4PMPA

The structure of trka kinase bound to the inhibitor 1-cyclopropyl-1-[3-(1,3-thiazol-2-yl)benzyl]-3-[4-(trifluoromethoxy)phenyl]urea
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
291
structure length
280
Chain Sequence
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLKMLVAVKALKSARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRIYSTDYYRVGTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title Maximizing diversity from a kinase screen: identification of novel and selective pan-Trk inhibitors for chronic pain.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 280
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pmpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pmpA01
2QOOA 4RIOA 5H3QA 3DFCB 3E5AA 4YNOA 3U9NA 2XH5A 2OWBA 3W18A 3QCSA 4TWOA 2PU8A 1DS5A 1IA8A 4FV0A 3VW8A 5HBEA 1XBAA 3SC1A 2R3LA 1KV1A 3NR9A 3QUPA 4HCTA 3ZRKA 3KVWA 2ERZE 1M52A 4H36A 4QD6A 3LJ0A 5C9CA 3VWAA 5IISA 5L6PA 2PK9A 2VO0A 3OOMA 3WYXA 4BYIA 2PE2A 3ODZX 4V04A 4X6RA 2X7GA 3CP9A 2Q0NA 4FYNA 4IJPA 3SX9A 3C50A 4K77A 3RBWA 2QR8A 3ZO4A 3AC5A 5HX8A 4D2VA 3TM0A 4O22A 2XBJA 2BIKB 3POZA 3UDBA 4E7WA 4EOLA 1LUFA 4EUUA 4EYJA 4RWIA 4TL0A 1G8SA 4N70A 4TZRA 4BDCA 1R3CA 4FTIA 3BYUA 4GIHA 5DGZA 2R9SA 5E1SA 1YDSE 3Q4UA 3LW0A 2B55A 5AAFA 1BL6A 3PXQA 3R9NA 3LXPA 2YLEA 3FMMA 4D2PA 2J51A 2GTMA 5JEBA 4ZJJA 4AS0A 5GJFA 4E6QA 3R9HA 2X7OA 3R6XA 3UYSA 2WOUA 4O7VA 3RAIA 4H1JA 3W1FA 4YURA 2DUVA 4KBAA 5HE1A 4DGMA 3CQWA 1VR2A 4GJ3A 2BDFA 2YZAA 2VTPA 3G15A 3GC8A 2XNBA 3UNJA 4FTKA 4PNKA 5IMXA 4XG9A 2YM7A 4D0WA 4D58A 5L2IA 2E9UA 3VS4A 2V0DA 2W1HA 5LVOA 4QP9A 4P7EA 4PMTA 4QMNA 2GFSA 2QLQA 4DFZE 3TKHA 3DBDA 4QTCA 4EH2A 3M42A 4R7BA 3EN5A 2UW7A 2GNIA 4NIFA 4F1TA 4RG0A 4CRLA 1H24A 3VJNA 2OH4A 3QGYA 3V5WA 3DA6A 3NNUA 5LOHA 4FSZA 2C5VA 5AP0A 5TKDA 4YZCA 4K8AA 1PMNA 4BBFA 3D94A 2R2PA 2VV9A 4E4LA 3FDNA 4FIJA 3FY2A 3DS6A 4JLCA 3R8PA 2UW0A 2VAGA 3F7WA 5ANEA 4NCTC 3NX8A 4G17A 3UIBA 4Z16A 3V6SA 2YIQA 4LL5A 2HIWA 4CMUA 4U5JA 1Z5MA 5AP4A 2JDRA 3HLLA 4NJDA 4PDSA 4ITIA 3SW7A 3FMEA 3HMPA 1X8BA 3PY3A 2REIA 4A9RA 2XYNA 4C62A 3WOWA 5IQDA 3BBWA 2W1ZA 3EIDA 3QBNA 2YISA 4FZ7A 4M68A 4EOIA 5BYYA 5M06A 5FUTA 3REPA 2WOTA 3R7YA 5CF6A 4M66A 2CNVA 4MD7E 3RNIA 3MPTA 5DR2A 1WVWA 2QOHA 4FVPA 4I0TA 5AR8A 4XG2A 3UNKA 3LFSA 3PLAE 4O6LA 4Y73A 3CPCA 4YGAA 1WZYA 2EXMA 3C51A 2CJMA 3FAAA 4J99A 4D4VA 2B0QA 3DTCA 4JG7A 1YXTA 2C30A 4LV5A 2EB3A 3WF8A 2JBPA 4QTAA 5KMLA 4JDIA 3BHUA 3BWJA 4L53A 4Q2AA 3K5VA 4R1YA 4CKIA 2W0JA 5FXQA 5T6KA 2C5XA 3PA3A 5FD2A 4E93A 3OF0A 4FOBA 2OH0E 3HUCA 5E1EA 3VUHA 1BKXA 4GUEA 4J71A 4L7FA 2V22A 2ZV8A 4KIQA 1FGKA 1B38A 2XJ0A 4GRBA 4TTHB 3R1YA 3QTWA 4FV4A 1YWVA 3NW7A 5JRQA 4O0RA 1T46A 2UZVA 2YDKA 4B99A 4H3BA 3SXFA 4FODA 4FEVA 4FKVA 4FX3A 4QYFA 2Y4IC 4QRCA 4DN5A 4UMUA 5K5XA 4DEDA 2O5KA 5AAGA 3I0OA 3E93A 3COHA 2Z7RA 3UZTA 4KKEA 3E8DA 1XH4A 3D5UA 3I4BA 4YZNA 1CKIA 3UIUA 5A6OA 3NVKI 3FKOA 4RT7A 2HELA 3EN4A 4BCIA 3EN6A 4NU1A 2ETRA 4G31A 3UG2A 1NT2A 5LVPA 4BZDA 3U4WA 3JY9A 3AD5A 2X0GA 3SXRA 4DH5A 3K54A 4JX7A 1CM8A 5GJDA 3OT8A 4ANMA 3KXNA 4HZSA 4R7IA 5J9YA 5FXSA 4EK4A 4FSRA 3T3VA 2UZWE 3L8PA 2XMYA 1H1PA 3AGMA 3VS2A 5L8JA 4CFMA 3BYSA 2ITTA 3KY2A 4ZS0A 3PPJA 4X3FB 3UNZA 5I9ZA 5KMJA 4EHZA 4PUZA 2HENA 3COIA 3GU6A 4QTDA 5AP3A 5FQDC 3TL8A 4YC8A 4AA0A 3U4UA 5CWZA 4ZTQA 3CGOA 2IZUA 3EQPA 2J5EA 5HLPA 4XV1A 2Y6OA 3IDPA 4C58A 4D1XA 4PP7A 5KHWA 3BYMA 3KRJA 4O7NA 4E6AA 3ZU7A 4IXPA 1AD5A 5B2MA 2W1GA 3OBGA 3NWWA 2PVJA 3FMNA 2QG7A 4U42A 3FZPA 3DXQA 2OXDA 3KFAA 3MN3A 3OXZA 5LMKC 2X81A 3OZ6A 4HYSA 4MHAA 3KULA 1F0QA 3FHRA 4FGRA 3ID6C 3G6GA 4FSTA 3PVWA 4EK5A 3WIGA 2VGPA 4O81A 3TNHA 5LXMA 5EDQA 2WB8A 3EL8A 1CMKE 2UW5A 5HESA 2YDIA 1ZXEA 4C0TA 2Y7JA 3R73A 4L44A 5AUZA 2J6MA 3WF7A 3G2FA 2WMWA 4QMPA 4W9WA 3EZRA 4JOAA 2WELA 5EI8A 4C4GA 4B8LA 2PL0A 3LFFA 4WUNA 4G3EA 4EEVA 4FV1A 3CSVA 4DFLA 3DXPA 2X6DA 4D9UA 5KHXA 2I0EA 3ORNA 2C1BA 5HZNA 4L3PA 3KF4A 1ZOHA 4EK8A 4ZEGA 4IC7A 3D7ZA 3QRIA 3FLSA 3SAYA 3ZUUA 3QRKA 4FSQA 5GHVA 3ALNA 3PXFA 3TUBA 4FIHA 4A9YA 4BDIA 4HNIA 3U87A 2YM5A 4KSQA 2YIRA 3FMDA 1PYEA 4ID7A 4EHVA 5FM2A 5DR9A 4DEAA 4IACA 4YC3A 4J8MA 3M2WA 5AUUA 5CALA 3UZRA 3LFCA 5FEDA 3V01A 5DH3A 4BCOA 3W16A 5L2SA 1QMZA 3W32A 2HZNA 4V0GB 4MF0A 3ZLYA 4AACA 4JXFA 4D2TA 4QO9A 4J8NA 2BAKA 4QMQA 5H8BA 3SHEA 3FLYA 3BLHA 4AF3A 5FBOA 3DNDA 4UBAA 5BVEA 3UYTA 3IOKA 2BHEA 1CSNA 2HK5A 3PXZA 4XG3A 2WTCA 4UV0A 2A0CX 1RE8A 3RPSA 3KQ7A 4G5JA 3SOCA 3V8TA 1Q24A 5KO1A 5ETAA 1KE9A 1GJOA 4GU6A 1Q8TA 1U54A 2W1EA 3ZCLA 1QPCA 1M14A 4M97A 4BTJA 2PVYA 4NM7A 4FIEA 4QYHA 2I1MA 4F9YA 2FVDA 1G8AA 4GIIA 1F5QA 3KU2A 3ORLA 4ZZNA 4N6ZA 4AQCA 4FOCA 3D14A 5I5ZA 1PXJA 4BGHA 3MPAA 3KB7A 4CRSA 3PE1A 5EW8A 5I4NA 1IA9A 2UW6A 4ZLZA 4QMMA 5BUEA 1ZYLA 2W5BA 3EN9A 3F5PA 3FQHA 5D7VA 4QMZA 5HORA 3F3VA 2RFNA 3NZ0A 4FICA 3QGWA 4UMQA 3LE6A 3MBLA 3SOAA 1V0BA 2C47A 4USEA 5CAUA 3Q9XA 4M0ZA 1U5RA 5AUXA 2CCIA 2B9FA 5E8SA 4WHZA 1ZY4A 5BVNA 2OZOA 4K6ZA 5FTQA 2ZJWA 3QQUA 3P1AA 4MBIA 2QNJA 1YI6A 4X6QC 1W98A 3Q2MA 5H9BA 3R7EA 5B7VA 2F2UA 4BDAA 3MS9A 3RTPA 4IVCA 4IANA 1FPUA 3B2TA 4BCQA 3WYYA 2BPMA 3BWFA 