4PMPA

The structure of trka kinase bound to the inhibitor 1-cyclopropyl-1-[3-(1,3-thiazol-2-yl)benzyl]-3-[4-(trifluoromethoxy)phenyl]urea
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
291
structure length
280
Chain Sequence
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLKMLVAVKALKSARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRIYSTDYYRVGTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Maximizing diversity from a kinase screen: identification of novel and selective pan-Trk inhibitors for chronic pain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
total genus 91
structure length 280
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pmpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pmpA01
2V5QA 3Q2JA 3VS1A 3MN3A 2R3NA 1YWRA 1FPUA 2PVRA 1MQ4A 1KE6A 2BAQA 4MCVA 2JAVA 2G01A 3L9NA 2UZDA 3GXLA 1H08A 4WSQA 3R7YA 3W18A 4CMOA 4DITA 4EZ5A 2G9XA 4UMQA 3CXWA 1QPDA 2UW6A 5IH6A 4O7LA 5K9IA 5B2KA 5I4NA 3PXQA 5I9WA 3EQDA 5CU0A 5G1XA 2F7EE 2HZIA 4QP1A 5H9BA 3I7BA 3L9PA 5A54A 4AACA 2DYLA 3GU4A 3HA6A 4GG7A 2XMYA 3RCJA 3A7GA 4UMUA 3GC9A 3C4ZA 1OBDA 5IEYA 2IVSA 2QOHA 2GNIA 5M08A 2XNGA 1VR2A 3DKOA 4CFFA 4I6HA 4WD5A 4EH7A 3DGKA 2R3GA 2YN8A 2VTRA 3RI1A 3RWPA 4IB0A 3DAKA 5CEOA 5BUJA 4M68A 2YM8A 4EOOA 2VWYA 4NM0A 4M12A 5IQCA 4N0SA 2ITQA 3OUKA 4XG2A 2YLFA 4PDYA 3FI8A 3R83A 3NIZA 3MBLA 3R21A 5EQPA 3LM0A 3F5GA 3KXZA 4XYFA 3O8PA 4YO6A 2W06A 3OBGA 3ZM4A 3U6HA 2XZSA 4A9SA 4UN0C 3FLNC 1XWSA 5EI6A 4U6RA 3R30A 4FKTA 4MNEB 3GC0A 2OF4A 4TYHB 3CIKA 2W9ZB 3BU5A 4EK8A 2PUUA 2XKDA 4GEOA 3R9DA 2Y4PA 4G6NA 2XEZA 5CAVA 3Q9XA 2GNJA 5ETCA 3JPVA 4YJPA 2CCIA 4TW9A 2EB2A 2RFSA 4NTSA 4RSSA 3BGQA 4RIYA 5FTQA 3BU3A 4L6QA 4IX4A 2DS1A 4C4IA 5IH4A 2J0IA 4DTBA 2UZLA 5LCKA 2XBAA 4PP9A 2BRHA 4DEAA 2XIRA 3EN6A 4D2TA 2FUMA 3DXNA 2CKPA 4F0FA 5KMMA 3UQGA 2ZM4A 5LWMA 1O6YA 1GNGA 3UC3A 1Q4LA 3UG1A 2JDRA 2OSCA 4Z7HA 3LLAA 1F0QA 4YPSA 2VTTA 4BDGA 5K0KA 3ODYX 3C0HA 2VO7A 4GYIA 2UW4A 2OLCA 2YERA 5JKGA 2X4ZA 1CM8A 1XH9A 3DOGA 5HO6A 5JFXA 1ND4A 4K2RA 4U7ZA 4BFMA 3LFNA 3BBWA 4NKAA 2CHLA 5HESA 3ZCLA 3ZRMA 1U59A 4HCVA 4ZAUA 4U0IA 1E1XA 2A27A 1TKIA 5DLSA 1OL7A 4WNOA 5F1ZA 5TOZA 3P7BA 3F5XA 4OAUC 3WBLA 2JFLA 4L3JA 1RJBA 2XM9A 1FGIA 4BTJA 2OBJA 4IANA 3U6JA 3G51A 2EXEA 4FSTA 2JFMA 3FMKA 4TYEA 4DG2E 2FH9A 3N4VA 4I24A 4CRSA 3SOCA 2YCSA 2UZBA 4J98A 5TE0A 2UVYA 3ZEWA 3KMMA 1PMNA 2YZAA 3K3IA 1OKYA 5AV3A 5J8IA 5EDPA 3T3UA 4EC9A 4D9TA 2I0YA 5KUPA 4C33A 2J7TA 3BLHA 4MQ1A 2PVKA 3MY0A 3ORXA 3ORLA 3Q2MA 4I4EA 4LI5A 5HVJA 3N9XA 3P0MA 5CT0A 5HBJA 3OUNB 3FLQA 5FTOA 2YIXA 3KULB 2F57A 4OTWA 5M09A 3P23A 2XCHA 2R2PA 3NRMA 3SRVA 4OBPA 4PMPA 5AX3A 4PL4A 4U97A 3QTWA 4FKVA 4ONAA 5E8ZA 3ZM9A 1H1SA 3ZZWA 3QC4A 1XHAA 4NEUA 4AW2A 3AMBA 3EQCA 4HGTA 4WBBB 2HY0A 4J8MA 2Z02A 3V04A 3S4QA 4TWCA 3KA0A 1XKKA 3L8SA 3RK9A 3DV3A 4C34A 5LWNA 2WTKC 3NS9A 5I5ZA 3NNWA 3QU0A 4YHTA 4I6QA 2YITA 5HLNA 4MXZA 1UU8A 5E8XA 4AA5A 4HZRA 3VRZA 4JAIA 1REJA 3ULIA 3ZO2A 1W7HA 1PYXA 4UYAA 2I0HA 3FSFA 4BCHA 3E88A 3LE6A 5BVOA 3DU8A 2W5AA 4BGHA 3QA0A 4V04A 3QHWA 4DEDA 3LXNA 3GVUA 5H2UA 4HYUA 3F66A 2P3GX 4YP8A 3VAPA 4C3PA 1YWVA 4G16A 2BRGA 1E1VA 2C6EA 3R8MA 4JNWA 5F95A 1NY3A 2WEVA 2QOIA 3DNEA 3DKGA 3TNQB 1GAGA 1RQQA 4ZZOA 1Y8YA 2WB8A 4FKGA 2IZRA 1L3RE 3G9LX 4C7TA 1Q8UA 2ZB0A 3HAMA 2VX3A 3G9NA 2CPKE 3CY3A 3M1SA 5J5SA 5DEYA 3LZBA 4XRLA 2F2UA 3GQIA 3RVGA 4K18A 4RVLA 5EW8A 3ROYA 3FSKA 4LL5A 5AP3A 4PDSA 3HZTA 2C5XA 4YO4A 4AGCA 1Q3DA 4ZTHA 1OUYA 4RJ4A 5AFVA 3UTOA 3RPVA 3CR0A 1G3NA 2PVHA 2BR1A 3CKXA 1OITA 2E9NA 3NNUA 5H3QA 2H96A 2OZOA 5CAQA 5CNOA 4O1OA 2OFUA 4AOIA 3PY3A 4GT4A 3D2KA 2VTNA 2ITYA 5LMBA 4ZTSA 4EK5A 4XHKB 5KNJA 3H30A 4WUNA 4E8AA 1DS5A 2XA4A 2HY81 3TV7A 3CTJA 5BMMA 3UYSA 4CGAA 3WZKA 5LVMA 3P7CA 4YSJA 3P9JA 3TEIA 3LMGA 2QURA 2OWBA 2V0DA 4OTIA 3OS3A 1SVGA 3OCTA 1V0PA 2BRMA 1YXXA 3CY2A 2C4GA 4PDPA 4L7SA 5CF5A 3UYTA 4R7BA 1OIUA 2UVZA 3GB2A 4F9CA 4C35A 3CGFA 3HEGA 3QRIA 2X8DA 5DGZA 4R3RA 3COMA 4FSYA 3DZQA 2PMOX 3FKNA 3ERKA 2BILB 4NIFB 4RA4A 4FT9A 1NVQA 5AR5A 3FI2A 1JNKA 2R9SA 5AUWA 4ZSEA 3QUEA 4BBMA 2OXXA 3O8TA 3ZLWA 5DEWA 3FAAA 3VUMA 4IWQA 1SNUA 4FVPA 4QNYA 3Q9ZA 4DYMA 3CTHA 3FXXA 2OI4X 1ZAOA 3AC8A 4O0YA 4TWPA 3QA8A 3QQJA 1YVJA 4WKQA 4BZOA 4QYYA 2VRXA 3EWHA 4FTOA 4CLIA 3OXTA 4R1YA 3DQWA 3FDNA 3ACKA 3ZO3A 1Q24A 5LVPA 3EN9A 2ITPA 4XS2A 4TYGA 5CEMA 2Q83A 3AOXA 2P2HA 3KCFA 4Q5HA 3FPQA 3BYSA 3BZ3A 3EYGA 4D55A 4BWKA 3R1QA 4F0IA 5CAOA 5HHWA 3UIUA 5IG1A 4DH3A 5M4IA 3MTLA 2BHHA 5CEQA 3DBQA 3SW4A 4E26A 4L8MA 3DK6A 4FV7A 5GINE 4AZVA 3GNIB 2YIRA 4P5ZA 3ZBXA 5E90A 4A9RA 3BX5A 2BDJA 2IZTA 4BIDA 3OW3A 4BCMA 3C9WA 4F7JA 4YTFA 2Z60A 3I60A 4BCGA 2EB3A 5KMOA 3UNJA 4BN1A 3NMUF 3PVUA 4IZYA 4YTIA 3QQKA 2VWBA 4NJDA 4CCBA 2OJIA 4FI1A 5L2WA 3FY2A 2ITXA 4JX3A 4EKLA 3ZDUA 3C7QA 3Q3BA 3R00A 4FZAB 3U51A 1MQBA 2XKCA 3DT1A 3S00A 4JBOA 1W83A 1W0XC 4CZUA 3KU2A 5FGKA 4CQEA 5CF8A 5F9EA 2YACA 4N4SA 4OGRA 4UV0A 2YAAA 5CXZA 1A48A 4FVRA 4WO5A 4EK6A 4FV8A 4XP3A 4FKWA 5IA4A 5IPJA 5KBRA 4EH6A 1Z9XA 1NA7A 2XJ0A 2C5NA 2PVFA 1J1BA 4S2ZA 5DA3A 3R9HA 5KMNA 4ZMEA 4ASDA 4EJ7A 3DTWA 5HQ0A 3IW4A 5LQFA 