3MBLA

Crystal structure of the human mitogen-activated protein kinase kinase 1 (mek 1) in complex with ligand and mgadp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
321
structure length
290
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure-based design and synthesis of pyrrole derivatives as MEK inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 290
sequence length 321
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mblA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mblA01
3POZA 3C1XA 3TV4A 4TKSA 3HA6A 1LEZA 2FH9A 2XMYA 5D7AA 5C1QB 3FLSA 3I0QA 3ZDUA 4EH5A 4WG3A 1W98A 3NIZA 2J0MB 3P79A 4FTNA 4RWKA 3ZFMA 3F5GA 3OROA 2W1CA 3CC6A 4XMOA 1FVTA 4FZAB 4XG3A 5DOSA 1R0PA 3VRZA 3Q60A 4F1OA 1OKWA 2PMOX 3DAJA 3UOJA 2ZJWA 4U43A 4AA0A 3R6XA 5HQ0A 2C69A 2W5HA 3R1QA 5AR2A 2PL0A 5IPJA 2I7QA 1SZMA 1CKPA 3E7OA 5CQUA 5FDXA 3FQSA 2X7FA 1YHWA 3TNHA 3ZTXA 4EORA 3KCKA 2WQBA 1J1BA 1Q4LA 5HCYA 1KE8A 5F4NA 3UP7A 3ULZA 3C0HA 4U42A 4C0TA 4FIFA 1QPDA 4YHTA 5E4HA 3FHRA 3SXFA 1XH6A 4U81A 4PTGA 4IAFA 4QYGA 2EUFB 4A07A 4OGRA 2WGJA 4BCQA 4FK3A 5E8ZA 4OTQA 4C34A 3PP1A 2P33A 2YLFA 3FDNA 2UV2A 3FZSA 3KXZA 5EYCA 3C9WA 4F0FA 5CALA 2ACXA 4DFBA 4C02A 2QOFA 4ZP5A 3ZM9A 3VUTA 3KRWA 2J4ZA 5FBNC 4AN9A 2V0DA 3UZRA 4DE4A 3AD4A 2R0IA 5AJQA 5HE3A 2WQMA 5FBOA 3CTHA 2W1ZA 4IAZA 4GW8A 3QYZA 2GCDA 5EQEA 3MTLA 2GNGA 2BALA 4F9CA 3N4UA 3LIJA 4J7BA 3CKWA 1YDSE 2UZBA 4JQEA 3A8XA 5FQDC 4KKGA 3W33A 5LARA 2ZV2A 1PMEA 3AMBA 4X7QA 5CNNA 4BL1A 2CLXA 5EDRA 4DF3A 3A7FA 4Z7GA 1REKA 4ORKA 4USDA 1TQPA 4BCNA 4ITIA 3HGKA 2VUWA 2YABA 4QPAA 5A3XA 4LG4A 3T9IA 4H1MA 5JMSA 4I4FA 3GB2A 4ZOGA 4TYEA 3VS1A 1L8TA 3FAAA 4AFEA 1M2QA 1JLUE 1SVGA 5AM7A 4D28A 2QONA 2YM7A 2ETKA 3OC1A 1H0VA 4G1WA 4EQCA 3NNWA 2GS6A 5IG1A 3ANRA 3Q52A 2GHMA 4CXAA 3QALE 4L43A 4HVSA 2GU8A 4EQMA 2OW3A 2J9MA 4BIDA 1UA2A 5C01A 4AGWA 2YLEA 2YDIA 3MFUA 3QX2A 4H58A 1P14A 3NW5A 2B9JA 3AC5A 2C5OA 1GY3A 2CN5A 4HVHA 4B8LA 4P4CA 3O7LD 3BRBA 2IZTA 4JQ8A 3GP0A 2ZYBA 5HTBA 3ID6C 4JI9A 1FOTA 2C0TA 4CFUA 4O38A 4PF4A 2JGZA 2I0YA 2G2FA 4GFOA 3QGYA 4W8EA 4O0TA 4HCVA 3I6UA 3DOGA 5HBJA 3DXPA 4TN6A 4D5KA 3ALNA 5CANA 2E9PA 2CNQA 3G15A 2WFYA 4MKCA 2WOUA 5CI6A 1DI8A 2B53A 1PMNA 3EFWA 5EKNA 4FZFB 4R5YA 1IA8A 3N51A 4IJ9A 4AUAA 5AV4A 5EQYA 4KB8A 5FLFA 3QXPA 5CWZA 3I7CA 4FI1A 2X7GA 4O83A 3Q6UA 3MSSA 2W1GA 5BYLA 3CS9A 3IK3A 3MV5A 4CVAA 4FTJA 2JDSA 2ITUA 3GEQA 3D4QA 5B2LA 3PYYA 3MVLA 2BMCA 4FIGA 3VUDA 3UTOA 1OL7A 5IQAA 3TDVA 2RFNA 2Y6OA 4IAAA 5H8GA 2QHMA 3UVRA 3MB6A 4O0SA 4FTQA 2VU3A 3COIA 4EK3A 2R3QA 5JFWA 2Y6MA 4O7VA 2G01A 4C2VA 2KTYA 5HTIA 2ZOQA 4F9AA 4Y5QA 4XV2A 2VTPA 3LFQA 4E6DA 3DK7A 3BPRA 3CE3A 4MNFA 4YBKA 3MY0A 3KMUA 3CY3A 5LMBA 1B39A 2PY3A 3SOAA 3V3VA 4KBKA 2A19B 3UYTA 3BYUA 4A4LA 2ERZE 4FIEA 4ACHA 3TV7A 4LUEA 4M66A 3TXOA 4YJVA 2LAVA 5HU3A 4FV5A 2QOHA 4AA4A 2Z7LA 3W2QA 3PIZA 3OOGA 2XIYA 2PPQA 2PE0A 2WTKB 3P9JA 4G6OA 3LAUA 3IS5A 5IQBA 3IW6A 3Q6WA 1M52A 5KMLA 3U55A 5AADA 3ZCLA 4BHNA 4X3FA 5F1ZA 4DLIA 3OF0A 2OFVA 2OU7A 3C4XA 4BI0A 1OBGA 3LCKA 5M4IA 3M1SA 5FEQA 4WG5A 4A06A 4USFA 4QD6A 3HLLA 3DCVA 1H01A 4N57A 5KHXA 1BLXA 4PX6A 1XH4A 2X1NA 3DZQA 3UPXA 3DKCA 4O7YA 3OZ6A 3MW1A 3EJ1A 2P0CA 3IDCA 3QTZA 3E88A 5BUEA 4YPDA 1IR3A 4QMUA 3IOPA 4D2PA 2VWZA 5HU9A 2CNUA 4C57A 4F6WA 2VTAA 2QLQA 5L2TA 1YVJA 2HZNA 3P08A 5HGIA 3VW6A 4MQ2A 5FXSA 5CASA 1QL6A 4CLJA 5M56A 5GJFA 2IPXA 2EWAA 3WF7A 2JIIA 4EC9A 4IWDA 2OH0E 4UMRA 4K33A 4EHEA 4FV8A 4YJTA 4N6ZA 2WHBA 4QNAA 2VWIA 3R8LA 3UBDA 3ZFXA 2R5TA 4U9AA 3QYWA 1DAYA 4DCEA 3HMNA 5HZNA 4AGCA 4JX7A 4WNMA 4AT5A 2F2CB 3KFAA 