2A1AB 3A2CA 3D9VA 4AWIA 3O8PA 4FTAA 4CCBA 3P7CA 1UWHA 3DPKA 4WG5A 2XBAA 3HA6A 4GU9A 5BMSA 2F7ZE 3R8ZA 3DDPA 5J79A 4IQ6A 4FKPA 1MUOA 2EU9A 3BQCA 3FPQA 1OBDA 5D9HA 5DT0A 3T3UA 2R3PA 3O8TA 3R9OA 4C4FA 1OECA 3V5QA 5B2LA 5AV2A 4KSPA 3ZTXA 4ZTHA 2C6KA 3MWUA 3I5NA 4C8BA 1GY3A 1Q97A 1BX6A 1SVHA 3LXNA 3JXWA 4FV6A 3C4XA 3KC3A 5IQCA 2V62A 4RLKA 1PJKA 3VBQA 5FXRA 3GVUA 3WE8A 5A46A 3NW5A 3C4EA 3LVPA 4BGGA 4EH6A 3WZKA 4W4YA 3RK7A 3ZBFA 1PXLA 3QZIA 4HCUA 3Q52A 2OKRA 3FZTA 3JUHA 4TXCA 4UWYA 4YZDA 5AMNA 4CQEA 4C3RA 5BNJA 3LFBA 2E9OA 3QZHA 4I6HA 3BKBA 4C02A 2WD1A 2BRNA 4L52A 3Q32A 5JQ5A 3ELJA 5LMAA 4MX9A 3C0HA 3BBTB 3K2LA 3T8OA 3UG1A 2QOKA 2J0JA 4L42A 4A9TA 2R3KA 4JIAA 3SLSA 4EBWA 4R5YA 4M0YA 5BUJA 2J50A 2FUMA 4ITJA 3BHHA 3RP9A 1GZNA 4F7LA 3IG7A 5CS6A 4I5CA 4F6UA 4XG6A 4D5HA 1RW8A 1KUTA 1XH7A 5AUTA 2QOFA 4PTEA 3P5KA 2B1PA 3ZFYA 5KMOA 5D11A 2A4LA 4CZUA 3EN7A 3DAKA 4YJTA 5TO8A 2QO2A 2VU3A 2WFYA 4F6SA 3MFTA 5BUIA 5I9VA 3LCSA 2VWVA 3IW7A 3RMFA 1OIRA 4BBEA 3RINA 4XV9A 4EH3A 3D7TB 3LCTA 4YJNA 5EYDA 4FL2A 5CEPA 4I6FA 2YM4A 3GOKA 4JQ7A 4IC8A 2WMXA 3GUBA 4O0TA 4I5MA 4X2KA 4V05A 1Q8UA 3VS3A 4C4HA 4PQNA 4IX6A 1FQ1B 2C5YA 5JZNA 3WILA 1CDKA 3F6XA 4ANLA 3PXKA 4IEBA 4A06A 5ANGA 4HW7A 4F65A 3EMGA 4R1VA 2W5AA 5A4TA 4PF4A 4M69B 5J5TA 5M4FA 1S9IA 3PSCA 3L9PA 2X8DA 3R28A 3QTQA 3LCOA 3OWLA 2A19B 5M56A 4YBKA 2G2IA 2PE0A 2V55A 4AW0A 1NA7A 4BCPA 5EW9A 3QRUA 4FTUA 4ASXA 1K9AA 4QP4A 2X39A 3LZBA 4I4FA 4FEQA 2WKMA 2Y4IB 5E92A 3NNVA 4HPUE 3P7BA 2UVXA 2GQRA 1O6LA 3Q60A 5HHWA 4FNYA 3OEZA 1H26A 3KMMA 3MB6A 3DNEA 2YEXA 4L68A 4I93A 3JVRA 2WNTA 5AP7A 2XEYA 3R8VA 3UMXA 4BDEA 2PVHA 5AEPA 4ERKA 2W9FB 4FSNA 3SQQA 5M07A 2QU6A 4RA4A 4A9UA 3GC7A 4NZWB 3VULA 3W2QA 2R3GA 4GL9A 2B9IA 2C3KA 3THBA 1UWJA 4CCUA 2VWXA 4F9CA 3RVGA 1UU3A 4YJPA 2A2AA 4FNXA 4KBCA 4LGGA 3AG9A 3OC1A 1P4OA 1UVRA 4JRVA 4E26A 4DE4A 3S2PA 2H9VA 2XCHA 3QXOA 4YZBA 4RFYA 4DTKA 3KN5A 5IA5A 4W4XA 2UV2A 4IWOA 3V5JA 1PMEA 5CEOA 2XCKA 5K0XA 2F7EE 1IASA 3QU0A 2QG5A 4I5HA 4MNEB 3BE2A 1JKLA 4JAJA 1JNKA 3TI1A 2XRWA 1Y8GA 4RGJA 3B8QA 1PY5A 2IN6A 3UQFA 5BVOA 4ZY6A 5E8TA 4C34A 4CMOA 4RJ5A 2GPHA 5T3QA 4K11A 4LV8A 3HRFA 3SDJA 3ZO1A 2OG8A 2PVNA 2VD5A 1WCCA 4OUCA 3RHXA 3VBVA 4HGTA 1R0EA 2JITA 4MAOA 3F69A 3G90X 4EQMA 4FTJA 3DJ5A 4JG6A 5IF1A 4PMSA 4C38A 3MA3A 3VIDA 5E9EA 4BC6A 4R3CA 3SXSA 5IUGA 4O84A 2XKDA 2OZAB 3OOGA 1H08A 3GNIB 4DH7A 3OEFX 3N4UA 3RPRA 4Y72A 4D9TA 3DV3A 5DRBA 1H27A 4JAIA 4LI5A 2JEDA 5LVMA 2WU6A 4MKCA 4EOQA 3LLAA 1ND4A 2R7BA 5DG5A 3COKA 1ZLTA 2JIUA 3ORIA 4Z3VA 4NM0A 3RZBA 1PF8A 1OITA 2VRXA 3F2AA 4FBXA 4G1WA 4XP2A 4IMYA 1GZ8A 4FV9A 3FQEA 4GW8A 4YPSA 5CANA 2LGCA 2V5QA 3RCDA 5JMSA 4FUYA 3LKMA 2O8YA 5CQWA 5EHLA 2LAVA 5K9IA 3N9XA 3NAYA 5AM6A 4NFMA 5TF9A 1JAMA 5IEXA 2O65A 4ZP5A 3TN8A 4IDTA 4CLIA 5DRDA 2WMTA 3BLQA 5M57A 2P0CA 4CFVA 4FKJA 4LRKA 5AV3A 2EXCX 1OUKA 4GVJA 3N4VA 5TR6A 2X4ZA 4F9BA 1TKIA 5HIEA 2HW6A 4FT7A 2ZYBA 3R04A 3BPRA 3R01A 3UO4A 4AW1A 4CVAA 3CS9A 4LRJA 2JFLA 2QR7A 4A4XA 2IW6A 2RIOA 3H9RA 4XOZA 5TE0A 3BU3A 3DBFA 4JJRA 5K3YA 4Z7HA 4N4SA 3ROCA 3TIYA 2IZTA 5A3XA 1KE6A 4TNDA 2PZ5A 4FTRA 3UIMA 4LRMA 3SKCA 1YI3A 4MBJA 2NO3A 3H3CA 4X3FA 3GP0A 3TNQB 1Y6BA 3BLRA 4OTFA 2IVSA 1T45A 1ZRZA 5DNRA 2XVDA 4R6VA 1Q8ZA 2VTHA 1W82A 5HE2A 4ZSAA 4RIWB 3QD3A 4L9IA 5L2TA 2JDSA 2C6TA 5CAVA 4CG8A 2OICA 5D12A 4ZSGA 4G5PA 3N51A 4E20A 3OW3A 3PVBA 2EVAA 5FTOA 2BRGA 2QO7A 4AT3A 2XA4A 3ENMA 4CFWA 1UNHA 1ZYSA 3PXYA 3OCBA 5DT3A 4Z9LA 2QQ7A 2W1IA 2XIKA 5IG1A 3LFNA 3QYZA 2YM3A 2GQSA 2ITQA 4RVTA 4LG4A 3QAME 4A07A 3HECA 4FEWA 3HAVA 2WMBA 2C4GA 1O6KA 4Z55A 4O0SA 4TRLA 1OPJA 4CTCA 2Y9QA 4E4MA 3NUYA 1MRVA 3NYOA 4ZS4A 3TACA 1GZOA 4XBUA 2OJ9A 5DHJA 3PDTA 4RJ4A 4M12A 1Y6AA 4DF3A 2RG6A 3JYAA 3NYXA 2PUPA 5CSHA 2GCDA 5KNJA 3DBEA 5EFQA 1E1XA 3S1HA 4AGUA 1CKJA 2R7IA 1SVGA 1ZWSA 3O2MA 4KS7A 5GZ9A 3ZUTA 5A9UA 4F99A 4QP3A 3KXGA 4ZJVA 2WGJA 2IO6A 3U51A 5F4NA 2CSNA 1JSVA 4FKQA 3U8WA 4I22A 4P4CA 1LEZA 1O9UA 4L6QA 3PSBA 4DTAA 2YIWA 2EXEA 2HAKA 3DK7A 3UIXA 5AR3A 1ZYDA 1M2RA 2ETMA 1OB3A 4LGHA 2C6IA 4E6CA 2XUUA 3PA5A 3ANRA 4M13A 2B7AA 4L01A 5AX3A 5CLPA 4FKOA 5C8MA 2UUEA 4V0GA 4AA5A 4BICA 4D4SA 4CFXA 2CDZA 3HKOA 3LXKA 4BY9E 4FIGA 1OI9A 2ITNA 4FZAB 2UW9A 4UEUA 5HTCA 3D5WA 5CENA 4IX5A 2ZM4A 2EUFB 3R7GA 4K0YA 3WF6A 4UY9A 3HA8A 4AZSA 2BTSA 2H34A 3OTVA 4K2RA 4IAIA 2XEZA 4NK9A 2C0IA 3ORMA 5EG3A 2VN9A 2PHKA 4Y46A 3G6HA 4FIIA 3GCUA 4FV3A 3VF9A 4O86A 1OKWA 2OF2A 3ET7A 4BF2A 4O0UA 4HVGA 4IFGA 5EYMA 5HU9A 2GSFA 1OKYA 4LUEA 3AC4A 4TYIA 3F7ZA 4ACMA 2IVUA 2E2BA 4DT9A 2WTVA 3HV3A 4ACDA 2YA9A 4C4EA 3NCZA 5ANOA 4AE9A 3NCGA 3QRTA 3MVLA 3FBVA 3E92A 4ERWA 3MPMA 1Y8YA 5BVWA 3DK3A 5F95A 3PG3A 2CNUA 4RBLA 3MY0A 2RL5A 4I21A 4BHNA 2P2HA 2C5NA 2XNPA 3UGCA 3BEAA 2VTJA 3R63A 2QKRA 2W05A 5E8XA 3VS0A 2OJIA 3EOCA 4OTRA 4HYUA 4OTPA 2YABA 5AM7A 1YHWA 3K3IA 4MQ1A 4GUBA 5FDXA 4OBOA 2F4JA 2PZPA 4BYJA 3I81A 2F49A 5EOLA 4U7ZA 5CZHA 3ULIA 4CYIA 3ZS5A 4AGWA 5KMMA 3RK9A 2JFMA 4RX8A 3GQLA 3DDQA 4G6LA 1Q4LA 3R7UA 3V04A 4GS6A 1PKDA 5ETCA 5AADA 5HO7A 4MTAA 2YDJA 2ESMA 4U44A 4ZTNA 4X2GA 2CLXA 4TW9A 2YHVA 4RWKA 5IUHA 4BCMA 1JPAA 3MVHA 3DJ6A 2NPQA 3KXMA 