4YZDA 3TG1A 3UOLA 3A61A 2E9VA 4F6SA 1OUKA 3NCZA 1ZZ2A 2JIUA 5H8EA 3H9FA 4FTJA 5K3YA 1J91A 1UWJA 5EM7A 2VAGA 4RJ8A 4Y73A 2IZSA 4GK3A 3EN5A 5AUTA 2FYSA 3FZSA 4YURA 3RPRA 5FXRA 4L67A 4BDKA 3FHIA 4L53A 4A7CA 2YWVA 3UVQA 5JFVA 2RFEA 4FNXA 2OZAA 2GDOA 2GS2A 4L46A 3AC5A 3TM0A 4X3FA 3QRJA 4QMNA 4ZSAA 4WRGA 2OGVA 3KRXA 4KB8A 4K0YA 5IA2A 3DY7A 4FT0A 3NUYA 3ID6C 3QGWA 4RPVA 1Y6BA 2F2CB 2WMAA 1IA8A 5HBEA 3VW8A 4BDDA 3V3VA 4A9TA 1IAJA 3DB6A 4UXLA 2E9UA 1TQMA 1FGKA 5HE1A 1Y57A 3DBCA 4PL3A 5AR8A 4ZXTA 4E1ZA 5IMXA 2CNUA 4ZS4A 4FOCA 5A3XA 5I9XA 4CSVA 3JVSA 5FQDC 1LPUA 3QD3A 2YISA 5CF6A 3RWQA 4AGUA 3SQQA 4AZSA 2XKFA 4II5A 3RNIA 4F7NA 4C59A 4XEYA 3DDPA 1ZMUA 4AU8A 3R0TA 4R6VA 5IDNA 3Q32A 3I79A 4BYIA 3QTQA 4ZY5A 4U79A 4H3BA 4M0ZA 4E20A 2BKZA 2J0LA 3C51A 5C9CA 1KUTA 4FNYA 1PXMA 2CKEA 3ZONA 3FZ1A 3LPBA 1P4OA 3ANRA 4RLLA 2XRUA 4RA5A 5JT2A 5KCVA 2PUPA 2R7BA 2X0GA 4ORKA 2O63A 5KMIA 2XBJA 3LM5A 3DB8A 3E3PA 3F6XA 3M2WA 1GZNA 1UNLA 5ETFA 3SXSA 3MWUA 4W8DA 3QQLA 4FSMA 5EYKA 1AD5A 2P4IA 3K54A 4FTTA 4EKKA 4NM7A 2WOUA 3D5XA 3UVRA 4A9YA 3PJ8A 4LQMA 1CKPA 3W55A 5CEPA 3LXPA 4UWYA 3ZO1A 3U6IA 3F7ZA 3KXXA 3R73A 3MYGA 4N6YA 5E8WA 3E7VA 5EH0A 3UODA 3UOKA 3OCBA 3VBWA 4DFNA 1CTPE 1YXSA 4IJ9A 4YZBA 3DK7A 5B7VA 3WI6A 1XJDA 3TJDA 5E8UA 1M17A 1NVRA 2QOOA 4TNDA 3IDBA 5LMAA 3HP5A 5DR6A 2R3LA 2B7AA 2BFXA 2XIZA 2PHKA 2Y4IB 2JD5A 2A4LA 4GK4A 5JH6A 1OIRA 3HMNA 4XV2A 4Z3VA 3QRKA 2C6OA 3VC4A 5EYDA 5EKNA 2XEYA 4FSZA 5A4TA 5M07A 3FLYA 2UUEA 3ZEPA 2ZMDA 3HVCA 1RDQE 5HD4A 1JSVA 4D4SA 3BE2A 3DDQA 5AR2A 1DAWA 3V5LA 4DG0E 4I5MA 1A9UA 4RJ6A 3OMVA 4QMPA 2WTKB 3L8VA 4HGEA 4I20A 4JQ8A 5HBHA 3S3IA 4CT1A 3BBTB 2E2BA 2E9PA 3TUDA 3PWDA 2VD5A 2FGIA 4J1RA 5HIBA 4O7WA 3BKBA 3E62A 5KHWA 3GU5A 2QHMA 4RIXB 3CC6A 3PPZA 3KRLA 3VUKA 3DJ5A 2QCSA 2H9VA 3F3UA 3HGKA 3UQCA 4RIYB 5FD2A 1J7IA 4AGDA 3NAXA 4BIEA 3NGAA 3QXPA 4XOYA 2PULA 5HCXA 4BCKA 4FNWA 5HZNA 4I41A 3PWYA 2YA9A 2BTRA 4D58A 3FXZA 2CSNA 2XK4A 5CI6A 5FRIA 2GTNA 2YJSA 3GBZA 3RAIA 3I7CA 1YDRE 2WAJA 2NP8A 2OF2A 4NW5A 5IQDA 4FTIA 4MNEA 4I3ZA 5CSVA 5AMNA 2C6MA 5EM5A 1A06A 2C0TA 1H1PA 1JVPP 4O1PA 3LFAA 4BZNA 2WMVA 4QPMA 3BE9A 3HV4A 1ERKA 4BHNA 4IZAA 3BYOA 2ONLA 2YHVA 2DQ7X 3LJ1A 3PY0A 1GIIA 2XP2A 2HXLA 1WBSA 5KMLA 3LMIA 2IPXA 3ZSGA 3Q60A 4OLIA 3FL5A 1PJKA 1PW2A 4WNKA 5K4IA 4CRLA 2GSFA 3BHYA 2VNYA 3FXWA 3OTUA 3ORPA 2C47A 3SA0A 3Q6WA 4FVQA 5C8MA 3C4FA 3TZMA 5ANEA 1JOWB 5C8KA 4OTGA 3IK3A 3WYXA 2QNJA 4FKIA 4AX8A 3R9OA 1WBVA 3O71A 4F08A 3RAHA 3QYWA 1SZMA 5E8VA 1PMEA 2R3OA 3D14A 3V5TA 4FSWA 3TZ8A 4O7VA 4P5QA 2IW6A 3CCNA 4HOKA 5J95A 3NZ0A 1V1KA 4BZDA 5AUXA 1UNHA 3C50A 2VNWA 5B2MA 2WMBA 2O64A 5EQYA 2Y4IC 3GOPA 5G6VA 2C6LA 3O7LD 1YWNA 4FZDB 3UIBA 4F9YA 4EJNA 4DC2A 4U40A 5DRBA 2WQMA 4JDKA 2W1HA 2VX1A 2ETMA 5AP2A 3FLSA 5IH5A 2Y6OA 2R3FA 3O8UA 1H0WA 3S0OA 5ANDA 3EQBA 3FMJA 3QQHA 4LV5A 4C57A 3E8CA 5CEKA 4BIBA 2ITVA 3PIYA 5IZFA 4Y83A 3OXIA 4IDTA 1PXLA 3BHUA 3FZRA 4TZRA 1OB3A 4EH5A 2JKKA 4OBQA 2O0UA 3AC4A 3PRFA 3SKCA 5HX6A 4RIWA 5A46A 3OP5A 5HD7A 3VNTA 5HTCA 2X8IA 3LCSA 4C0TA 3CPCA 1XR1A 4FIIA 1PKGA 2W4KA 3D94A 3FUPA 4HZSA 1VYWA 3ELJA 4WOVA 3N4TA 2PTKA 4GU9A 4MXCA 2UW8A 2XK7A 4C4FA 4F65A 4FKJA 3QYZA 3R71A 3LCKA 5HO7A 2QOBA 4K8AA 2RL5A 4D4YA 4HVIA 3LCOA 5KZ0A 2BKKA 3D83A 4L45A 5CSHA 5I3OA 2GNHA 2C30A 4NKSA 3R7VA 4BTFA 5A6OA 3ODZX 5CZHA 3VF8A 2PZRA 4WSYA 5CSXA 4CVAA 4AG8A 4IVBA 1OKZA 1W84A 4YNEA 4I4FA 5CWZA 4C37A 2B55A 5CANA 1T45A 2JIIA 3F2NA 4ZJJA 5E8SA 3TT0A 5J1WA 1OKVA 4EH9A 4D2PA 4C4HA 2F7XE 4FZ7A 2WTJA 3GEQA 3KEXA 5AA9A 2X7GA 2I40A 4Y95A 3SD0A 2RF9A 4CLJA 4CG8A 3Q53A 4A4XA 5J1VA 3PJ3A 4DT8A 2YDKA 2B54A 4MBLA 4NK9A 3RGFA 4DH1A 2IVTA 2R3QA 3UZPA 4XH6A 5I9YA 4EYJA 2R7IA 4AW1A 4B99A 4MWIA 4IW0A 4U43A 2WMTA 5BMSA 3BV2A 5CQWA 4V0GB 2YDIA 3RJCA 4BVUA 5HORA 3W2OA 1OGUA 1JKKA 2NPQA 3GUBA 4B4LA 4TKSA 4RVMA 5KE0A 2XNNA 2PY3A 2X8EA 3QLGA 3V8SA 3G5DA 4JIKA 3EIDA 2J0KA 4QP6A 3OF0A 4MTAA 4KKEA 4PWNA 5HNGA 2Z7QA 2UW0A 2OIQA 3KK9A 3QF9A 3T9IA 4ANNA 4E73A 4L52A 3AMYA 4CEGA 3ANQA 3EH9A 3UOHA 3U4UA 1MUOA 1PXIA 4BBFA 4DFXE 4CKRA 2QO7A 4FV6A 4EWQA 5LVNA 4J95A 1ZOHA 1QPCA 4FZ6A 3VWAA 4E5BA 3RK7A 2FSMX 2B53A 4FTMA 4EYMA 3ZFMA 5AV2A 4BY9E 5CU6A 1KOAA 3FLZA 3HKOA 5H8GA 4WG4A 3W2PA 4DGOA 3RZBA 4JVGA 3TJCA 3JYAA 5IEVA 2UZNA 2HZ4A 3MPAA 4ALUA 2VO6A 3ZH8A 4DT9A 2OIDA 2XVDA 4EQUA 4RX8A 4XCUA 2WMXA 5CY3A 2R3KA 2HK5A 2GQGA 2W5BA 3NNVA 1YDSE 3DAEA 3NUXA 3A62A 3GCQA 3OT3A 4PPCA 4DTKA 1DAYA 1WVYA 5BX0A 3QZIA 2WEIA 4EH3A 3W2CA 5DN3A 1GOLA 5EHOA 5CEIA 3C4EA 2B1PA 2OW3A 5I9UA 5HVKA 4OTDA 5DNRA 4QMOA 4GU6A 3KVXA 5IUHA 3TUBA 3OCGA 3U4WA 5GZAA 1KE7A 2GHGA 2IJMA 2R4BA 3HUBA 4FV9A 3UIMA 4UZDA 1OM1A 2BRBA 4RWJA 4BTKA 4IZ5A 3GT8A 4PUZA 3G15A 5TF9A 3TNPC 1H28A 3W2SA 2GFCA 4A06A 1Y8GA 4GFMA 2CKOA 2JAMA 2O3PA 1XH6A 4RC2A 3I81A 3D5UA 4XLVA 3ZUTA 3R1SA 4O27B 3HMMA 3R7OA 5EG3A 4ASXA 5HCYA 4QP7A 2WTWA 1UU7A 1ZYSA 3KMWA 1UNGA 4N6ZA 2HELA 4RIXA 2V7OA 3A2CA 4FG7A 4HPUE 3TI1A 2CLXA 3ZUVA 4G17A 2GTMA 4IAKA 4O7NA 1YXUA 3MTFA 3PZEA 4I6BA 5LCJA 4LGGA 2WGJA 2R3JA 4EQCA 3NCGA 4P2KA 2PE0A 5BVEA 2QOFA 3PP0A 3ZTXA 4APCA 1V0OA 4FTCA 1T46A 3GC8A 4X2KA 5A4QA 1YW2A 