1WZYA 4O7NA 3ETAA 4Y72A 4ZMEA 2XJ2A 4D9UA 2C5XA 2ITWA 3DBCA 4Y83A 2PK9A 3B8QA 4S33A 3CSVA 4MH7A 3NVMB 3DQWA 4BDGA 2FYSA 4F64A 4HCTA 3R1YA 2R3IA 4C58A 3F61A 5K5XA 2FSLX 4ERKA 3VF9A 3KXNA 3LXLA 3HMIA 4Y8DA 3S4QA 3LOKA 1YXTA 2VZ6A 2W1IA 2WQEA 1BMKA 1P4FA 3PJ8A 4II5A 2A2AA 4ASZA 2VWBA 2BRGA 4F0GA 4N70A 4RX5A 3DDPA 2C47A 3C0IA 3VS0A 2DWBA 5IH4A 1FPUA 1TQIA 4QMTA 3F69A 4QMQA 2BR1A 1PKGA 4RIWA 3O0GA 4L45A 5JT2A 4DH1A 2R3FA 3HMPA 3TJDA 3GENA 2VX1A 3LE6A 1EH4A 2PU8A 3EL7A 2H6DA 4IAYA 3RALA 3QZIA 4I6HA 3FPQA 5C03A 3U4UA 4DAWA 1CMKE 4FSUA 5HO7A 1OBDA 1OIUA 2HW6A 2P2IA 5DG5A 3FC2A 5KZ0A 2VNYA 2BZIB 3HVCA 4QQ5A 3EQDA 1G8SA 3UIMA 2RFDA 2DS1A 5EW8A 3BWFA 4NU1A 2UW9A 3TKUA 1W83A 3A61A 3AT2A 5AA9A 1OI9A 5J87A 1PRYA 2YHVA 3KMMA 3HECA 4I23A 2WU7A 4K18A 3IW7A 4MXYA 5AP6A 3O8PA 3ZZWA 4RSSA 3NAXA 5IDPA 4H3QA 2BVAA 5HD4A 2X6EA 4WOVA 1XHAA 3EQCA 3QQFA 1KOAA 4RZWA 4YC6A 2J6MA 3EZVA 5I3RA 2P4IA 4D2WA 4FSTA 4AZWA 4ZJVA 4P2KA 3DFCB 3FPMA 3SGCA 3UNZA 4C37A 3L8PA 2ZAZA 1R0EA 3AT4A 4NKAA 4BCMA 4YHFA 4APCA 3D2KA 3S3IA 3MPMA 2QKWB 4JG6A 3R7UA 1H08A 2GNJA 3GUBA 4BDKA 3PVWA 3C7QA 4YJSA 5A6NA 5IA0A 2CKOA 4ZLOA 3ODZX 4IVBA 4A9UA 4CKIA 5DVRA 5HO6A 4EK5A 3I5NA 3ZDIA 4U0IA 5IQFA 4QPSA 2YIRA 4O82A 4DGGA 2WMRA 2WMAA 3KXXA 5FDPA 2CJMA 1ZZ2A 2XH5A 3DGKA 5M44A 5M53A 1BUHA 2PUNA 5M07A 2CHLA 1J7UA 3RPSA 5M4UA 3TUBA 1JWHA 1FGIA 2WAJA 3B2TA 5AP4A 5JZJA 3DK6A 2FUMA 4IZYA 3BGZA 3FJQE 3O17A 3OW4A 3LJ2A 4FOCA 4IWPA 4KS7A 4FTAA 3UO5A 4Z16A 1KUTA 3BGPA 4EOPA 4BY9E 3HA8A 2C5NA 2B9IA 2GQGA 2JBPA 3DBDA 4RPVA 2IWIA 4KIKB 4FODA 1PYXA 4IDVA 3O50A 4A7CA 4C4HA 4EZ3A 2I0EA 3HDMA 2IW9A 5T3QA 3DTCA 5ITAA 2QOQA 4NJ3A 3LMIA 2GS2A 3ACKA 4JXFA 5AUUA 5A6OA 2JC6A 4ZTHA 1UWHA 3TJCA 2UZOA 3FHIA 3QRIA 1R39A 3VBWA 4FSYA 4IVDA 2JBOA 2R2PA 4S31A 4JR7A 4MEDA 4E4LA 5I0BA 4ZLZA 2XB7A 2E9UA 2VWVA 4TRLA 4IX6A 4PY1A 2GNHA 3L8XA 4I5HA 3ZM4A 4FV7A 4A9RA 5LXMA 2BAQA 3DS6A 3EQPA 5LMKC 3VW8A 3V6RA 4X21A 4KIOA 1DS5A 2W4JA 2WMBA 3R7IA 3A7HA 2X2LA 5B2MA 4O7TA 3UQGA 3LM0A 2QLUA 2V55A 3FY2A 5AP3A 3PJ1A 1Y8YA 5HE1A 2PVHA 3R30A 1ZYCA 1OB3A 4FA2A 3IDPA 4U45A 2JDOA 4TYHB 4AGUA 4JIAA 4BIEA 4O0WA 4A4XA 2QOKA 2XCHA 2JDVA 5AV3A 3U87A 3SRVA 1PHKA 2O63A 3DB6A 3FMDA 4E20A 4FKJA 5IQIA 1VEBA 4ZSGA 4JAJA 2XCKA 2AUHA 2WTJA 3ITZA 4GSBA 5DEWA 4C38A 4BCKA 4M67A 2R7IA 3I5ZA 3LM5A 3QL8A 3R1SA 3F7ZA 3GOKA 2ONLC 4GIIA 4DFYA 3UGCA 4B8MA 2X2KA 2JFMA 2VX3A 4HYSA 2GNFA 4BI1A 3EQGA 5CSWA 2X4ZA 2WOTA 4WRGA 2Y4IB 3REPA 4DFZE 4UV0A 3VHKA 3TNQB 4HPTE 4AOTA 2YCQA 4FEWA 5FTGA 2DUVA 4O0XA 5E8YA 4FTKA 4V04A 2WTVA 3QA0A 5CEIA 5GIOE 5LVMA 3DXNA 3DY7A 3AT3A 3SW4A 4LRJA 2XK7A 5LCJA 2PTKA 2ZMDA 4V0GA 3NAYA 4JJRA 2OLCA 3R7OA 4YNOA 3TZ9A 4CV8A 4IB5A 4AU8A 2QKRA 5AUTA 3O71A 3BE9A 3NCGA 4KS8A 2VTLA 5M4FA 3ROCA 5AUXA 1YOJA 3O96A 3G33A 2R3GA 2XUUA 2CN8A 4TW9A 4YJOA 3JS2A 3KB7A 4JVGA 2QHNA 5HOAA 3UOKA 2VAGA 2JDTA 3GCUA 4AFJA 4G3EA 2UZNA 2PULA 5CSPA 4MAOA 2Z60A 1CDKA 5HE0A 3COMA 4DBXA 3GU8A 3MH0A 4MD7E 3FZ1A 3PXQA 2VWXA 2YN8A 2PUPA 3HRBA 2XNMA 3R7EA 5M06A 2J5EA 4FV0A 4E5WA 4JBOA 4YC3A 3MFRA 2WIPA 2X7OA 4EONA 3GQIA 4IADA 5AP7A 3GFEA 5ANOA 4ANSA 4H1JA 4XS2A 5AX9A 3KK9A 4BGGA 4ERWA 4M68A 3QRUA 3AD6A 3EFJA 4CG8A 2XYNA 3GC0A 5C4LA 3RTPA 5E1SA 2OZAA 5C8NA 5KO1A 4O21A 4ZTSA 5GZ9A 4XP0A 3EFLA 4E4NA 1K3AA 3DNEA 3DJ5A 3EN5A 3IECA 4QP6A 4M13A 5GIPE 3LJ1A 4JT3A 3FMHA 2YM5A 4QP1A 1XBBA 1S9IA 5L6WL 5BMSA 4IX3A 4WSQA 3DZOA 4QOXA 2WMXA 5AR5A 5B0XA 4AZSA 4YZDA 4EBVA 4FT5A 3CJGA 4XH6A 4DEDA 5IEVA 3A60A 3GC8A 5C8KA 3OBGA 3QHRA 1KE7A 5DLSA 5AX3A 4QYYA 5KKRC 2RF9A 5HLNA 4EH2A 3ZRMA 3WYXA 4IFGA 3R8VA 