5FRIA 4FKSA 5KX8A 2XK6A 1YOLA 2RFDA 2C1AA 4RVMA 4YHFA 3E8NA 1AGWA 4KUJA 3A4OX 3F5UA 4HVHA 4FG9A 3TKIA 2CGVA 2W06A 3R00A 3KVXA 3I6UA 4O27B 1ZY5A 3TG1A 3QKLA 3ORKA 3VBTA 1M17A 4YMJA 4J97A 4WSYA 2PE1A 3BGZA 2E9NA 2GNHA 4K1BA 5CEIA 4O7ZA 3OY3A 5FP6A 3Q5IA 5HNGA 3GT8A 1OUYA 5C27A 3C7QA 5HLNA 3E8CA 5KMIA 4OAVB 5HNBA 4FKGA 3UOJA 4RRVA 4TNBA 4B7TA 4QYYA 3FKLA 3VF8A 5IU2A 4TYHB 4CFNA 3CTQA 4F0FA 2BKZA 2C3IB 4YUQA 3KRLA 1H1WA 1Z57A 3TWJA 4ALUA 3GXLA 3G0EA 4KIPA 4B4LA 1LR4A 3V8SA 4E3CA 3ERKA 3FI3A 3U54A 4JDHA 3P7AA 2I0VA 3BHVA 3AGLA 3E64A 3UC4A 2WPAA 3DCVA 5G6VA 4NKAA 4I23A 4QP6A 1K2PA 5AA9A 4U40A 2CGXA 4O7LA 3U9CA 2W5HA 4HNFA 5AX9A 2FGIA 4Q5HA 1MQ4A 3EQBA 3SD0A 4NCTA 4F1MA 3S95A 2BZJA 1YXSA 4PL5A 3C4FA 5AUWA 3GGFA 4HYIA 1OBGA 5IQHA 3DKFA 4CZYB 2PWLA 1W7HA 2RFSA 1J91A 4MXZA 4FVQA 3AXWA 3O51A 3VQHA 4BCJA 3ZH8A 5E8VA 5KZ0A 3H9FA 3ZBXA 3EFWA 5IH6A 3DKCA 3P79A 4MXCA 3E7VA 3IDBA 3TKUA 2GTNA 4GH2A 5H8EA 3GCPA 3H4JA 3LFAA 3DOGA 5DT4A 3OMVA 2XNOA 3QD4A 4RFZA 4Y85A 5B2KA 4BB4A 2CLQA 1L8TA 5A54A 2ERKA 3LMGA 2UZDA 3D7TA 3HNGA 3MB7A 4UYNA 4DGOA 1OMWA 3Q53A 3FMJA 2Q0BA 4WNKA 4C57A 4HGEA 4PNIA 2VWUA 3JR1A 1CTPE 3ZFMA 3EKKA 4AA4A 5I3RA 3DZQA 4C7TA 3PY0A 4YP8A 2RSVA 3JY0A 4XOYA 1R1WA 1GIIA 1J7LA 4NFNA 4DHFA 4M69A 4BR3A 4QQJA 3FI2A 3QFVA 1Q61A 1UKHA 3RALA 4S34A 3GFWA 4C3PA 3AC8A 3KCKA 4X2NA 3QZFA 2PVLA 2YJRA 1SNXA 3NIZA 2XK8A 2WTJA 3JPVA 5DR6A 4ANNA 4DT8A 3FQSA 3L8SA 5B0XA 4QYGA 3R2BA 4H3PA 4RC2A 4PL4A 4ITHA 4APPA 3CLYA 4BDGA 3U55A 4BDJA 1UA2A 4ZLYA 4WIHA 4GV1A 4FT5A 4G3FA 4O96A 4G3CA 1H00A 3QTSA 4MQ2A 3F3UA 4YJOA 4K18A 1IEPA 5CASA 3PJ1A 4XUFA 4BCGA 5AA8A 2AUHA 4EH7A 4RVKA 3BQRA 4EH8A 3QF9A 2YCFA 3ZHPC 4C35A 4QQ5A 3CD3A 3PPZA 3RAKA 2FYSA 4I1ZA 3A8XA 1FMOE 3OFMA 3DAJA 4G3GA 4RA5A 3Q04A 2I7QA 3O7LB 3CD8A 4FVRA 4NEUA 2ONLC 4YNEA 5AAEA 2W1CA 3S0OA 2J4ZA 2W4OA 4NJ3A 5D10A 4O82A 3FKNA 4IB1A 3P86A 1VYZA 3HEGA 3BX5A 3E87A 1MP8A 1DAYA 4DCAA 4I6QA 5CI7A 4XRLA 4DFYA 3AT2A 4BTKA 3ENHA 3IKAA 3ZEWA 4ZLOA 1ZARA 4MNEA 3F88A 3F2NA 3NUSA 4FSMA 4J7BA 4RFMA 4FUXA 2NRUA 3E62A 5AR5A 3LJ1A 4W9XA 3RJCA 4ACHA 3UVRA 4AXAA 4UXQA 3BEGA 5I9XA 3IGGA 1GZKA 3W8QA 5LMKA 4FV8A 3NIEA 5LCKA 3JS2A 1B6CB 2UZUE 3O71A 3MFRA 3HGKA 3KRWA 4U3ZA 3OT3A 5E8UA 2BZIB 4DCEA 3SVVA 3D0EA 4TYGA 3QQHA 2BHHA 4FC0A 4FZ6A 4D55A 3OTUA 4QPMA 5A4CA 2WEIA 4I92A 4ZAUA 2OZAA 4O6EA 4TYJA 2YAKA 4FR4A 3IQ7A 2BR1A 4L8MA 2O63A 2BRHA 4O21A 3WF5A 4AOIA 4NWMA 2CKOA 1HCKA 2FSOX 3FLZA 3PP1A 2ITPA 3BRBA 3TXOA 2WEVA 5I3OA 3TZ8A 3PIXA 3EFLA 4C3FA 3QD2B 4IB0A 5K4JA 3N4TA 3TNWA 4HJOA 4CZTA 2J0IA 4X2FA 2YCSA 3OG7A 5HVJA 3SV0A 3F9NA 3F61A 3MV5A 4U0IA 5CAPA 5F1ZA 4NYEA 1UKIA 3DTWA 2C3JA 3QWKA 4GG5A 4WBOA 5EM5A 3QQFA 1R78A 2X8EA 2QODA 1HOWA 2G9XA 3HP2A 3Q4CA 2C5OA 1XBBA 1OL5A 3GQIA 3ZLWA 2OXXA 2BUJA 3HMNA 4XJ0A 4AE6A 1PHKA 4M14A 3BELA 4IM0A 4F7NA 2HW7A 4AUAA 3QWJA 1BYGA 2J5FA 3WIKA 4I0RA 2OFVA 4F9WA 1A06A 2XKFA 1Q8YA 3GFEA 1OVEA 2Q83A 3FMHA 3PYYA 3GU8A 5CSWA 4UWBA 3EKNA 5EM6A 3QCXA 4XRJA 2OBJA 5CF4A 2ACXA 4TY1A 3DAEA 4YLJA 4E1ZA 2R3MA 2OFUA 1XH8A 5LCJA 4LOPA 5EI2A 1SYKA 1OL2A 4QMTA 2JDTA 2WMVA 2R3QA 2HYYA 3LHJA 4YU2A 4IAYA 5LQFA 2R3IA 4PTGA 4BBMA 2P2IA 4IIRA 3VUDA 3GBZA 4NW6A 3VN9A 3GCSA 4HZRA 3ZRLA 2QC6A 1H01A 4YJRA 4DGLC 2XIYA 2XKEA 2X2KA 3NSZA 1TQPA 3ACJA 4FL1A 1JSUA 3I6WA 2X9EA 2W17A 3NPCA 4EOSA 2HXLA 3OVVA 2RG5A 3C0GA 4L7SA 4RIWA 4GK4A 5AUYA 1M7QA 3IGOA 4W4WA 4YLKA 4AG8A 3LQ3A 3FZ1A 4XV3A 4QOXA 3E88A 5DE2A 3L9NA 5ANKA 2WQEA 1VEBA 4H39A 2YM8A 2GNFA 3NNWA 4YJVA 4MWIA 1W84A 3NUAA 4PDPA 2YJSA 4YHTA 4HOKA 4WO5A 2X4FA 4BDBA 2BKKA 4AN3A 3GC9A 1H1RA 2YLFA 4LQMA 1NVSA 4PY1A 1FVTA 5HG7A 4DINA 3Q6UA 4LOQA 3W2OA 4BDHA 3TDWA 1DI9A 3ODYX 4APCA 2C3LA 3HZTA 4FTMA 4XNEA 4YPDA 4AGDA 2ZM3A 3LMIA 4Y5HA 3VC4A 3MJ2A 3BU6A 4PMPA 4BVUA 2ITOA 2OK1A 5EI6A 1PXOA 5LWMA 1PMVA 2WIPA 3MVMA 3PG1A 4QMXA 3HMMA 3TT0A 3ZRMA 4M7IA 3BV3A 4L00A 2XIZA 2C6EA 4MD9E 2W96B 4V01A 1XH6A 2GDOA 2QOIA 3QL8A 5HOAA 5HKMA 1R39A 2GNLA 3OCGA 3FUPA 5ACKA 5C4LA 4UMTA 3UOLA 4DA5A 1Z9XA 3SGCA 4YTIA 2GU8A 5FG8A 4FGBA 5HNIX 4FTCA 3S3IA 3R21A 3O50A 3GEQA 3K5UA 3BI6A 2R5TA 1RQQA 2UW4A 2ZM1A 3NEWA 3E3BX 3UVQA 3PIZA 4DFXE 1NXKA 3QHRA 1GIJA 4JR7A 2VWIA 4XYFA 4RJ6A 3HUBA 5HU3A 4GT5A 4AFJA 3A8WA 3DBQA 3OP5A 3TNPC 4DITA 4FE2A 2JD5A 4FV2A 4H58A 4XEYA 3MVJA 2BROA 4BCKA 5CT7A 4BTFA 3BIZA 5HVYA 4DEEA 5ANIA 2G1TA 4EJNA 2OJFE 1WBOA 4GYGA 3EZVA 1URWA 3LM5A 3QUDA 3D15A 3CTJA 4JQ8A 4AOJA 4O7RA 3MJ1A 2JKMA 2XZSA 2QOCA 3VO3A 3WBLA 3WZJA 3QZGA 2XRUA 4BN1A 2QD9A 2CKQA 4DEHA 5IUIA 2P55A 2JDOA 3NGAA 1STCE 2DS1A 4NUSA 1OGUA 4EQCA 3RAHA 5AR2A 3VAPA 3MI9A 3CPBA 2Z02A 3EQHA 5ETFA 1WVXA 2WMQA 4IX4A 4WOVA 4R78A 3PZHA 1V0PA 3QC4A 2Z7SA 1JKKA 5L2QA 3KL8A 1FGIA 3IECA 5ITAA 3PRIA 3Q2JA 2QI8A 2ZB1A 4FSUA 3FPMA 4LGDA 4ZZMA 3C4CA 4D28A 4QP1A 3VVHA 2UZLA 3OCTA 5AP6A 3V3VA 2OGVA 4QP8A 3D83A 3ETAA 4IZ7A 5DIAA 3OD6X 4BKZA 2X9FA 4KNBA 3GOPA 3F5GA 1AQ1A 3VBYA 2XK3A 2YFXA 4EL9A 3UODA 5IDPA 4JG8A 4WUAA 4CSVA 1WBTA 5HICA 3QX2A 5CXHA 3TZ7A 4MBLA 3EQDA 4G3DA 4DAWA 2OIDA 2UZNA 3Q4ZA 4DG0E 1H1SA 3KRRA 3CBLA 4WNOA 5GJGA 4CTBA 4QNYA 2B4SB 5AIKA 4WBBB 2C69A 3RCJA 5EQPA 