3MBLA

Crystal structure of the human mitogen-activated protein kinase kinase 1 (mek 1) in complex with ligand and mgadp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
321
structure length
290
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of pyrrole derivatives as MEK inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
total genus 86
structure length 290
sequence length 321
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mblA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mblA01
3TV6A 3IG7A 2P55A 3C1XA 1R0PA 3PIXA 1U4DA 3PXZA 3VUKA 1JOWB 3ID6C 3DLSA 3TUDA 4FKGA 3ZDIA 5IQFA 3HL7A 3BLRA 4D9UA 1YXTA 1AGWA 3LCOA 4EJ7A 4FZDB 2JKMA 4O84A 3NW6A 3VNTA 3D5WA 5HCZA 2WELA 2PUUA 4O0SA 1OL7A 2RFNA 2XM8A 3FPMA 4NCTA 4A4LA 4X6RA 5D9HA 4H05A 2RL5A 2VX3A 4BKJA 1IRKA 4DGMA 4IB1A 3NAXA 3O71A 4J52A 4H39A 5M4CA 4O96A 4ACGA 2BAJA 2JDVA 4C38A 5AP2A 3TNHA 3DQXA 3TV7A 2R3RA 2Y4IC 3BU5A 3Q4UA 3ET7A 4RIYB 1J1CA 4ZOGA 4UWYA 2G15A 4L3JA 3TEIA 3ZLYA 4BI1A 1IEPA 3V01A 3VF9A 5HO8A 2J0KA 4M13A 4DH8A 3FLQA 5HX6A 4DT9A 5IQHA 1YHWA 1DM2A 3FI4A 4IAZA 3WF5A 1SVEA 2PMLX 5HIEA 3S1HA 4FZFB 4PDSA 2J5EA 3AGMA 2PMIA 3MFUA 4LOQA 4N57A 5FP5A 4CKRA 2ESMA 2YIYA 3EQIA 3TNIA 2BKZA 4W4VA 3BZ3A 3Q2JA 4GU6A 4ASZA 5IDNA 3K5VA 2FSLX 4BBFA 2YWPA 3HMPA 1OM1A 4FX3A 3RPSA 4APCA 4AA5A 3HMMA 3F2RA 1ERKA 4BTJA 3M42A 2E9NA 4L52A 2GQSA 3S4QA 4BN1A 3CQUA 5A54A 5M51A 4Z7GA 4HCTA 3RKBA 4QMWA 1PXMA 2J0JA 4XV2A 4IBMA 4PY1A 3AMAA 3QCYA 2QR7A 1BX6A 2ZDUA 3EFLA 4DE4A 2VGPA 2WMUA 3IDCA 4XOZA 1YVJA 3FEGA 3LXPA 4PL3A 1DAYA 2WMWA 2IVSA 5HTCA 2XNOA 1QPJA 4UB7A 5K0XA 3JVSA 1TQPA 2A0CX 2WTVA 2JD5A 4UXLA 4MD8E 1L3RE 3EQDA 2GMXA 1XBAA 3BEGA 4C37A 4U41A 4G3CA 4TY1A 1PW2A 3SX9A 4ZP5A 3UIBA 5I9YA 3NAYA 4YNOA 1Y6BA 5CYIA 3PPJA 2PYWA 2C3KA 3GGFA 4FV6A 4RJ4A 5CVFA 1IAJA 3GU7A 4M14A 3TI1A 3KMMA 5E92A 1F5QA 2HW7A 3WOWA 2VWZA 2Y6OA 3QZHA 2GNHA 3CJGA 3QKLA 3R8ZA 4E5WA 5ICPA 5DYJA 5JKGA 3CTHA 2WIPA 3LAUA 4F6SA 3GENA 5KMIA 4AN3A 4EUTA 3SGCA 3SVVA 2C68A 3P08A 4MF0A 1Q62A 4E5BA 3KRLA 3U8WA 2QU6A 3HNGA 5I9UA 1BI8A 3AT4A 3D7TA 2B9IA 3DBDA 4USEA 4DEHA 3JYAA 1T46A 3QTWA 3RJCA 3EYGA 3CY2A 4EH9A 4BDHA 3SA0A 5IEXA 3OBJA 4QPAA 4WUNA 5FM2A 2HELA 3CPCA 3IK3A 4CZYB 4FT3A 2XIKA 2XNNA 3KXZA 3UO4A 4TYHB 3QF9A 5HLWA 4O0TA 4BTMA 4NKSA 4PL4A 4FUXA 5BNJA 5K4JA 2C6TA 4Z9LA 3U4UA 5L8LA 2PULA 4DTBA 4OLIA 2E2BA 3B2TA 4QTAA 3VS6A 4FSRA 4RQKA 5LMBA 2CMWA 2A4LA 3WIGA 5IQGA 4YSMA 4O22A 3EL7A 3I5ZA 4USDA 1WVWA 3C4WA 1YXSA 3DJ7A 4JT3A 4KBKA 3H9RA 2IVTA 4FTUA 5M08A 4PDOA 4J98A 4MXXA 4LMNA 2BPMA 5AV2A 4O0VA 4F7SA 4O1PA 5FRIA 1NVQA 3BEAA 5DMZA 5AUZA 3Q6UA 2VWBA 4X3FA 2YIXA 2OKRA 3PPZA 3V3VA 2YEXA 1ND4A 3I6WA 3FUPA 5BMMA 3SLSA 3MFRA 4O0RA 1W83A 2XKFA 4TWCA 2W1DA 3FKOA 4FKSA 4UX9A 1Y8YA 3SRVB 4IVBA 4QP4A 3S00A 2OJFE 3P4KA 3SOAA 1TQMA 3AD4A 3UNJA 3ZSIA 4BCOA 4AX8A 4TW9A 2GDOA 3BU3A 3COHA 1H1RA 3QLFA 4ID7A 2GQGA 2RKUA 4FKWA 5EI6A 2UW5A 1URWA 2R3KA 3MGYA 3MVJA 4QMVA 3G0FA 1XBCA 4IANA 4KAOA 3HUCA 1Y91A 4CSVA 2W96B 4PDYA 3BV2A 3RBWA 2H96A 2X81A 3KL8A 3VJNA 4KINA 3DT1A 4V0GB 4RIXA 4RGJA 4MBJA 4LGGA 3HEGA 4P90A 4WA9A 4N6ZA 3CTQA 4P5QA 4JLCA 5D12A 5FP6A 4C4IA 5J5TA 3EMGA 3OY1A 5DIAA 2CLXA 3FKLA 4DFLA 4F6WA 4QMNA 4R7BA 4BTKA 4QMYA 4D4RA 5K9IA 2F4JA 4KIPA 3N4UA 3PLAE 5AM6A 3FMEA 2UZNA 3LKMA 4LGDA 2IW6A 3OTVA 1XH7A 3UGCA 1REKA 2YAKA 2F49A 3L9MA 3AMBA 5CXZA 4MBIA 4DTKA 4NK9A 4AZTA 3E8DA 5HIBA 4EHEA 3Q52A 5JMSA 1OKZA 2WPAA 3FZ1A 3QQKA 4U80A 4F4PA 5BVOA 3BYMA 4RJ6A 5JGBA 2PZIA 4G3GA 2XIYA 3GI3A 1OL1A 3R83A 3JUHA 2OI4X 3ACJA 1IA9A 4FIHA 2HWPA 4MAOA 3RAKA 3KEXA 4UN0C 1DS5A 4CFXA 5IH4A 3BGQA 1NA7A 3S2PA 2F7EE 3R1QA 2BRMA 4FSNA 3U55A 3QYZA 3R6XA 3Q6WA 4WUAA 1M2PA 3ORNA 3COMA 2BMCA 3UNZA 4ZLYA 4RA5A 3DB6A 4ZJJA 1UWHA 4G6NA 2QOOA 4XG7A 3VULA 5EM6A 4CTBA 5HLPA 4NFMA 5J1VA 4DAWA 3AMYA 4WNKA 4R1VA 4MD9E 4ZSEA 4FG7A 4BKYA 2B52A 5L6OA 2PVFA 4RX7A 4BCPA 4KIQA 4D0WA 1H4LA 2XNEA 5AA9A 2E9VA 3MESA 2BFXA 4AG8A 3FDNA 5HESA 3G51A 4I41A 3OROA 3W8QA 3H3CA 3WILA 4D1XA 4ZJVA 2B7AA 4V01A 3ZEPA 4XP3A 3UG1A 3QD3A 4HOKA 3MIAA 2H8HA 4IC8A 4M68A 3T9IA 4MX9A 3MIYA 5G1XA 2BRGA 5FEEA 3I7CA 4FL2A 4NTTA 1KE5A 1OL6A 2O3PA 3BQRA 4O6LA 2XBJA 3EZRA 4MK0A 4NEUA 4PF4A 5HO6A 3RWQA 3F69A 4U9AA 4LV8A 4ZTHA 4BYJA 4WD5A 2C47A 1WFCA 4UZHA 2CGWA 3DA6A 5CLPA 2QHNA 1OUKA 2YISA 5EM8A 2Z2WA 4FTTA 3A7JA 2LAVA 4OT6A 5DNRA 4WOVA 4FIFA 4Y5QA 5CF6A 3ERKA 3OEFX 5IEYA 3FI8A 4BCMA 3QTIA 4ACHA 4YZCA 3TCPA 1UKHA 3ZDUA 1NXKA 3HX4A 1XH4A 4DBNA 4ZSJA 4NYEA 2R3NA 4FSMA 4FTOA 4E1ZA 5CF4A 2BFYA 2OO8X 4QPSA 3LOKA 5DN3A 3I6UA 4AT5A 5LOHA 3OW3A 3QCQA 3I4BA 5D11A 4A07A 5H2UA 5M09A 1IG1A 3NIEA 3QHWA 2QR8A 4DITA 1FGIA 2OH0E 3PP1A 4X6QC 4D28A 4Z16A 5I9ZA 3N4VA 4ANOA 4BCKA 2WTCA 3AXWA 2PMOX 3G2FA 3GT8A 4YHTA 4CG8A 4JBPA 5IH5A 3VS4A 4C2WA 2C1AA 3LLTA 2WEVA 3UZTA 1T45A 5LMAA 3WE8A 4BICA 3ORZA 2ITXA 5DR2A 2EU9A 3EJ1A 4YR8A 5I5ZA 3LCSA 4BDBA 3FI3A 5ANJA 4C3PA 4Y85A 3KRXA 2CCHA 4M0ZA 1PJKA 5AUVA 3ZXZA 2Z60A 3ZO3A 2ITZA 4ZEGA 2C6LA 4II5A 4BDIA 3LCTA 1PXLA 3V04A 4A7CA 3BE2A 5AADA 1Q8TA 4O7ZA 1YHSA 3IECA 3ZHPC 2OBJA 