4MCVA 3AG9A 4P7EA 4QMPA 5FP6A 3TIYA 2NRYA 1XH5A 4GIHA 1WAKA 4U80A 4EK6A 4EJNA 4GYIA 2VTIA 2XP2A 1RJBA 4CEGA 1H1SA 2VWUA 4CV9A 1Y57A 5D41A 4EH4A 4K0YA 4FL3A 4K9YA 4O1PA 5IH5A 3UP2A 4RGJA 5CU0A 2PUUA 4IJPA 5CVHA 3W2SA 5TT7A 4EUTA 4M84A 2UW6A 1T46A 2XKEA 4F0IA 4DG2E 5L6PA 4HYUA 4I5MA 2QI8A 5KKRB 4ZJJA 4XP3A 5GNKA 3V5PA 5CXZA 3U6IA 1IG1A 1TQMA 3MFSA 3UG1A 4EWHA 5BQ0A 4ID7A 1GOLA 4CQGA 4HJOA 1SVEA 4C4GA 4JL9A 4AZTA 5H8BA 4NCTA 1WBOA 3BGQA 4RMZA 5CNOA 3VUHA 3R7VA 4BTJA 4AW5A 4CZTA 1FBNA 1Q8TA 3RPYA 3VQUA 2NO3A 3PJ3A 4PMSA 5E8XA 3SD0A 4AZVA 3MIYA 5KMNA 2BRHA 2B54A 4UXLA 3R83A 5M09A 4GT3A 3F5XA 5DR2A 3LCOA 5EM8A 1OM1A 5IQDA 3D15A 2I0VA 4IWOA 3ZEWA 4OTGA 4UWYA 4WIHA 3MESA 3NUUA 4DEEA 5EHOA 4DT9A 2FSMX 5F94A 2AYPA 2RGPA 4H05A 1P2AA 4BTMA 4EYMA 2C6EA 3NNVA 4GKHA 5CI7A 5DT3A 3QZGA 3QD3A 4QMWA 5CZHA 4MXXA 2GHGA 1RW8A 3LPBA 4G3DA 3AC3A 4TY1A 1OKVA 2PUIA 4CLIA 1GIHA 4IC7A 4ANNA 4CTBA 4IW0A 2QR8A 3C5IA 3FQEA 3F88A 2ITQA 4GRBA 4AZEA 2J0IA 1VR2A 1L3RE 3ET7A 3RZFA 3KQ7A 4CKJA 4A4OA 4MTAA 4UZHA 5BVOA 5CSXA 2VO3A 4IVCA 4MNEB 4MBJA 4RVMA 2J2IB 1OL6A 4I92A 5TO8A 3A7IA 3C0GA 1O9UA 3PG1A 4FR4A 3P7AA 5JRSA 4PQNA 3F2NA 3GVUA 3H0ZA 3BCEA 4J1RA 4W9XA 3RINA 4DFLA 3NZ0A 4MVFA 2B9HA 1NVRA 2C6IA 2JEDA 3I7BA 3MI9A 4I20A 5I4NA 1WVXA 4CFMA 2B9FA 2X8EA 3FY0A 5GINE 4EH8A 2H8HA 1P4OA 1REJA 3IQ7A 5DEYA 3GOPA 2PE2A 3HAVA 1M7QA 2BKZA 4FKRA 2A1AB 5K4JA 3PSDA 5LJJA 2VTRA 4UYAA 4WKQA 4XCUA 4JNWA 3LHJA 3LKMA 1A9UA 5HG8A 2VTQA 3MGYA 5E91A 1AQ1A 4DYMA 4RWLA 5EOLA 4WHZA 4L01A 4EOKA 4RJ5A 3E8CA 4OTWA 2V22A 1NA7A 2BFXA 2BZJA 5L8KA 3I6WA 2JKOA 3LMHA 3LFEA 5AUZA 3MDYA 3FLZA 5EM5A 3COKA 5ICPA 4OLIA 5EM7A 3U51A 2QU5A 3Q9YA 5JSMA 4ENXA 4F09A 2C6KA 2PMNX 2GSFA 2WTDA 4U3ZA 5ACBC 1LR4A 4B7TA 4W9WA 4M69A 2X9FA 4FOBA 3EKKA 4KKHA 1WVYA 2HXLA 5HNIX 2XEZA 5C8MA 4P5QA 4FTIA 3PA4A 3L9NA 2C5VA 2BDJA 3ZYAA 2XNNA 5CU3A 4FSZA 3TUDA 4MHAA 4CFXA 3V51A 4PP7A 5EFQA 4O0UA 3RK5A 4D4RA 3NCZA 2PHKA 4ASXA 3WZUA 5E9EA 3M2WA 3KULA 4I4EA 5CF8A 2RFSA 5JFVA 3PJCA 1XKKA 4EOOA 4RZVA 4G9RA 3BIZA 4IZ5A 2IZUA 4J95A 5CT0A 3UNJA 2C6DA 4M0ZA 3CGFA 2HIWA 1OGUA 4DHFA 3R2YA 2BZKB 2HENA 2QO7A 4OTPA 4FICA 5HCXA 3MVMA 1OIRA 3LFSA 3GT8A 4AT3A 3LVPA 4M97A 3A8WA 3FL5A 3MA6A 1JBPE 4IZAA 1IASA 3CTQA 3VS3A 1YKRA 2RIOA 2QQ7A 3G6GA 4JS8A 4LUDA 4FE2A 2LGCA 3VBYA 2QCSA 5LWMA 3W10A 3H30A 4J96A 4UALA 4U97A 5D12A 3TL8A 4G6LA 5DA3A 3FZPA 4EEVA 4GUBA 3HV5A 3RPRA 3UMWA 3NYVA 4YU2A 2PWLA 3F5UA 3OY1A 4TWOA 4Y46A 4KRCA 4C3PA 4M3QA 5ANJA 4EKKA 2V7AA 4E93A 2W7XA 5FD2A 5HX6A 3GU6A 3GU7A 4FKIA 1ZYSA 4O7RA 1BYGA 4UXQA 3GGFA 4FG9A 5IUIA 2HXQA 2W4OA 4IQ6A 1K2PA 3RAWA 3TTIA 4GYGA 5CEKA 4IACA 3OFMA 3QKKA 4L7SA 3C4EA 2UW8A 3FLYA 3PY0A 3I79A 5CY3A 2C30A 4Q5HA 4Q9SA 4K8AA 2C6OA 3PIXA 1UV5A 3C51A 3TV6A 2QOCA 3LZBA 4WRSA 5CSHA 2ZDUA 1PMUA 1JVPP 3AXWA 3DBQA 5A4LA 5I9WA 3P1AA 4G3GA 3HMOA 1URWA 3NX8A 1IAHA 5IF1A 3FI8A 3BV3A 4KD1A 2VO0A 3GC9A 4GU6A 3CXWA 4G2FA 5LCKA 4GL9A 3DK3A 4YC8A 4XV3A 3W55A 3IOKA 4O96A 5K0XA 3Q96A 3QC4A 4E6AA 3RMFA 4KIPA 5LVOA 3P7BA 2XKFA 2ITTA 1QMZA 2X39A 4DG3E 3KGAA 3ORIA 2AC5A 3ZO2A 4CMOA 3HDNA 2R7BA 2E2BA 1ZOGA 2PVJA 5J79A 5J9LA 2ZMCA 1NT2A 4GU9A 2G2IA 5EW3A 4YLJA 3RWPA 1JAMA 2F9GA 2FO0A 2JKKA 4FV4A 4I0TA 2UZTA 4GV1A 4M15A 3W2PA 3HV7A 4XHKB 3ZMMA 4BCIA 4ZS4A 4U5JA 4EH7A 1G8AA 4KRDA 4PWNA 5TR6A 3OCSA 4FNYA 3EOCA 4ACMA 2BHHA 3GCVA 3UODA 2HAKA 1K9AA 3L9PA 3MPAA 3IW5A 2HWOA 3QZFA 1YXUA 3A7JA 4O22A 3AQVA 4PPAA 3WOWA 4F70A 3ZC5A 4EYJA 4PNKA 4H39A 3BX5A 2QC6A 2VN9A 3ZRKA 3QHWA 1R1WA 5ETIA 3A4PA 2OJJA 2C3IB 3NUSA 1XH8A 3QQKA 3PZEA 4LGGA 4ZS0A 4YHJA 4IB3A 