3LKMA 3RZFA 3C0GA 2A0CX 3UPZA 1WBTA 3JXWA 3G90X 1OVEA 4NSTA 4LRJA 4O91A 5CU4A 4ITJA 2HENA 5TKDA 5E8YA 3GU8A 5AP1A 3ZDIA 2WTVA 4YC8A 5LOHA 3TDWA 4RX9A 2R3RA 3W32A 4QTAA 3HV7A 4AA4A 1CMKE 5C01A 4XP2A 3ZFXA 2YIWA 2GQRA 3LFEA 2ETKA 2WQBA 2IZUA 4RG0A 3P1AA 4FF8A 5AX9A 2PU8A 5ETIA 5CX9A 3MVMA 3IS5A 4JQEA 5T68A 5HICA 1QMZA 4U41A 4HVHA 3BPRA 4FT5A 5D9HA 3DKFA 5L6OA 4YLLA 1U5QA 1CDKA 4IQ6A 4F1MA 3NNXA 4PMMA 4CV9A 4FR4A 4EOMA 4X2GA 4FEQA 4QT1A 2O2UA 1E9HA 3D0EA 4I0SA 2IW9A 1FOTA 3VBYA 3D15A 3E3BX 3PPKA 2PVJA 3L1SA 3WIGA 5D41A 1STCE 3BQRA 4UY9A 4R78A 2VO0A 5KKRC 4DF3A 3MH2A 2ZM1A 4CZYB 2IG7A 1OL2A 1HCKA 4G6LA 1UVRA 2BALA 2QG5A 3GOKA 3SG8A 5IQAA 5L2SA 5GZ9A 2CNVA 5DR9A 5IISA 4PPBA 1PXPA 3QD0A 2QI8A 5E91A 1JKTA 2OK1A 3H3CA 4GUBA 3TV6A 5CLPA 5JGDA 1OPJA 3QUPA 4QOXA 3PE2A 2VTQA 1LR4A 1X8BA 2YM3A 3A8XA 4CXAA 3ZLSA 1IRKA 1WVXA 1GZOA 4QMUA 3GU6A 4H1JA 2V62A 3KL8A 3ZYAA 1QPJA 4E7WA 4EK4A 3CLYA 4BGGA 1WZYA 2C68A 1REKA 2SRCA 2YEXA 1Z57A 3LJ2A 4LGDA 4R7IA 4WBOA 4XX9A 5ANJA 3TUCA 4NZWB 2YM6A 2Y7JA 3KXNA 3LCTA 3OWLA 4NM3A 2W1GA 4U45A 3VJOA 4FKPA 4JG7A 5AV1A 4GCJA 2PMLX 3C4XA 4DINA 3SC1A 5BVKA 4EOIA 4EZ3A 2ITOA 5DT0A 1YHSA 3PIZA 3IONA 5IQGA 2XF0A 2OG8A 3BYMA 4Z16A 4O2PA 4OTRA 4W4YA 2ZVAA 4C4GA 1J7UA 5I3RA 2A19B 5EI8A 1Q8TA 3MA6A 4LV8A 4GKHA 4IACA 3MY5A 4S30A 4U81A 2REIA 3EZRA 4WG3A 3QKKA 3EQHA 1ZYJA 3MFSA 4TL0A 5HO8A 2B9HA 5F20A 5EM6A 5C03A 2OH0E 4W4VA 3RHXA 3MY1A 3I0OA 3KN5A 3M11A 5ACKA 4EHZA 2HZNA 4A4LA 5JSMA 4GJ3A 3C1XA 4MHAA 2UZEA 2B0QA 3NPCA 4HVGA 1H07A 4M67A 1SVHA 4HNFA 3FKLA 2PVLA 4EH4A 4HYIA 3EQGA 3TXOA 4EI4A 3H9RA 2B9JA 2VWXA 2Y0AA 1L8TA 5C4KA 3L9MA 4MYGA 3R28A 5EK7A 4RGJA 2IVUA 5EFQA 2WELA 3WE4A 3P7AA 1UWHA 4LUDA 3MFRA 2CGVA 4O22A 5KMKA 5KMJA 4D4RA 5HE2A 3ZC6A 2VGPA 2BAKA 4FV5A 4PNIA 3EQIA 2CMWA 2HWPA 2YDJA 3GFEA 4HYHA 3U9CA 3FKOA 1PF8A 2XYUA 4XG7A 4V0GA 2GCDA 1MRYA 3QTSA 2C69A 5CTPA 2BZJA 1GY3A 1WVWA 3EYHA 3PLAE 2GS7A 4E6AA 2QONA 4PY1A 4KAOA 2R3MA 2OXYA 4P4CA 2HOGA 4WNPA 4BICA 5JEBA 2EU9A 2C6TA 4FKUA 2OKRA 1O6LA 2C5OA 2PK9A 3BV3A 4FV3A 4OR5A 2W1ZA 1OIYA 4O0VA 4CT2A 4Z55A 3BCEA 2V55A 4DCEA 2Y8OA 3IGGA 5AIRA 3ZXTA 3UBDA 4L7FA 5AAGA 4UX9A 1H24A 3ORTA 2I1MA 5A14A 4EOPA 2JKOA 5JZJA 3A7HA 2RSVA 4PF4A 3FQHA 4J7BA 2BROA 4MKCA 3I1AA 2B4SB 4ANMA 3F3VA 4X6QC 3E8DA 4XMOA 2OICA 1HCLA 3EKNA 3LFSA 4NL0A 2WHBA 3HRFA 5ANGA 4QMLA 3SLSA 2R0IA 5DWRA 4AXAA 3UO5A 2R3PA 5EDRA 4C38A 2QO9A 4K1BA 4LGHA 3FMDA 2AC3A 4USFA 4K11A 5IQIA 4FC0A 3QFVA 1TVOA 3FJQE 3MV5A 2FSOX 5AAFA 3ATTA 3NAYA 5FDPA 1IAHA 3RK5A 5DE2A 3Q9YA 4FT3A 5KX8A 4WG5A 2DUVA 3FC1X 5GIPE 4QMSA 4LYNA 4DFBA 3MH0A 3UJGA 2AYPA 1FVTA 2WMSA 4I5CA 5L3AA 2XNEA 4FKSA 2FA2A 2XH5A 5EDQA 3MS9A 3IW5A 4H3QA 3TNIA 1M2RA 2YCFA 1XH7A 1FQ1B 2YLEA 2YM4A 3PJCA 4CZTA 3DXQA 4FTAA 3G0EA 2FSTX 4GUEA 4XJ0A 4RX7A 4ID7A 3DJ6A 3KY2A 3R1NA 1WCCA 4YJNA 4RX5A 3KRRA 3VO3A 2XK3A 1ZYLA 3C0IA 3H9OA 1YXVA 5AIKA 2VWUA 2QKWB 4DCAA 5DFPA 5DBXA 1BMKA 1FVVA 3JVRA 4MBJA 3V5WA 4U5JA 5JFWA 2HYYA 4FZFB 4S31A 1U5RA 4UYNA 3D7ZA 4ZP5A 3TN8A 3ULZA 3KB7A 4E6DA 3E8NA 4HGSA 5TR6A 2WOTA 4FEWA 4F70A 3HP2A 2JITA 1WAKA 1M7NA 3PXZA 4Y5QA 4YTHA 5KBQA 5HIDA 3KMUA 4O0RA 4E4XA 4H1MA 4QNAA 3AD5A 3F9NA 4ZLYA 3ORIA 3OXZA 4JT3A 3TZ7A 4R5YA 4E6QA 3UIXA 3O23A 5AP7A 4AE6A 4B8LA 2OIBA 3RKBA 4LMUA 4LFIA 4NCTC 3W1FA 4ZTRA 5IQHA 3LHJA 4WA9A 5L8JA 3MPMA 5K5XA 3QX2A 4JIAA 4KABA 4FTRA 3EOCA 4GIHA 3I0QA 4IAAA 4ZTMA 1UV5A 3IECA 3DZOA 3V5JA 3BEGA 2C1BA 4DH5A 1GIJA 5EM8A 3OTVA 2JKMA 3WILA 5J7HA 1XO2B 4IWOA 4AAAA 4FOBA 4TTHB 4ZTNA 4D2VA 3PVGA 4AF3A 4FSUA 5E4HA 3VBVA 4RFMA 3AMAA 2G1TA 2G2IA 3JY9A 4DAWA 1P5EA 4O2ZA 2YAKA 3H0ZA 4JRNA 4KWPA 1V0BA 4L00A 3N4UA 4DTAA 4FTUA 5LVOA 3QQGA 4UB7A 4YR8A 3TL8A 2CGXA 1Y91A 4NWMA 4YZ9A 3IPHA 1PXNA 3VW6A 1BI8A 2WFYA 3ZBFA 4O6LA 3Q4CA 5GJFA 4IC7A 3I5ZA 2UW9A 2X7OA 1BL6A 2WD1A 4KRDA 5CT7A 4CFXA 4YGAA 1R0PA 4J53A 4QQCA 4X6RA 4F9BA 3WF6A 1JQHA 4GFOA 3WZJA 1H27A 3R63A 3E5AA 4QP4A 5LXMA 1WBWA 3ZRLA 2PMIA 5HNBA 3UO6A 3PYYA 2VZ6A 3HECA 5LVLA 4F09A 4BCPA 4BL1A 3FZPA 5BYZA 4IEBA 5D7VA 2QR8A 2ITWA 5BUEA 1Q8ZA 2PZ5A 3V51A 3AT2A 2WMRA 3WF8A 4FEVA 4JRVA 4C8BA 1FINA 3S95A 3F5UA 3IOKA 1W82A 2YIQA 3NIEA 5F4NA 3ZSHA 3KN6A 3PJ1A 2WQOA 4G6OA 4ARKA 3MSSA 4O6EA 1ZMWA 1ZRZA 2OJ9A 3NYOA 5EHLA 1G8AA 4AWIA 4J99A 3KF7A 2R0UA 1FMKA 4JDIA 1H1QA 4M66A 3PXFA 2VTIA 3LVPA 5EW3A 4A4OA 4HCUA 3R01A 5DPVA 4ACDA 2Q0BA 4FA2A 3QQFA 3KQ7A 4CV8A 1I44A 4IMYA 4QP8A 3MW1A 4XG3A 3DNDA 1DI8A 3WZDA 2WIPA 4ZZMA 4EBWA 5CALA 3KXGA 4FE2A 3OEFX 5CF4A 5HE3A 3UQFA 2W1IA 4U80A 1LEWA 2CKQA 3ZOSA 3AD4A 1UKHA 4CMUA 2VWZA 3FQEA 5A4CA 3ALOA 2JDTA 3QQUA 4UMTA 1LP4A 3TZ9A 5DVRA 3VS2A 5CSPA 3JS2A 4O0WA 4A07A 4KSPA 5DOSA 2XCKA 4DFLA 4ZLOA 4XLIA 4H39A 5M51A 4PX6A 2UZVA 3DFCB 3HRCA 3HDNA 4YJTA 4YJVA 5ANOA 3UNKA 5AJQA 2IWIA 3HMOA 3ZZEA 2JEDA 3U55A 1H8FA 4TXCA 2X1NA 4FYNA 5J5TA 3E92A 3FL4A 3G2FA 3RBWA 1QPEA 1KWPA 4PTCA 3EMGA 3VF9A 4FIGA 4NTTA 3KRWA 3LFBA 3ENHA 1GJOA 3KXHA 4IX5A 2G2FA 5CU3A 3V8TA 2BRNA 1XBAA 4EHVA 1Q5KA 4ZMFA 2VWWA 3CJGA 3VS7A 1YRPA 2ZAZA 3MB7A 4OTFA 4PL5A 3EQFA 4M13A 5K0XA 4FKOA 2ITZA 4KIQA 5T3QA 3UGCA 3AT3A 4IX3A 5JN2A 4KBCA 4D1SA 5AP6A 