4LUDA 4X7QA 2PZ5A 3OEZA 4CKJA 3BV3A 3TDVA 3ORXA 5JGAA 4O1OA 5DWRA 1QMZA 2RG5A 2PVYA 3QD2B 4IAIA 1NW1A 3FMKA 3MY1A 4FV1A 5DR9A 3GFEA 4L3LA 4EBVA 3E8NA 4RVTA 4PL5A 2QVSE 4BIDA 3I0QA 2P3GX 1H0WA 2C3JA 3NGAA 2WB8A 1JNKA 4F7JA 1LP4A 1OVEA 1UVRA 2F7XE 3QD0A 4GFMA 2C6EA 4IAKA 2OXYA 4MXYA 2WTDA 5AV0A 3HLLA 4EHZA 5EFQA 3HDNA 4O7WA 2BZJA 2WMBA 4FKIA 3Q5ZA 4OGRA 5EOLA 2I0YA 2W1FA 4GG7A 4EZ3A 3EKNA 1MRVA 2XJ0A 3W2OA 1I09A 3R30A 5TF9A 3RCJA 4QTBA 1PXOA 3A7GA 3SD0A 4I23A 3EQGA 2ITOA 3R63A 4QP1A 3KN6A 4XG6A 3TXOA 5JT2A 2Y4IB 3WIKA 4OTQA 3KRJA 3NS9A 5ANGA 5E8UA 4KUJA 3MPMA 2IWIA 5LMKC 2YABA 1KE8A 3MVLA 2WMXA 2E9OA 2FSMX 2PZPA 2C0IA 2OXXA 2QKRA 2VWYA 2W1GA 3LMGA 3D5UA 2ZYBA 3QC4A 2UVZA 1YXVA 4IMYA 4XG3A 5FGKA 3LVPA 4AZWA 2PTKA 2UZOA 3M2WA 3KQ7A 3VC4A 3UIMA 3QBNA 3ROYA 4IJ9A 3ZRKA 4FKRA 4HVHA 4ANBA 4U3YA 3HMIA 3V5QA 4AACA 4HGSA 3BHYA 4E4LA 4RX5A 3NUPA 2HZ0A 4GK2A 2PE1A 2QURA 4KKHA 4Y73A 4HPUE 2G2IA 5FLFA 2ONLC 3FBVA 2XS0A 4V0GA 5EI2A 3TTJA 1XH9A 5J79A 2UZBA 4EKLA 3CR0A 4YJSA 2GNFA 3Q32A 3Q04A 3ETAA 3OCTA 4PNKA 2ZVAA 1H08A 4BDAA 4ALWA 1FOTA 5KKRB 4RG0A 2PZRA 4FV5A 4EQUA 4GUEA 3KXHA 3N4TA 4I1ZA 2BILB 4FOCA 5ETCA 3QUEA 5HLNA 1UNLA 2V5QA 4Y46A 4TWPA 4KABA 2OICA 2I40A 3AQVA 1WBWA 2VWVA 4ZTRA 5CX9A 5CEKA 5EW8A 3ELJA 3OOMA 3W18A 1H1PA 4ASDA 1M14A 5AUXA 5C4KA 3JXWA 3FMDA 1OIRA 4AAAA 4C33A 4IQ6A 4L44A 2JIUA 4FIIA 3VQHA 4LG4A 2HZIA 1ZMUA 4EH6A 3E7VA 3CY3A 4FGBA 4KS7A 3BHTA 4OW8A 5E8XA 5HBJA 5JFSA 5IQIA 2XNBA 5IPJA 2QG7A 2W5AA 5E91A 3VS2A 2NPQA 4P5ZA 4D2PA 2Q83A 2BZHB 5ANEA 4G9CA 3R21A 4ITIA 4EK8A 5AUWA 4NZWB 1DI9A 4Q9SA 3O96A 2W17A 4ZLOA 4ANNA 4DFNA 3EQBA 4UBAA 3MS9A 4DFBA 2OFVA 5HQ0A 3PP0A 4YO6A 4RIWA 1R0EA 2W1CA 1B38A 2YCQA 3GCPA 4FSZA 5M4IA 3ATTA 3OXTA 4U42A 4NWMA 5AP1A 3FMNA 2WTKB 3RINA 3TT0A 1KOAA 3MPAA 3FHRA 4EH3A 3A7FA 1B39A 3UBDA 1WBSA 2R4BA 3GEQA 1P4FA 3NZ0A 4JRNA 2WAJA 3DDQA 1KE9A 4IB3A 3F3UA 1R3CA 2XIXA 4ZS0A 2YA9A 5GJFA 3P9JA 4C4GA 4O81A 2HK5A 5I0BA 3LFCA 4FNXA 4ZMEA 2PVMA 3CBLA 1PYXA 2F2CB 4DH7A 3TKUA 2W9ZB 1XHAA 3QALE 3QHRA 2CKEA 5KZIA 5CSWA 4RQVA 4XCUA 4OAUC 3LCDA 5AR2A 1AD5A 3QRUA 2HZNA 2VTRA 4UXQA 4MXOA 5B2KA 5JFXA 4IEBA 2Y7JA 3AT2A 4XLIA 4TN6A 4RJ5A 4RIOA 2HY81 4AGWA 4HJOA 1PMEA 4YJUA 2QNJA 3F82A 4TYJA 3NW7A 4K6ZA 3QWJA 2VZ6A 4FK6A 3V5TA 4EOQA 4ZSAA 3BYUA 3DXNA 2UW0A 2EXCX 3LMIA 3NCZA 4FSUA 5CALA 5IH6A 3UO5A 4TT7A 4J53A 4ZXTA 2CKQA 3UTOA 5C8MA 2WOTA 2PVKA 3AC8A 5DEWA 2XK3A 4BWXA 3LCKA 3DJ6A 2HWOA 2QOFA 1OL5A 5CU3A 3V8TA 3HMOA 1YQJA 2JGZA 3MH3A 3HV3A 3HDMA 4U0IA 5A6NA 5CAPA 4RX8A 5HEZA 3VRZA 5CS6A 3VUGA 1LUFA 4YC8A 2OJIA 2UZEA 2OW3A 5AMNA 3SXRA 1OUYA 4KNBA 3A4PA 4RJ8A 5AR3A 5AR4A 1WCCA 4F7LA 4XLVA 2X1NA 4FOBA 4FV0A 2J6MA 4NJ3A 1XWSA 2PHKA 4FF8A 4I92A 5TO8A 2Z7SA 3FZTA 2I0HA 3QKKA 3CPBA 4S30A 4IM0A 3LQ8A 1CSNA 4M67A 1QPEA 3CSVA 3KU2A 3DXPA 4PMTA 3D83A 4KIOA 3E5AA 4EBWA 4PMSA 1STCE 3KVXA 2GFSA 3PA3A 4EONA 3D9VA 4XBUA 3FQHA 3NW5A 4GYGA 1OBDA 5C03A 2JDOA 3F7WA 3R7YA 1BL7A 4FUYA 3OCGA 4AE6A 2YDKA 4TZRA 4YZDA 5ETIA 5LMKA 2C1BA 4O6EA 2QO2A 1J3HA 4RIYA 3SAYA 1CKJA 2FUMA 4NFNA 2NNWB 4IZAA 4XG8A 2QOHA 1R1WA 1MRUA 1X8BA 4RWLA 3BHUA 3DOGA 5CAUA 3PXKA 4ANQA 4U3ZA 3C7QA 2FB8A 1PMNA 1YWVA 5LWMA 3FL4A 2YCSA 3GP0A 2YLEA 4R8QA 3POZA 1FBNA 2ERKA 2FA2A 2GTMA 2HXQA 5CI6A 4K33A 3QX4A 4PX6A 4IM2A 4ARKA 3SXSA 4AWIA 4YUQA 4BB4A 3QTXA 5JFWA 3DS6A 3EN6A 3QQLA 4BR3A 1MRYA 3WBLA 3ZO1A 4CV9A 4BGGA 2CKOA 1NVSA 3OUKA 4FTCA 3EYHA 5EG3A 3RTPA 3RWPA 2R2PA 4CNHA 4BZDA 1SMHA 2X2LA 1YDTE 2A27A 3AD6A 2FVDA 4QQJA 5E8YA 4MBLA 3R9HA 1V0PA 2WMAA 3BCEA 3WI6A 1R39A 4WG4A 4FIEA 1Z57A 4NIFB 3E8CA 2BVAA 2GS7A 1H1SA 2YIWA 3LFSA 4N6YA 5KMJA 4JJRA 3PSDA 3DK3A 4I24A 2CCIA 4OBQA 3GCSA 5EYMA 3EWHA 4YMJA 3MB7A 5E8TA 5HO7A 3LIJA 4FKPA 3UVQA 1SYKA 3DAEA 1BLXA 4XX9A 2V55A 4FV3A 2Y6MA 3UP2A 3C4FA 4ASXA 3EN4A 4HVDA 1Y57A 4TKSA 4X3JA 4AZEA 5BVNA 5FQDC 4QMUA 3P5KA 1PHKA 2P2IA 2XK7A 3C0GA 2W4OA 2YERA 3FXZA 3FV8A 2CNQA 1QCFA 4KRDA 4WRGA 3F9NA 4I6QA 1UNHA 4XP2A 1H00A 3K3IA 3ZFXA 3POOA 2WU7A 4OTPA 3P86A 3DFCB 3FXXA 3HA6A 3KF7A 1YI6A 4O0XA 4QMPA 3ZUVA 5AAEA 5IUHA 4EOMA 4GYIA 2R3LA 4JDIA 4UY9A 2BKKA 3VUHA 3TUCA 3NEWA 5GZ9A 1JVPP 3NUYA 3BYVA 2EXEA 1ZY5A 1RJBA 4OBPA 5H8EA 1ZWSA 4C7TA 2Y4PA 3IGOA 3VF8A 3KK8A 4LQMA 4HZSA 2G2FA 5CVHA 2QOCA 3ORKA 1A9UA 1KWPA 1YWRA 4GFGA 3OCBA 4ZJIA 5KO1A 2Z02A 5FG8A 3VBTA 1UV5A 1XJDA 4GL9A 4ANSA 5M56A 2VTSA 1KE6A 4YTCA 5C8KA 2XYNA 3NYNA 4WBOA 1YRPA 4LFIA 4KA3A 3V51A 4AW0A 2B9JA 2VTPA 2X2MA 1GNGA 2FO0A 2KTYA 3QGYA 4JOAA 4K11A 2YM3A 5TT7A 2SRCA 5C4LA 5EM5A 4RMZA 4O7VA 4L42A 4E20A 1U54B 1GY3A 4K0YA 5DPVA 2G2HA 3ORIA 4ITHA 2F57A 1OPKA 3GCUA 5D1JA 2RF9A 3NYOA 5LCKA 2WNTA 2EB2A 3OBGA 3RZFA 4YURA 2ZB1A 3DTCA 3E8EA 2OIDA 5FXRA 1RDQE 1K9AA 3ULIA 4HYSA 1H8FA 2J5FA 5DE2A 3TNPC 3QUPA 1FVTA 4NJDA 3M11A 4NTSA 4JBQA 5IA1A 1JKTA 2IJMA 4PNIA 3UJGA 4IM3A 2BCJA 1ZY4A 4C4HA 2JC6A 4DFUA 4W9WA 5HBHA 3G33A 2QONA 4JDHA 4W8EA 3A4OX 4LL0A 2WIHA 5KBQA 2XNPA 3R2BA 5IQBA 2PE0A 4OTGA 4FYNA 1IR3A 2VV9A 2VTAA 4GCJA 2ZJWA 3HV4A 4FBXA 1JSVA 1F3MC 2XM9A 3FLNC 3OWLA 3ZO4A 1FGKA 3IW7A 3R28A 4J71A 4M66A 