4WUNA 3I1AA 4MD8E 3ANQA 1ZMVA 2HWPA 3FV8A 3UQFA 4OAUC 4J99A 4R78A 4QMMA 2HK5A 3QUDA 4L3JA 3DJ7A 2HW7A 5CAVA 2PVYA 4BCFA 2UZWE 4GVJA 1PXOA 4UMPA 4ZEGA 4QT1A 5JGAA 4C8BA 3HZTA 2HZ4A 1BL7A 5JRQA 1IAJA 5J9ZA 4XBRA 5CQWA 4AW0A 4XV9A 5EYDA 3TIZA 3MBLA 3R00A 1U54A 4C2WA 3GFWA 3ZU7A 1FVVA 2C5YA 1BI8A 5AAGA 4DFXE 4BR3A 4O7SA 4UMUA 2F7ZE 5F9EA 2V62A 2JDRA 1M7NA 5IEYA 5CZIA 5ANKA 4W4YA 3HUBA 4M8TA 3F3TA 1O6YA 4DEBA 4G5JA 5BVWA 2EXCX 5A4QA 5JQ5A 4ITJA 2NRUA 3FKNA 4OUCA 3KA0A 4IZ7A 2YACA 2WTKC 3EZRA 4PNIA 2YISA 2PE1A 4DC2A 4EH6A 2CSNA 3AC2A 3Q5IA 4DN5A 5K4IA 1OUYA 4EOLA 3PPZA 5L2IA 4YTIA 5EHLA 4RC4A 3BBWA 3QUPA 3KXMA 5HG7A 1OITA 3AMYA 4UMQA 4BC6A 4EHVA 4ACCA 4OAVB 4C4FA 3NVKI 3NYOA 1NVSA 3E3BX 1JKTA 3E8NA 3G9LX 3BYSA 2QODA 4Y85A 3PUPA 1YDRE 3QRKA 3G90X 3ORXA 3TACA 1H1QA 2VTMA 4E5AX 3F2RA 2WZJA 2J0KA 2ITOA 4ZY6A 4IC8A 5HLPA 4RG0A 3PXZA 3ZS5A 1STCE 3FXZA 4ANMA 1MRVA 4CSVA 3ZO4A 3LCDA 3DBEA 3FMNA 5KX8A 3R8MA 5J7HA 4NZWB 3C50A 3V5QA 2WELA 4RVKA 3NUAA 2HELA 3RK9A 3JYAA 3PFQA 3FMMA 4G3FA 4I5PA 4D55A 3F5PA 3WARA 4E7WA 5E90A 4F7SA 3BYMA 5ANGA 3S95A 4U40A 2R3MA 3MB7A 2I40A 4QP9A 4J8NA 3EIDA 4X6QC 4LI5A 2J7TA 4YR8A 1FMKA 4K1BA 3MWUA 3U9CA 4GK2A 4DFNA 3KRLA 2GFCA 2FSOX 4XBUA 4RRVA 5DT0A 2OJ9A 3CD8A 2P2HA 3OTUA 3QZHA 4RQVA 4M14A 3RNIA 3OP5A 3TTJA 4FYNA 4AT4A 4BDEA 2Z7QA 2F7XE 4UWBA 3VBXA 2Z8CA 3GNIB 3Q4TA 4OBQA 3H9FA 3E64A 3NUYA 5AWMA 2Q83A 3KC3A 3PPJA 3S00A 3PJ2A 2QG5A 2BDWA 3AD5A 5IA2A 2WEVA 3Q3BA 3ROYA 4RA4A 3R73A 3I4BA 4W4VA 3E62A 4QTEA 4RJ8A 2H96A 5J5SA 1YWNA 3LCTA 3WBLA 4UYNA 2OF2A 5HD7A 4RX8A 4EZ7A 3VJNA 3PE1A 4UWCA 5IKWA 3HAMA 3GCSA 2WMUA 3V5JA 3ZSHA 5IH6A 3ORNA 3QFVA 3R71A 4PTCA 3O2MA 2GTMA 4I41A 3VUMA 4TNDA 3R28A 3EL8A 3D94A 2OIBA 4D1SA 5J1WA 1Z9XA 1Q8YA 5HBEA 3MY5A 4KKEA 3E5AA 3CY2A 5GZAA 4XX9A 3GCQA 3TDWA 3UZPA 1V0OA 4MYGA 3QTQA 2OG8A 4FSQA 2IZSA 4FV1A 4BBEA 3R21A 5HG5A 5DI1A 3GQLA 3OD6X 4ZSJA 4DH5A 5AIRA 3OCGA 5CT7A 1LPUA 1FVRA 3B8RA 5DPVA 5EI8A 3C4CA 4G6NA 4AWIA 2OIDA 4U41A 3FKOA 1OL5A 4FKVA 2VRXA 3OWKA 3JR1A 1P5EA 5FEDA 3OXIA 5HEZA 4FIIA 4ENYA 3KU2A 4QPMA 4KSQA 4L46A 1J7IA 3BHTA 1T45A 3HKOA 2IVTA 2Q0NA 3RBWA 4ZLYA 4D4VA 3F3UA 4S32A 5KUPA 3CQWA 1NY3A 2OO8X 4GMYA 2CGVA 2W9ZB 5LVLA 3PA5A 2VTOA 4AOJA 3H9OA 3SDJA 3T3UA 3R63A 1Y6AA 3NNUA 4H3BA 4LOOA 1ZOHA 4E5BA 4GKIA 4DA5A 1GZNA 3P7CA 5AM6A 4NH1A 3F3WA 2QD9A 3PLSA 5IDNA 3BWJA 1PMVA 4DBNA 4MF1A 4LGDA 4BDBA 3G6HA 3NYNA 3VS6A 5JKGA 4WSYA 2EB2A 2EXMA 5T6KA 3OXTA 1WBNA 3DT1A 4KIKA 2ZV7A 1AD5A 5AV2A 3UVQA 3UMXA 4BCHA 4QQTA 4IDTA 1JKSA 3EQBA 2CGWA 2CMWA 2W5AA 5BPYA 3R02A 5E8SA 2YIYA 2B7AA 3QTRA 4TYGA 2C6MA 4E6QA 2R3KA 5BUJA 3CEKA 5LWNA 5KBRA 3R9NA 3W1FA 2RSVA 4DH7A 4GG7A 2W17A 3PWYA 4C4EA 5IUGA 2ERKA 5E8WA 1PJKA 2UVXA 3PPKA 3ZC6A 5IQCA 4D4YA 4IWQA 1SVHA 2YJRA 2W1FA 4YZCA 3TN8A 4BKJA 4QMZA 5IQHA 4RIWB 4R6VA 2VTJA 4LOQA 5IQEA 4QMSA 4I24A 3W16A 3II5A 4R3PA 2FGIA 3RJCA 2C4GA 1JSTA 3FI4A 3KN6A 3KRRA 4LV8A 4HNFA 5CF4A 1J91A 4D2RA 3DKGA 3F82A 2XKCA 4E26A 2JFLA 4BKZA 1CSNA 1YWRA 3COHA 1G5SA 1Q5KA 4TYHA 2JAVA 3QQLA 1W7HA 4XJ0A 3CTJA 5LMKA 3QX4A 3PY3A 4ZTNA 1UU9A 4M7IA 5CF6A 4C36A 4R77A 4FG7A 5DFPA 1CTPE 3R7GA 4YLLA 1PYEA 4YZMA 4O2PA 4EWQA 2IW8A 4HZRA 2GPHA 3PXRA 5H8EA 5CAUA 5K9IA 5EI2A 1V0BA 4RIOA 3PY1A 3DQXA 3QWKA 3V8SA 3OVVA 5CVGA 2WO6A 3EYGA 1QCFA 5EOBA 2UUEA 4NW6A 4CFWA 3D5VA 4EKLA 4RT7A 3NPCA 4MX9A 3SQQA 3ZUTA 1OIYA 4ITHA 1DI9A 2PVNA 2Y4PA 4QTDA 3EN9A 1G3NA 5AUWA 2YZLA 1UWJA 4RVTA 2BFYA 5CF5A 2C1BA 2IW6A 2ONLA 4EK8A 5L4QA 3OWPA 1IA9A 2Y4IC 4O0YA 4WBOA 5IU2A 1GNGA 3MS9A 3QKMA 2XJ1A 4UB7A 1NVQA 3K3JA 3CP9A 2OIQA 3G9NA 