3LFCA 4IADA 4X3FB 5HGIA 2W17A 3A4OX 5BQ0A 4XV1A 4P7EA 4FSQA 4HCTA 4RLKA 3COHA 4ANQA 4YZCA 5J9LA 3ZRKA 3IDCA 4IX6A 3NVMB 3R04A 1PXOA 4RQKA 3WF9A 5BUIA 4IAFA 4G3GA 4AZEA 4AT5A 1U4DA 4ZTLA 2VTAA 2CN5A 3FYKX 4QO9A 5HNIX 4JG8A 3R9RA 1Q3WA 3O17A 4IM0A 4AOJA 3MIAA 4F1OA 4O0XA 1GZKA 4CFUA 3FV8A 3U9NA 3F5PA 1M52A 4IVAA 2XNBA 2W1CA 4AW5A 5FUTA 4EOQA 4N70A 3CQWA 4OTHA 5H8BA 3KKVA 3F61A 4BKYA 3MVHA 4BDHA 4KBAA 3EJ1A 2H6DA 3UDBA 3TKUA 3ORZA 4YC3A 1GIHA 4I92A 4IHPA 2OJFE 4BWXA 3I6WA 3K3JA 4ITHA 4MEDA 3IKAA 3LQ8A 3TIZA 3BWJA 5BVNA 3GGFA 5HIEA 2EUFB 3PA5A 4AZFA 3QRTA 3DFAA 3OW4A 2C0OA 3PTGA 2J0JA 4I0TA 4IM3A 4R1VA 4WNMA 3T8OA 4F6UA 3GC7A 3FMLA 1DM2A 1U46A 5DRDA 3OZ6A 4NH1A 5CVHA 3PVBA 3H0YA 4D2SA 5C1QB 3TIYA 2XNMA 2CGUA 4CFWA 3NR9A 4MAOA 2VTHA 4FL1A 3R1YA 4UZHA 4FIJA 3JR1A 3IOPA 4M69B 1OECA 3EZVA 1OIQA 4HPTE 5GNKA 4EH2A 3LFDA 3W2RA 5E92A 4CFNA 4M0YA 5ANIA 3HYHA 4G3FA 4FYOA 3D2IA 3BU6A 1H26A 3EFKA 3FZTA 3GQLA 1UU3A 4FTKA 4I21A 2VTJA 4YZNA 4TN6A 2PVYA 4XG4A 4E6CA 2PUNA 4V05A 4AE9A 4NYEA 4O81A 3P78A 3WARA 4JDJA 1JKLA 4NUSA 4OTPA 4OT6A 4JG6A 3UG2A 4IDVA 4FIFA 4I0RA 3T9TA 4F0GA 2FSLX 3LQ3A 1UU9A 4WHZA 4FKQA 4JBVA 4KNBA 4ZZNA 1H00A 4XRJA 2CN8A 4FG9A 1OPLA 3SRVB 3UNZA 4FKLA 4ACCA 4PV0A 3EQRA 2VX0A 3Q6UA 4N57A 3PSBA 4EOJA 3LXLA 2X9EA 3AQVA 1OPKA 3MPTA 5EQEA 1YHVA 2QU5A 1NT2A 4BYJA 5JGBA 3OY1A 5CI7A 4C02A 2J4ZA 2QOQA 5I9VA 1VZOA 4OW8A 1IEPA 3COIA 3NW5A 4WRSA 3OWJA 2VGOA 4FX3A 3VJNA 5IU2A 3QTUA 4HNIA 2VU3A 1AQ1A 3FZOA 3BGPA 2ZV7A 5AEPA 3UZTA 4I94A 2RFNA 3BLRA 5IQEA 4FUXA 3PG1A 4YLJA 4IE9A 5HTBA 4FEXA 2QODA 3QCXA 4Z9LA 2X2KA 3C4CA 3NVKI 5IEXA 4IXPA 3O7LB 2RG5A 2WQNA 3TKHA 3D7TB 4U9AA 5AV4A 1J7LA 1BUHA 5CYIA 3ZLXA 5IA5A 2PSQA 4XG8A 3KREA 3E8EA 3MH3A 4TPTA 4FODA 2A1AB 3IGOA 4JOAA 5AP5A 5IA1A 2QLQA 3CSVA 3NEWA 1JWHA 4R3PA 4XBRA 5FP5A 4BKJA 3DCVA 3VHKA 4AT4A 2PZYA 4QMYA 4Y72A 4XNEA 3RPSA 3F3ZA 2BMCA 5DT3A 4PP7A 4J97A 3HNGA 3KXMA 4QMWA 3POZA 5AV0A 5HLWA 2WMWA 3VIDA 3ATSA 1OBGA 1B38A 1H1RA 3EB0A 3CS9A 2GQSA 2OFVA 3R8UA 5FDXA 5ETAA 3ITZA 2YM7A 1O6KA 3RP9A 3MGYA 4F9AA 1YOMA 3SG9A 4KD1A 3QBNA 5AWMA 1MRVA 2IN6A 2B52A 2JLDA 5AP4A 1RE8A 4TYIA 2YWPA 2VN9A 3AC1A 4BHZA 2OJJA 4IFCA 3UOJA 5M55A 4ENXA 2QHNA 3B2TA 4Y5HA 1PXKA 3SXFA 4DFZE 2WTCA 3G6GA 3A99A 1OL5A 5CVFA 1TQPA 2ERZE 3Q4UA 1EH4A 3LIJA 4O82A 4IB1A 2X81A 2PVNA 4W9XA 3F69A 3G0FA 2UZUE 3WYYA 5D12A 1H0VA 5M44A 3Q9WA 5CVGA 1H1WA 4LM5A 4O84A 2ZV2A 3SX9A 4YU2A 4GT3A 3WF7A 5FWKK 2WKMA 2UZOA 4KRCA 4NIFA 4DBNA 4JR7A 4O83A 2AC5A 4BGQA 4FTLA 3R22A 4D2RA 2VTOA 4F4PA 5LJJA 3CQEA 4WIHA 1IA9A 2QC6A 3BEAA 3RAKA 4FICA 2PVMA 3VULA 4GK2A 4OUCA 3PXKA 3QGYA 3HUCA 3EFJA 3PRIA 2ETRA 4YBKA 5LMKC 4BTMA 4WT6A 4BR3A 3SW7A 3BYUA 3KC3A 4IM2A 4ALVA 1JSTA 2J90A 2JDOA 4W4WA 4FBXA 4Z7GA 3MVLA 3NUSA 5IA3A 3E63A 1ZZLA 4HVSA 4XBUA 2NRUA 4F1TA 5EHYA 3AGMA 3OY3A 4UWBA 3W33A 3F82A 3DS6A 3CD3A 3EFWA 5HKMA 4B6LA 3MVJA 3TWJA 3HV3A 4LOQA 3SAYA 4XOZA 2PZPA 2VTMA 1R1WA 2GHLA 3PUPA 3PY1A 4QD6A 4ANOA 1K3AA 2ZB1A 3RTPA 2ITUA 3GP0A 5EYMA 4Y8DA 1WMKA 2YFXA 4GV1A 4O0SA 1P4FA 1H25A 3NWWA 4QQTA 4BCIA 4X2FA 1ZOGA 5AR3A 3QXOA 4AZTA 2ITTA 4TRLA 3EL7A 4AS0A 4MD9E 4QP2A 1YXTA 3FLWA 4JR3A 3M42A 1XH4A 2W99B 3DK3A 3HA8A 3FEGA 2JDSA 4IVDA 4W4XA 3FHRA 3B8RA 3DKCA 4GG5A 4NCTA 4R3CA 1ZLTA 2QKRA 4JL9A 4EL9A 1G5SA 4ZTQA 2RGPA 5I0BA 2R64A 2Y9QA 3PXYA 3UO4A 3BGZA 3PA4A 3F88A 3VBQA 3NYXA 3QLFA 4QYEA 5JFSA 2XUUA 3FMHA 1SNXA 3C13A 4YLKA 3GENA 3ZXZA 5IQBA 4RWKA 5HEZA 4YTCA 2VUWA 5DH3A 2YM5A 2GHMA 2J5EA 3Q52A 4W9WA 4YJRA 3VBTA 4YNOA 2B9IA 4ACGA 4CYIA 3R7UA 4CKJA 4BDEA 3OWKA 3A4PA 1K2PA 3NW7A 4X7QA 1U54A 2WPAA 4MQ2A 2H34A 1XH8A 3MH1A 4EWHA 4M97A 3CBLA 3HAVA 2DWBA 4RT7A 2KULA 2ZYBA 4Q2AA 5C8NA 1VJYA 4DGNA 2GU8A 2ITNA 4RZVA 4RIOA 2JGZA 2WMUA 4JQ7A 4XG9A 3GCSA 3W10A 5BVDA 3BQCA 3GI3A 5L2QA 4H36A 2HXQA 4D0XA 5IF1A 2F9GA 4PQNA 4ANLA 2W0JA 4U8ZA 4DEEA 4O7TA 3OVVA 5IDPA 2C3LA 3R6XA 1KE5A 1HOWA 1TQIA 5AUVA 4ASEA 4ERWA 3IW7A 4YJQA 2YCRA 4M84A 1F5QA 4O0UA 3L8PA 4PPAA 4HGLA 1SYKA 3KK8A 2JDVA 2PWLA 4ERKA 4EOLA 3PSCA 3PIXA 4NFMA 4AOTA 5J79A 4Q9ZA 4J8NA 4IC8A 3KGAA 1B39A 4ALWA 3LQ5A 2GNGA 4BCJA 3KVWA 1M14A 3ENMA 3OD6X 3RHKA 2EXCX 3GCVA 5T6KA 3ZU7A 5A4EA 3DLZA 3OOGA 2QG7A 4EC8A 4K77A 5DI1A 3MIYA 3FE3A 4EH8A 4ENYA 4O7RA 4RFYA 1ZYCA 3OT8A 4NM5A 1YI6A 1GZ8A 3F7WA 1YHWA 3NLBA 3UP2A 3UZRA 4QQ5A 5BVWA 4USDA 2UW3A 4AA0A 4G31A 4RJ7A 4AW0A 3UPXA 2XIYA 1Z5MA 5ACBC 4EUTA 5E8TA 4QTEA 3R8PA 5GJDA 4JAJA 3HRBA 1ZY4A 5GZ8A 5EOBA 2QD9A 3R02A 4QYFA 3E93A 2F7ZE 4MF0A 4AT3A 4OTQA 4DHFA 4E4LA 3CE3A 4G9CA 4RWLA 4I22A 4D0WA 2EVAA 2HZ0A 4I93A 4M15A 4F99A 1URCA 3SGCA 2RG6A 5FBNC 3DQXA 2W5HA 2QVSE 5BYYA 1IG1A 2ACXA 4C4EA 5JGAA 4FUYA 4QMVA 5E7RA 2P2IA 5C27A 3FMEA 4LOOA 4ITIA 2WTDA 3CD8A 4EK3A 3PP1A 4L9IA 2O5KA 4ACHA 4LOPA 4FV1A 3VVHA 4EORA 4ZEGA 4B8MA 4L43A 3ET7A 4FIHA 2GPHA 2ONLC 5GHVA 3F2RA 4ZJVA 3QCSA 4FL3A 3R2BA 3R8ZA 4MBIA 3BLQA 4F9WA 3FPMA 4ACMA 1CKIA 5K4JA 4C3RA 2WU6A 1XBBA 5EW9A 2BHEA 5M57A 4O7SA 4DFUA 2FO0A 3H10A 5FEQA 4IJPA 3PXRA 3FQSA 3QHRA 4DH7A 3W2QA 3Q04A 5D10A 5M4CA 2UW5A 3UVPA 3RNYA 2CDZA 4OBOA 2PMNX 4FG8A 4CG9A 2XK6A 1OMWA 4NT4A 3ETAA 2XB7A 