4ZTQA 1SVGA 1NT2A 3HYHA 1TVOA 4EC9A 3PXFA 4ENXA 3IW8A 4DINA 1SZMA 1PXIA 4XG2A 3U6HA 3F6XA 3VS3A 4PDPA 1PY5A 3P23A 3P78A 3VJOA 4RVKA 2JFMA 3QTUA 4B0GA 4GK4A 4FIJA 2XZSA 4IVAA 5BVEA 4H3PA 2O0UA 4B8LA 4EOIA 2WMVA 3OG7A 4HNFA 4EOLA 1P5EA 3LXLA 3OD6X 2IZSA 3JVRA 5KMLA 3O8UA 4QP9A 4YPDA 5HVKA 2J50A 5C9CA 2JIIA 1WVYA 4YZNA 2WKMA 5C26A 4JQ8A 1ZMWA 2WTIA 4IVCA 4JG8A 5A3XA 3GU5A 3Q4TA 3VIDA 4MEDA 3R9DA 2JAMA 5CANA 1M7NA 2R7IA 4QT1A 3E88A 3TL8A 4F0GA 3R00A 5FXSA 2GS2A 2I0VA 2VO3A 4EZ5A 2R7BA 3EL8A 2NO3A 4FT9A 5JRSA 4I5HA 3AC1A 2BRHA 3H0YA 2CNVA 4DLJA 1H0VA 3HKOA 5B2LA 1OPLA 1OB3A 5JH6A 3F2AA 2OSCA 2RSVA 4FR4A 5DG5A 4C2VA 3BIZA 3CGFA 4M7IA 2XK9A 3QZGA 5EHOA 3H4JA 4NM5A 1XH5A 2C6IA 4QP2A 5G6VA 1U46A 3KREA 4Z7HA 1PKGA 3IS5A 1CM8A 3R7UA 3RNIA 1XQZA 5CXHA 5JGDA 2DS1A 5HTIA 4P4CA 1W7HA 3D2KA 4IWQA 5EOBA 3FY0A 1LEWA 5HZNA 5F4NA 1SNUA 4H3BA 3QL8A 4O0YA 4BDFA 1O6YA 4GS6A 3PDTA 4ORKA 3T8OA 4KBCA 3ZYAA 2XVDA 3UIUA 4E3CA 3NPCA 3F3ZA 3DBQA 4LOOA 3LFDA 4IAYA 4YTFA 4Y83A 2WOUA 4KB8A 3OTUA 2JIVA 1UWJA 4I0RA 4I3ZA 2WXVA 3QXOA 3EIDA 4LYNA 3U87A 3ZC6A 4F1MA 4D4SA 3RPYA 4DH3A 4I93A 2JKQA 4F08A 2HY0A 3ZLSA 4C4JA 2OZAA 3NUXA 5FDXA 2ONLA 4ANLA 4L01A 5GZ8A 5BX0A 2GNGA 1W8CA 1URCA 4UZDA 5DR6A 4NM3A 4V04A 3FAAA 3FLZA 3W32A 3A62A 2IZUA 3SV0A 3OF0A 3FLYA 4CFFA 5HD4A 1GZKA 1TKIA 3SW4A 4W4XA 5JSMA 2OZOA 5TKDA 4Q5HA 4FIGA 4U45A 5LQFA 1E1XA 2VTNA 3C0IA 4CYJA 4C58A 3E7OA 3WF8A 4KWPA 3RAWA 2WQMA 4A9UA 2W99B 3VUDA 2P2HA 2WU6A 4YBKA 4XG4A 4H3QA 4PMMA 4UWBA 5F9EA 5LVMA 1UA2A 5LVOA 3O7LD 4GT4A 4BWKA 2ITVA 3R9OA 5CF8A 5A4QA 4BZNA 3IQ7A 2YDJA 3N9XA 5EHLA 5TOZA 1APME 3CKWA 1FVRA 1ZXEA 3NIZA 3OMVA 5DOSA 5EDQA 4MXAA 3KA0A 3VBWA 4FA2A 4AOIA 3NVKI 5LVPA 4FSWA 4D2WA 4CFNA 3KFAA 3ORPA 4AN9A 2RFSA 4FTAA 3QKMA 4H1JA 2ACXA 4EQMA 2IVVA 1WBTA 4GK3A 3KC3A 1WBNA 4RPVA 1WVXA 2VTLA 2YAAA 2PWLA 3BGPA 3GC7A 5AWMA 2HW6A 3FQEA 4G31A 3WZJA 3PJ1A 4TWNA 3W10A 5EDRA 5C27A 4OAVB 1YWNA 1J1BA 3QRTA 4GIIA 2ZV8A 2CGVA 4CD0A 5E8SA 1H01A 4F7NA 4EYMA 2VNYA 2DUVA 3V6RA 4XOYA 4HGTA 2Z7QA 4UEUA 3PG1A 3RK7A 3PLSA 4XV3A 2VTHA 3I79A 3IOKA 1U54A 3PWDA 3ZLWA 3TUBA 3IDBA 4FV2A 1Z5MA 3FWQA 3F61A 2VN9A 3T9TA 1Q8YA 4S2ZA 5I3RA 4HYUA 4XV1A 2BRBA 1AQ1A 2Z8CA 4I6FA 4AUAA 4N0SA 4BDKA 4IXPA 2X7GA 4JBOA 3R2YA 4K2RA 4UV0A 3ZMMA 2C6OA 3PJ3A 3WARA 4E6AA 3ENHA 3ZRMA 1JPAA 5CAQA 2OWBA 3PXQA 4YLJA 3CJFA 3FXWA 3ZC5A 2J51A 2O64A 5CEOA 3KULB 3UMXA 4XG9A 5F20A 1W82A 5M4FA 4G6OA 1S9IA 4FODA 1JKKA 4CEGA 2R3QA 4QMZA 4M69B 5HI2A 4IB0A 4CVAA 3EQHA 5AP3A 4YLLA 2O63A 1XBBA 3VHKA 2C6DA 2PZYA 4E4NA 3MJ2A 3FMJA 4P7EA 2GPHA 1GZOA 3UP7A 4CLJA 3BGZA 3WZEA 4UMPA 2JFLA 2Y8OA 4G1WA 2X6DA 4R5YA 2CNUA 4O91A 5AAFA 4F9AA 5AV4A 3E93A 2BDJA 3V6SA 3LZBA 4PTCA 4RA4A 5BUIA 2G9XA 3TV4A 4BL1A 5CY3A 1YW2A 3G5DA 2WTWA 3ULZA 4TXCA 3VBVA 3CQWA 1ZZ2A 2GFCA 5KMNA 2H34A 3DNDA 1VZOA 2IW8A 2XMYA 3NUAA 4IWDA 4D4YA 3COIA 4ZSGA 2XK4A 5FWKK 5IZFA 3FI2A 2BHHA 3TKHA 2QD9A 4FV9A 4DLIA 4J96A 3BI6A 3TN8A 2W1IA 3R8UA 1JQHA 2JDSA 5HE0A 4PMPA 2R3IA 3CXWA 2R3GA 3BLQA 3EN5A 3A99A 4GJ2A 3IO7A 5CQWA 5CEMA 2IW9A 2YCFA 2DQ7X 4CMUA 3F2NA 4PRJA 4BZOA 3NNWA 5B0XA 5T3QA 2XRWA 3VAPA 3U6JA 5GIOE 4A4XA 4GFOA 3UOLA 3V8SA 4DC2A 4MXZA 3VWAA 2ERZE 4G17A 1SNXA 4E93A 3MA6A 2O65A 3PA4A 3SOCA 4BDJA 3QTSA 5TE0A 4C4EA 3CC6A 4O86A 3DKOA 1TQIA 4QYHA 2EVAA 4GV1A 2Z7RA 3VN9A 1Q24A 4BCFA 4ZY4A 4L45A 2YIRA 4TNDA 3VW8A 4QO9A 4CTCA 2G1TA 4FSQA 4HW7A 3BHHA 4R78A 3P1AA 2XKEA 3C50A 1OKVA 3L9LA 3ZUTA 2YM6A 1YOJA 1Q41A 2X9EA 5CU4A 4OTDA 2BDFA 2BHEA 2VTJA 4HVIA 3DKGA 3MN3A 2W9FB 1I44A 4C57A 2QO7A 3PY0A 2C3IB 5LVLA 5HU9A 3ZONA 5DRBA 1ZRZA 4UMQA 5LARA 1KE7A 4WKQA 4M97A 4CCUA 3NRMA 4DYMA 3WZDA 4PP9A 4IH8A 4I0SA 5CEPA 4FE2A 2XK6A 4ALVA 4BHZA 4DFZE 3R1YA 5DVRA 1JAMA 1OMWA 4I21A 5I4NA 3PVUA 3HRBA 3AC5A 5IUGA 3MVMA 4R3RA 4EL9A 3S3IA 3DAJA 4G3DA 3WF7A 4W4YA 3DBCA 4QYGA 4HGEA 4XRJA 2OJJA 3ACKA 2YM8A 4KKGA 4QQ5A 5JZNA 2YFXA 3EKKA 4I6BA 2B4SB 2ITUA 4A9TA 3SG8A 3PPKA 2QO9A 3LFBA 5E1EA 5IQCA 5ANDA 4ZZMA 3ORMA 3R7VA 4QP8A 1KV1A 5J9YA 2ZM4A 3DNEA 3PG3A 3B2WA 2X7OA 4DEDA 3QCXA 5M57A 1VYWA 4YZMA 3AC3A 4I5PA 3NCGA 2XNGA 4JI9A 1DAWA 3UQGA 4BI2A 2VWWA 3DAKA 3A7HA 3O7LB 4KRCA 2X4FA 1MUOA 3HRFA 4ZLZA 3OT8A 1Q61A 5A46A 1YI3A 5BYYA 5J8IA 1O6LA 3UQCA 4K8AA 5AR8A 2R3HA 4JXFA 4QYYA 5CEIA 5EHYA 4AZVA 5F1ZA 3BLHA 3FMMA 2AC5A 3Q4ZA 4Q5EA 3PZEA 4AW1A 3NUUA 4X2NA 4NW5A 5FBNC 1NY3A 3O50A 3QZFA 4WG3A 4X2KA 5ANOA 5HNIX 5JEBA 2QOBA 3IKAA 3KRWA 3QU0A 3C4XA 2J90A 3TJDA 4L8MA 4ACCA 3TACA 5HG7A 2V62A 4JR7A 4OTIA 4UALA 5HG5A 1YOMA 3QWKA 4FGRA 3RCDA 5J95A 5IA4A 2OG8A 5HHWA 5EDPA 3BHVA 3E87A 4MXCA 4QRCA 3PXYA 4XNEA 4U8ZA 3MTLA 1OKWA 5BUJA 3IW6A 3PVGA 3D7ZA 3V5WA 4QNAA 4YJQA 3W2SA 4DF3A 4GKIA 4RZWA 1ZZLA 4D5HA 5IA3A 1H26A 3DFAA 4E4XA 3WYYA 3ZCLA 2R3OA 5CZHA 3PJ2A 4RLLA 2QC6A 2XIRA 4E6CA 3A7IA 1Z9XA 4FTNA 3KXMA 4AU8A 2OXDA 2HOGA 2V22A 3VBXA 3ZRLA 3UIXA 4O7SA 2OU7A 4EWHA 4R77A 3GNIB 3EZVA 1GJOA 5BVDA 1FINA 4YBJA 4ANMA 4D4VA 4FZ7A 1G8AA 4LMUA 2R5TA 1J7UA 4RBLA 2UZTA 2R64A 3EQCA 5CWZA 4YHFA 3FYJX 4YJVA 3DK7A 4G5JA 5A9UA 5HBEA 4O83A 3D5VA 2I0EA 4PPAA 3O17A 3ODYX 