3BYOA 4FBXA 3WZEA 4PMPA 1WBSA 4QMOA 4K77A 5TKDA 4JLCA 2F4JA 2IJMA 2FB8A 2YWPA 4GJ2A 4X2KA 4AN2A 5KBQA 3FL4A 3LXPA 4FUXA 4FGBA 3WF5A 2W1DA 5HBHA 3D7ZA 1WBTA 3ATTA 3VUKA 4F1MA 3FUPA 1H1WA 3VRYA 2NNWB 5LVNA 4RIXA 2ZDTA 4D0WA 3KF4A 5E8VA 5EYKA 4E3CA 2JD5A 4AE6A 4DCAA 3WIGA 2W1EA 1B6CB 2XM8A 4NIFB 3CPCA 3EHAA 4IX4A 4S30A 5KE0A 1Q41A 2ITYA 3C13A 3NGAA 4D2SA 5AUYA 3UC4A 3UYSA 3VBQA 4KBAA 3R8PA 3R0TA 4MQ1A 3HL7A 3SC1A 3AC8A 3KXHA 3GU5A 4ASDA 5EDPA 1PF8A 3U6HA 4HW7A 2NP8A 4PV0A 5DGZA 2Y0AA 3QBNA 4BBFA 4FT9A 5E1EA 1JNKA 5FUTA 2GNIA 2BZHB 2XRWA 3L1SA 4NWMA 4LL5A 3KVXA 4PRJA 4ANBA 1F0QA 5GJDA 4NYEA 2SRCA 4U44A 4GJ3A 4L67A 4LFIA 2R3NA 3TG1A 4YGAA 4ZIMA 4CTCA 2ZM3A 3OEZA 5IEXA 4RC3A 3QLFA 3HV6A 2YAAA 4MBLA 4EL9A 1Q97A 5BVDA 3R8ZA 2BUJA 4F1TA 1AGWA 4YZ9A 2W99B 1KOBA 4MF0A 4YURA 5HVYA 3OW3A 3ZEPA 4CYIA 4NM0A 2XNEA 3BU3A 2VTNA 4DGNA 4GEOA 4QQCA 1F5QA 3NMUF 2ZB1A 2UZDA 3C5UA 5BVFA 5HE2A 4RFYA 4XYFA 5DR6A 4QP3A 2UVZA 4L44A 3UPZA 4HGEA 4ZJIA 3HRCA 3QWJA 5A4EA 4RFMA 4CFVA 4CQEA 2PVFA 4JX3A 4V01A 2BROA 3ZLYA 4BCGA 4XG8A 4BDAA 5I9VA 1ZZLA 2YIXA 2EXEA 2OGVA 3VS5A 1UU8A 3D7TA 3A4OX 4I0SA 2WD1A 4C61A 1IRKA 4NFNA 5AAFA 1GZ8A 3DU8A 4IB0A 4WO5A 3ZBFA 5AP1A 3E7VA 3FLQA 2GNLA 2GHLA 3SV0A 3QRJA 4V0GB 4ZSEA 5ETCA 1UU7A 1KWPA 1YQJA 5HO8A 3EQIA 4Y73A 4FKGA 5BNJA 3RAKA 3BLHA 1Q24A 4BTFA 4DEIA 4GT5A 4U8ZA 2IVSA 5AV0A 5D7VA 3OG7A 1CKIA 4RBLA 3FLWA 3KL8A 2IVUA 5IUHA 2XK8A 2OXDA 2BDFA 2ETRA 4BWKA 3I81A 2KULA 5GHVA 4JRVA 3QA8A 2IG7A 1B38A 3H10A 1KE6A 4RWJA 4QNYA 2YFXA 3KXGA 3FBVA 5M08A 4K11A 5DE2A 5DRDA 5FWKK 2BAJA 4X2JA 3WI6A 2YERA 3PRIA 5HVKA 1PXIA 1OPKA 3BLQA 2X0GA 3EFKA 3CIKA 4R1VA 2PMIA 4B6LA 2J50A 5GZ8A 2GFSA 3FE3A 4OBOA 4XEYA 4IANA 4IVAA 3ORLA 2QOLA 4ONAA 1J1CA 5IA4A 4D58A 3RPOA 3QCXA 3SA0A 3B2WA 5B2KA 3SVVA 2R9SA 4BDJA 5L3AA 1GAGA 3W8LA 4MNEA 1XO2B 4UMTA 1URCA 2BPMA 3QRTA 4R1YA 3VC4A 3ZBXA 3NEWA 4E1ZA 1Q8ZA 2OZAB 4IFCA 4JAIA 1XWSA 4FZDB 4IMYA 5K3YA 5J9YA 3GC7A 4FTLA 5F20A 3O8TA 4BRXA 4HNIA 5FEEA 5HIEA 4H3PA 4QP8A 4HPUE 4O86A 4FX3A 3A99A 4N0SA 2FSTX 1VYZA 2CCIA 4W8DA 4AN3A 3VUIA 4BN1A 4DLJA 3POOA 5CS6A 3Q4CA 2CLQA 3VIDA 4PL3A 2W06A 2C0IA 4NEUA 3E63A 1MUOA 3IONA 4C33A 3HYHA 1H00A 2WMTA 3L8SA 4CFNA 1VZOA 4CRLA 3RCDA 4BCJA 3TM0A 2WTIA 2Z02A 3P4KA 2VGOA 3A2CA 3FKLA 4XG6A 4I22A 4RIYB 3VO3A 1ZY5A 4DGMA 3KVWA 2OJIA 3GCPA 4FZ6A 2BRMA 5J5TA 4PMTA 3EB0A 3RI1A 2OFUA 4ZY4A 3M11A 3UIXA 4BFMA 4F6UA 1H26A 2OJGA 3AMAA 2R0UA 4FKTA 2O8YA 4ZSLA 5A14A 3FMEA 5JQ8A 3TI1A 3ZH8A 3SLSA 2W1HA 5L2WA 4AX8A 3RAIA 2UZLA 3DKFA 1OPLA 2A27A 4M0YA 4OTDA 3IPHA 4FIJA 4FNWA 5FTOA 3ZHPC 3UQCA 4NM3A 3BHVA 4FT7A 3G5DA 4KAOA 2C0OA 4WBBB 3Q53A 4QMXA 2G1TA 4YUQA 4QO9A 4J8MA 3ORZA 4U6RA 2WXVA 4EHZA 4ZXTA 2CGXA 4HVIA 3O7LB 1RQQA 2R64A 2YEXA 3PTGA 3WYYA 4B99A 1WMKA 3FZRA 4QP7A 5CVFA 4IE9A 4ACDA 3DA6A 5FXRA 4HCUA 2VO6A 1QPCA 5FTQA 5BVKA 2QU6A 4I6BA 4XP2A 2XNPA 3PWDA 5IA5A 2RKUA 2WTWA 3KK8A 5JN2A 4JBVA 3NLBA 4LMNA 2C3JA 5KMOA 4F9WA 3NYXA 3CGOA 2B55A 1ZWSA 1KE5A 4O27B 3RKBA 3E8DA 5EQPA 2OWBA 4DFUA 4BYJA 3FI2A 1LUFA 3IW8A 4BKYA 4E4XA 5CU4A 1Q3DA 1OZ1A 1MP8A 2YDJA 3EQHA 4IM3A 2VX0A 4FVRA 1ZOEA 4LMUA 3DLZA 1SNXA 3HP2A 4IAIA 3R01A 1WCCA 4QQJA 1NW1A 3VS7A 4GK3A 4HGSA 3HNGA 4JDIA 3BBTB 5D10A 3T3VA 3BHUA 4AS0A 3LFAA 3QF9A 3RZBA 2B4SB 2C3KA 2F2UA 3MY1A 1FGKA 2DYLA 2A0CX 5CTPA 4IHPA 3V04A 4YBJA 1Y8GA 4RX7A 4GH2A 3FSKA 2BKKA 4AAAA 4O7LA 3NUPA 4QRCA 3R8UA 5AR3A 3NDMA 4I6QA 5EYMA 2R3JA 3VN9A 4N4SA 3Q9WA 4YJQA 3ODYX 5EHYA 5C26A 5IISA 4YTFA 4U79A 4PTEA 4BI2A 3DAEA 4WNPA 4IBMA 5CSVA 2WQNA 4YMJA 3ZUVA 1QPJA 3AGLA 2E9VA 3OY3A 4XOYA 4L8MA 