3EHAA 4FV2A 2QO2A 3WZEA 3LMHA 3C5IA 3U87A 3V01A 1S9JA 1KV2A 1BLXA 2O65A 2P33A 4PRJA 2PE1A 4HJOA 4YPDA 2Y6MA 3ZFYA 4E5WA 4RRVA 3F3TA 4G3CA 3NX8A 4H3PA 4GMYA 4LRKA 4CYJA 2ERKA 5L4QA 4ZLZA 4GFGA 2X39A 4DEIA 4R77A 4KIPA 3I5NA 3MA3A 3QD2B 3SV0A 3A7JA 1ZXEA 4BRXA 2C0IA 1Q97A 2GMXA 4FEUA 4BDIA 3N51A 3BHTA 4GSBA 3O50A 5AUUA 5L8KA 2W05A 3PE1A 3UE4A 2GNFA 4MK0A 4DGMA 5ITAA 4MD8E 4GT5A 2QOCA 2EXMA 2HCKA 3T3VA 1R0EA 3QUDA 4FV4A 1NW1A 2C6DA 2A2AA 2KTYA 3BHVA 5AA8A 4MD7E 5FEEA 4E5AX 1ZWSA 2JKQA 1J3HA 1Q62A 1NXKA 4FSRA 1AGWA 3LW0A 4X3JA 4EBVA 4AP7A 3KCKA 3VBXA 1UKIA 3BRBA 5AR7A 4O0TA 4ZSLA 1F3MC 5AAEA 3ACJA 2V22A 5HX8A 1KOBA 4MXOA 1M7QA 3C4WA 5FLFA 1QCFA 3OEZA 2YZLA 1ZMVA 4YJUA 3TNHA 2WMQA 3D7TA 3RCDA 2JBPA 5AADA 3QAME 2IW8A 4KBKA 4D4VA 4IFGA 3QTRA 4B9DA 3Q4ZA 4BI0A 2ZJWA 4KKHA 1R39A 2RIOA 2WNTA 4G3EA 3VS0A 3B2WA 3EQPA 1OKWA 3VUGA 4B0GA 4D2WA 2PE2A 5ICPA 3EKKA 4FIEA 4DH8A 3DBDA 4MF1A 2QOLA 3ORKA 2VTPA 5E9EA 1URWA 2FB8A 2UVXA 3E87A 3QTIA 3QZFA 5HG9A 4MXAA 2CCHA 2YABA 3CGOA 2LAVA 2VO3A 3KRJA 5GJGA 4UMRA 2GNLA 4F6WA 3U54A 3QTZA 3OOMA 2J51A 4KUJA 3F2AA 3Q5IA 1PMUA 2XYNA 4FL2A 4IZ7A 3BWFA 4RVTA 5IUGA 5JRQA 4IAZA 4ZS0A 4E3CA 4CMTA 4ASZA 4O7ZA 3VUHA 1PYEA 5AR4A 2C3KA 3V6SA 3EN4A 5FBOA 1DI9A 1WBNA 4ANBA 4Q9SA 3OFMA 3RPYA 3QTXA 4F7LA 2QOKA 3AD6A 3VQHA 1R78A 2ZOQA 4HVDA 1JSUA 4GVJA 5D1JA 4GJ2A 4ZK5A 3SHEA 4DEBA 3PG3A 2C6IA 3U8WA 4UEUA 2OJGA 4KKGA 4AQCA 2XNPA 2Z7RA 3UMXA 4M14A 1B6CB 5HE0A 4BDFA 2OZAB 4ZSJA 1W8CA 1SM2A 5EI2A 4JJRA 4CFMA 4RVKA 3TTIA 2BPMA 2J0MB 2C5VA 2C3IB 2QR7A 5GIOE 2Z7SA 4J52A 4X2JA 4UMPA 3OG7A 1YI3A 3QCYA 4CCUA 2P55A 1MP8A 5DYJA 2J9MA 5I9ZA 3QKMA 3B8QA 3CPBA 3QWJA 4FV0A 4MVFA 3TKIA 5CASA 5KKRB 3UP7A 2WXVA 4IAIA 2E9OA 1KSWA 3R7GA 1OL1A 2PZIA 2LGCA 1FMOE 3MI9A 3HDMA 5DG5A 4D1ZA 3FC2A 4QQJA 3QZHA 1G8SA 2W4JA 3W8LA 4G2FA 3LFFA 4PMSA 1FBNA 4C61A 1WBOA 5EKOA 4L01A 4L3PA 2VWIA 2YCQA 2C1AA 3LXKA 1KV1A 4PMTA 3ORNA 4ZIMA 5JQ5A 4RFZA 2BZKB 5AM6A 3NSZA 4IVCA 1PXJA 3OBJA 4JBQA 3CEKA 5F94A 2V7AA 1JBPE 4B7TA 4IB5A 2NO3A 2CJMA 4U3ZA 5HU9A 4W8EA 4X0MA 5A6NA 4G9RA 4MNFA 4AN3A 4AN2A 1R3CA 5BNJA 3OCSA 4XUFA 5J9YA 1IR3A 1W98A 4C3FA 4E4MA 3OHTA 4CD0A 2HW6A 2OU7A 1SMHA 5IKWA 2ESMA 2JBOA 4M7IA 3R2YA 5L6WL 3IO7A 4MXYA 5LMKA 3HMPA 4BKZA 4QPSA 2YIYA 2Z8CA 3HL7A 4KIKA 3PDTA 2XK8A 4JDHA 3W16A 4YJSA 4DEGA 2NNWB 5HOAA 4EQMA 5AUZA 4XV3A 3ZUUA 3UMWA 1VEBA 4BF2A 2XIKA 2ZDUA 2I7QA 4DLJA 2C6KA 1YQJA 2W96B 3CTQA 4RBLA 2WU7A 2X6EA 4K33A 4CNHA 5HCZA 1H01A 3SDJA 3FMNA 5JZNA 3D9VA 1H4LA 4PTEA 1PHKA 3OWPA 2WQEA 4S32A 4I5HA 2R3IA 1K9AA 4QTDA 3IDPA 3OROA 4R8QA 4DN5A 3LOKA 1Q99A 2VTLA 3QKLA 5JK3A 3NYNA 2R5TA 4G1WA 4QTBA 3ROCA 3QRUA 5CNNA 3QZGA 4FNZA 1YOLA 4QRCA 1YI4A 5FXSA 1U54B 4DEHA 5DMZA 5M06A 3VS4A 4FSNA 1YDTE 5CZIA 2C5YA 3HV5A 2XNOA 5D7AA 2W9FB 5M4UA 2NRYA 2XJ1A 2QLUA 3KULA 2WIHA 2OXDA 3POOA 3VUTA 3BELA 3K2LA 1PY5A 4RJ3A 4DLIA 3IW6A 3D5VA 3OC1A 4P90A 3IG7A 1LUFA 3JY0A 5B0XA 3FI3A 2F4JA 3PLSA 3F3WA 2RFDA 4JBPA 4ZSGA 4D5KA 2X9FA 5J87A 1CSNA 2BAJA 3CJFA 3GCUA 4L3LA 5CSWA 3ZLYA 5J9ZA 4C62A 4M8TA 5L2IA 1RW8A 1SVEA 3DTCA 1IASA 1KE9A 4EONA 3NUUA 2VWVA 4TWOA 5HG5A 3V8WA 3WF5A 4LUEA 4AN9A 3R7EA 5HU3A 5E1SA 5CAUA 1O9UA 4FK3A 4DGLC 4O7YA 2PPQA 4QMZA 4EEVA 2PYWA 3A8WA 4BWPA 3E7OA 5B2LA 2FVDA 5FEDA 4LL0A 3R8VA 3D5WA 4HW7A 4CTBA 2QQ7A 3HMIA 2I6LA 1JAMA 4IWDA 4FGRA 4DA5A 4BI2A 3AT4A 3K5VA 3IQ7A 5IMEA 1JKSA 2BZIB 3HX4A 3I4BA 3P08A 4UALA 3A7FA 3LLTA 4NW6A 5HTIA 4QTCA 3WIKA 2HAKA 4AFEA 4MXXA 3EFLA 4C58A 2VTSA 4YSMA 3V6RA 2UZWE 5FP6A 1PRYA 2I0VA 3C5UA 4FTNA 3UC4A 3IW8A 3QL8A 3PPJA 2QU6A 2XK9A 3TCPA 3JUHA 4RQVA 3A60A 3D4QA 4G5JA 4X21A 4DBXA 4FMQA 4DE4A 2AUHA 4CTCA 3K5UA 2YJRA 2J6MA 2VV9A 3THBA 5JQ8A 2XS0A 2JIVA 2UV2A 4RMZA 5DR2A 4BCOA 4KS7A 4L44A 1Q8WA 1QL6A 3NUNA 4FT7A 4L42A 5HI2A 3FY0A 3AC2A 2O8YA 3VUDA 4ZY4A 4IB3A 1ZOEA 4G3DA 5FXQA 1PMVA 4F7SA 2HWOA 4M69A 2XIXA 1Y6AA 3AC3A 4YC6A 4OAVB 4AUAA 4QYGA 5JRSA 4QP3A 3W8QA 5CQUA 5IUIA 4DGGA 2W1DA 4TYHA 2Q0NA 4NFNA 2WTIA 2BUJA 4GH2A 4GYGA 5M4FA 1P14A 1CKJA 5CS6A 2BTSA 2IO6A 4X2NA 4AFJA 3O51A 5D11A 4D1XA 5FM3A 3S2PA 2BIKB 5A4LA 3WE8A 2J50A 3CKWA 3VS3A 1P2AA 4TYJA 2RKUA 5E1EA 1MRUA 2J2IB 5HLPA 1YOJA 4RC4A 3PVWA 2CGWA 2BCJA 3S1HA 3FWQA 4G5PA 2J5FA 3AXWA 5DT4A 1Q8YA 3DAJA 4KIOA 4FKRA 2C3JA 4LG4A 3CP9A 4Q5EA 4KS8A 3E64A 3SOAA 3NUPA 3DBFA 4K6ZA 4JXFA 4TWNA 5CXHA 4YUQA 1ZARA 3BI6A 1PKDA 3QCQA 2H8HA 4QMQA 3HLLA 3RM7A 2W1EA 4HYSA 1BYGA 3BIZA 3VHEA 5BPYA 3L9LA 2JC6A 4APPA 3FI4A 3EN7A 4DG3E 4H05A 4YHFA 2IVVA 4FTQA 5IA0A 1Q41A 3RALA 3TTJA 5C26A 5L2TA 4BCFA 1WFCA 3VS6A 4DFYA 1XBCA 4A9UA 4R7HA 4U42A 4RZWA 4BDAA 3DLSA 2HIWA 4BDCA 2ZV8A 4LMNA 1APME 5BYLA 2X6DA 4Y46A 1S9IA 3AGLA 3O0GA 3PJ2A 4PDOA 4AGWA 4F64A 5A9UA 3MFUA 4RJ5A 2I0EA 3TACA 1ATPE 3V5QA 3RINA 4CKIA 4Y85A 2B9FA 4C36A 3PA3A 4I23A 4JX7A 1I09A 3P5KA 3QWKA 3Q5ZA 1BI7A 5HVYA 4U3YA 4C2VA 3HV6A 4S34A 4BC6A 4CFVA 1ZYDA 2OH4A 5M56A 5C4LA 3MB6A 3II5A 1KE8A 4C4JA 2BFYA 2BIYA 4KINA 4BB4A 3L8XA 4CQGA 4F63A 4H58A 3V5PA 4GS6A 5FTGA 3MDYA 4GKIA 2UW7A 2X2MA 4EHEA 3SVVA 3WOWA 4OT5A 2EWAA 3DBEA 3DXPA 2PL0A 1OL6A 4RWIA 3MJ2A 4EHGA 3P4KA 4ZOGA 4BCNA 4GIIA 