4RZVA 3II5A 3VO3A 1P4OA 1V1KA 2Z7LA 2VD5A 3PWYA 3NYVA 4M69A 2VNWA 4JL9A 5K3YA 4A9RA 2FSTX 2PMNX 3AGLA 3CKXA 3L9NA 4QYFA 4XV9A 5FM3A 4BHNA 5HCYA 1ZYJA 5GHVA 4N4SA 4F0IA 4F63A 5AFVA 2YJSA 4MQ2A 5EM7A 5GJDA 4P2KA 4CXAA 4DEAA 3HGKA 5KMKA 4HCUA 1IA8A 3CCNA 3VS5A 2CSNA 1F0QA 1ZAOA 1LEZA 1Q99A 3O8TA 5M53A 2VWXA 2WMSA 2YZLA 3LFNA 3OHTA 4J7BA 3AT3A 4U5JA 4QQTA 2VTQA 4PWNA 2QU5A 1ZOEA 4OTRA 5ETAA 4ALUA 3KVWA 4WNOA 3E63A 3ZUUA 3JY0A 4Z3VA 3R1NA 4PPCA 3UPXA 4AGUA 3NDMA 4JQ7A 5DBXA 3AOXA 3S0OA 3DY7A 5C1QB 5TR6A 5CU2A 4GVAA 5HVJA 4U97A 5IA5A 1GZNA 1L8TA 2DWBA 5AP4A 3ROCA 3ENMA 4ZTMA 5IDPA 3OXIA 2ITNA 3P0MA 1WBVA 2VU3A 3QFVA 4IFGA 4U44A 3WZUA 5CSXA 3DKCA 2C3LA 4HGLA 2UZUE 2W4JA 1JLUE 4J1RA 5AP7A 4HYHA 5JZJA 2OH4A 3KMWA 2BR1A 4GT3A 4FEVA 4KSPA 5CASA 2C30A 2PVLA 4AQCA 1KUTA 3Q9WA 4N70A 1U5QA 4CT2A 3MB6A 5AUYA 4I22A 5FTQA 4MYGA 3EN7A 4FNYA 5A4LA 4WHZA 4EJNA 3UC4A 4XUFA 5DT3A 4AGDA 2YITA 5I9VA 5KX8A 5J87A 4WBBB 3CTJA 1RQQA 4AW2A 2GTNA 3OUNB 3K2LA 3L8VA 4FICA 3W2CA 4Y8DA 3ZZEA 1XO2B 2V7AA 4FNWA 1CKIA 3DGKA 5C8NA 2IPXA 1BUHA 2RG6A 2UW6A 2YHVA 2RGPA 2XP2A 3DV3A 1ZARA 4MWHA 3Q3BA 1HOWA 4KKEA 1UKIA 4ACDA 2CJMA 4FTQA 3VBYA 5EQPA 3R73A 1UU3A 2HIWA 3G6GA 3GU6A 3TNQB 3BELA 4AN2A 3H9OA 4NSTA 5AX3A 5K5NA 4X21A 4G9RA 2BROA 4C4FA 4I4EA 3MYGA 5L8JA 1KOBA 2B9HA 3R7OA 4LRJA 1W84A 2YDIA 3CIKA 2EUFB 2OJGA 4UYNA 3G9NA 4YGAA 4YHJA 3TIZA 4BTFA 2C0TA 2VRXA 5K5XA 4WNPA 5IISA 4ZMFA 4FV8A 2R3MA 1G3NA 1U59A 3HV5A 4DEIA 3G6HA 2C0OA 3C51A 5E4HA 4O2PA 5CU6A 3KXGA 4S32A 3TKIA 3W2QA 4YNEA 4QYEA 5F95A 4FV4A 4KSQA 4MNEA 4HZRA 1OIYA 4QP3A 3TNWA 4CG9A 1ZYSA 3FC2A 3Q2MA 4RC3A 3LQ3A 2PVJA 4AOTA 5T6KA 2WD1A 3BX5A 2GNIA 2EXMA 3GC8A 4D55A 3CGOA 1CMKE 3UVPA 4JQEA 4C34A 4IADA 5H8BA 2XF0A 2REIA 1A06A 3KGAA 3RVGA 4ZIMA 5ACKA 4BWPA 5B7VA 5BVWA 5KBRA 4NL0A 1JWHA 5L8KA 2YCRA 1PXJA 4AOJA 4QMLA 3LE6A 3HMNA 3DK6A 1HCLA 3R71A 2Q0NA 3TWJA 1KV2A 2A2AA 3EFKA 3OS3A 3UODA 4CMTA 1PXNA 1W0XC 4CV8A 5CAVA 2YM5A 2UZLA 4JR3A 4MD7E 4EOKA 4X3FC 4MVFA 4U81A 3KCFA 3SRVA 1PRYA 5IA0A 1PXKA 4NM7A 4AF3A 3QTRA 3QRIA 3NR9A 3MVHA 3U9NA 5BYZA 4O0UA 5E90A 3TZ8A 2QLQA 4OTFA 1J7LA 2XKDA 2R9SA 5JK3A 5ITAA 5HOAA 2YIQA 4EK3A 1K3AA 2YN8A 3NNVA 2GNLA 1XKKA 4QTCA 3SW7A 3ANRA 4IHPA 2VX0A 4JVGA 4A4OA 5L3AA 4F0FA 4F9WA 4USFA 5L2WA 4MH7A 4RJ7A 4FZ6A 4MWIA 4QMQA 2QQ7A 2XIZA 1J7IA 3MH2A 2XH5A 4X2GA 5BUEA 1FPUA 4DTAA 2W1ZA 4I5CA 4M15A 4I4FA 4O21A 3LXNA 5E1SA 4CFVA 2VWUA 3RZBA 3DZQA 3EHAA 4FVRA 4IX6A 4K77A 4LL5A 4FTRA 5HD7A 3JS2A 3O0GA 3A60A 5D10A 3HVCA 5J5SA 4RC2A 3H0ZA 4H36A 1VJYA 2EWAA 4FEUA 3MY5A 3QLGA 3QXPA 3SDJA 1IAHA 5CNOA 4RVLA 3OXZA 5M55A 5FD2A 5HG9A 4GVJA 4U43A 3ZLXA 4NM0A 1EH4A 4UMTA 5AV1A 4BRXA 4DGGA 4KIKB 4WSYA 5I9WA 3NWWA 2VWIA 4GT5A 4BBMA 4Q2AA 3LFEA 4CQEA 5L4QA 3OT3A 4R7HA 3ORTA 4G16A 4WRSA 2W5BA 4A9YA 5AA8A 4QMSA 2UZDA 2XK8A 1OKYA 1Q5KA 3QTQA 2PUPA 4RIWB 2BIKB 1NVRA 5B2MA 1OI9A 4EWQA 5KMMA 2IG7A 5KHXA 1VYZA 5EH0A 2ZB0A 3GBZA 3NSZA 3OWKA 3A61A 4RC4A 5HIDA 2HCKA 4TPTA 1M52A 3DB8A 3QYWA 4QMXA 5CENA 4CFUA 4PTEA 2V0DA 5J7BA 1ZYDA 2CKPA 4BCJA 4CGAA 4DEBA 4IAAA 5H8GA 3I60A 2X9FA 2X2KA 3O2MA 3HV7A 4FKLA 4IDVA 4CZUA 2OZAB 4O82A 3C4ZA 4UMUA 2QOQA 5GZAA 3R02A 3RPOA 2ETMA 5C01A 4BY9E 3PJ8A 5KHWA 5CNNA 3ORLA 2YJRA 1O6KA 3FKNA 3L8XA 5A14A 3FMHA 1VR2A 5CT7A 4OBOA 4DGLC 4JIAA 2ETRA 2ITWA 3FSKA 2QKWB 3SHEA 5EW9A 2PE2A 1XH8A 4FNZA 4BI0A 4R5SA 5EI8A 4F1TA 2W06A 4YTHA 2WMQA 3QRJA 4OR5A 3QC9A 5IA2A 3DZOA 3R01A 3TZ9A 3JY9A 4I0TA 3B8QA 1XH6A 4ZS4A 3F5GA 4C3RA 4L7SA 1OL2A 3E3BX 2OLCA 5H3QA 3TJCA 2PVRA 2F9GA 3HV6A 2XNMA 4S31A 4L67A 5D41A 3SQQA 2CLQA 1GZ8A 1FVVA 4C0TA 4LV5A 4Y95A 4ZZOA 3HAVA 2ZV2A 2BAQA 4BGQA 2WQOA 4J97A 1WZYA 3MWUA 3FJQE 1PMUA 3R04A 5IU2A 5LJJA 3D14A 3TDWA 2YM7A 3H9FA 4XMOA 4ENYA 2NP8A 3KXNA 3LM0A 3PE1A 3CEKA 4UMRA 2RFDA 4FV7A 3RHKA 4NH1A 4FTIA 5K0KA 2I7QA 1YXXA 2LGCA 2I1MA 3E3PA 4HYIA 2WGJA 5AIRA 4CMOA 3C4CA 4U40A 3I81A 3LJ1A 3MA3A 1K2PA 3EQFA 3F3TA 5CTPA 4R6VA 5AV3A 3RGFA 3I1AA 3ZSGA 4EYJA 4CRLA 4YO4A 4DFXE 2H6DA 4YTIA 2XKCA 5JN2A 1IASA 4IW0A 4NUSA 5HGIA 4B8MA 2BTSA 2GU8A 5AX9A 4PP7A 5CSPA 2PPQA 5EQYA 3WZKA 4GW8A 2FYSA 2WEIA 3KKVA 3ZSHA 4QD6A 3Q60A 5EKOA 4TRLA 1M7QA 3KXXA 4J95A 4ZSLA 4ZTSA 4JG7A 4FTJA 3NLBA 5E8VA 5J9ZA 1Q8WA 3VRYA 4RFZA 3HUBA 2XA4A 2EB3A 3PRIA 4PV0A 2CHLA 3FZOA 4DCEA 4O38A 2UZVA 1BMKA 2O2UA 1PYEA 5CF5A 1ZOHA 1V0OA 4GJ3A 3CP9A 1M17A 2R3JA 3H10A 2PK9A 2X4ZA 3AC2A 2J0IA 4ZZNA 3VUTA 3COKA 4IZ7A 5HVYA 1PMVA 2QODA 4YC6A 4BCHA 3MBLA 4AP7A 4OT5A 4G34A 5JQ5A 4EH5A 4WSQA 2V7OA 3D2IA 2UV2A 3F66A 3KCKA 4PUZA 3LW0A 5IEVA 3GQIA 3EB0A 2ZAZA 2H9VA 3RPVA 3U4WA 1V0BA 3VHEA 1W98A 4ZTLA 3BYSA 3QX2A 3ZU7A 1E9HA 2VX1A 3LJ2A 4E4MA 4YP8A 3QQJA 4YLKA 3UOJA 4IE9A 3FSFA 3PA5A 1QPCA 4IX5A 2OJ9A 4IWPA 3NVMB 4YJOA 4BGHA 5LXMA 4O0WA 2WTKC 2UW3A 2YACA 2PUNA 2CN8A 4FKVA 4FL3A 3ZXTA 1FMOE 2ZMCA 2GHLA 3LFQA 3I5NA 5LWNA 1Y8GA 4BCQA 2ZV7A 1A48A 2P0CA 5DRDA 4BCIA 4B6LA 3I0OA 4AW5A 1O9UA 4G2FA 1YHVA 2JLDA 1S9JA 2W0JA 4DG2E 2GSFA 2R3FA 1FMKA 3KK9A 4JS8A 5FEQA 1YI4A 4YPSA 4BDCA 3AD5A 4RVMA 5FDPA 1CKPA 3ATSA 2W5HA 4FYOA 4DBXA 2E9UA 1G5SA 3DU8A 