4FYOA 2Z2WA 4R7HA 3RVGA 1YRPA 5C27A 4BZDA 1H25A 5HI2A 3VULA 2HY81 2XIRA 4LM5A 4AG8A 4EQUA 3F66A 2GDOA 1FMOE 2PSQA 2GMXA 4BDCA 2UW5A 4YO6A 2PYWA 2PMLX 2YM8A 5A9UA 4BHZA 4FSMA 3ATSA 4QMLA 1JSVA 3D5XA 4PPBA 2ZM4A 4TWPA 4QMNA 3V5TA 5T68A 1XBAA 1XQZA 3C4FA 3D2IA 2P55A 4FKQA 3R7YA 3ORKA 2J51A 2O2UA 3FXWA 4FSWA 3OUNB 4FVQA 4JG8A 1YXSA 1DM2A 2O5KA 5LMAA 5LQFA 4M69B 2X9EA 1M14A 3HEGA 3JUHA 3PRFA 4NW5A 3SKCA 3JPVA 1Q61A 2QO2A 3EQFA 5CU2A 4FL1A 4I1ZA 5L8JA 2C68A 2ZV9A 4BWXA 5D9HA 4HYHA 5HNGA 3S0OA 3KULB 4O6LA 3BU6A 3VHEA 3R9RA 3BZ3A 2QOOA 4IM0A 1A06A 3CQUA 4D1ZA 4PDYA 5AV1A 5G6VA 1ZMWA 1DAWA 3CCNA 3WE4A 1RE8A 4K2RA 1YHSA 4N6YA 1ZRZA 3KKVA 4ZZMA 1MRYA 1BKXA 5I9ZA 4MXAA 3FMKA 4J53A 3QTSA 4HYIA 2JKMA 2PVMA 4QTBA 3RPVA 4BDIA 3ZLSA 4X0MA 3NW6A 2CKPA 1BX6A 3F9NA 4L00A 4X6RA 3K5UA 3WF8A 4RJ4A 1ZARA 4MXOA 5JZNA 2B52A 2ITXA 1JSUA 1IEPA 4Z3VA 4P5ZA 1WBVA 3P0MA 4DINA 3U54A 5IZFA 4FV2A 3R9OA 4BBMA 2ITZA 3H3CA 3KF7A 2DQ7X 4C62A 2J90A 3MJ2A 3SXRA 5CENA 4KA3A 3QTUA 2XKDA 4JRNA 4J52A 3LFFA 3CPBA 1UU3A 2HZ0A 3RCJA 1Q3WA 4ALVA 4APPA 4YJPA 2VTSA 4CCUA 1M2PA 1WVWA 4E6CA 2PZIA 3OCBA 2G9XA 2R4BA 4FIHA 4TYJA 3KCFA 4UZDA 4CFFA 1OKYA 3TZ8A 5L8LA 3D9VA 4BGQA 2BTSA 4HZSA 4KBCA 4OT5A 4BZOA 4QYEA 4TT7A 4ZTRA 3W2OA 5A4TA 3MIAA 2ETMA 4LV5A 2YA9A 3D14A 1GIJA 1NXKA 3FSFA 5BVNA 3BLRA 5ANDA 2YIQA 3V5WA 3FQHA 1WBPA 2QVSE 5EKOA 4FGRA 4DT8A 3EYHA 2OXYA 4ZTQA 3Q32A 2J0LA 2E9NA 4O91A 5CAPA 3FYKX 3QD2B 4G9CA 3PVBA 4YO4A 3U8WA 4LL0A 4CNHA 4KINA 3UDBA 1Y6BA 3OUKA 2WIHA 2BIYA 4GG5A 4Y95A 2BRBA 2QOIA 1JPAA 4R8QA 3ACJA 1Q8WA 1Q99A 2F7EE 3U6JA 4L42A 4AZFA 2ZB0A 4EK4A 5CAQA 3KEXA 2J5FA 4I3ZA 3HUCA 1ZLTA 3BEGA 1R3CA 4G5PA 4PMMA 4Q2AA 4U3YA 1UKIA 5D11A 2Z7SA 3UIBA 4OTRA 4QYHA 3WILA 2BIKB 4USEA 1PXJA 3MJ1A 4FZ7A 1RDQE 2E9OA 2I6LA 4B9DA 3ORMA 4BDHA 3AC1A 4G31A 4IAKA 3DDQA 3V8TA 4WNOA 2OK1A 4XLIA 3ZRLA 4CZUA 4E4MA 3UZTA 2WEIA 4IIRA 5M4CA 1Z57A 3S2PA 3KY2A 1YHVA 2R3RA 3O51A 4ANLA 2YM4A 3AGMA 4RWIA 4BIBA 4EI4A 3ULIA 3PSCA 4I21A 1ZMUA 4AOIA 2X81A 2RL5A 4GFGA 4ZAUA 5JFXA 3EMGA 1CKJA 3I60A 4RX9A 4FSNA 3V8WA 2JKQA 3BQRA 4YTHA 3N9XA 2WQOA 3SG9A 2EB3A 2OXXA 3GI3A 2JITA 4QYFA 4JDJA 4IX5A 5HKMA 4C4JA 2UW7A 3OWJA 3WZJA 4EZ5A 3LCSA 2Y9QA 5EI6A 4TWCA 3OXZA 2OF4A 1OL1A 1SM2A 2PZRA 4FTMA 5ACKA 5AAEA 4XNEA 2XBAA 4QMVA 4F6SA 4U7ZA 3I0OA 4FTOA 4ZMFA 2BILB 5IMEA 3LXKA 2OI4X 3E87A 4BCOA 4FG8A 3N4VA 4YJNA 4IXPA 5E8UA 4HGTA 2XIKA 5EH0A 3GXLA 2QURA 1E1XA 3QLGA 3BI6A 4ZZNA 5HTCA 1O6KA 1U54B 4F9YA 1GJOA 4C3RA 4L52A 5FM2A 4UX9A 4Z7HA 1W0XC 5J1VA 5I3OA 5KNJA 1JKKA 4OTIA 4O84A 3MVJA 2OBJA 4QP4A 5J8IA 1PKDA 4YJUA 4D2TA 3CQEA 2JIVA 2PZ5A 2PVLA 5DNRA 4AXAA 3PLAE 2JIUA 5CEOA 4KSPA 4YZNA 3C4WA 2R3OA 5TOZA 1APME 1YXVA 3TNIA 5LOHA 2OJFE 5KMIA 3QTWA 4J71A 3L9MA 4PP9A 3L8VA 2UZVA 3EWHA 4X3FC 3K54A 3E3PA 3D0EA 3QQUA 4IB1A 5AP0A 4EOQA 4BVUA 1CM8A 5BMMA 4DGLC 1I44A 3LMGA 2CPKE 4NKSA 4YJRA 4F63A 4UY9A 4AW2A 3HV3A 3UJGA 4ZY5A 4DTAA 3PA3A 4CD0A 5IA3A 2ITPA 2ZM1A 4CT2A 1LP4A 2B1PA 3FLNC 3R04A 3UOLA 4D2VA 3LQ8A 4YTCA 4LRMA 4GFMA 3RHKA 3ENHA 3PIYA 3SHEA 3BHHA 2WMWA 4MWIA 2IN6A 5HIDA 3WIKA 1YOLA 1J7LA 2GQSA 2BAKA 2GTNA 5ETFA 3QD0A 4BTKA 2XRUA 2YCRA 1VJYA 5AMNA 4X3FB 3PVGA 5ANEA 4EOSA 3JVSA 2HYYA 2HY0A 1H27A 3MH3A 3NIEA 5HESA 3VAPA 4PUZA 3NS9A 3ZZEA 3TKHA 4UN0C 3DXQA 4L9IA 2RG6A 5HVJA 5C4KA 5K5NA 3SW7A 2FVDA 3CJFA 3QCQA 2YM3A 2UVYA 2XK6A 3DV3A 3S1HA 4R3CA 4DTKA 5HICA 2UZUE 3KRJA 3TCPA 4O0RA 3PXKA 4D4SA 4X2NA 5A54A 4PDSA 4FTTA 4UEUA 2G15A 4LOPA 4RC2A 1U46A 4TL0A 2F57A 4BZNA 5JGDA 3VJOA 3H0YA 5IQGA 4YZBA 4O0VA 1FINA 3A62A 4YNEA 5D1JA 5EG3A 4D5HA 1HCLA 