2ZV9A 5AUYA 2W7XA 3Q4TA 4UWCA 4GL9A 5AP0A 4JS8A 4XG6A 1VYZA 4XP0A 2ZDTA 3PSDA 3TV4A 3GFWA 4YBJA 4GVAA 3ZO4A 3KFAA 2WZJA 3ORMA 2X2LA 4V01A 2GFSA 4TNBA 1LEZA 5L8LA 3P79A 3COKA 4IH8A 3VS5A 2XRWA 5FG8A 4EOKA 4IWPA 3RAWA 4C2WA 4AZWA 4GRBA 4MX9A 5TO8A 1BL7A 4KA3A 2F49A 4QMTA 2W1FA 3CQUA 3REPA 1FVRA 2W4OA 3EL8A 3DJ7A 3TDVA 4BI1A 3MFTA 4ANSA 3GU7A 4E4NA 4EZ7A 4WUAA 4ZY6A 2Z7LA 1BKXA 3I6UA 4TY1A 4PTGA 4I5PA 3H4JA 4RIWB 2GS6A 2XJ2A 1M2PA 3R7IA 2WO6A 4FGBA 5KZIA 5BVFA 5JMSA 4QYHA 3RPOA 4O38A 3DA6A 2R3HA 4M3QA 5HG8A 5EYCA 3QC9A 4PNKA 4TT7A 4NU1A 2XKEA 1ZY5A 2PUIA 3NW6A 1BX6A 1NVSA 3ALNA 1UA2A 4MH7A 3DPKA 4IAYA 5ANKA 4FK6A 5CENA 3O96A 2BDFA 3MJ1A 4QP9A 3FBVA 4I6FA 4QPAA 3BHHA 3O2MA 3NYVA 2CLQA 4EUUA 5KHXA 4EOSA 2ZMCA 4IBMA 4USEA 2XM8A 5M53A 3R8LA 3ZMMA 4KIKB 4RC3A 4YMJA 5L6PA 3VN9A 3Q96A 3P86A 4QMMA 1J1CA 4GW8A 3KF4A 5AM7A 4KSQA 4O96A 4UBAA 1M2QA 4R5SA 4QMXA 5CAPA 3LAUA 3TNWA 4BCQA 2BZHB 4JI9A 3LFQA 2G2HA 3AG9A 3G6HA 4UXQA 3LCDA 5EOLA 3R9NA 3ZSIA 4E93A 3FYJX 1JPAA 3GCPA 4YHJA 1OI9A 5K5NA 1YKRA 4MWHA 2HW7A 2X7FA 2BVAA 3RMFA 4BDBA 4ZJIA 2Z2WA 5CU2A 4J71A 3NUAA 3MESA 2OO8X 2P0CA 4BBEA 4NJ3A 5LARA 3BYVA 3NDMA 3SXRA 2CNQA 4I1ZA 4YJOA 5J7BA 5KO1A 5IQFA 3QD4A 4IIRA 3PFQA 4G34A 4S33A 3RM6A 4J96A 4LRMA 5TT7A 5FM2A 4O21A 3QX4A 4X3FC 1XQZA 2ZM3A 3FMMA 3LJ0A 2BDWA 4D9UA 4BDJA 5HG7A 1JLUE 3ZHPC 2X4FA 4XV9A 4YZMA 3VRYA 5DHJA 3PZHA 4U44A 3QALE 4D5HA 1OZ1A 3VQUA 4D28A 3G33A 3ZC5A 4O86A 3ZS5A 4JLCA 2UZTA 3VUIA 2G15A 3A7IA 3WZUA 4L68A 1XH5A 5DIAA 1WBPA 4K9YA 1Q61A
chains in the Genus database with same CATH superfamily
2V5QA 3ML1A 3Q2JA 3VS1A 3MN3A 2R3NA 1YWRA 1FPUA 2PVRA 1MQ4A 1KE6A 2BAQA 4MCVA 2JAVA 2G01A 3L9NA 2UZDA 3GXLA 1H08A 4WSQA 3R7YA 3W18A 4CMOA 4DITA 4EZ5A 2G9XA 4UMQA 3CXWA 1QPDA 2UW6A 3TMOA 5IH6A 4O7LA 5K9IA 5B2KA 5I4NA 3PXQA 5I9WA 3EQDA 5CU0A 5G1XA 2F7EE 2HZIA 4QP1A 5H9BA 3I7BA 3L9PA 5A54A 4AACA 2DYLA 3GU4A 3HA6A 4GG7A 2XMYA 3RCJA 3A7GA 4UMUA 3GC9A 3C4ZA 1OBDA 5IEYA 2IVSA 2QOHA 2GNIA 5M08A 2XNGA 1VR2A 3DKOA 4CFFA 4I6HA 4WD5A 4EH7A 3DGKA 2R3GA 2YN8A 2VTRA 3RI1A 3RWPA 4IB0A 3DAKA 5CEOA 5BUJA 4M68A 2YM8A 4EOOA 2VWYA 4NM0A 4M12A 5IQCA 4N0SA 2ITQA 3OUKA 4XG2A 2YLFA 4PDYA 3FI8A 3R83A 3NIZA 3MBLA 3R21A 5EQPA 3LM0A 3F5GA 3KXZA 4XYFA 3O8PA 4YO6A 2W06A 3OBGA 3ZM4A 3U6HA 2XZSA 4A9SA 4UN0C 3FLNC 1XWSA 5EI6A 4U6RA 3R30A 4FKTA 4MNEB 3GC0A 2OF4A 4TYHB 3CIKA 2W9ZB 3BU5A 4EK8A 2PUUA 2XKDA 4GEOA 3R9DA 2Y4PA 4G6NA 2XEZA 5CAVA 4BJJB 3Q9XA 2GNJA 5ETCA 3JPVA 4YJPA 2CCIA 4TW9A 2EB2A 2RFSA 4NTSA 4RSSA 3BGQA 4RIYA 5FTQA 3BU3A 4L6QA 4IX4A 2DS1A 4C4IA 5IH4A 2J0IA 4DTBA 2UZLA 5LCKA 2XBAA 4PP9A 1ST0A 2BRHA 4DEAA 2XIRA 3EN6A 4D2TA 2FUMA 3DXNA 2CKPA 4F0FA 5KMMA 3UQGA 2ZM4A 5LWMA 1O6YA 1GNGA 3UC3A 1Q4LA 3UG1A 2JDRA 2OSCA 4Z7HA 4O4CA 3LLAA 1F0QA 4YPSA 2VTTA 4BDGA 5K0KA 3ODYX 3C0HA 2VO7A 4GYIA 2UW4A 2OLCA 2YERA 5JKGA 2X4ZA 1CM8A 1XH9A 3DOGA 5HO6A 5JFXA 1ND4A 4K2RA 4U7ZA 4BFMA 3LFNA 3BBWA 4NKAA 2CHLA 5HESA 3ZCLA 3ZRMA 1U59A 4HCVA 4ZAUA 4U0IA 1E1XA 2A27A 1TKIA 5DLSA 1OL7A 4WNOA 5F1ZA 5TOZA 3P7BA 3F5XA 4OAUC 3WBLA 2JFLA 4L3JA 1RJBA 2XM9A 1FGIA 4BTJA 2OBJA 4IANA 3U6JA 3G51A 2EXEA 4FSTA 2JFMA 3FMKA 4TYEA 4DG2E 2FH9A 3N4VA 4I24A 4CRSA 3SOCA 2YCSA 2UZBA 4J98A 5TE0A 2UVYA 3ZEWA 3KMMA 1PMNA 2YZAA 3K3IA 1OKYA 5AV3A 5J8IA 1G8KA 5EDPA 3T3UA 4EC9A 4D9TA 2I0YA 5KUPA 4C33A 2J7TA 3BLHA 4MQ1A 2PVKA 3MY0A 3ORXA 3ORLA 3Q2MA 4I4EA 4LI5A 5HVJA 3N9XA 3P0MA 5CT0A 5HBJA 3OUNB 3FLQA 5FTOA 2YIXA 3KULB 2F57A 4OTWA 5M09A 3P23A 2XCHA 2R2PA 3NRMA 3SRVA 4OBPA 4PMPA 5AX3A 4PL4A 4U97A 3QTWA 4FKVA 4ONAA 5E8ZA 3ZM9A 1H1SA 3ZZWA 3QC4A 1XHAA 4NEUA 4AW2A 3AMBA 3EQCA 4HGTA 4WBBB 2HY0A 4J8MA 2Z02A 3V04A 3S4QA 4TWCA 3KA0A 1XKKA 3L8SA 3RK9A 3DV3A 4C34A 5LWNA 2WTKC 3NS9A 5I5ZA 3NNWA 3QU0A 4YHTA 4I6QA 2YITA 5HLNA 4MXZA 1UU8A 5E8XA 4AA5A 4HZRA 3VRZA 4JAIA 1REJA 3ULIA 3ZO2A 1W7HA 1PYXA 4UYAA 2I0HA 3FSFA 4BCHA 3E88A 3LE6A 5BVOA 3DU8A 2W5AA 4BGHA 3QA0A 4V04A 3QHWA 4DEDA 3LXNA 3GVUA 5H2UA 4HYUA 3F66A 2P3GX 4YP8A 3VAPA 4C3PA 1YWVA 4G16A 2BRGA 1E1VA 2C6EA 3R8MA 4JNWA 5F95A 1NY3A 2WEVA 2QOIA 3DNEA 3DKGA 3TNQB 1GAGA 1RQQA 4ZZOA 2XARA 1Y8YA 2WB8A 4FKGA 1TFFA 2IZRA 1L3RE 3G9LX 4C7TA 2XAMA 1Q8UA 2ZB0A 3HAMA 2VX3A 3G9NA 2CPKE 3CY3A 3M1SA 5J5SA 5DEYA 3LZBA 4XRLA 2F2UA 3GQIA 3RVGA 4K18A 4RVLA 5EW8A 3ROYA 3FSKA 4LL5A 5AP3A 4PDSA 3HZTA 2C5XA 4YO4A 3W0PA 4AGCA 1Q3DA 4ZTHA 1OUYA 4RJ4A 5AFVA 3UTOA 3RPVA 3CR0A 1G3NA 2PVHA 2BR1A 3CKXA 4O4FA 1OITA 2E9NA 3NNUA 5H3QA 2H96A 2OZOA 5CAQA 5CNOA 4O1OA 2OFUA 4AOIA 3PY3A 4GT4A 3D2KA 2VTNA 2ITYA 5LMBA 4ZTSA 4EK5A 4XHKB 5KNJA 3H30A 4WUNA 4E8AA 1DS5A 2XA4A 2HY81 3TV7A 3CTJA 5BMMA 3UYSA 4CGAA 3WZKA 5LVMA 3P7CA 4YSJA 3P9JA 3TEIA 3LMGA 2QURA 2OWBA 2V0DA 4OTIA 3OS3A 1SVGA 3OCTA 1V0PA 2BRMA 1YXXA 3CY2A 2C4GA 4PDPA 4L7SA 5CF5A 3UYTA 4R7BA 1OIUA 2UVZA 3GB2A 4F9CA 4C35A 3CGFA 3HEGA 3QRIA 2X8DA 5DGZA 4R3RA 3COMA 4FSYA 3DZQA 2PMOX 3FKNA 3ERKA 2BILB 4NIFB 4RA4A 4FT9A 1NVQA 5AR5A 3FI2A 1JNKA 2R9SA 5AUWA 4ZSEA 3QUEA 4BBMA 2OXXA 3O8TA 3ZLWA 5DEWA 3FAAA 3VUMA 4IWQA 1SNUA 4FVPA 4QNYA 3Q9ZA 4DYMA 3CTHA 3FXXA 2OI4X 1ZAOA 3AC8A 4O0YA 4TWPA 3QA8A 3QQJA 1YVJA 