4YTFA 5CNNA 1Q3WA 4U6RA 1JVPP 3HAMA 1JKTA 2CGWA 4YLLA 2IVVA 4CQGA 3LXLA 3OW4A 5KMNA 4ZMFA 4MVFA 2VTRA 5J8IA 1GNGA 4F0GA 3BGQA 3EFKA 4BFMA 4C36A 4PTCA 5DOSA 3TV6A 4KKHA 1KOAA 2WMSA 4J53A 3AC3A 4EH9A 2FB8A 5JRSA 2V7OA 2Z7LA 3MGYA 5C03A 3C1XA 4ANBA 4QTEA 5CF5A 3IONA 1JSTA 1OIQA 2JGZA 3MFUA 4JRNA 4C59A 4IZ5A 3QQGA 3R1QA 2UZTA 3PRFA 3IW6A 3PWYA 3VUIA 4D4YA 1L3RE 5CT0A 4RQVA 1YXUA 4QMYA 2YWPA 3UBDA 3MYGA 4TPTA 4G6OA 4IM2A 4EORA 4L3JA 5AR4A 1J7UA 3DLZA 3KCFA 1YDTE 2B52A 3FL5A 4IZAA 4WD5A 4DG3E 1JKSA 4L45A 1IRKA 2X7FA 2O64A 5CSXA 2J2IB 5M55A 1OIUA 5K4IA 3EB0A 2HOGA 3I0QA 4TYHA 3VW6A 1IAJA 2QVSE 4AOTA 5AP1A 3FLWA 2FSTX 1YRPA 3QQJA 4MEDA 3FY0A 3OXIA 2BILB 5HCYA 4EHGA 3DFAA 2ZDUA 1OIYA 3QC9A 4KB8A 4IDVA 5HO8A 1W8CA 5I9YA 2W4KA 1A48A 3LFEA 3CGFA 4YSJA 4EJ7A 4Z7GA 4O2ZA 5AJQA 4EOPA 3MESA 2AC5A 3GENA 3QX4A 4JNWA 5GNKA 2BCJA 4QQCA 5H8GA 3RI1A 2QURA 4WKQA 5HG9A 3HRBA 4GKHA 3NW6A 2H8HA 2CN8A 1XQZA 4QT1A 4M3QA 5K5NA 2JKOA 5H2UA 4BZNA 4FA2A 2HWPA 3EJ1A 3UQCA 3R9RA 2H6DA 5E8WA 3O7LD 2R3JA 2YERA 4PV0A 3S4QA 1YHVA 4EH5A 2PUIA 3CJFA 4Q9SA 3MFSA 5J87A 3HYHA 4LUDA 2ZMDA 3VNTA 4IVDA 2CKPA 4IWPA 3WZEA 4U80A 1LP4A 3F3TA 5FTGA 5KMKA 3D4QA 4R5SA 4PPAA 4F09A 3VQUA 3MDYA 4DYMA 5JT2A 5KUPA 3A4PA 3KK9A 4RC4A 5CYIA 3S00A 4XBRA 4DEGA 3KXXA 3HV6A 3AC1A 4B6LA 1APME 1ZZ2A 2VGOA 4UYAA 3DK6A 4IVBA 2HY81 2F7XE 4W8DA 3TTJA 5HQ0A 3VUKA 3FYJX 4FIFA 3VRZA 3RWPA 3LAUA 4TT7A 4JL9A 1PXIA 3UOKA 3PLSA 3EL7A 3U6HA 4DBXA 4E73A 2GMXA 1BL7A 2J7TA 4OBQA 3QKKA 2CGUA 3VBWA 4O7SA 3CKWA 4R8QA 4HCVA 1XBCA 3HV5A 4DEIA 3WE4A 5IH5A 3E7OA 4P90A 5CX9A 4EC9A 3C5IA 4OAUC 4UZHA 3RAWA 5HBJA 3AT4A 4O83A 2PPQA 2UW8A 2VTSA 4I4EA 1Q62A 3LCKA 4BGQA 5AP2A 1Q3DA 3V51A 2GNJA 4JVGA 4GKIA 5E8ZA 2Y0AA 2CCHA 3VRYA 2YIXA 3OWKA 2VX1A 5EYKA 5LVLA 1RJBA 3FZRA 1ZZLA 2WXVA 3NAXA 5JN2A 1FMKA 5CY3A 4R3PA 4E4XA 4F64A 1VJYA 2WQBA 3PSDA 1XH9A 3PJ8A 5AR7A 2WQNA 3RHKA 4IAFA 4FV5A 2CKEA 5KKRC 3Q4TA 1O6YA 3UQGA 4AGCA 4D1SA 3BU5A 4Q5EA 3QHWA 3R9DA 4I94A 4S33A 4B8MA 3MW1A 4KAOA 3DQXA 1Q8WA 2PMIA 4I24A 5CVGA 4IZYA 3QKMA 2R3HA 3NUPA 4KA3A 3WZDA 4ANSA 1FVRA 5F94A 1NVQA 2WMRA 3AMAA 5E4HA 1WMKA 1YWNA 1Y57A 3VS7A 4XHKB 3AOXA 4Y5QA 2G2FA 1JBPE 4EZ5A 3DY7A 2QLUA 3TDVA 3EQIA 3MA6A 3OY1A 2VTLA 4KIKB 3ORZA 4RX9A 3I79A 2PVKA 3LFQA 2W99B 4KD1A 3G0FA 4JIKA 3SG8A 3UZPA 3P0MA 4KS8A 4DLIA 2E9VA 5IA2A 5JFSA 5HBHA 3KRXA 3ACKA 1P2AA 4FSWA 5IEVA 4XG8A 4RC3A 4FEUA 3ZONA 1KE8A 2UVYA 1W83A 2YIYA 4F7JA 2XK4A 2WMUA 2HWOA 4AP7A 1FINA 4R3RA 2BAQA 3QYWA 4CV9A 4CYJA 4OW8A 1V1KA 5D7AA 3ATSA 2B53A 4HGLA 4MXXA 4P5QA 2P3GX 4ASEA 2FSLX 2R64A 5HI2A 3G51A 4Y83A 5DEYA 2OI4X 4F08A 2R3OA 2XJ2A 3MH1A 4BDDA 5CVHA 3Q6WA 4RZWA 3FYKX 4YJUA 3O23A 4G16A 4WRSA 3Q3BA 4MCVA 5CTPA 4FNZA 1YKRA 2BZKB 2XYUA 3GU7A 4LMNA 3L1SA 1M2QA 3HV7A 1Q99A 3BE9A 3FLNC 3QTIA 5M09A 1XHAA 2C6LA 3VHEA 2J9MA 2GNGA 3LPBA 3DLSA 4B0GA 4D5KA 1XKKA 3CKXA 4YHJA 3EQFA 4U43A 3RPYA 4J98A 4DH1A 2PZRA 4ONAA 4C33A 5AFVA 3R1SA 4WG4A 2I6LA 4PDOA 3CIKA 3UO6A 3QQLA 3QXPA 4UXLA 3PJ3A 5CEQA 1J1BA 4RVLA 2E9PA 2ITUA 3CR0A 3H30A 4LL0A 2ZV2A 5HD7A 3KGAA 1SZMA 4IH8A 3AMYA 1WBVA 4NTSA 2I40A 4YBJA 3R83A 5HTBA 4DEBA 5KCVA 4O0WA 5A14A 1Q41A 1TQIA 2ITYA 5C1QB 5CF8A 4D1ZA 4CGAA 3F3WA 5C01A 4OGRA 5JFWA 4F0IA 3ULZA 5DLSA 4KRCA 3RZFA 1GAGA 3HV4A 3MH0A 5DPVA 4M8TA 4IW0A 4U9AA 2W9ZB 2VO3A 5M44A 2OLCA 4F63A 2EB2A 3ITZA 5CSVA 4AZEA 5JSMA 4CEGA 3OCSA 4RIXB 4FYOA 2PTKA 3VUTA 2PZIA 2JBOA 1PRYA 4IM3A 2R0UA 4BHZA 4NL0A 4RWLA 1F3MC 3UE4A 4RQKA 4F9AA 2FA2A 3ZZWA 3GCQA 4U41A 1U46A 3WZUA 3ZM4A 1QPJA 1YOMA 5JQ8A 3LQ8A 3PP0A 5EQEA 4M84A 5L3AA 4WT6A 2X2MA 4GVAA 4NSTA 4RJ3A 2IJMA 3CY3A 2PY3A 5HE3A 3C13A 2PMOX 1WBWA 2RGPA 2QONA 3NUUA 3W2RA 3TUDA 3ZFXA 4AAAA 4O1PA 4S30A 3OHTA 2G15A 3TIZA 4ZMEA 5AWMA 2ZB0A 1MRUA 3BYOA 2R3FA 3A99A 3CC6A 3G33A 1UNGA 4G9RA 4K9YA 3V6RA 4X7QA 2OJJA 3UP2A 3MH3A 4IVAA 3KN6A 4GK2A 2ITXA 3R71A 4KWPA 4TN6A 4AT4A 4AZWA 4XG4A 2HZ4A 2ZDTA 3HVCA 3O0GA 4OTGA 4MXOA 4GT3A 4A7CA 4RJ7A 4FTNA 4BI1A 4GYIA 3UO5A 2VTQA 3TTIA 5BYLA 2V7AA 2ITWA 1MRYA 4U8ZA 4KINA 4RIYB 2VTOA 3R8MA 4B9DA 2GS6A 2BZHB 3O8UA 2XIRA 3ZC5A 2OXYA 1LPUA 2XP2A 2PSQA 4FTTA 2EWAA 5DWRA 3HMOA 3LFDA 4KIOA 5EDPA 3FI4A 4EI4A 3F5XA 3CE3A 4TWNA 3I5ZA 3QD0A 4DTBA 3UJGA 3FMKA 3WARA 4ASZA 5L6WL 2W7XA 4AFEA 2W1DA 4AW2A 4O1OA 3ZZEA 4BWPA 5JFXA 4GJ2A 2WTDA 1PXNA 4KKGA 4H05A 4EK6A 3CY2A 1WBNA 3FMLA 5C4KA 1VZOA 1XR1A 5HTIA 2WU7A 1FOTA 5FLFA 3F2RA 3DXNA 4YTHA 2UZBA 5HCXA 1OKZA 2BMCA 3EH9A 1YHSA 2BIYA 2ZOQA 2WZJA 3VBXA 1PKGA 5EQYA 1M2PA 4BTMA 1OL1A 4KABA 2O0UA 2HCKA 3TCPA 1URCA 2JC6A 3H0YA 4HVDA 3U6JA 5M4UA 3ORTA 3KK8A 2ZVAA 2VO7A 3LLTA 4CV8A 1NVRA 3L8XA 3I60A 3EYGA 5IA0A 3W2SA 3RGFA 2NP8A 2QO9A 3D5VA 3RK5A 4ANQA 2I0HA 5GZ8A 4CFFA 1E9HA 2VX3A 2Y4PA 4NT4A 4EQUA 4ZIMA 3FC2A 2RFEA 3QA8A 5CI6A 5CU3A 4P2KA 4C2WA 3ATTA 4S32A 4IHPA 4JR3A 1OKVA 3G9LX 2GS7A 5KBRA 2WTIA 3ZXTA 2SRCA 3QLFA 5EW3A 3RWQA 2ZV9A 4WRGA 3H0ZA 3D2KA 5K0KA 1IAHA 3ORPA 2AYPA 2C0OA 4EWQA 4ASDA 4G9CA 4O38A 2P4IA 4P5ZA 3R7OA 4CKRA 2PMNX 2F57A 1XJDA 2JKQA 2VTNA 4BWXA 4I0SA 3VUGA 2G2HA 2IVTA 1QPDA 2PUUA 4OTIA 1OPLA 5HVKA 3TJCA 3FC1X 4OR5A 3AT3A 2B54A 