3F3VA 5K0KA 4ASEA 5I9UA 4DH8A 3JY9A 1H8FA 4AP7A 4MD9E 5FGKA 1GZOA 4NFMA 1U59A 4A9SA 3SXSA 4X2GA 3RM6A 1HOWA 2V5QA 5AUVA 3UC3A 1YWVA 4D0XA 2XYUA 4AA5A 3EN6A 2UW3A 3ORTA 4FT0A 1W8CA 4ZK5A 2W4KA 3LJ0A 5BYYA 3ZONA 4F99A 5AFVA 3HP5A 3TZMA 3H9RA 3NUNA 3ZO1A 2EVAA 1OPJA 5F95A 4XG9A 3HV4A 4WA9A 4G34A 4JR3A 4PDPA 3SX9A 3TEIA 2H9VA 4WNKA 5JGBA 1U4DA 5DBXA 1XR1A 3OBJA 3F7WA 5M51A 5J95A 3LW0A 5DRBA 2HOGA 4QMYA 3BU5A 4NM5A 3VF8A 3WF9A 4CZYB 2VTHA 4X2FA 4MXZA 4DEAA 4CKRA 4FV9A 5IA1A 5DYJA 3DBFA 4OBPA 5G1XA 5AR8A 1SYKA 2H34A 3LLTA 3LXNA 2ZV8A 1QPEA 4OTHA 4RA5A 4R7IA 1PXPA 4LQMA 3ZXTA 4KABA 2YZAA 5CEMA 5E8TA 1GIIA 2YCFA 1JKLA 1Z5MA 3H4JA 1UNHA 3PE2A 3IGOA 3NSZA 5AA8A 4XRJA 4DEHA 3Q2MA 3RNYA 4E8AA 4G3CA 3BQCA 1YI4A 4X3JA 2XZSA 4HVDA 5I9YA 2W96B 5E92A 3QCYA 4MK0A 4NTTA 1E9HA 2XNBA 2XEYA 5ANIA 4WT6A 1A48A 3GBZA 2XIXA 1KV2A 5C9CA 4CMTA 3EQRA 1YXXA 2XK4A 4Q5EA 5HCZA 5M55A 3A7GA 1R78A 3KRXA 2R3HA 2OICA 5CYIA 4EOIA 5EK7A 2ITVA 4FKPA 4S34A 1U5QA 4L3LA 3THBA 1BI7A 4BYIA 4ANQA 1JOWB 4KNBA 4L6QA 4GK4A 3FZOA 4W4WA 3UOHA 4D1XA 4FEVA 2VWYA 3OT8A 3ZLXA 3LFNA 4CT1A 2W5BA 2XS0A 4ZTMA 4RJ7A 4FK6A 3MVHA 4FNZA 4YPSA 1H1RA 5FM3A 1YW2A 3NNXA 4LGHA 1MQBA 4HVGA 3MH2A 1OUKA 2JAMA 4DITA 5L2QA 5DMZA 3P78A 3QC9A 4R5SA 4NIFA 3LFCA 1H0WA 2PVRA 4IH8A 2Y7JA 3UG2A 3Q5ZA 4DTBA 1M17A 2REIA 3TNWA 4FKLA 3CKXA 4JIKA 5J7BA 5BYZA 4QTAA 5CLPA 5EW9A 3VQHA 1SMHA 3IG7A 4EOMA 5H3QA 3IDBA 2OZOA 1WFCA 3G0EA 3K2LA 3ZSIA 2F49A 4C4IA 5KMKA 3OT3A 3Q2JA 2AC3A 3QUEA 4FUYA 4F08A 3MA3A 2PZYA 4GCJA 4EH3A 3P86A 4NJDA 5AP5A 4AW1A 4ZZOA 4FEXA 3JXWA 3MPTA 3OEFX 5CX9A 3W2CA 1W84A 3VBTA 5A4CA 4BDFA 4O7WA 1PY5A 3HMMA 3U4WA 1XJDA 4CGAA 3ELJA 3UIUA 2UW0A 2P3GX 4PDOA 3WZDA 2WB8A 2R3PA 5HX8A 1YOMA 3W2RA 1U5RA 4L53A 1YI6A 5AP2A 3QTIA 3W18A 2WKMA 5LVPA 4YLKA 2XK9A 5AR4A 1PXKA 4FKSA 3NR9A 3RP9A 1KSWA 2CDZA 2NPQA 3MTFA 3Q9ZA 4FEQA 3QKLA 3L9LA 4PPCA 4TZRA 4F7JA 4HGLA 4TWNA 4RFZA 4R3RA 1W82A 5FRIA 2XVDA 4ALUA 3E8EA 4UBAA 4G17A 5CAOA 4XRLA 5BX0A 4MBIA 4I5CA 2O0UA 4BCPA 4NK9A 4KWPA 3FZTA 3VNTA 4DEGA 3WZKA 4JOAA 3DAKA 2OH4A 3F2AA 4OT6A 2X4FA 4V05A 4EC8A 2V7OA 3NW7A 2X6DA 2QR7A 4XOZA 4FF8A 2B0QA 3EN4A 5EM6A 3E93A 3TT0A 5JK3A 3DNDA 4BICA 2IZRA 1TVOA 4OR5A 3RGFA 2WMVA 3IGGA 4BWPA 5L6OA 3W32A 3DB8A 3EH9A 5FG8A 2CKEA 3V5LA 3N4TA 1M2RA 4CRSA 2WTCA 3P23A 3TNPC 1LEWA 2OSCA 5HLWA 4C3FA 5L2SA 3QAME 3K3IA 3V01A 3PP0A 1E1VA 3PXYA 2X8DA 4F9BA 5CXHA 1PW2A 4O6EA 2X8IA 3SRVB 5BUIA 3JY0A 1Y91A 3EKNA 5BVEA 3ALOA 3BV2A 4BB4A 2ITNA 5TE0A 4FNXA 2XF0A 4XV1A 3FMJA 3G51A 4R7BA 4RQKA 4XG7A 3DKOA 5DR9A 1ZXEA 2Y8OA 5H9BA 5HG9A 1TKIA 3NWWA 3BHYA 1ZYJA 2JLDA 5B7VA 3VVHA 3KN5A 3LQ5A 4RVLA 5DWRA 3ZUUA 4W4XA 4F4PA 3TUCA 2BRNA 4F7LA 4B0GA 4JG7A 4RIXB 4Q9ZA 4JBQA 4C35A 3DPKA 2VV9A 4GVAA 4TNBA 2YWVA 3BYVA 4MXCA 4MWHA 1JQHA 5HHWA 5CEQA 4PL5A 1ZYLA 1UNGA 2XNOA 3PXFA 2VTTA 2IVVA 4Z9LA 2IO6A 3ZO3A 2C1AA 2CKQA 3ERKA 5DHJA 4AE9A 4EHGA 1XH7A 2RFEA 4OW8A 5I9XA 2QNJA 1H28A 4NT4A 3ORPA 1H1PA 3T8OA 2PVKA 4EUUA 3M42A 3AOXA 3Q4ZA 5AIKA 5EDQA 2VD5A 4CG9A 4CYJA 4DG0E 3CBLA 3P5KA 3LQ3A 3R9DA 4I93A 1PXLA 2C6LA 3CD3A 2XBJA 3ZOSA 3D5UA 1WBWA 4K6ZA 5GJGA 3QCSA 4Y5HA 5DH3A 5AEPA 5IMXA 2QG7A 4IM2A 4FV3A 4L7FA 4AF3A 4BGHA 4C7TA 2WMSA 4I94A 3R22A 2YJSA 4WUAA 5CEPA 1YI3A 3SAYA 3ENMA 3D5WA 4FTUA 4FTRA 1Q8UA 3NRMA 4TTHB 2QOBA 2YDKA 4RIYA 5ETAA 4DGOA 4YP8A 3TWJA 3DJ6A 4GUEA 3FWQA 4ARKA 4XUFA 4YSJA 2XA4A 1KE9A 3KMWA 3R2BA 2VWWA 2Z7RA 4M12A 4XG4A 5JEBA 3RHXA 3VBVA 4F65A 3O23A 3BEAA 3OOMA 5KMMA 4AQCA 3OCTA 4Z55A 2WU6A 5KMJA 2J0JA 2CCHA 3PDTA 4E73A 4RLKA 1OIQA 4WD5A 1PXMA 4EH9A 3G0FA 2W0JA 2G2HA 3D7TB 