4WKQA 4BZOA 4QYYA 2VRXA 3EWHA 4FTOA 4CLIA 3OXTA 4R1YA 3DQWA 3FDNA 3ACKA 3ZO3A 1Q24A 5LVPA 3EN9A 2ITPA 4XS2A 4TYGA 5CEMA 2Q83A 3AOXA 2P2HA 3KCFA 4Q5HA 3FPQA 4AXFA 3BYSA 4AXCA 3BZ3A 3EYGA 4D55A 4BWKA 3R1QA 4F0IA 5CAOA 5HHWA 3UIUA 5IG1A 4DH3A 5M4IA 3MTLA 2BHHA 5CEQA 3DBQA 3SW4A 4E26A 4L8MA 3DK6A 4FV7A 5GINE 4AZVA 3GNIB 2YIRA 4P5ZA 3ZBXA 5E90A 4A9RA 3BX5A 2BDJA 2IZTA 4BIDA 3OW3A 4BCMA 3C9WA 4F7JA 4YTFA 2Z60A 3I60A 4BCGA 2EB3A 5KMOA 3UNJA 4BN1A 3NMUF 3PVUA 4IZYA 4YTIA 3QQKA 2VWBA 4NJDA 4CCBA 2OJIA 4FI1A 5L2WA 3FY2A 2ITXA 4JX3A 4EKLA 3ZDUA 3C7QA 3Q3BA 3R00A 4FZAB 3U51A 1MQBA 2XKCA 3DT1A 2X0PA 3S00A 4JBOA 1W83A 1W0XC 3PFYA 4CZUA 3KU2A 5FGKA 4CQEA 5CF8A 5F9EA 2YACA 4N4SA 4OGRA 4UV0A 2YAAA 5CXZA 1A48A 4FVRA 4WO5A 4EK6A 4FV8A 4XP3A 4FKWA 5IA4A 5IPJA 5KBRA 4EH6A 1Z9XA 1NA7A 2XJ0A 2C5NA 2PVFA 1J1BA 4S2ZA 5DA3A 3R9HA 5KMNA 4ZMEA 4ASDA 4EJ7A 3DTWA 5HQ0A 3IW4A 5LQFA 4YZDA 3TG1A 3UOLA 3A61A 2E9VA 4F6SA 1OUKA 3NCZA 1ZZ2A 2JIUA 5H8EA 3H9FA 4FTJA 5K3YA 1J91A 1UWJA 5EM7A 2VAGA 4RJ8A 4Y73A 2IZSA 4DHIB 4GK3A 3EN5A 5AUTA 2FYSA 3FZSA 4YURA 3RPRA 5FXRA 4L67A 4BDKA 3FHIA 4L53A 4A7CA 2YWVA 3UVQA 5JFVA 2RFEA 4FNXA 2OZAA 2GDOA 2GS2A 4L46A 3AC5A 3TM0A 4X3FA 3QRJA 4QMNA 4ZSAA 3UDSA 4WRGA 2OGVA 3KRXA 4KB8A 4K0YA 5IA2A 3DY7A 4FT0A 3VONA 3NUYA 3ID6C 3QGWA 4RPVA 1Y6BA 2F2CB 2WMAA 1IA8A 5HBEA 3VW8A 4BDDA 3V3VA 4A9TA 1IAJA 3DB6A 4UXLA 2E9UA 1TQMA 1FGKA 5HE1A 1Y57A 3DBCA 4PL3A 5AR8A 4ZXTA 4E1ZA 5IMXA 2CNUA 4ZS4A 4FOCA 5A3XA 5I9XA 4CSVA 3JVSA 5FQDC 1LPUA 3QD3A 2YISA 5CF6A 3RWQA 4AGUA 3SQQA 4AZSA 2XKFA 4II5A 3RNIA 4F7NA 4C59A 4XEYA 3DDPA 1ZMUA 4AU8A 3R0TA 4R6VA 5IDNA 3Q32A 3I79A 4BYIA 3BLAA 3QTQA 4ZY5A 4U79A 4H3BA 4M0ZA 4E20A 2BKZA 2J0LA 3C51A 5C9CA 1KUTA 4FNYA 1PXMA 2CKEA 3ZONA 3FZ1A 3LPBA 1P4OA 3ANRA 4RLLA 2XRUA 4RA5A 5JT2A 5KCVA 3TYKA 2PUPA 2R7BA 2X0GA 4ORKA 2O63A 5KMIA 2XBJA 3LM5A 3DB8A 3E3PA 3F6XA 3M2WA 1GZNA 1UNLA 5ETFA 3SXSA 3MWUA 4W8DA 3QQLA 4FSMA 5EYKA 1AD5A 2P4IA 3K54A 4FTTA 4EKKA 4NM7A 2WOUA 3D5XA 3UVRA 4A9YA 3PJ8A 4LQMA 1CKPA 3W55A 5CEPA 3LXPA 4UWYA 3ZO1A 3U6IA 3F7ZA 3KXXA 3R73A 3MYGA 4N6YA 5E8WA 3E7VA 5EH0A 3UODA 3UOKA 3OCBA 3VBWA 4DFNA 1CTPE 1YXSA 4IJ9A 4YZBA 3DK7A 5B7VA 3WI6A 1XJDA 3TJDA 5E8UA 1M17A 1NVRA 2QOOA 4TNDA 3IDBA 5LMAA 3HP5A 5DR6A 2R3LA 2B7AA 2BFXA 2XIZA 2PHKA 2Y4IB 2JD5A 2A4LA 4GK4A 5JH6A 1OIRA 3HMNA 4XV2A 4Z3VA 3QRKA 2C6OA 3VC4A 5EYDA 5EKNA 2XEYA 4FSZA 5A4TA 5M07A 3FLYA 2UUEA 3ZEPA 2ZMDA 3HVCA 1RDQE 5HD4A 1JSVA 4D4SA 3BE2A 3DDQA 5AR2A 1DAWA 3V5LA 4DG0E 4I5MA 1A9UA 4RJ6A 3OMVA 4QMPA 2WTKB 3L8VA 4HGEA 4I20A 4JQ8A 5HBHA 3S3IA 4CT1A 3BBTB 2E2BA 2E9PA 3TUDA 3PWDA 2VD5A 2FGIA 4J1RA 5HIBA 4O7WA 3BKBA 3E62A 5KHWA 3GU5A 2QHMA 4RIXB 3CC6A 3PPZA 3KRLA 3VUKA 3DJ5A 2QCSA 2H9VA 3F3UA 3HGKA 3UQCA 4RIYB 5FD2A 1J7IA 4AGDA 3NAXA 4BIEA 3NGAA 3QXPA 4XOYA 2PULA 5HCXA 4BCKA 4FNWA 5HZNA 4I41A 3PWYA 2YA9A 2BTRA 4D58A 3FXZA 2CSNA 2XK4A 5CI6A 5FRIA 2GTNA 2YJSA 3GBZA 3RAIA 3I7CA 1YDRE 2WAJA 2NP8A 2OF2A 4NW5A 5IQDA 4FTIA 4MNEA 4I3ZA 5CSVA 5AMNA 2C6MA 5EM5A 1A06A 2C0TA 1H1PA 1JVPP 4O1PA 3LFAA 4BZNA 2WMVA 4QPMA 3BE9A 3HV4A 1ERKA 4BHNA 4IZAA 3BYOA 2ONLA 2YHVA 2DQ7X 3LJ1A 3PY0A 1GIIA 2XP2A 2HXLA 1WBSA 5KMLA 3LMIA 2IPXA 3ZSGA 3Q60A 4OLIA 3FL5A 1PJKA 1PW2A 4WNKA 3W0RA 5K4IA 4CRLA 2GSFA 3BHYA 2VNYA 3FXWA 3OTUA 3ORPA 2C47A 3SA0A 3Q6WA 4FVQA 5C8MA 3C4FA 3TZMA 5ANEA 1JOWB 5C8KA 4OTGA 3IK3A 3WYXA 2QNJA 4FKIA 4AX8A 3R9OA 1WBVA 3O71A 4F08A 3RAHA 3QYWA 1SZMA 5E8VA 1PMEA 2R3OA 3D14A 3V5TA 4FSWA 3TZ8A 4O7VA 4P5QA 2IW6A 3CCNA 4HOKA 5J95A 3NZ0A 1V1KA 4BZDA 5AUXA 1UNHA 3C50A 2VNWA 5B2MA 2WMBA 2O64A 5EQYA 2Y4IC 3GOPA 5G6VA 2C6LA 3O7LD 1YWNA 4FZDB 3UIBA 4F9YA 4EJNA 4DC2A 4U40A 5DRBA 2WQMA 4JDKA 2W1HA 2VX1A 2ETMA 5AP2A 3FLSA 5IH5A 2Y6OA 2R3FA 3O8UA 1H0WA 3S0OA 5ANDA 3EQBA 3FMJA 3QQHA 4LV5A 4C57A 3E8CA 5CEKA 4BIBA 2ITVA 3PIYA 5IZFA 4Y83A 3OXIA 4IDTA 1PXLA 3BHUA 3FZRA 4TZRA 1OB3A 4EH5A 2JKKA 4OBQA 2O0UA 3AC4A 3PRFA 3SKCA 5HX6A 4RIWA 4DHJA 5A46A 3OP5A 5HD7A 3VNTA 5HTCA 2X8IA 3LCSA 4C0TA 3CPCA 1XR1A 4FIIA 1PKGA 2W4KA 3D94A 3FUPA 4HZSA 3UDZA 1VYWA 3ELJA 4WOVA 3N4TA 2PTKA 4GU9A 4MXCA 2UW8A 2XK7A 4C4FA 4F65A 4FKJA 3QYZA 3R71A 3LCKA 5HO7A 2QOBA 4K8AA 2RL5A 4D4YA 4HVIA 3LCOA 5KZ0A 2BKKA 3D83A 4L45A 5CSHA 5I3OA 2GNHA 2C30A 4NKSA 3R7VA 4BTFA 5A6OA 3ODZX 5CZHA 3VF8A 2PZRA 4WSYA 5CSXA 4CVAA 4AG8A 4IVBA 1OKZA 1W84A 4YNEA 4I4FA 5CWZA 4C37A 2B55A 5CANA 1T45A 2JIIA 3F2NA 4ZJJA 5E8SA 3TT0A 5J1WA 1OKVA 4EH9A 4D2PA 4C4HA 2F7XE 4FZ7A 2WTJA 3GEQA 3KEXA 5AA9A 2X7GA 2I40A 4Y95A 3SD0A 2RF9A 4CLJA 4CG8A 3Q53A 4A4XA 5J1VA 3PJ3A 4DT8A 2YDKA 2B54A 4MBLA 4NK9A 3RGFA 4DH1A 2IVTA 2R3QA 3UZPA 4XH6A 5I9YA 4EYJA 2R7IA 4AW1A 4B99A 4MWIA 4IW0A 4U43A 2WMTA 5BMSA 3BV2A 5CQWA 4V0GB 2YDIA 3RJCA 4BVUA 5HORA 3W2OA 1OGUA 1JKKA 2NPQA 3GUBA 3AKJA 4B4LA 4TKSA 4RVMA 5KE0A 2XNNA 2PY3A 2X8EA 3QLGA 3V8SA 3G5DA 4JIKA 3EIDA 2J0KA 4QP6A 3OF0A 4MTAA 4KKEA 4PWNA 5HNGA 2Z7QA 2UW0A 2OIQA 3KK9A 3QF9A 3T9IA 4ANNA 4E73A 4L52A 3AMYA 4CEGA 3ANQA 3EH9A 3UOHA 3U4UA 1MUOA 1PXIA 4BBFA 4DFXE 4CKRA 2QO7A 4FV6A 4EWQA 5LVNA 3P5JC 4J95A 1ZOHA 1QPCA 4FZ6A 3VWAA 4E5BA 3RK7A 2FSMX 2B53A 4FTMA 4EYMA 