3B8RA 1J3HA 3I7BA 1ZYJA 5ANDA 3KMWA 1Q5KA 3C4ZA 1KE7A 3E3PA 4YO6A 1J1CA 4N57A 2W1FA 3G5DA 4PP9A 3DGKA 4FT0A 4EOJA 2CN5A 2Y6MA 4C4JA 4ZSEA 2CNQA 2XM9A 3W8LA 1QPEA 3FXZA 3PJ2A 3ZDUA 5FDPA 3TUCA 2YITA 5I9UA 4MNFA 2JIVA 3F3ZA 3ZEPA 4JDJA 1Y91A 2PMLX 2Z2WA 3NS9A 3IK3A 3I1AA 3DKOA 3LQ5A 3UMWA 4EWHA 3NUNA 3SRVA 5J9ZA 4TKSA 1PW2A 3LIJA 3W33A 3ZM9A 4WG3A 2F9GA 3NDMA 4U81A 1SM2A 3ZSIA 3NUXA 2QCSA 5JGAA 4E4NA 2CHLA 3ANQA 4RPVA 3C5UA 4G2FA 5J7BA 3FHIA 4H3QA 1CKPA 4PL3A 3ZO3A 3W55A 4A4LA 3FJQE 3Q9ZA 3GCVA 3FLQA 1H8FA 5EYCA 3R2YA 2IW9A 5I0BA 1H07A 1SVEA 3DB8A 3FE3A 3CXWA 4U3YA 4ZY4A 3BZ3A 1WAKA 3FEGA 2XNNA 4U45A 5CQUA 4QYEA 5M53A 3QUEA 3TNIA 4CT1A 2YZLA 5A6NA 3O17A 4G6NA 1UU8A 3HDMA 4GCJA 5IKWA 3FZSA 2BDWA 4YO4A 4XX9A 3KXZA 3QA0A 2ITZA 4O7YA 3MY1A 3IW5A 2WHBA 3PFQA 2WTKC 3F82A 2VTTA 3CQUA 3Q9WA 3A61A 4IE9A 1SNUA 2XB7A 3EHAA 4J96A 4UWCA 5CU6A 4FKIA 4BCFA 2AC3A 4D2RA 2PUNA 3DJ7A 1KV2A 4II5A 4NH1A 1JLUE 1XWSA 4YJQA 4PWNA 3PJCA 2RKUA 2B9JA 4UALA 2OW3A 3TZ9A 4QMVA 5KKRB 2VZ6A 4FKUA 5FP5A 4QMWA 4O2PA 4FTOA 1OPKA 4IFCA 5ACBC 3T9IA 1G3NA 3W2PA 3HDNA 4GK3A 3R1NA 4S2ZA 4FTQA 5L6OA 4UMRA 1K3AA 5C26A 4ZXTA 4YTCA 4ZZOA 4YSMA 5IDNA 4BIDA 5HIDA 2IPXA 4I6BA 2DYLA 1UV5A 4LMUA 1BLXA 3EQRA 1G5SA 5CU2A 5EHOA 4AZFA 1ZMWA 2WIHA 4AZVA 3UPZA 4XCUA 4L3LA 4HYHA 4PRJA 4RJ8A 3KKVA 2VWZA 3PIYA 2ONLA 3RKBA 3R30A 3PE2A 3ZLXA 4XG7A 5E7RA 5HCZA 2XIXA 3AD6A 2WO6A 4Y8DA 5CZIA 4JBQA 3P4KA 1P5EA 2JIIA 5M51A 1BI8A 4IADA 5IQEA 2VTMA 5ANJA 1QL6A 1YW2A 4I41A 1YQJA 5EH0A 4MK0A 4O0YA 4FV7A 2BFXA 1MQBA 5E8YA 4X0MA 4ALWA 5DYJA 3GU5A 3LJ2A 3FSKA 4OT6A 5HEZA 2KULA 4I5PA 4R77A 1S9JA 2XK7A 4EOOA 1GOLA 5L8LA 3VS6A 4IB3A 4D2WA 3A7JA 5F9EA 5IMEA 3V5TA 4MXAA 3H10A 4EYMA 5AV4A 4EH4A 4BDKA 1I44A 1XO2B 4TWPA 2JDVA 4XV2A 4DFUA 4PX6A 4S31A 3PPKA 4J1RA 4MH7A 3B2WA 5A4QA 5EM7A 5DVRA 5BX0A 4MF1A 1H25A 5HIBA 4ACCA 3RPVA 2IG7A 2XKCA 2A27A 2FSMX 3NLBA 5JK3A 2ZV7A 5M08A 2YCQA 4ZTRA 1ZMUA 1P4FA 2F2CB 4UZDA 5ETIA 5FWKK 3DKGA 3Q5ZA 3GB2A 1YOJA 1PXKA 1YI4A 2BTRA 2YN8A 5CVFA 5J95A 4OTQA 3AMBA 5KZIA 4FK6A 5C8NA 4ENYA 2P33A 2J90A 2X1NA 3DT1A 1WVYA 1ZYCA 4FT9A 2GQGA 4EKLA 4IB5A 2HZ0A 3DBCA 3R0TA 4BL1A 1NY3A 3DQWA 4FTLA 4USFA 4YZ9A 3F66A 2GHLA 2IWIA 5AV0A 4F70A 5DBXA 4A4OA 2JKKA 3UTOA 5T68A 5IZFA 4QPSA 4BDFA 4JX3A 4UB7A 2ZMCA 5LWNA 5IQFA 3RNYA 4NM3A 4ZSJA 5L2WA 4TWCA 3TZMA 4NIFB 3PY1A 3PVGA 5DI1A 1H4LA 5BVDA 4BKJA 4C4IA 3POOA 3BV2A 2BVAA 5IA4A 4NW5A 3FXWA 4EUTA 4KIKA 5C8KA 2QOQA 1DM2A 3V5LA 3KXHA 3OROA 4JBPA 3BGPA 1ZMVA 3OUKA 4HGSA 2I0YA 4RZVA 4IJ9A 4GT4A 2BDJA 4TYEA 3DB6A 2C6OA 3LOKA 2VTAA 2XK9A 3ZLSA 5EHYA 5DA3A 4LOOA 5IA1A 3P08A 4X2JA 3C4WA 1KOBA 4WNMA 4EOKA 3COMA 4ZSLA 4UX9A 4W4VA 4H1MA 3SA0A 4FKLA 3QTRA 3ZUVA 1YXXA 1ATPE 4YR8A 3AC2A 4RSSA 4OBPA 4OLIA 1RDQE 2JAMA 3QLGA 3VJOA 2NRYA 2X6EA 4GEOA 2PVFA 3KEXA 4DGNA 5BMMA 3A7FA 2VWWA 2BRBA 2HY0A 2QHMA 4FMQA 4AZTA 4O7WA 3A7HA 1EH4A 3PXRA 1M7NA 4D2SA 4BI0A 4F1OA 1E1VA 2R3RA 3Q96A 2YACA 1B39A 3IO7A 5E90A 4QMUA 1R0PA 2WTWA 5CNOA 4PDYA 2VNYA 3QTUA 1JQHA 5IQGA 3QTXA 4ZTSA 5BVFA 1H0VA 2QU5A 2YM6A 4E5BA 2OJGA 2OF4A 2VUWA 4RX7A 3RM6A 1FBNA 5CU4A 4JT3A 1KSWA 5CU0A 2XNMA 3HX4A 4G34A 5CAOA 1U59A 5HO6A 3IOPA 4EOMA 5IEYA 4WA9A 5L8KA 4NKSA 5DEWA 4CMTA 5M4IA 3Q9YA 2BAJA 5LARA 2GS2A 3BYVA 3ZMMA 5D1JA 4GSBA 4FKTA 2J0KA 4BIEA 4DLJA 4X3JA 4Q9ZA 3P23A 2W4JA 1REKA 5JGBA 5BVKA 5D41A 4CT2A 1H1QA 4IBMA 4MXYA 4CXAA 2FO0A 4QTBA 3SG9A 4FG8A 5AIRA 5JKGA 4O0XA 5GIOE 3UOHA 1SMHA 2GFCA 5FBNC 4XP3A 2ZAZA 2O3PA 2QOLA 4FKRA 2WQOA 5FEQA 3RM7A 4QMOA 2UVZA 3MTFA 1DAWA 3L9MA 4KRDA 4QP7A 4RIXA 2BALA 2QHNA 4FG7A 3SRVB 4XLIA 4AW5A 3C0IA 5JZJA 5A4EA 3FV8A 4XMOA 5HG8A 5J7HA 3LMHA 2YCRA 5HGIA 5JH6A 3TV7A 4A9SA 3OWJA 4O91A 4OTHA 2H96A 3FWQA 3R8LA 4PMMA 3OWPA 2JLDA 3SW4A 3CCNA 5FEEA 5HG5A 1WFCA 2R4BA 2WAJA 1BMKA 2IZRA 3LCDA 4FI1A 4GFGA 4HPTE 3OBJA 3IPHA 5EOBA 1XH5A 2UZEA 2C68A 3HL7A 4NM5A 4BCHA 3PWDA 4AX8A 3GC0A 4GFOA 4FK3A 1OL7A 2GHGA 1ZOGA 5AV1A 4UN0C 3VS5A 4AT5A 1DI8A 1P14A 1YDRE 5DN3A 3ZSGA 1TVOA 3PTGA 3BCEA 3W2CA 4KBKA 1BI7A 3D2IA 4J52A 3QQKA 5J9LA 3BHTA 4IAKA 3KULB 3ALOA 4EC8A 5J1VA 2PVRA 3DU8A 3R7IA 3A60A 4JBVA 1VYWA 4JQEA 3KA0A 1REJA 3FXXA 5IQAA 1PXMA 4RIYA 1I09A 5AP5A 4IWDA 2Z8CA 3E8EA 5IPJA 4IAZA 4OT5A 4IX3A 5I9WA 1YWRA 1QCFA 2RF9A 2PVMA 4E8AA 4GG7A 4CFUA 1UNLA 5HX6A 4FF8A 4JBOA 2HXQA 5EM8A 2VNWA 3FSFA 3NVMB 4M15A 3L9LA 4DFNA 4F4PA 1J7IA 2VO6A 4ALVA 5CEMA 3G9NA 5JGDA 5A4LA 1WBSA 3I7CA 3OS3A 3WI6A 4M67A 3CTHA 4MWHA 3VS1A 3R22A 1OL6A 3MSSA 4DG2E 4E5WA 3A7IA 1TQMA 3L8VA 4PPCA 5GINE 2UZOA 4QP2A 4DH3A 4U79A 4N6YA 2BRMA 1PMUA 3HRCA 5EDRA 5EKOA 4ARKA 3AQVA 4J95A 5FGKA 5EKNA 2XS0A 3IS5A 3QALE 4RLLA 4DBNA 4R7HA 5TT7A 4MYGA 2JAVA 5IA3A 3PZEA 4IWQA 4DH8A 3QCYA 5M4CA 3EFJA 2WTKB 3TV4A 3NMUF 3ZDIA 5LMBA 3V8WA 2VWYA 4EBVA 3NRMA 3OUNB 4XLVA 1UU9A 5F20A 3A7GA 4EZ3A 5HLWA 5KBQA 1A9UA 2VWBA 2OO8X 3E63A 2UW3A 2WMAA 4Y95A 3V5PA 2OSCA 3VHKA 4AU8A 5J1WA 2QOBA 4ENXA 1ERKA 4HVSA 3R7VA 4FKWA 4D4RA 5CXZA 4N0SA 3ROYA 3LM0A 1H28A 3CJGA 3NNXA 3OXTA 4PPBA 2FH9A 2C0TA 4ZY5A 3JVSA 4GMYA 4X3FC 2PYWA 5E91A 4MD8E 3QRJA 1U54B 4BZOA 2J0LA 2XF0A 5HE0A 4DGGA 2X2LA 3EQGA 