4JNWA 1J91A 4W8DA 4MKCA 3V5JA 3FHIA 1Q4LA 1P2AA 3DBEA 3KN5A 4R1YA 3EFJA 5GINE 3MW1A 1UU9A 3GUBA 4O7NA 3IW5A 4U79A 4ZY6A 4EC8A 4RRVA 4IDTA 2OFUA 5EQEA 4FSTA 3MI9A 3PUPA 3W1FA 4FSYA 3FL5A 1PF8A 4GEOA 3R7IA 4GRBA 4MTAA 4GUBA 5CZIA 4JX3A 1BKXA 1ZMVA 5KKRC 4R3PA 2YLFA 4C59A 2WMRA 4BCNA 5BVKA 4KIKA 5DHJA 5M07A 3QZIA 4O27B 4CQGA 3PVWA 1OIUA 4FT5A 3ZH8A 1ZOGA 4TYGA 5IQEA 3GQLA 3BWFA 4XH6A 2ZMDA 3W33A 3ZTXA 3UNKA 2JAVA 4RWJA 2VAGA 4EUUA 3W16A 5EKNA 2QOIA 2CGXA 2XCHA 3R22A 3RP9A 3ZBXA 3R7EA 3ZEWA 2F2UA 2PL0A 4IC7A 1H25A 3PY3A 3P7AA 5HG8A 4BBEA 2AUHA 3MFSA 4RFMA 1PKDA 3OOGA 3GVUA 2IZTA 4NT4A 5E7RA 5D7AA 2X8DA 1WAKA 3UQFA 1MP8A 2DYLA 3LLAA 3FE3A 2P4IA 3GOKA 1YDRE 5DT0A 5A6OA 3SKCA 4HVGA 4DGOA 3D94A 4UWCA 5AP6A 5AIKA 2XJ1A 3ITZA 3OCSA 2IZRA 4QMTA 4W9XA 4X0MA 1H07A 4AT4A 4D2RA 4EKKA 1JKLA 3L9PA 4WIHA 5KUPA 2UW8A 1H24A 3TTIA 3HP2A 3R1SA 3K3JA 3MPTA 4LRMA 1CDKA 4IJPA 4TYIA 4M8TA 2BIYA 3KRRA 1OGUA 4U7ZA 1REJA 5A4TA 1M2RA 3GXLA 3DXQA 3DQWA 3PYYA 3DBFA 3GC0A 2JITA 5KZ0A 4DHFA 4EH8A 2PSQA 3Q53A 4QTEA 2BDWA 2RFEA 3DLZA 4IZ5A 4S33A 4EQCA 1Q3WA 4LRKA 4EH4A 2QOKA 4FKTA 1BL6A 2BZIB 4BIEA 4F6UA 4L43A 1RW8A 3EH9A 3JPVA 3OWJA 2ETKA 3F88A 4FZAB 3FPQA 3REPA 4AE9A 4K18A 5A4CA 3NUSA 4BKZA 2XEZA 3G15A 4RJ3A 1WBOA 1ZYCA 4QP6A 3R8MA 1OBGA 4O7TA 4F09A 2YZAA 4F65A 4FK3A 3UO6A 4PPBA 4C8BA 4X3FB 4K1BA 3GCQA 4FTKA 2WFYA 4FI1A 2X0GA 2C5OA 4K9YA 4C35A 2ITTA 3EFWA 3L1SA 4QMMA 4FEQA 5KCVA 3E62A 5FTOA 4DT8A 2OK1A 2C5YA 2GNJA 2ZV9A 5DEYA 3C0HA 3D0EA 2BRNA 3P79A 3GFWA 3UPZA 4D2TA 3LM5A 4IAFA 5HE2A 3OZ6A 2UW9A 5FEDA 2UUEA 3P7CA 3RI1A 4C02A 4MCVA 2C5NA 5EYDA 4BDEA 5BVFA 2JEDA 3AG9A 4RWIA 2B1PA 5M44A 2UW4A 4CZTA 3EOCA 3EQRA 2HXLA 4JG6A 2JKKA 4YJTA 3OFMA 3BPRA 5DLSA 2C4GA 2XRUA 3D4QA 3LXKA 3THBA 3U9CA 4RIXB 4L7FA 2R3PA 3UDBA 3QQHA 2A19B 4V05A 4LM5A 4ZY5A 4YJPA 5J7HA 5ANKA 2WO6A 4ONAA 4AFJA 3VBQA 4W4WA 3ZS5A 2VTTA 4C62A 4FVPA 5HICA 2VGOA 2XCKA 1YDSE 2PVHA 4CFWA 3F5XA 2BUJA 2J0MB 2VO6A 3RM7A 3V5PA 4GU9A 3FLWA 3LHJA 4DH1A 2C6KA 5GJGA 3PIYA 4MNFA 3TZ7A 3D5XA 5AEPA 3BYOA 5J9LA 3BU6A 4I94A 5DH3A 4CT1A 3KB7A 5FUTA 1MQ4A 2HAKA 3QA0A 3Q9XA 4BDGA 4HPTE 3IPHA 3MV5A 4X2JA 3VS7A 3B8RA 5ACBC 4AA4A 5BQ0A 3NNXA 4L9IA 2XYUA 5CSHA 2FSOX 1DI8A 2C5VA 5LVNA 5DT4A 3U6IA 4AT3A 3ZFMA 4F9CA 2AC3A 2WQBA 3UOKA 3R8LA 5D7VA 2P33A 4DG3E 3GC9A 5HCXA 5HORA 3RMFA 4RSSA 5I9XA 3C13A 3TG1A 1H28A 3KF4A 5AAGA 3DTWA 5CI7A 4EORA 5CVGA 4G5PA 2J7TA 4XHKB 3UYTA 3FYKX 5KMOA 4DN5A 3ZO2A 4O2ZA 1H27A 3FZPA 2WQEA 4X2FA 4QOXA 3PTGA 3UYSA 4EHVA 4XS2A 3LFFA 4B4LA 4WO5A 5L2IA 3GCVA 3F5PA 4D2VA 5AUTA 2QCSA 2Y9QA 3GU4A 4EI4A 4EK5A 1JSTA 2OIQA 4H1MA 2QI8A 1H1WA 3P7BA 4Y72A 3VQUA 4EOPA 5L6WL 2FH9A 3K5UA 4IIRA 3PE2A 4XJ0A 3UE4A 4DG0E 3RALA 3MH1A 4ERKA 4F9YA 4QTDA 4FKJA 2IVUA 3PVBA 2ITYA 4OUCA 4ASEA 4J8NA 4E5AX 1SVHA 3CQEA 1OITA 2W7XA 4IX4A 5AP0A 3CS9A 4F1OA 5IG1A 3ALOA 1ZYLA 4AXAA 4NIFA 1Q8UA 2WZJA 4F64A 4F99A 5CQUA 3PIZA 2Q0BA 4C61A 3H30A 2B0QA 2WMTA 5FXQA 3OWPA 3N51A 5E9EA 4BFMA 4IVDA 4GKHA 3IDPA 4WNMA 3UVRA 5JRQA 3LJ0A 4TNBA 4I5MA 2VTOA 4B9DA 4EH7A 1YKRA 3V8WA 3W2PA 3C9WA 3FY2A 4HCVA 3SG9A 3DCVA 1GIJA 2YM4A 3ODZX 4FKUA 4L6QA 4M3QA 4QQCA 3WE4A 3QGWA 1MQBA 5IF1A 2B9FA 2GQRA 4S34A 1OIQA 2O8YA 4IACA 5IKWA 4G3EA 4LOPA 2UW7A 3O51A 4B7TA 4F70A 4GH2A 2GCDA 3BQCA 5BMSA 5L2SA 4ERWA 4ACMA 5HTBA 3ZM9A 5L6PA 2IN6A 2JDRA 3MTFA 3F3VA 2Y0AA 4RX9A 4YSJA 4DA5A 4FC0A 3WYXA 2CGUA 3ZFYA 5HKMA 3ZM4A 3RK5A 4L53A 5DFPA 3Q4CA 3RAHA 3F5UA 5HE1A 4Z55A 3R0TA 3C5IA 4D1ZA 5M06A 3OY3A 4FKOA 4IWOA 3VS1A 2UVYA 3G90X 3RHXA 4Q9ZA 2OIBA 4TYHA 3FC1X 3MDYA 1JSUA 4UYAA 2PVNA 1E1VA 3QQFA 3KY2A 2C6MA 4GMYA 4WT6A 3M1SA 4L46A 2JKOA 3VUMA 2RIOA 1UNGA 3MH0A 3U51A 4AFEA 2BTRA 4M12A 2C69A 5KE0A 2X39A 4RLKA 2J0LA 2J9MA 2QLUA 3DJ5A 4IB5A 1U5RA 4MNEB 2PUIA 3EQPA 4CFMA 1UU7A 4AZSA 2A1AB 2ZDTA 5EW3A 4AS0A 3O23A 2KULA 1ATPE 4LI5A 4PTGA 3G0EA 5L2TA 4JRVA 1OECA 2XEYA 4CRSA 4JDKA 2JBPA 3QTZA 3KULA 4QPMA 3QAME 4EZ7A 1ZLTA 4EH2A 3MJ1A 4O7YA 4QNYA 3MY0A 2VTIA 5GNKA 4EK6A 4JIKA 3ANQA 3C5UA 4M84A 3UC3A 4FTMA 4BCGA 3UG2A 1FQ1B 2QHMA 1BI7A 1PXPA 3LMHA 4DEGA 2QG5A 2B55A 3V5LA 2NRUA 2OF4A 4D58A 3Q96A 4J8MA 1CTPE 2J2IB 2JDTA 4GG5A 3HRCA 2ITQA 4XEYA 4EOJA 3DDPA 4DFYA 3JR1A 3VW6A 5BYLA 3A8XA 5F94A 3Q5IA 3S95A 5IQDA 1Q3DA 3BKBA 4WG5A 3W55A 1OPJA 4R7IA 4F9BA 2GHMA 2OGVA 3DKFA 3ZBFA 3OW4A 3TZMA 1QL6A 3WF9A 1XR1A 4H58A 4JX7A 5ETFA 2W1EA 3RAIA 2UZWE 4PQNA 4E7WA 3BE9A 5E8WA 3GOPA 4GSBA 3UOHA 4HVSA 4FG8A 3D15A 4R3CA 3QD4A 1Q97A 2O5KA 2OF2A 3K54A 4APPA 1LR4A 4ITJA 2X7FA 4KS8A 4HNIA 5EK7A 2IO6A 3PZHA 4FG9A 5EYKA 3E64A 5HU3A 2PU8A 4A06A 3OVVA 3SXFA 4CKIA 5AUUA 4MF1A 2HYYA 3AC4A 5AR7A 3IONA 3ZOSA 4MHAA 4OTHA 5DI1A 2ZM3A 3VS0A 3LFAA 3NYXA 3CD8A 3O8PA 5GIPE 1Y6AA 4D1SA 4FVQA 1WMKA 4XBRA 4DH5A 4GIHA 5JFVA 4BDDA 3R9RA 3L8PA 5IUIA 4ZK5A 1JKSA 4LGHA 3QQGA 4JDJA 5AR5A 5HNBA 3R8PA 3TIYA 4EEVA 5CU0A 2YWVA 1WBPA 5K4IA 4E26A 4FT7A 5A4EA 4BF2A 2CN5A 3HA8A 4XYFA 4TTHB 3UZRA 3A2CA 2I6LA 2BALA 3FMLA 3FZRA 3PFQA 5I3OA 5L2QA 4FTLA 1VEBA 3GU8A 4I6HA 4YU2A 5J1WA 3RPRA 3QUDA 1RE8A 3NNUA 1GAGA 3W2RA 3IGGA 3W8LA 3HAMA 3HP5A 