1XMMA 3ZFMA 5AV2A 4BY9E 5CU6A 4DDGA 1KOAA 3FLZA 3HKOA 5H8GA 4WG4A 3W2PA 4DGOA 3RZBA 4JVGA 3TJCA 3JYAA 5IEVA 2UZNA 2HZ4A 3MPAA 4ALUA 2VO6A 3ZH8A 4DT9A 2OIDA 2XVDA 4O4EA 4RX8A 4EQUA 4XCUA 2WMXA 5CY3A 2R3KA 2HK5A 2GQGA 2W5BA 3NNVA 1YDSE 3DAEA 3NUXA 3A62A 3GCQA 3OT3A 4PPCA 4DTKA 1DAYA 1WVYA 5BX0A 3QZIA 2WEIA 4EH3A 3W2CA 5DN3A 1GOLA 5EHOA 5CEIA 3C4EA 2B1PA 2OW3A 5I9UA 5HVKA 4OTDA 5DNRA 4QMOA 4GU6A 3KVXA 5IUHA 3TUBA 3OCGA 3U4WA 5GZAA 1KE7A 2GHGA 2IJMA 2R4BA 3HUBA 4FV9A 3UIMA 4UZDA 1OM1A 2BRBA 4RWJA 4BTKA 4IZ5A 3GT8A 4PUZA 3G15A 5TF9A 3TNPC 1H28A 3W2SA 2GFCA 4A06A 1Y8GA 4GFMA 2CKOA 2JAMA 2O3PA 1XH6A 4RC2A 3I81A 3D5UA 4XLVA 3ZUTA 3R1SA 4O27B 3HMMA 3R7OA 5EG3A 4ASXA 5HCYA 4QP7A 2WTWA 1UU7A 1ZYSA 3KMWA 1UNGA 4N6ZA 2HELA 4RIXA 2V7OA 3A2CA 4FG7A 4HPUE 3TI1A 2CLXA 3ZUVA 4G17A 2GTMA 4IAKA 4O7NA 1YXUA 3MTFA 3PZEA 4I6BA 5LCJA 4LGGA 3KIOC 2WGJA 2R3JA 4EQCA 3NCGA 4P2KA 2PE0A 5BVEA 4F78A 2QOFA 3PP0A 3ZTXA 4APCA 1OGYA 1V0OA 4FTCA 1T46A 3GC8A 4X2KA 5A4QA 1YW2A 3LKMA 3RZFA 3C0GA 2A0CX 3UPZA 1WBTA 3JXWA 3G90X 1OVEA 4NSTA 4LRJA 4O91A 5CU4A 4ITJA 2HENA 5TKDA 5E8YA 3GU8A 5AP1A 3ZDIA 2WTVA 4YC8A 3W0MA 5LOHA 3TDWA 4RX9A 2R3RA 3W32A 4QTAA 3HV7A 4AA4A 1CMKE 5C01A 4XP2A 3ZFXA 2YIWA 2GQRA 3LFEA 2ETKA 2WQBA 2IZUA 4RG0A 3P1AA 4FF8A 5AX9A 2PU8A 5ETIA 5CX9A 3MVMA 3IS5A 4JQEA 5T68A 5HICA 1QMZA 4U41A 4HVHA 3BPRA 4FT5A 5D9HA 3DKFA 5L6OA 4YLLA 1U5QA 1CDKA 4IQ6A 4F1MA 3NNXA 1ST4A 4PMMA 4CV9A 4FR4A 4EOMA 4X2GA 4FEQA 4QT1A 2O2UA 1E9HA 3D0EA 4I0SA 2IW9A 1FOTA 3VBYA 3D15A 3E3BX 3PPKA 2PVJA 3L1SA 3WIGA 5D41A 1STCE 3BQRA 4UY9A 4R78A 2VO0A 5KKRC 4DF3A 3MH2A 2ZM1A 4CZYB 2IG7A 1OL2A 1HCKA 4G6LA 1UVRA 2BALA 2QG5A 3GOKA 3SG8A 5IQAA 5L2SA 5GZ9A 2CNVA 5DR9A 5IISA 4PPBA 1PXPA 3QD0A 2QI8A 5E91A 1JKTA 2OK1A 3H3CA 4GUBA 3TV6A 5CLPA 5JGDA 1OPJA 3QUPA 4QOXA 3PE2A 2VTQA 1LR4A 1X8BA 2YM3A 3A8XA 4CXAA 3ZLSA 1IRKA 1WVXA 1GZOA 4QMUA 2AQXA 3GU6A 4H1JA 2V62A 3KL8A 3ZYAA 1QPJA 4E7WA 4EK4A 3CLYA 4BGGA 1WZYA 2C68A 1REKA 2SRCA 2YEXA 1Z57A 3LJ2A 4LGDA 4R7IA 4WBOA 4XX9A 5ANJA 3TUCA 4NZWB 2YM6A 2Y7JA 3KXNA 3LCTA 3OWLA 4NM3A 2W1GA 4U45A 3VJOA 4FKPA 4JG7A 5AV1A 4GCJA 2PMLX 3C4XA 4DINA 3SC1A 5BVKA 4EOIA 4EZ3A 2ITOA 5DT0A 1YHSA 3PIZA 3IONA 5IQGA 2XF0A 2OG8A 3BYMA 4Z16A 4O2PA 4OTRA 1W2DA 4W4YA 2ZVAA 4C4GA 1J7UA 5I3RA 2A19B 5EI8A 1Q8TA 3MA6A 4LV8A 4GKHA 4IACA 3MY5A 4S30A 4U81A 2REIA 3EZRA 4WG3A 3QKKA 3EQHA 1ZYJA 3MFSA 4TL0A 5HO8A 2B9HA 5F20A 5EM6A 5C03A 2OH0E 4W4VA 3RHXA 3MY1A 3I0OA 3KN5A 3M11A 5ACKA 4EHZA 2HZNA 4A4LA 5JSMA 4GJ3A 3C1XA 4MHAA 2UZEA 2B0QA 3NPCA 4HVGA 1H07A 4M67A 1SVHA 4HNFA 3FKLA 2PVLA 4EH4A 4HYIA 3EQGA 3TXOA 4EI4A 3H9RA 2B9JA 2VWXA 2Y0AA 1L8TA 5C4KA 3L9MA 4MYGA 3R28A 5EK7A 4RGJA 2IVUA 5EFQA 2WELA 3WE4A 3P7AA 1UWHA 4LUDA 3MFRA 2CGVA 4O22A 5KMKA 5KMJA 4D4RA 5HE2A 3ZC6A 2VGPA 2BAKA 4FV5A 4PNIA 3EQIA 2CMWA 2HWPA 2YDJA 3GFEA 4HYHA 3U9CA 2XALA 3FKOA 1PF8A 2XYUA 4XG7A 4V0GA 2GCDA 1MRYA 3QTSA 2C69A 5CTPA 2BZJA 1GY3A 1WVWA 3EYHA 3PLAE 2GS7A 4E6AA 2QONA 4PY1A 4KAOA 2R3MA 2OXYA 4P4CA 2HOGA 4WNPA 4BICA 5JEBA 2EU9A 2C6TA 4FKUA 2OKRA 1O6LA 2C5OA 2PK9A 3BV3A 4FV3A 4OR5A 2W1ZA 1OIYA 4O0VA 4CT2A 4Z55A 3BCEA 2V55A 4DCEA 2Y8OA 3IGGA 5AIRA 3ZXTA 3UBDA 4L7FA 5AAGA 4UX9A 1H24A 3ORTA 2I1MA 5A14A 4EOPA 2JKOA 5JZJA 3A7HA 2RSVA 4PF4A 3FQHA 4J7BA 2BROA 4MKCA 3I1AA 2B4SB 4ANMA 3F3VA 4X6QC 3E8DA 4XMOA 2OICA 1HCLA 3EKNA 3LFSA 4NL0A 4DHZA 2WHBA 3HRFA 5ANGA 4QMLA 3SLSA 2R0IA 5DWRA 4AXAA 3UO5A 2R3PA 5EDRA 4C38A 2QO9A 4K1BA 4LGHA 3FMDA 2AC3A 4USFA 4K11A 5IQIA 4FC0A 3QFVA 1TVOA 3FJQE 3MV5A 2FSOX 5AAFA 3ATTA 3NAYA 5FDPA 1IAHA 3RK5A 5DE2A 3Q9YA 4FT3A 5KX8A 4WG5A 2DUVA 3FC1X 5GIPE 4QMSA 4LYNA 4DFBA 3MH0A 3UJGA 2AYPA 1FVTA 2WMSA 4I5CA 5L3AA 2XNEA 4FKSA 2FA2A 2XH5A 5EDQA 3MS9A 3IW5A 4H3QA 3TNIA 1M2RA 3BL9A 2YCFA 1XH7A 1FQ1B 2YLEA 2YM4A 3PJCA 4CZTA 3DXQA 4FTAA 3G0EA 2FSTX 4GUEA 4XJ0A 4RX7A 4ID7A 3DJ6A 3KY2A 3R1NA 1WCCA 4YJNA 4RX5A 3KRRA 3VO3A 2XK3A 1ZYLA 3C0IA 3H9OA 1YXVA 5AIKA 2VWUA 2QKWB 4DCAA 4QDVA 5DFPA 5DBXA 1BMKA 1FVVA 3JVRA 4MBJA 3V5WA 4U5JA 5JFWA 2HYYA 4FZFB 4S31A 1U5RA 4UYNA 3D7ZA 4ZP5A 3TN8A 3ULZA 3KB7A 4E6DA 3E8NA 4HGSA 5TR6A 2WOTA 4FEWA 4F70A 3HP2A 2JITA 1WAKA 1M7NA 3PXZA 4Y5QA 4YTHA 5KBQA 5HIDA 2NYAA 3KMUA 4O0RA 4E4XA 4H1MA 4QNAA 3AD5A 3F9NA 4ZLYA 3ORIA 3OXZA 4JT3A 3TZ7A 4R5YA 4E6QA 3UIXA 3O23A 5AP7A 4AE6A 4B8LA 2OIBA 3RKBA 4LMUA 4LFIA 4NCTC 3W1FA 4ZTRA 5IQHA 3LHJA 4WA9A 5L8JA 3MPMA 5K5XA 3QX2A 4JIAA 4KABA 4FTRA 3EOCA 4GIHA 3I0QA 4IAAA 4ZTMA 1UV5A 3IECA 3DZOA 3V5JA 3BEGA 2C1BA 4DH5A 1GIJA 5EM8A 3OTVA 2JKMA 3WILA 5J7HA 1XO2B 4IWOA 4AAAA 4FOBA 4TTHB 4ZTNA 4D2VA 3PVGA 4AF3A 4FSUA 5E4HA 3VBVA 4RFMA 3AMAA 2G1TA 2G2IA 3JY9A 4DAWA 1P5EA 4O2ZA 2YAKA 3H0ZA 4JRNA 4KWPA 1V0BA 4L00A 3N4UA 4DTAA 4FTUA 5LVOA 3QQGA 4UB7A 4YR8A 3TL8A 2CGXA 1Y91A 4NWMA 4YZ9A 3IPHA 1PXNA 3VW6A 1BI8A 2WFYA 3ZBFA 4O6LA 3Q4CA 5GJFA 4IC7A 3I5ZA 2UW9A 2X7OA 1BL6A 2WD1A 4KRDA 5CT7A 4CFXA 4YGAA 1R0PA 4J53A 4QQCA 4X6RA 4F9BA 3WF6A 1JQHA 4GFOA 3WZJA 1H27A 3R63A 3E5AA 4QP4A 5LXMA 1WBWA 3ZRLA 2PMIA 5HNBA 3UO6A 3PYYA 2VZ6A 3HECA 5LVLA 4F09A 4BCPA 4BL1A 3FZPA 5BYZA 4IEBA 5D7VA 2QR8A 2ITWA 5BUEA</