2BFYA 2HZIA 3QTZA 3C9WA 4UMPA 1BUHA 3UPXA 4GFMA 2R0IA 3O96A 1PYXA 1PXPA 3MIAA 4LFIA 4WSQA 2KTYA 3EQCA 4ZTMA 2XJ1A 3IDCA 5LVNA 5AUVA 4D0XA 3D5XA 3TEIA 5BYZA 3CQEA 3KMUA 3U6IA 3K3JA 4XS2A 4FEXA 3CEKA 2IZSA 4LYNA 4HVIA 5CSPA 1LEWA 2J0MB 4E6DA 4QMLA 5BPYA 3HP5A 4DC2A 3ZC6A 4CD0A 4L46A 1OZ1A 4BCNA 4OTWA 3IW8A 5GIPE 5L4QA 4FZFB 1IR3A 3EYHA 3PVUA 2X8IA 3DZOA 3ZSHA 3ZYAA 4NTTA 3NYNA 4BIBA 3PA4A 3ORXA 3IW4A 3EWHA 4ANOA 4YC6A 2QKWB 3FZOA 4K33A 4C37A 1OM1A 4EZ7A 3T9TA 1ZAOA 4O0VA 4LM5A 4U97A 4EKKA 5CEKA 4ACGA 1V0OA 1W0XC 1WBPA 3HMIA 2YAAA 3KF7A 4L43A 5TOZA 4JDKA 2OU7A 1KE5A 3R8UA 4EHEA 5LJJA 2IW8A 1UU7A 4FT3A 3MY5A 4QNAA 5IQBA 4IAAA 4YZMA 3GU4A 2PZYA 4E5AX 4JS8A 4W8EA 4BWKA 5GZAA 2OIBA 4CLJA 3RPOA 4BI2A 5CAQA 3BHYA 3M1SA 5ICPA 1H0WA 4QPAA 5HD4A 2PULA 3UC3A 3FL4A 1JWHA 4YJSA 4QMSA 5IH4A 3MTLA 4AN9A 4ZJIA 3UP7A 2OIQA 4CG9A 2NNWB 4FZDB 2C6MA 3II5A 4RX5A 4RMZA 4ORKA 4USDA 4FL3A 4I20A 4X21A 4XH6A 2DWBA 3P9JA 2ETKA 3MH2A 1ZOEA 4CNHA 1GIHA 2Z60A 4ZOGA 5JFVA 4I3ZA 5G1XA 2XNGA 1U4DA 1KWPA 4OTDA 2G01A 3R02A 4RWJA 5KE0A 1NW1A 4BKYA 3KREA 3WF9A 2C6DA 2Z7QA 2B9HA 1U5QA 4BRXA 2O2UA 3AD4A 5EK7A 4AN2A 4O7TA 3P78A 2VX0A 3W10A 5BQ0A 3UVPA 4C61A 4CKJA 5J5SA 3FI8A 2YWVA 2XM8A 4C2VA 4XP0A 5DFPA 1JOWB 1YXVA 3NYVA 5FM3A 4L67A 2GHMA 4ZK5A 2Y8OA 3QCQA 3VUMA 4ZTLA 4EK3A 1HCLA 3M11A 2CPKE 1YVJA 3ZOSA 4FNWA 1FVVA 4EONA 3TJDA 5IQIA 3GI3A 3ZO2A 2XNEA 4FSYA 2CMWA 5DMZA 4QQTA 3MIYA 1IG1A 2DQ7X 2VTIA 3A62A 4WNPA 4F6WA 3ZXZA 3PUPA 3H9OA 4F7SA 2WQMA 4DFBA 2R3NA 4JI9A 2ITVA
chains in the Genus database with same CATH superfamily
2QOOA 4RIOA 5H3QA 1OGYA 3DFCB 3E5AA 4YNOA 3U9NA 2XH5A 2OWBA 3W18A 3QCSA 4TWOA 2PU8A 1DS5A 1IA8A 4FV0A 3VW8A 5HBEA 1XBAA 3SC1A 2R3LA 1KV1A 3NR9A 3QUPA 4HCTA 3ZRKA 3KVWA 2ERZE 1M52A 4H36A 4QD6A 3LJ0A 5C9CA 3VWAA 5IISA 5L6PA 2PK9A 2VO0A 3OOMA 3WYXA 4BYIA 2PE2A 3ODZX 4V04A 4X6RA 2X7GA 3CP9A 2Q0NA 4FYNA 4IJPA 3SX9A 3C50A 4K77A 3RBWA 2QR8A 3ZO4A 3AC5A 5HX8A 4D2VA 3TM0A 4O22A 2XBJA 2BIKB 3POZA 3UDBA 4E7WA 4EOLA 1LUFA 4EUUA 4EYJA 4RWIA 4TL0A 1G8SA 4N70A 4TZRA 4BDCA 1R3CA 4FTIA 2X0PA 3BYUA 4GIHA 5DGZA 2R9SA 5E1SA 1YDSE 3Q4UA 3LW0A 2B55A 5AAFA 1BL6A 3PXQA 3R9NA 3LXPA 2YLEA 3FMMA 4D2PA 2J51A 2GTMA 5JEBA 4ZJJA 4AS0A 5GJFA 4E6QA 3R9HA 2X7OA 3R6XA 3UYSA 2WOUA 4O7VA 3RAIA 4H1JA 3W1FA 4YURA 2DUVA 4KBAA 5HE1A 4DGMA 3CQWA 1VR2A 4GJ3A 2BDFA 2YZAA 2VTPA 3G15A 3GC8A 2XNBA 3UNJA 4FTKA 4PNKA 5IMXA 4XG9A 3KIOC 2YM7A 4D0WA 4D58A 5L2IA 4QDEA 2E9UA 3VS4A 2V0DA 2W1HA 5LVOA 4QP9A 4P7EA 4PMTA 4QMNA 2GFSA 2QLQA 4DFZE 3TKHA 3DBDA 4QTCA 4EH2A 3M42A 4R7BA 3EN5A 2UW7A 2GNIA 4NIFA 4F1TA 4RG0A 4CRLA 1H24A 3VJNA 2OH4A 3QGYA 3V5WA 3DA6A 3NNUA 5LOHA 4FSZA 2C5VA 5AP0A 5TKDA 4YZCA 4K8AA 1PMNA 4BBFA 3D94A 2R2PA 2VV9A 4E4LA 3FDNA 4FIJA 3FY2A 3DS6A 4JLCA 3R8PA 2UW0A 2VAGA 3F7WA 5ANEA 4NCTC 3NX8A 4G17A 3UIBA 4Z16A 3V6SA 2YIQA 4LL5A 2HIWA 4CMUA 4U5JA 1Z5MA 5AP4A 2JDRA 3HLLA 4NJDA 4PDSA 4ITIA 3SW7A 3FMEA 3HMPA 1X8BA 3PY3A 2REIA 4A9RA 2XYNA 4C62A 3WOWA 5IQDA 3BBWA 2W1ZA 3EIDA 3QBNA 2YISA 4FZ7A 4M68A 4EOIA 5BYYA 4I6LA 5FUTA 3TMOA 5M06A 3REPA 2WOTA 3R7YA 5CF6A 4M66A 2CNVA 4MD7E 3RNIA 3MPTA 5DR2A 1WVWA 2QOHA 4FVPA 4I0TA 5AR8A 4XG2A 3UNKA 3LFSA 3PLAE 4O6LA 4Y73A 3CPCA 4YGAA 1WZYA 2EXMA 3C51A 2CJMA 3FAAA 4J99A 4D4VA 2B0QA 3DTCA 4JG7A 1YXTA 2C30A 4LV5A 2EB3A 3WF8A 2JBPA 4QTAA 5KMLA 4JDIA 3BHUA 3BWJA 4L53A 4Q2AA 3K5VA 4R1YA 4CKIA 2W0JA 5FXQA 5T6KA 2C5XA 3PA3A 5FD2A 4E93A 3OF0A 4FOBA 2OH0E 3HUCA 5E1EA 3VUHA 1BKXA 4GUEA 4J71A 4L7FA 2V22A 2ZV8A 4KIQA 1FGKA 1B38A 2XJ0A 4GRBA 4TTHB 3R1YA 3QTWA 4FV4A 1YWVA 3NW7A 5JRQA 4O0RA 1T46A 2UZVA 2YDKA 4B99A 4H3BA 3SXFA 4FODA 4FEVA 4FKVA 4FX3A 4QYFA 2Y4IC 4QRCA 4DN5A 4UMUA 5K5XA 4DEDA 2O5KA 5AAGA 3I0OA 3E93A 3COHA 2Z7RA 3UZTA 4KKEA 3E8DA 1XH4A 3D5UA 3I4BA 4YZNA 1CKIA 3UIUA 5A6OA 3NVKI 3FKOA 4RT7A 2HELA 3EN4A 4BCIA 3EN6A 4NU1A 2ETRA 4G31A 3UG2A 1NT2A 5LVPA 4BZDA 3U4WA 3JY9A 3AD5A 2X0GA 3SXRA 4DH5A 3K54A 4JX7A 1CM8A 5GJDA 3OT8A 4ANMA 3KXNA 4HZSA 4R7IA 5J9YA 5FXSA 4EK4A 4FSRA 3T3VA 2UZWE 3L8PA 2XMYA 1H1PA 3AGMA 3VS2A 5L8JA 4CFMA 3BYSA 2ITTA 3KY2A 4ZS0A 3PPJA 4X3FB 3UNZA 5I9ZA 5KMJA 4EHZA 4PUZA 2HENA 3COIA 3GU6A 4QTDA 5AP3A 5FQDC 3TL8A 4YC8A 4AA0A 3U4UA 5CWZA 4ZTQA 3CGOA 2IZUA 3EQPA 2J5EA 5HLPA 4XV1A 2Y6OA 3IDPA 4C58A 4D1XA 4PP7A 5KHWA 3BYMA 3KRJA 4O7NA 4E6AA 3ZU7A 4IXPA 1AD5A 5B2MA 2W1GA 3OBGA 3NWWA 2PVJA 3FMNA 2QG7A 4U42A 3FZPA 3DXQA 2OXDA 3KFAA 3MN3A 3OXZA 5LMKC 2X81A 3OZ6A 4HYSA 4MHAA 3KULA 1F0QA 3FHRA 4FGRA 3ID6C 3G6GA 4FSTA 3PVWA 4EK5A 3WIGA 2VGPA 4O81A 3TNHA 5LXMA 5EDQA 2WB8A 3EL8A 1CMKE 2UW5A 5HESA 2YDIA 1ZXEA 4C0TA 2Y7JA 3R73A 4L44A 5AUZA 2J6MA 3WF7A 3G2FA 2WMWA 4QMPA 4W9WA 3EZRA 4JOAA 2WELA 5EI8A 4C4GA 4B8LA 2PL0A 3LFFA 4WUNA 4G3EA 4EEVA 4FV1A 3CSVA 4DFLA 3DXPA 2X6DA 4D9UA 5KHXA 2I0EA 3ORNA 2C1BA 5HZNA 4L3PA 3KF4A 1ZOHA 4EK8A 4ZEGA 4IC7A 3D7ZA 3QRIA 3FLSA 3SAYA 3ZUUA 3QRKA 4FSQA 5GHVA 3ALNA 3PXFA 3TUBA 4FIHA 4A9YA 4BDIA 4HNIA 3U87A 2YM5A 4KSQA 2YIRA 3FMDA 1PYEA 4ID7A 4EHVA 5FM2A 5DR9A 4DEAA 4IACA 4YC3A 4J8MA 3M2WA 5AUUA 5CALA 3UZRA 3LFCA 5FEDA 3V01A 5DH3A 4BCOA 3W16A 5L2SA 1QMZA 3W32A 2HZNA 