3HZTA 4EOOA 5FTGA 2G01A 3KMUA 5CAOA 2VO7A 5BPYA 4QP7A 3VUIA 1G8SA 5FBOA 3BBTB 5E8ZA 1GIIA 3MSSA 2JBOA 3LPBA 4G6LA 4JBVA 4FT0A 2XBAA 4G3FA 5H9BA 3VVHA 4XP0A 1YOLA 5M4UA 3OP5A 4D9TA 3PRFA 3EN9A 4U6RA 4TYEA 4RWKA 1GOLA 2UVXA 3UZPA 4ZAUA 3RNYA 3PXRA 3D7TB 4E6QA 3FLSA 1YXUA 4KBAA 3WF6A 4DGNA 5IMEA 4IZYA 3FZSA 5HX8A 5CEQA 3MFTA 4RT7A 2ITPA 4RFYA 4FEXA 3Q9ZA 2X6EA 4NW6A 4Y5HA 2BZKB 3IW4A 3OC1A 1OZ1A 4EHGA 2E9PA 4EOSA 3I7BA 4O7LA 3BRBA 5ANIA 4BVUA 2HENA 4NKAA 3C4EA 2B53A 5AP5A 5HNGA 4FL1A 1SM2A 2CPKE 4NU1A 3ALNA 3R9NA 2FGIA 3RK9A 4EK4A 3FQSA 2X8EA 3CLYA 3QRKA 3RM6A 2CDZA 4AA0A 4BYIA 1R78A 4JAJA 4LUEA 3BWJA 2R0UA 2VO0A 2X8IA 4CCBA 4J99A 1KSWA 2ZM1A 3Q9YA 5T68A 5IMXA 4QMOA 2W1HA 1H1QA 3IOPA 4YZ9A 2WQNA 5EYCA 2VTMA 2XUUA 1JBPE 4E6DA 2QOLA 3F7ZA 3PY1A 4YJNA 4C3FA 5KNJA 2XB7A 4OTWA 3T3UA 4D0XA 3UMWA 4YZBA 5IQAA 5AJQA 4O7RA 2GHGA 3PJCA 1BYGA 3T3VA 2J4ZA 3PSCA 1P14A 1QPDA 4L68A 4L3PA 2F7ZE 4AZFA 3TM0A 4D2SA 1UU8A 2HZ4A 4CYIA 4JAIA 3QCSA 4MQ1A 4FEWA 1B6CB 4IX3A 4ZTNA 4IFCA 2XJ2A 2AYPA 2ZOQA 2B54A 2C5XA 4FKQA 5HE3A 4BIBA 4E73A 4E8AA 5JQ8A 5CT0A 3BBWA 3DPKA 4FMQA 3GB2A 2WHBA 4M0YA 3ZZWA 3R7GA 3E92A 3CE3A 3F3WA 1M2QA 1HCKA 3LQ5A 4A9SA 4KD1A 5AM7A 2GS6A 3QA8A 3NMUF 2BAKA 3U54A 4DEEA 4YJRA 3NX8A 4TWOA 2NRYA 4B99A 1Q8ZA 4AGCA 5DGZA 3G9LX 2VUWA 5LCJA 3L8SA 1LPUA 4BC6A 2R0IA 3A8WA 4DCAA 4YC3A 3PSBA 3SC1A 4NCTC 4TL0A 4I20A 1GIHA 3HECA 2WTJA 3QQUA 2W05A 4L00A 4CLIA 3NUNA 2W4KA 3CD3A 4XRLA 4C36A 5DA3A 3R8VA 4D5KA 5CSVA 2PY3A
chains in the Genus database with same CATH superfamily
3TV6A 3IG7A 2P55A 3C1XA 1R0PA 3PIXA 1U4DA 3PXZA 3VUKA 1JOWB 3ID6C 3DLSA 3TUDA 4FKGA 3ZDIA 5IQFA 3HL7A 3BLRA 4D9UA 1YXTA 1AGWA 3LCOA 4EJ7A 4FZDB 2JKMA 4O84A 3NW6A 3VNTA 3D5WA 5HCZA 2WELA 2PUUA 4O0SA 1OL7A 2RFNA 2XM8A 3FPMA 4NCTA 4A4LA 4X6RA 5D9HA 4H05A 2RL5A 2VX3A 4BKJA 1IRKA 4DGMA 4IB1A 3NAXA 3O71A 4J52A 4H39A 5M4CA 2XAMA 4O96A 4ACGA 2BAJA 2JDVA 4C38A 3KIOC 5AP2A 3TNHA 3DQXA 3TV7A 2R3RA 2Y4IC 3BU5A 3Q4UA 3ET7A 4RIYB 1J1CA 4ZOGA 4UWYA 2G15A 4L3JA 3TEIA 3ZLYA 4BI1A 1IEPA 3V01A 3VF9A 5HO8A 2J0KA 4M13A 4DH8A 3FLQA 5HX6A 4DT9A 5IQHA 1YHWA 1DM2A 3FI4A 4IAZA 3WF5A 1SVEA 2PMLX 5HIEA 3S1HA 1VLRA 4FZFB 4PDSA 2J5EA 3AGMA 2PMIA 3MFUA 4LOQA 4N57A 5FP5A 4CKRA 2ESMA 2YIYA 3EQIA 3TNIA 2BKZA 4W4VA 3BZ3A 3Q2JA 4GU6A 4ASZA 5IDNA 3K5VA 2FSLX 4BBFA 2YWPA 3HMPA 1OM1A 4FX3A 3RPSA 4APCA 1W2FA 4AA5A 3HMMA 3F2RA 1ERKA 4BTJA 3M42A 2E9NA 4L52A 2GQSA 3S4QA 4BN1A 3CQUA 5A54A 5M51A 4Z7GA 4HCTA 3RKBA 4QMWA 1PXMA 2J0JA 4XV2A 4IBMA 4PY1A 3AMAA 3QCYA 2QR7A 1BX6A 2ZDUA 3EFLA 2ZFYA 4DE4A 2VGPA 2WMUA 3IDCA 4XOZA 1YVJA 3FEGA 3LXPA 4PL3A 1DAYA 2WMWA 2IVSA 5HTCA 2XNOA 1QPJA 4UB7A 5K0XA 3JVSA 1TQPA 2A0CX 2WTVA 2JD5A 4UXLA 4MD8E 1L3RE 3EQDA 2GMXA 1XBAA 3BEGA 4C37A 4U41A 4G3CA 4TY1A 1PW2A 3SX9A 4ZP5A 3UIBA 5I9YA 3NAYA 4YNOA 1Y6BA 5CYIA 3PPJA 2PYWA 2C3KA 3GGFA 4FV6A 4RJ4A 5CVFA 1IAJA 3GU7A 1TFFA 4M14A 3TI1A 3KMMA 5E92A 1F5QA 2HW7A 3WOWA 2VWZA 2Y6OA 3QZHA 2GNHA 3CJGA 1OGYA 3QKLA 3R8ZA 4E5WA 5ICPA 5DYJA 5JKGA 3CTHA 2WIPA 3LAUA 4F6SA 4AXEA 3GENA 5KMIA 4AN3A 4EUTA 3SGCA 3SVVA 2C68A 3P08A 4MF0A 1Q62A 4E5BA 3KRLA 3U8WA 2QU6A 3HNGA 5I9UA 1BI8A 3AT4A 3D7TA 2B9IA 3DBDA 4USEA 4DEHA 3JYAA 1T46A 3QTWA 3RJCA 3EYGA 3CY2A 4EH9A 4BDHA 3SA0A 5IEXA 3OBJA 4QPAA 4WUNA 5FM2A 2HELA 3CPCA 3IK3A 4CZYB 4FT3A 2XIKA 2XNNA 3KXZA 3UO4A 4TYHB 3QF9A 5HLWA 4O0TA 4BTMA 4NKSA 4PL4A 4FUXA 5BNJA 5K4JA 2C6TA 4Z9LA 3U4UA 5L8LA 2PULA 4DTBA 4OLIA 2E2BA 3B2TA 4QTAA 3VS6A 4FSRA 4RQKA 5LMBA 2CMWA 2A4LA 3WIGA 5IQGA 4YSMA 4O22A 3EL7A 3I5ZA 4USDA 1WVWA 3C4WA 1YXSA 3DJ7A 4JT3A 4KBKA 1G8KA 3H9RA 2IVTA 4FTUA 5M08A 4PDOA 4J98A 4MXXA 4LMNA 2BPMA 5AV2A 4O0VA 4F7SA 4O1PA 5FRIA 1NVQA 3BEAA 5DMZA 5AUZA 3Q6UA 2VWBA 4X3FA 2YIXA 2OKRA 3PPZA 3V3VA 2YEXA 1ND4A 3I6WA 3FUPA 5BMMA 3SLSA 3MFRA 4O0RA 1W83A 2XKFA 4TWCA 2W1DA 3FKOA 4FKSA 4UX9A 1Y8YA 3SRVB 4IVBA 4QP4A 3S00A 2OJFE 3P4KA 3SOAA 1TQMA 3AD4A 3UNJA 3ZSIA 4BCOA 4AX8A 4TW9A 2GDOA 3BU3A 3COHA 1H1RA 3QLFA 4ID7A 2GQGA 2RKUA 4FKWA 5EI6A 2UW5A 1URWA 2R3KA 3MGYA 3MVJA 4QMVA 3G0FA 1XBCA 4IANA 4KAOA 3HUCA 1Y91A 4CSVA 2W96B 4PDYA 3BV2A 3RBWA 2H96A 2X81A 3KL8A 3VJNA 4KINA 3DT1A 4V0GB 4RIXA 4RGJA 4MBJA 4LGGA 3HEGA 4P90A 4WA9A 4N6ZA 3CTQA 4P5QA 4JLCA 5D12A 5FP6A 4C4IA 5J5TA 3EMGA 3OY1A 5DIAA 2CLXA 3FKLA 4DFLA 4F6WA 4QMNA 4R7BA 4BTKA 4QMYA 4D4RA 5K9IA 2F4JA 4KIPA 3N4UA 3PLAE 5AM6A 3FMEA 2UZNA 3LKMA 4LGDA 2IW6A 3OTVA 1XH7A 3UGCA 1REKA 2YAKA 2F49A 3L9MA 3AMBA 5CXZA 4MBIA 4DTKA 4NK9A 4AZTA 3E8DA 5HIBA 4EHEA 3Q52A 5JMSA 1OKZA 2WPAA 3FZ1A 3QQKA 4U80A 4F4PA 5BVOA 3BYMA 4RJ6A 5JGBA 2PZIA 4G3GA 2XIYA 3GI3A 1OL1A 3R83A 3JUHA 2OI4X 3ACJA 1IA9A 4FIHA 2HWPA 4MAOA 3RAKA 3KEXA 4UN0C 1DS5A 4CFXA 5IH4A 3BGQA 1NA7A 3S2PA 2F7EE 3R1QA 2BRMA 4FSNA 3U55A 3QYZA 3R6XA 3Q6WA 4WUAA 1M2PA 3ORNA 3COMA 2BMCA 3UNZA 4ZLYA 4RA5A 3DB6A 4ZJJA 1UWHA 4G6NA 2QOOA 4XG7A 3VULA 5EM6A 4CTBA 5HLPA 4NFMA 5J1VA 4DAWA 3AMYA 4WNKA 4R1VA 4MD9E 4ZSEA 4FG7A 4BKYA 2B52A 5L6OA 2PVFA 4RX7A 4BCPA 4KIQA 4D0WA 1H4LA 2XNEA 5AA9A 2E9VA 3MESA 2BFXA 4AG8A 3FDNA 5HESA 3G51A 4I41A 3OROA 3W8QA 