4V0GB 4MF0A 3ZLYA 4AACA 4JXFA 4D2TA 2XARA 4QO9A 4J8NA 2BAKA 4QMQA 5H8BA 3W0PA 3SHEA 3FLYA 3BLHA 4AF3A 5FBOA 3DNDA 4UBAA 5BVEA 3UYTA 3IOKA 2BHEA 1CSNA 2HK5A 3PXZA 4XG3A 2WTCA 4UV0A 2A0CX 1RE8A 3RPSA 3KQ7A 4G5JA 3SOCA 3V8TA 1Q24A 5KO1A 5ETAA 1KE9A 1GJOA 4GU6A 1Q8TA 1U54A 2W1EA 3ZCLA 1QPCA 1M14A 4M97A 4BTJA 2PVYA 4NM7A 4FIEA 4QYHA 2I1MA 4F9YA 2FVDA 1G8AA 4GIIA 1F5QA 3KU2A 3ORLA 4ZZNA 4N6ZA 4AQCA 4FOCA 3D14A 5I5ZA 1PXJA 4BGHA 1VLRA 3MPAA 3KB7A 4CRSA 3PE1A 5EW8A 5I4NA 1IA9A 2UW6A 4ZLZA 4QMMA 5BUEA 1ZYLA 2W5BA 3EN9A 3F5PA 3FQHA 5D7VA 4QMZA 5HORA 3F3VA 2RFNA 3NZ0A 4FICA 3QGWA 4UMQA 3LE6A 3MBLA 3SOAA 1V0BA 2C47A 4USEA 5CAUA 3Q9XA 4M0ZA 1U5RA 5AUXA 2CCIA 2B9FA 5E8SA 4WHZA 1ZY4A 5BVNA 2OZOA 4K6ZA 5FTQA 2ZJWA 3QQUA 3P1AA 4MBIA 2QNJA 1YI6A 4X6QC 1W98A 3Q2MA 5H9BA 3R7EA 5B7VA 2F2UA 4BDAA 3MS9A 3RTPA 4IVCA 4AXCA 4IANA 1FPUA 3B2TA 4BCQA 3WYYA 2BPMA 3BWFA 2A1AB 3A2CA 3D9VA 4AWIA 3O8PA 4FTAA 4CCBA 3P7CA 1UWHA 3DPKA 4WG5A 4LV7A 2XBAA 3HA6A 4GU9A 5BMSA 2F7ZE 3R8ZA 3DDPA 5J79A 4IQ6A 4FKPA 1MUOA 2EU9A 3BQCA 3FPQA 1OBDA 5D9HA 5DT0A 3T3UA 2R3PA 3O8TA 3R9OA 4C4FA 1OECA 3V5QA 5B2LA 5AV2A 2NYAA 4KSPA 3W0QA 3ZTXA 3P5JC 4ZTHA 2C6KA 3MWUA 3I5NA 4C8BA 1GY3A 1Q97A 1BX6A 1SVHA 3LXNA 3JXWA 4FV6A 3C4XA 3KC3A 5IQCA 2V62A 4RLKA 1PJKA 3VBQA 5FXRA 3GVUA 3WE8A 5A46A 3NW5A 3C4EA 3LVPA 4BGGA 4EH6A 3WZKA 4W4YA 3RK7A 3ZBFA 1PXLA 3QZIA 4HCUA 2AQXA 2OKRA 3FZTA 3Q52A 3JUHA 4TXCA 4UWYA 4YZDA 5AMNA 4CQEA 4C3RA 5BNJA 3LFBA 2E9OA 3QZHA 4I6HA 3BKBA 4C02A 2WD1A 2BRNA 4L52A 3Q32A 5JQ5A 3ELJA 5LMAA 4MX9A 3C0HA 3BBTB 3K2LA 3T8OA 3UG1A 2QOKA 2J0JA 4L42A 4A9TA 2R3KA 4JIAA 3SLSA 4EBWA 4R5YA 4M0YA 5BUJA 2J50A 2FUMA 4ITJA 3BHHA 3RP9A 1GZNA 4F7LA 3IG7A 5CS6A 4I5CA 4F6UA 4XG6A 4D5HA 1RW8A 1KUTA 1XH7A 5AUTA 2QOFA 4PTEA 3P5KA 2B1PA 3ZFYA 5KMOA 5D11A 2A4LA 4CZUA 3EN7A 3DAKA 4YJTA 5TO8A 2QO2A 2VU3A 2WFYA 4F6SA 3MFTA 5BUIA 5I9VA 3LCSA 2VWVA 3IW7A 3RMFA 1OIRA 4BBEA 3RINA 4XV9A 4EH3A 3D7TB 3LCTA 4YJNA 5EYDA 4FL2A 5CEPA 4I6FA 2YM4A 3GOKA 4JQ7A 4IC8A 2WMXA 3GUBA 4O0TA 4I5MA 4X2KA 4V05A 1Q8UA 3VS3A 4C4HA 4PQNA 4IX6A 1FQ1B 2C5YA 5JZNA 3WILA 1CDKA 3F6XA 4ANLA 3PXKA 4IEBA 4A06A 5ANGA 4HW7A 4F65A 3EMGA 4R1VA 2W5AA 5A4TA 4PF4A 4M69B 5J5TA 5M4FA 1S9IA 3PSCA 3L9PA 2X8DA 3R28A 3QTQA 3LCOA 5BV3A 3OWLA 2A19B 5M56A 4YBKA 2G2IA 2PE0A 2V55A 4AW0A 1NA7A 4BCPA 5EW9A 3QRUA 4FTUA 4ASXA 1K9AA 4QP4A 2X39A 3LZBA 4I4FA 4FEQA 2WKMA 2Y4IB 5E92A 3NNVA 4HPUE 3P7BA 2UVXA 2GQRA 1O6LA 3Q60A 5HHWA 4FNYA 3OEZA 1H26A 3KMMA 3MB6A 3DNEA 2YEXA 4L68A 4I93A 3JVRA 2WNTA 5AP7A 2XEYA 3R8VA 3UMXA 4BDEA 2PVHA 5AEPA 4ERKA 2W9FB 4FSNA 3SQQA 5M07A 2QU6A 4RA4A 4A9UA 3GC7A 4NZWB 3VULA 3W2QA 2R3GA 4GL9A 2B9IA 2C3KA 3THBA 1UWJA 4CCUA 2VWXA 4F9CA 3RVGA 1UU3A 4YJPA 2A2AA 4FNXA 4KBCA 4LGGA 3AG9A 3OC1A 1P4OA 1UVRA 4JRVA 4E26A 4DE4A 3S2PA 2H9VA 2XCHA 3QXOA 4YZBA 4RFYA 4DTKA 3KN5A 5IA5A 4W4XA 2UV2A 4IWOA 3V5JA 1PMEA 5CEOA 2XCKA 5K0XA 2F7EE 1IASA 3QU0A 2QG5A 4I5HA 4MNEB 3BE2A 1JKLA 4JAJA 1JNKA 3TI1A 2XRWA 1Y8GA 4RGJA 3B8QA 1PY5A 2IN6A 3UQFA 4MUQA 5BVOA 4ZY6A 5E8TA 4C34A 4CMOA 4RJ5A 2GPHA 5T3QA 4K11A 4LV8A 3HRFA 3SDJA 3ZO1A 2OG8A 2PVNA 2VD5A 1WCCA 4OUCA 3RHXA 3VBVA 4HGTA 1R0EA 2JITA 4MAOA 3F69A 3G90X 4EQMA 4FTJA 3DJ5A 4JG6A 5IF1A 3AKJA 4PMSA 4C38A 3MA3A 3VIDA 5E9EA 4BC6A 4R3CA 3SXSA 5IUGA 4O84A 2XKDA 2OZAB 3OOGA 1H08A 3GNIB 4DH7A 3OEFX 3N4UA 3RPRA 4Y72A 4D9TA 3DV3A 5DRBA 1H27A 4JAIA 4LI5A 2JEDA 5LVMA 2WU6A 4MKCA 4EOQA 3LLAA 1ND4A 2R7BA 5DG5A 3COKA 1ZLTA 2JIUA 3ORIA 4Z3VA 4NM0A 3RZBA 1PF8A 1OITA 2VRXA 3F2AA 4FBXA 4G1WA 4XP2A 4IMYA 3NFGB 1GZ8A 4FV9A 3FQEA 4GW8A 4YPSA 5CANA 2LGCA 2V5QA 3RCDA 5JMSA 4FUYA 3LKMA 2O8YA 5CQWA 5EHLA 2LAVA 5K9IA 3N9XA 3NAYA 5AM6A 4NFMA 5TF9A 1JAMA 5IEXA 2O65A 4ZP5A 3TN8A 4IDTA 4CLIA 5DRDA 2WMTA 3BLQA 5M57A 2P0CA 4CFVA 4FKJA 4LRKA 5AV3A 2EXCX 1OUKA 4GVJA 3N4VA 5TR6A 2X4ZA 4F9BA 1TKIA 5HIEA 2HW6A 4FT7A 2ZYBA 3R04A 3BPRA 3R01A 3UO4A 4AW1A 4CVAA 3CS9A 4LRJA 2JFLA 2QR7A 4A4XA 2IW6A 2RIOA 3H9RA 4XOZA 5TE0A 3BU3A 3DBFA 4JJRA 5K3YA 4Z7HA 4N4SA 3ROCA 3TIYA 2IZTA 5A3XA 1KE6A 4TNDA 2PZ5A 4FTRA 4AXEA 3UIMA 4LRMA 3SKCA 1YI3A 4MBJA 2NO3A 3H3CA 4X3FA 3GP0A 3TNQB 1Y6BA 3BLRA 4OTFA 2IVSA 1T45A 1ZRZA 5DNRA 2XVDA 4R6VA 1Q8ZA 2VTHA 1W82A 5HE2A 4ZSAA 4RIWB 3QD3A 4L9IA 5L2TA 2JDSA 2C6TA 5CAVA 4CG8A 2OICA 5D12A 4ZSGA 4G5PA 3N51A 4E20A 3OW3A 3PVBA 2EVAA 5FTOA 2BRGA 2QO7A 4AT3A 2XA4A 3ENMA 4CFWA 1UNHA 1ZYSA 3PXYA 3OCBA 5DT3A 4Z9LA 2QQ7A 2W1IA 2XIKA 5IG1A 3LFNA 3QYZA 2YM3A 2GQSA 2ITQA 4RVTA 4LG4A 3QAME 4A07A 3HECA 4FEWA 3HAVA 2WMBA 2C4GA 1O6KA 4Z55A 4O0SA 4TRLA 1OPJA 4CTCA 2Y9QA 4E4MA 3NUYA 1MRVA 3NYOA 4ZS4A 3TACA 1GZOA 4XBUA 2OJ9A 5DHJA 3PDTA 4RJ4A 4M12A 1Y6AA 4DF3A 2RG6A 3JYAA 3NYXA 2PUPA 5CSHA 2GCDA 5KNJA 3DBEA 5EFQA 1E1XA 3S1HA 4AGUA 1CKJA 2R7IA 1SVGA 1ZWSA 3O2MA 4KS7A 5GZ9A 3ZUTA 5A9UA 4F99A 4JMQA 4QP3A 3KXGA 4ZJVA 2WGJA 2IO6A 3U51A 5F4NA 2CSNA 1JSVA 4FKQA 3U8WA 4I22A 4P4CA 1LEZA 1O9UA 4L6QA 3PSBA 4DTAA 2YIWA 2EXEA 2HAKA 3DK7A 3UIXA 5AR3A 1ZYDA 1M2RA 2ETMA 1OB3A 4LGHA 2C6IA 4E6CA 2XUUA 4LDTA 3PA5A 3ANRA 4M13A 2B7AA 4L01A 5AX3A 5CLPA 4FKOA 5C8MA 2UUEA 4V0GA 4AA5A 4BICA 4D4SA 4CFXA 