3H3CA 3WILA 4D1XA 4ZJVA 2B7AA 4V01A 3ZEPA 4XP3A 3UG1A 3QD3A 4HOKA 3MIAA 2H8HA 4IC8A 4M68A 3T9IA 4MX9A 3MIYA 5G1XA 2BRGA 3AKJA 5FEEA 3I7CA 4FL2A 4NTTA 1KE5A 1OL6A 2O3PA 3BQRA 4O6LA 2XBJA 3EZRA 4MK0A 4NEUA 2XARA 4PF4A 5HO6A 3RWQA 3F69A 4U9AA 4LV8A 4ZTHA 4BYJA 4WD5A 2C47A 1WFCA 4UZHA 2CGWA 3DA6A 5CLPA 2QHNA 1OUKA 2YISA 5EM8A 2Z2WA 4FTTA 3A7JA 2LAVA 4OT6A 5DNRA 4WOVA 4FIFA 4Y5QA 5CF6A 3ERKA 3OEFX 5IEYA 3FI8A 4BCMA 3QTIA 4ACHA 4YZCA 3TCPA 1UKHA 3ZDUA 1NXKA 3HX4A 1XH4A 4DBNA 4ZSJA 4NYEA 2R3NA 4FSMA 4FTOA 4E1ZA 5CF4A 2BFYA 2OO8X 4QPSA 3LOKA 5DN3A 3I6UA 4AT5A 5LOHA 3OW3A 3QCQA 3I4BA 5D11A 4A07A 5H2UA 5M09A 1IG1A 3NIEA 3QHWA 2QR8A 4DITA 1FGIA 2OH0E 3PP1A 4X6QC 4D28A 4Z16A 5I9ZA 3N4VA 4ANOA 4BCKA 2WTCA 3AXWA 2PMOX 4F78A 3G2FA 3GT8A 4YHTA 4CG8A 4JBPA 5IH5A 3AKKA 3VS4A 4C2WA 2C1AA 3LLTA 2WEVA 3UZTA 1T45A 5LMAA 3WE8A 4BICA 3ORZA 2ITXA 5DR2A 2EU9A 3EJ1A 4YR8A 5I5ZA 4AAYA 3LCSA 4BDBA 3FI3A 5ANJA 4C3PA 4Y85A 3KRXA 2CCHA 4M0ZA 1PJKA 5AUVA 3ZXZA 2Z60A 3ZO3A 2ITZA 4ZEGA 2C6LA 4II5A 4BDIA 4QDEA 3LCTA 1PXLA 3V04A 4A7CA 3BE2A 5AADA 1Q8TA 4O7ZA 1YHSA 3IECA 3ZHPC 2OBJA 4LUDA 4X7QA 2PZ5A 3OEZA 4CKJA 3BV3A 3TDVA 3ORXA 5JGAA 4O1OA 5DWRA 1QMZA 2RG5A 2PVYA 3QD2B 4IAIA 1NW1A 3FMKA 3MY1A 4FV1A 5DR9A 3W0NA 3GFEA 4L3LA 4EBVA 3E8NA 4RVTA 4PL5A 2QVSE 4BIDA 3I0QA 2P3GX 1H0WA 2C3JA 3NGAA 2WB8A 1JNKA 4F7JA 1LP4A 1OVEA 1UVRA 2F7XE 3QD0A 4GFMA 2C6EA 4IAKA 2OXYA 4MXYA 2WTDA 5AV0A 3HLLA 4EHZA 5EFQA 3HDNA 4O7WA 2BZJA 2WMBA 4FKIA 3Q5ZA 4OGRA 5EOLA 2I0YA 2W1FA 4GG7A 4EZ3A 3EKNA 1MRVA 2XJ0A 3W2OA 1I09A 3R30A 5TF9A 3RCJA 4QTBA 1PXOA 3A7GA 3SD0A 4I23A 4I6LA 3EQGA 2ITOA 3R63A 4QP1A 3KN6A 4XG6A 3TXOA 5JT2A 2Y4IB 3WIKA 4OTQA 3KRJA 3NS9A 5ANGA 5E8UA 4KUJA 3MPMA 2IWIA 5LMKC 2YABA 1KE8A 3MVLA 2WMXA 2E9OA 2FSMX 2PZPA 2C0IA 2OXXA 2QKRA 2VWYA 2W1GA 3LMGA 3D5UA 2ZYBA 3QC4A 2UVZA 1YXVA 4IMYA 4XG3A 5FGKA 3LVPA 4AZWA 2PTKA 2UZOA 3M2WA 3KQ7A 3VC4A 3UIMA 3QBNA 3ROYA 4IJ9A 3ZRKA 3ML1A 4FKRA 4HVHA 4DHZA 4ANBA 4U3YA 3HMIA 3V5QA 4AACA 4HGSA 3BHYA 4E4LA 4RX5A 3NUPA 2HZ0A 4GK2A 2PE1A 2QURA 4KKHA 4Y73A 4HPUE 2G2IA 5FLFA 2ONLC 3FBVA 2XS0A 4V0GA 5EI2A 3TTJA 1XH9A 5J79A 2UZBA 1ST4A 4EKLA 3CR0A 4YJSA 2GNFA 3Q32A 3Q04A 3ETAA 3OCTA 4PNKA 2ZVAA 1H08A 4BDAA 4ALWA 1FOTA 5KKRB 3TMOA 4RG0A 2PZRA 4FV5A 4EQUA 4GUEA 3KXHA 3N4TA 4I1ZA 2BILB 4FOCA 5ETCA 3QUEA 5HLNA 1UNLA 2V5QA 4Y46A 4TWPA 4KABA 2OICA 2I40A 3AQVA 1WBWA 2VWVA 4O4CA 5CX9A 4ZTRA 5CEKA 5EW8A 3ELJA 3OOMA 3W18A 1H1PA 4ASDA 1M14A 5AUXA 5C4KA 3JXWA 3FMDA 1OIRA 4AAAA 4C33A 4IQ6A 4L44A 2JIUA 4FIIA 3VQHA 4LG4A 2HZIA 1ZMUA 4EH6A 3E7VA 3CY3A 4FGBA 4KS7A 3BHTA 4OW8A 5E8XA 5HBJA 5JFSA 5IQIA 2XNBA 5IPJA 2QG7A 2W5AA 5E91A 3VS2A 2NPQA 4P5ZA 4D2PA 2Q83A 2BZHB 5ANEA 4G9CA 3R21A 4ITIA 4EK8A 5AUWA 4NZWB 1DI9A 4Q9SA 3O96A 2W17A 4ZLOA 4ANNA 4DFNA 3W0OA 3EQBA 4UBAA 3MS9A 4DFBA 2OFVA 5HQ0A 3PP0A 4YO6A 4RIWA 1R0EA 2W1CA 1B38A 2YCQA 3GCPA 4FSZA 5M4IA 3ATTA 3OXTA 4U42A 4NWMA 5AP1A 3FMNA 2WTKB 3RINA 3TT0A 1KOAA 3MPAA 3FHRA 4EH3A 3A7FA 1B39A 3UBDA 1WBSA 2R4BA 3GEQA 1P4FA 3NZ0A 4JRNA 2WAJA 3DDQA 1KE9A 4IB3A 3F3UA 1R3CA 2XIXA 4ZS0A 2YA9A 5GJFA 3P9JA 4C4GA 4O81A 2HK5A 5I0BA 3LFCA 4FNXA 3W0MA 4ZMEA 2PVMA 3CBLA 1PYXA 2F2CB 4DH7A 3TKUA 2W9ZB 1XHAA 3QALE 3QHRA 4MUQA 2CKEA 5KZIA 5CSWA 4RQVA 4XCUA 4OAUC 3LCDA 5AR2A 1AD5A 3UDTA 3QRUA 2HZNA 2VTRA 4UXQA 4MXOA 5B2KA 5JFXA 3BL7A 4IEBA 2Y7JA 3AT2A 4XLIA 4TN6A 4RJ5A 4RIOA 2HY81 4AGWA 4HJOA 1PMEA 4YJUA 2QNJA 3F82A 4TYJA 3NW7A 4K6ZA 3QWJA 2VZ6A 4FK6A 3V5TA 4EOQA 4ZSAA 3BYUA 3DXNA 2UW0A 2EXCX 3LMIA 3NCZA 4FSUA 5CALA 5IH6A 3UO5A 4TT7A 4J53A 4ZXTA 2CKQA 3UTOA 5C8MA 2WOTA 2PVKA 3AC8A 5DEWA 2XK3A 4BWXA 3LCKA 3DJ6A 2HWOA 2QOFA 1OL5A 5CU3A 3V8TA 3HMOA 1YQJA 2JGZA 3MH3A 3HV3A 3HDMA 4U0IA 5A6NA 5CAPA 4RX8A 5HEZA 3VRZA 5CS6A 3VUGA 1LUFA 4YC8A 2OJIA 2UZEA 2OW3A 5AMNA 3SXRA 1OUYA 4KNBA 3A4PA 4RJ8A 5AR3A 5AR4A 1WCCA 4F7LA 4XLVA 2X1NA 4FOBA 4FV0A 2J6MA 4NJ3A 1XWSA 2PHKA 4DDGA 4FF8A 4I92A 5TO8A 2Z7SA 3FZTA 2I0HA 3QKKA 3CPBA 4S30A 4IM0A 3LQ8A 1CSNA 4M67A 1QPEA 3CSVA 3KU2A 3DXPA 4PMTA 3D83A 4KIOA 3E5AA 4EBWA 4PMSA 1STCE 3KVXA 2GFSA 3PA3A 4EONA 3D9VA 4XBUA 3FQHA 3NW5A 4GYGA 1OBDA 5C03A 2JDOA 3F7WA 3R7YA 1BL7A 4FUYA 3OCGA 4AE6A 2YDKA 4TZRA 4YZDA 5ETIA 5LMKA 2C1BA 4O6EA 2QO2A 1J3HA 4RIYA 3SAYA 1CKJA 2FUMA 4NFNA 2NNWB 4IZAA 4XG8A 2QOHA 1R1WA 1MRUA 1X8BA 4RWLA 3BHUA 3DOGA 5CAUA 3PXKA 4ANQA 4U3ZA 3C7QA 2FB8A 1PMNA 1YWVA 5LWMA 3FL4A 2YCSA 3GP0A 2YLEA 4R8QA 3POZA 1FBNA 2XAOA 2ERKA 2FA2A 2GTMA 2HXQA 5CI6A 4K33A 3QX4A 4PX6A 4IM2A 4ARKA 3SXSA 4AWIA 4YUQA 4BB4A 3QTXA 5JFWA 3DS6A 3EN6A 3QQLA 4BR3A 1MRYA 3WBLA 3ZO1A 4CV9A 4BGGA 4FRFA 2CKOA 4DDIA 1NVSA 3OUKA 4FTCA 3EYHA 5EG3A 3RTPA 3RWPA 2R2PA 4CNHA 4BZDA 1SMHA 2X2LA 1YDTE 2A27A 3AD6A 2FVDA 4QQJA 5E8YA 4MBLA 3R9HA 1V0PA 2WMAA 3BCEA 3WI6A 1R39A 4WG4A 4FIEA 1Z57A 4NIFB 3E8CA 2BVAA 2GS7A 1H1SA 2YIWA 3LFSA 4N6YA 5KMJA 4JJRA 3PSDA 3DK3A 4I24A 2CCIA 4OBQA 3GCSA 5EYMA 3EWHA 4YMJA 3MB7A 5E8TA 5HO7A 3LIJA 4FKPA 3UVQA 1SYKA 3DAEA 1BLXA 4XX9A 2V55A 4FV3A 2Y6MA 3UP2A 3C4FA 4ASXA 3EN4A 4HVDA 1Y57A 4TKSA 4X3JA 4AZEA 5BVNA 5FQDC 4QMUA 3P5KA 1PHKA 2P2IA 2XK7A 3C0GA 2W4OA 2YERA 3FXZA 3FV8A 2CNQA 1QCFA 4KRDA 4WRGA 3F9NA 4I6QA 1UNHA 2X0PA 4XP2A 1H00A 3K3IA 3ZFXA 3POOA 2WU7A 4OTPA 3P86A 3DFCB 3FXXA 3HA6A 3KF7A 1YI6A 4O0XA 4QMPA 3ZUVA 5AAEA 5IUHA 4EOMA 4GYIA 2R3LA 4JDIA 4UY9A 2BKKA 3VUHA 3TUCA 3NEWA 5GZ9A 1JVPP 3NUYA 3BYVA 2EXEA 1ZY5A 1RJBA 4OBPA 5H8EA 1ZWSA 4C7TA 2Y4PA 3IGOA 3VF8A 3KK8A 4LQMA 4HZSA 2G2FA 5CVHA 2QOCA 3ORKA 1A9UA 1KWPA 1YWRA 4GFGA 3OCBA 4ZJIA 5KO1A 2Z02A 5FG8A 3VBTA 1UV5A 1XJDA 4GL9A 4ANSA 5M56A 2VTSA 1KE6A 4YTCA 5C8KA 2XYNA 3NYNA 4WBOA 1YRPA 4LFIA 4KA3A 3V51A 4AW0A 2B9JA 2VTPA 2X2MA 1GNGA 2FO0A 2KTYA 3QGYA 4JOAA 4K11A 2YM3A 5TT7A 2SRCA 5C4LA 5EM5A 4RMZA 4O7VA 4L42A 4E20A 1U54B 1GY3A 4K0YA 5DPVA 2G2HA 2NYAA 3ORIA 4LDTA 4ITHA 2F57A 1OPKA 3GCUA 5D1JA 2RF9A 3NYOA 5LCKA 2WNTA 2EB2A 3OBGA 3RZFA 4YURA 2ZB1A 3DTCA 3E8EA 2OIDA 5FXRA 1RDQE 1K9AA 3ULIA 4HYSA 1H8FA 2J5FA 5DE2A 3TNPC 3QUPA 1FVTA 4NJDA 3M11A 4NTSA 4JBQA 5IA1A 1JKTA 2IJMA 4PNIA 3UJGA 4IM3A 2BCJA 1ZY4A 4C4HA 2JC6A 4DFUA 4W9WA 5HBHA 3G33A 2QONA 4JDHA 4W8EA 3A4OX 4LL0A 2WIHA 5KBQA 2XNPA 3R2BA 5IQBA 2PE0A 4OTGA 4FYNA 1IR3A 2VV9A 2VTAA 4GCJA 2ZJWA 3HV4A 4FBXA 1JSVA 1F3MC 2XM9A 3FLNC 3OWLA 3ZO4A 1FGKA 3IW7A 3R28A 4J71A 1W2DA 4M66A 4ZTQA 1SVGA 1NT2A 3HYHA 1TVOA 4EC9A 3PXFA 4ENXA 3IW8A 4DINA 1SZMA 1PXIA 4XG2A 3U6HA 3F6XA 3VS3A 4PDPA 1PY5A 3P23A 3P78A 3VJOA 4RVKA 2JFMA 3QTUA 4B0GA 4GK4A 4FIJA 2XZSA 4IVAA 5BVEA 4H3PA 2O0UA 4B8LA 4EOIA 2WMVA 3OG7A 4HNFA 4EOLA 1P5EA 3LXLA 3OD6X 2IZSA 3JVRA 5KMLA 3O8UA 4QP9A 4YPDA 5HVKA 2J50A 5C9CA 2JIIA 1WVYA 4YZNA 2WKMA 5C26A 4JQ8A 1ZMWA 2WTIA 4IVCA 4JG8A 5A3XA 3GU5A 3Q4TA 3VIDA 4MEDA 3R9DA 2JAMA 5CANA 1M7NA 2R7IA 4QT1A 3E88A 3TL8A 4F0GA 3R00A 5FXSA 2GS2A 2I0VA 2VO3A 4EZ5A 2R7BA 3EL8A 2NO3A 4FT9A 5JRSA 4I5HA 3AC1A 2BRHA 3H0YA 2CNVA 4DLJA 1H0VA 3HKOA 5B2LA 1OPLA 1OB3A 5JH6A 1TZDA 3F2AA 2OSCA 2RSVA 4FR4A 5DG5A 4C2VA 3BIZA 3CGFA 4M7IA 2XK9A 3QZGA 5EHOA 3H4JA 4NM5A 1XH5A 2C6IA 4QP2A 5G6VA 1U46A 3KREA 4Z7HA 1PKGA 3IS5A 1CM8A 3R7UA 3RNIA 1XQZA 5CXHA 5JGDA 2DS1A 5HTIA 4P4CA 1W7HA 3D2KA 4IWQA 5EOBA 3FY0A 1LEWA 5HZNA 5F4NA 1SNUA 4H3BA 3QL8A 4O0YA 4BDFA 1O6YA 4GS6A 3PDTA 4ORKA 3T8OA 4KBCA 3ZYAA 2XVDA 3UIUA 4E3CA 3NPCA 3F3ZA 3DBQA 4LOOA 3LFDA 4IAYA 4YTFA 4Y83A 2WOUA 4KB8A 3OTUA 2JIVA 1UWJA 4I0RA 4I3ZA 2WXVA 3QXOA 3EIDA 4LYNA 3U87A 3ZC6A 4F1MA 4D4SA 3RPYA 4DH3A 4I93A 2JKQA 4F08A 2HY0A 3ZLSA 4C4JA 2OZAA 3NUXA 5FDXA 2ONLA 4ANLA 4L01A 5GZ8A 5BX0A 2GNGA 1W8CA 1URCA 4UZDA 5DR6A 1XMMA 4NM3A 4V04A 3FAAA 3FLZA 3W32A 3A62A 2IZUA 3SV0A 3OF0A 3FLYA 4CFFA 5HD4A 1GZKA 1TKIA 3SW4A 4W4XA 5JSMA 2OZOA 5TKDA 4Q5HA 4FIGA 4U45A 5LQFA 1E1XA 4BJJA 2VTNA 3C0IA 4CYJA 4C58A 3E7OA 3WF8A 4KWPA 3RAWA 2WQMA 4A9UA 2W99B 3VUDA 2P2HA 2WU6A 4YBKA 4XG4A 4H3QA 4PMMA 4UWBA 5F9EA 5LVMA 1UA2A 5LVOA 3O7LD 4GT4A 4BWKA 2ITVA 3R9OA 5CF8A 5A4QA 4BZNA 3IQ7A 2YDJA 3N9XA 5EHLA 5TOZA 1APME 3CKWA 1FVRA 1ZXEA 3NIZA 3OMVA 5DOSA 5EDQA 4MXAA 3KA0A 3VBWA 4FA2A 4AOIA 3NVKI 5LVPA 4FSWA 4D2WA 4CFNA 4FJVA 3KFAA 3ORPA 4AN9A 2RFSA 4FTAA 3QKMA 4H1JA 2ACXA 4EQMA 2IVVA 1WBTA 4GK3A 3KC3A 1WBNA 4RPVA 1WVXA 2VTLA 2YAAA 2PWLA 3BGPA 3GC7A 5AWMA 2HW6A 3FQEA 4G31A 3WZJA 3PJ1A 4TWNA 3W10A 5EDRA 5C27A 4OAVB 1YWNA 1J1BA 3QRTA 4GIIA 2ZV8A 2CGVA 4CD0A 5E8SA 1H01A 4F7NA 4EYMA 2VNYA 2DUVA 3V6RA 4XOYA 4HGTA 2Z7QA 4UEUA 3PG1A 3RK7A 3PLSA 4XV3A 2VTHA 3I79A 3IOKA 1U54A 3PWDA 3ZLWA 3TUBA 3IDBA 4FV2A 1Z5MA 3FWQA 3F61A 2VN9A 3T9TA 1Q8YA 4S2ZA 5I3RA 4HYUA 4XV1A 2BRBA 1AQ1A 2Z8CA 4I6FA 4AUAA 4N0SA 4BDKA 4IXPA 2X7GA 4JBOA 3R2YA 4K2RA 4UV0A 3ZMMA 2C6OA 3PJ3A 3WARA 4E6AA 3ENHA 3ZRMA 1JPAA 5CAQA 2OWBA 3PXQA 4YLJA 3CJFA 3FXWA 3ZC5A 2J51A 2O64A 5CEOA 3KULB 3UMXA 4XG9A 3NFFB 5F20A 1W82A 5M4FA 4G6OA 1S9IA 4FODA 1JKKA 4CEGA 2R3QA 4QMZA 4M69B 5HI2A 4IB0A 4CVAA 3EQHA 5AP3A 4YLLA 2O63A 1XBBA 3VHKA 2C6DA 2PZYA 4E4NA 3MJ2A 3FMJA 4P7EA 2GPHA 1GZOA 3UP7A 4CLJA 3BGZA 3WZEA 4UMPA 2JFLA 2Y8OA 4G1WA 2X6DA 4R5YA 2CNUA 4O91A 5AAFA 4F9AA 5AV4A 3E93A 2BDJA 3V6SA 3LZBA 4PTCA 4RA4A 5BUIA 2G9XA 3TV4A 4BL1A 5CY3A 1YW2A 3G5DA 2WTWA 3ULZA 4TXCA 3VBVA 3CQWA 1ZZ2A 2GFCA 5KMNA 2H34A 3DNDA 1VZOA 2IW8A 2XMYA 3NUAA 4IWDA 4D4YA 3COIA 4ZSGA 2XK4A 5FWKK 5IZFA 3FI2A 2BHHA 3TKHA 2QD9A 4FV9A 4DLIA 4J96A 3BI6A 3TN8A 2W1IA 3R8UA 1JQHA 2JDSA 5HE0A 4PMPA 2R3IA 3CXWA 2R3GA 3BLQA 3EN5A 3A99A 4GJ2A 3IO7A 5CQWA 5CEMA 2IW9A 2YCFA 2DQ7X 4CMUA 3F2NA 4PRJA 4BZOA 3NNWA 5B0XA 5T3QA 2XRWA 3VAPA 3U6JA 5GIOE 4A4XA 4GFOA 3UOLA 3V8SA 4DC2A 4MXZA 3VWAA 2ERZE 4G17A 1SNXA 4E93A 3MA6A 3P5JC 2O65A 3PA4A 3SOCA 4BDJA 3QTSA 5TE0A 4C4EA 3CC6A 4O86A 3DKOA 1TQIA 4QYHA 2EVAA 4GV1A 2Z7RA 3VN9A 1Q24A 4BCFA 4ZY4A 4L45A 2YIRA 4TNDA 3VW8A 4QO9A 4CTCA 2G1TA 4FSQA 4HW7A 3BHHA 4R78A 3P1AA 2XKEA 3C50A 1OKVA 3L9LA 3ZUTA 2YM6A 1YOJA 1Q41A 2X9EA 5CU4A 4OTDA 2BDFA 2BHEA 2VTJA 4HVIA 3DKGA 3MN3A 2W9FB 1I44A 4C57A 2QO7A 3PY0A 2C3IB 5LVLA 5HU9A 3ZONA 5DRBA 1ZRZA 4UMQA 5LARA 1KE7A 4WKQA 4M97A 4CCUA 3NRMA 4DYMA 3WZDA 4PP9A 4IH8A 4I0SA 5CEPA 4FE2A 4AQKA 2XK6A 4ALVA 4BHZA 4DFZE 3R1YA 5DVRA 1JAMA 1OMWA 4I21A 5I4NA 3PVUA 3HRBA 3AC5A 5IUGA 3MVMA 4R3RA 4EL9A