2CDZA 3HKOA 3LXKA 3VONA 4BY9E 4FIGA 1OI9A 2ITNA 4FZAB 2UW9A 4UEUA 5HTCA 3D5WA 5CENA 4IX5A 2ZM4A 2EUFB 3R7GA 4K0YA 3WF6A 4UY9A 3HA8A 4AZSA 2BTSA 2H34A 3OTVA 4K2RA 4IAIA 2XEZA 4NK9A 2C0IA 3ORMA 5EG3A 2VN9A 2PHKA 4Y46A 3G6HA 4FIIA 1TZDA 3GCUA 4FV3A 3VF9A 4O86A 1OKWA 2OF2A 3ET7A 4BF2A 4O0UA 4HVGA 4IFGA 5EYMA 5HU9A 2GSFA 1OKYA 4LUEA 3AC4A 4TYIA 3F7ZA 4ACMA 2IVUA 2E2BA 4DT9A 2WTVA 3HV3A 4ACDA 2YA9A 4C4EA 3NCZA 5ANOA 4AE9A 3NCGA 3QRTA 3MVLA 3FBVA 3E92A 4ERWA 3MPMA 1Y8YA 5BVWA 3DK3A 5F95A 3PG3A 2CNUA 4RBLA 3MY0A 3BL9A 2RL5A 4I21A 4BHNA 2P2HA 2C5NA 2XNPA 3UGCA 3BEAA 2VTJA 3R63A 2QKRA 2W05A 5E8XA 3VS0A 2OJIA 3EOCA 4OTRA 4HYUA 4OTPA 2YABA 5AM7A 1YHWA 3K3IA 4MQ1A 4GUBA 5FDXA 4OBOA 2F4JA 2PZPA 4BYJA 3I81A 2F49A 5EOLA 4U7ZA 5CZHA 3ULIA 4CYIA 3ZS5A 4AGWA 5KMMA 3RK9A 2JFMA 4RX8A 3GQLA 3DDQA 4G6LA 1Q4LA 3R7UA 3V04A 4GS6A 1PKDA 5ETCA 5AADA 5HO7A 4MTAA 2YDJA 3O5AA 2ESMA 4U44A 4ZTNA 4X2GA 2CLXA 4TW9A 2YHVA 4RWKA 5IUHA 4BCMA 1JPAA 3MVHA 3DJ6A 2NPQA 3KXMA 5FRIA 4FKSA 3PUFC 5KX8A 2XK6A 1YOLA 2RFDA 2C1AA 4RVMA 4FRFA 4YHFA 3E8NA 1AGWA 4KUJA 2XANA 3A4OX 3F5UA 4HVHA 2PUNA 4FG9A 3TKIA 2CGVA 2W06A 3R00A 3KVXA 3I6UA 4O27B 1ZY5A 3TG1A 3QKLA 3ORKA 3VBTA 1M17A 4YMJA 4J97A 4WSYA 2PE1A 3BGZA 2E9NA 2GNHA 4K1BA 5CEIA 4O7ZA 3OY3A 5FP6A 3Q5IA 5HNGA 3GT8A 1OUYA 5C27A 3C7QA 5HLNA 3E8CA 5KMIA 4OAVB 5HNBA 4FKGA 3UOJA 4RRVA 4TNBA 4B7TA 4QYYA 3FKLA 3VF8A 5IU2A 4TYHB 4CFNA 3CTQA 4F0FA 2BKZA 2C3IB 4YUQA 3KRLA 1H1WA 1Z57A 3TWJA 4ALUA 3GXLA 3G0EA 4KIPA 4B4LA 1LR4A 3V8SA 4E3CA 3ERKA 3FI3A 3U54A 4JDHA 3P7AA 2I0VA 3BHVA 3AGLA 3E64A 3UC4A 2WPAA 3DCVA 5G6VA 4NKAA 4I23A 4QP6A 1K2PA 5AA9A 4U40A 2CGXA 4O7LA 3U9CA 2W5HA 4HNFA 5AX9A 2FGIA 4Q5HA 1MQ4A 3EQBA 3SD0A 4NCTA 4F1MA 3S95A 2BZJA 1YXSA 4PL5A 3C4FA 5AUWA 3GGFA 4HYIA 1OBGA 5IQHA 3DKFA 4CZYB 2PWLA 1W7HA 2RFSA 1J91A 4MXZA 4FVQA 3AXWA 3O51A 3VQHA 4BCJA 3ZH8A 5E8VA 5KZ0A 3H9FA 3ZBXA 3EFWA 5IH6A 3DKCA 3P79A 4MXCA 3E7VA 3IDBA 3TKUA 2GTNA 4GH2A 5H8EA 3AKLA 3GCPA 3H4JA 3LFAA 3DOGA 5DT4A 3OMVA 2XNOA 3QD4A 4RFZA 4Y85A 2IEWA 5B2KA 2CLQA 4BB4A 1L8TA 5A54A 2ERKA 3LMGA 2UZDA 3D7TA 3HNGA 3MB7A 4UYNA 4DGOA 1OMWA 3Q53A 3FMJA 2Q0BA 4WNKA 4C57A 4HGEA 4PNIA 2VWUA 3JR1A 1CTPE 3ZFMA 3EKKA 4AA4A 5I3RA 3DZQA 4C7TA 3PY0A 4YP8A 2RSVA 3JY0A 4XOYA 1R1WA 1GIIA 1J7LA 4NFNA 4DHFA 4M69A 4BR3A 4QQJA 3FI2A 3QFVA 1Q61A 1UKHA 3RALA 4S34A 3GFWA 4C3PA 3AC8A 3KCKA 4X2NA 3QZFA 2PVLA 2YJRA 3W0OA 1SNXA 3NIZA 2XK8A 2WTJA 3JPVA 5DR6A 4ANNA 4AAYA 4DT8A 3FQSA 3L8SA 5B0XA 4QYGA 3R2BA 2A98A 4H3PA 4RC2A 4PL4A 4ITHA 4APPA 3CLYA 4BDGA 3W0MA 3U55A 4BDJA 1UA2A 4ZLYA 4WIHA 4GV1A 4FT5A 4G3FA 4O96A 4G3CA 1H00A 3QTSA 4MQ2A 3F3UA 4YJOA 4K18A 1IEPA 5CASA 3PJ1A 4XUFA 4BCGA 4DDIA 5AA8A 2AUHA 4EH7A 4RVKA 3BQRA 4EH8A 3QF9A 2YCFA 3ZHPC 4C35A 4QQ5A 3CD3A 3PPZA 3RAKA 2FYSA 4I1ZA 3A8XA 1FMOE 3OFMA 3DAJA 4G3GA 4RA5A 3Q04A 2I7QA 4FJVA 3O7LB 3CD8A 4FVRA 1G8KA 4NEUA 2ONLC 4YNEA 5AAEA 2W1CA 3S0OA 2J4ZA 2W4OA 4NJ3A 5D10A 4O82A 3FKNA 4IB1A 3P86A 1VYZA 3HEGA 3BX5A 3E87A 1MP8A 1DAYA 1ST4A 4DCAA 4I6QA 5CI7A 4XRLA 4DFYA 3AT2A 4BTKA 3ENHA 3IKAA 3ZEWA 4ZLOA 1ZARA 4MNEA 3F88A 3F2NA 3NUSA 4FSMA 4J7BA 4RFMA 4FUXA 2NRUA 3E62A 5AR5A 3LJ1A 4W9XA 3RJCA 4ACHA 3UVRA 4AXAA 4UXQA 3BEGA 5I9XA 3IGGA 1GZKA 3W8QA 5LMKA 4FV8A 3NIEA 5LCKA 3JS2A 1B6CB 2UZUE 3O71A 3MFRA 3HGKA 3KRWA 4U3ZA 3OT3A 5E8UA 2BZIB 4DCEA 3SVVA 3D0EA 4TYGA 3QQHA 2BHHA 4FC0A 4FZ6A 4D55A 3OTUA 4QPMA 5A4CA 2WEIA 4I92A 4ZAUA 2OZAA 4O6EA 4TYJA 2YAKA 4FR4A 3IQ7A 2BR1A 4L8MA 2O63A 2BRHA 4O21A 3WF5A 4AOIA 4NWMA 2CKOA 1HCKA 2FSOX 3FLZA 3PP1A 2ITPA 3BRBA 3TXOA 2WEVA 5I3OA 3TZ8A 3PIXA 3EFLA 4C3FA 3QD2B 4IB0A 5K4JA 3N4TA 3TNWA 4HJOA 4CZTA 2J0IA 4X2FA 2YCSA 3OG7A 5HVJA 3SV0A 3F9NA 3F61A 3MV5A 4U0IA 5CAPA 5F1ZA 4NYEA 1UKIA 3DTWA 2C3JA 3QWKA 4GG5A 4WBOA 5EM5A 3QQFA 1R78A 2X8EA 2QODA 1HOWA 2G9XA 3HP2A 3Q4CA 2C5OA 1XBBA 1OL5A 3GQIA 3ZLWA 2OXXA 2BUJA 3HMNA 4XJ0A 4AE6A 1PHKA 4M14A 3BELA 4IM0A 4F7NA 2HW7A 4AUAA 4AXFA 3QWJA 1BYGA 2J5FA 3WIKA 4I0RA 2OFVA 4F9WA 1A06A 2IF8A 2XKFA 1Q8YA 3GFEA 1OVEA 2Q83A 3FMHA 3PYYA 3GU8A 5CSWA 4UWBA 2XAMA 3EKNA 5EM6A 3QCXA 4XRJA 2OBJA 5CF4A 2ACXA 4TY1A 3DAEA 4YLJA 4E1ZA 2R3MA 2OFUA 1XH8A 5LCJA 4LOPA 5EI2A 1SYKA 1OL2A 4QMTA 2JDTA 2WMVA 2R3QA 2HYYA 3LHJA 4YU2A 4IAYA 5LQFA 2R3IA 4PTGA 4BBMA 2P2IA 4IIRA 3VUDA 3GBZA 4NW6A 3VN9A 3GCSA 4HZRA 3ZRLA 2QC6A 1H01A 4YJRA 4DGLC 2XIYA 2XKEA 2X2KA 3NSZA 1TQPA 3ACJA 4FL1A 1JSUA 3I6WA 2AEGA 2X9EA 2W17A 3NPCA 4EOSA 2HXLA 3OVVA 2RG5A 3C0GA 4L7SA 4RIWA 4GK4A 5AUYA 1M7QA 3IGOA 4W4WA 4YLKA 4AG8A 3LQ3A 3FZ1A 4XV3A 4QOXA 3E88A 5DE2A 3L9NA 5ANKA 2WQEA 1VEBA 4H39A 2YM8A 2GNFA 3NNWA 4YJVA 4MWIA 1W84A 3NUAA 4PDPA 2YJSA 4YHTA 4HOKA 4WO5A 2X4FA 4BDBA 2BKKA 4AN3A 3GC9A 1H1RA 2YLFA 4LQMA 1NVSA 4PY1A 1FVTA 5HG7A 4DINA 3Q6UA 4LOQA 3W2OA 4BDHA 3TDWA 1DI9A 3ODYX 4APCA 2C3LA 3HZTA 4FTMA 4XNEA 4YPDA 4AGDA 2ZM3A 3LMIA 4Y5HA 3VC4A 3MJ2A 3BU6A 4PMPA 4BVUA 2ITOA 2OK1A 5EI6A 1PXOA 5LWMA 1PMVA 2WIPA 3MVMA 3PG1A 4QMXA 3HMMA 3TT0A 3ZRMA 4M7IA 3BV3A 4L00A 2XIZA 2C6EA 4MD9E 2W96B 4V01A 1XH6A 2GDOA 2QOIA 3QL8A 5HOAA 5HKMA 1R39A 2GNLA 3OCGA 3FUPA 5ACKA 5C4LA 4UMTA 3UOLA 4DA5A