4NTSA 3PVUA 3QD4A 1OECA 4J98A 4BF2A 2VGPA 4PL4A 3TZ7A 4FKOA 2UZEA 4ZSAA 4O81A 4LYNA 2XIZA 2A4LA 3FC1X 2RG5A 4FL2A 4FV6A 2I0HA 3RAHA 1OL2A 3VUGA 4KIQA 2YAKA 1UVRA 2XK3A 3OS3A 4P90A 5KCVA 4O2ZA 3RWQA 1O6LA 3T9TA 1S9JA 4H36A 1X8BA 4NCTC 5FXQA 4TXCA 1F3MC 2O65A 1UKHA 4XG2A 4A9TA 4ALWA 4IEBA 4FEUA 4J97A 4QP2A 2BCJA 2HZIA 5TF9A 4ACGA 2GS7A 4F7NA 2HCKA 3D83A 3LFDA 3DFAA 2YCSA 4NSTA 1ZAOA 2CGUA 3DTWA 4L3PA 3QQHA 2WNTA 1VYWA 3UO4A 3WF6A 4EBWA 3E92A 3ZSGA 3NUXA 5A46A 1I09A 3PG3A 3FYJX 3DLSA 3Q04A 3KREA 4GT4A 3Q4UA 2W9FB 4ZTLA 5DT4A 2PZPA 4LRKA 5HNBA 3W8QA 1SNUA 5KHWA 1H4LA 2O64A 4FKUA 4WG4A 2W05A 3WE8A 2C3LA 4B4LA 4CMUA 3U9NA 1UNLA 3QGWA 5E7RA 3IKAA 5CU6A 4NL0A 4FVPA 4O7ZA 3GU4A 4C59A 4L68A 3F3ZA 2VO7A 1Q62A 4D9TA 4HOKA 3PSBA 2YITA 2VNWA 3UE4A 3UO6A 3V6SA 1ND4A 2WPAA 4AACA 2C6TA 1PXNA 2R3LA 1KV1A 4FT3A 5JFSA 4FC0A 4JQ7A 1V0PA 3QTXA 3BKBA 3OHTA 1V1KA 4TYIA 4EOJA 3RK7A 5H2UA 4YSMA 3MH1A 3FI3A 3ZLWA 2FA2A 4BDDA 4A9YA 4JDHA 4G16A 4I6FA 3ZFYA 2UW4A 3VWAA 5AR7A 4CCBA 3IO7A 2Q0BA 4DH3A 3TKIA 1OKZA 2ESMA 4XLVA 3HRFA 3O8UA 2EU9A 4TPTA 3OWLA 3CR0A 5DN3A 4RLLA 1HCKA 1FQ1B 3SG8A 2GQRA 1GZKA 3JVRA 1H07A 1MQ4A 1OMWA 3EN7A 3FEGA 4NUSA 5HIBA 3Q9XA 2BHEA 3BELA 3C4ZA 3LFBA 4OTFA 2QO9A 4FKWA 3R9HA 3VS2A 2WMQA 1YDTE 2XM9A 3IW4A 1XBCA 1ERKA 3UVPA 2I1MA 3HX4A 2YIWA 3OMVA 3CLYA 3QQJA 1OVEA 2OKRA 4FTCA 5I5ZA 3UNKA 3BE2A 4QTCA 3G2FA 3PZHA 3FXXA 4FMQA 3MYGA 1ZY4A 3FMLA 4RJ3A 3SOCA 4S2ZA 2YM6A 5HORA 1H24A 4KUJA 3QQGA 3MN3A 3ZXZA 4AGDA 3RM7A 4JDKA 4GS6A 2XJ0A 3VS4A 3MFTA 1XH9A 3R1NA 1ATPE 3AC4A 4JBPA 1ZYDA 3OTVA 2XNGA 4ANOA 3LLAA 2O3PA 4NM7A 4O1OA 5JH6A 1BL6A 3K5VA 3QXOA 2ZVAA 4FSRA 4I0RA 3F6XA 3QU0A 1J3HA 5KZIA 2CNVA 4EJ7A 1MRUA 5FP5A 5DIAA 2X2MA 5M57A 2BTRA 4RJ6A
chains in the Genus database with same CATH superfamily
3POZA 3C1XA 3TV4A 2NYAA 4TKSA 3HA6A 1LEZA 2FH9A 2XMYA 5D7AA 5C1QB 3FLSA 3I0QA 3ZDUA 4EH5A 4WG3A 1W98A 3NIZA 2J0MB 3P79A 4FTNA 4RWKA 3ZFMA 3F5GA 3OROA 2W1CA 3CC6A 4XMOA 1FVTA 4FZAB 4XG3A 5DOSA 1R0PA 3VRZA 3Q60A 4F1OA 1OKWA 2PMOX 3DAJA 3UOJA 2ZJWA 4U43A 4AA0A 3R6XA 5HQ0A 2C69A 2W5HA 3R1QA 5AR2A 2PL0A 5IPJA 2I7QA 1SZMA 1CKPA 3E7OA 5CQUA 5FDXA 3FQSA 2X7FA 1YHWA 3TNHA 3ZTXA 4EORA 3KCKA 2WQBA 1J1BA 1Q4LA 5HCYA 1KE8A 5F4NA 3UP7A 3W0PA 3ULZA 3C0HA 4U42A 4C0TA 4FIFA 1QPDA 4YHTA 5E4HA 3FHRA 3SXFA 1XH6A 4U81A 4PTGA 4IAFA 4QYGA 2EUFB 4A07A 4OGRA 2WGJA 4BCQA 4FK3A 5E8ZA 4OTQA 4C34A 3PP1A 2P33A 2YLFA 3FDNA 2UV2A 3FZSA 3KXZA 5EYCA 3C9WA 4F0FA 5CALA 2ACXA 4DFBA 4C02A 2QOFA 4ZP5A 3ZM9A 3VUTA 3KRWA 2J4ZA 5FBNC 4AN9A 2V0DA 3UZRA 4DE4A 3AD4A 2R0IA 5AJQA 5HE3A 2WQMA 5FBOA 3CTHA 2W1ZA 4IAZA 4GW8A 3QYZA 2GCDA 5EQEA 3MTLA 2GNGA 2BALA 4F9CA 3N4UA 3LIJA 4J7BA 3CKWA 1YDSE 2UZBA 4JQEA 3A8XA 5FQDC 4KKGA 3W33A 5LARA 2ZV2A 1PMEA 3AMBA 4X7QA 5CNNA 4BL1A 2CLXA 5EDRA 4DF3A 3A7FA 4Z7GA 1REKA 4ORKA 4USDA 1TQPA 4BCNA 4ITIA 3HGKA 2VUWA 2YABA 4QPAA 5A3XA 4LG4A 3T9IA 4H1MA 5JMSA 4I4FA 3GB2A 4ZOGA 4TYEA 3VS1A 1L8TA 3FAAA 4AFEA 1M2QA 1JLUE 1SVGA 5AM7A 4D28A 2QONA 2YM7A 2ETKA 3OC1A 1H0VA 4G1WA 4EQCA 1W2CA 2GS6A 3NNWA 5IG1A 3ANRA 3Q52A 2GHMA 4CXAA 3QALE 3BLAA 4L43A 4HVSA 2GU8A 4EQMA 2OW3A 2J9MA 4BIDA 1UA2A 5C01A 4AGWA 2YLEA 2YDIA 3MFUA 3QX2A 4H58A 1P14A 3NW5A 2XALA 4JMQA 2B9JA 3AC5A 2C5OA 1GY3A 2CN5A 4HVHA 4B8LA 4P4CA 3O7LD 3BRBA 4DTAA 2IZTA 4JQ8A 3GP0A 4DDGA 2ZYBA 5HTBA 3ID6C 4JI9A 1FOTA 2C0TA 4CFUA 4O38A 4PF4A 2JGZA 2I0YA 2G2FA 4GFOA 3QGYA 4W8EA 4O0TA 4HCVA 3I6UA 3DOGA 5HBJA 3DXPA 4TN6A 4D5KA 3ALNA 5CANA 2E9PA 2CNQA 3G15A 2WFYA 4MKCA 2WOUA 5CI6A 1DI8A 2B53A 1PMNA 3EFWA 2XARA 5EKNA 5BV3A 4FZFB 4R5YA 1IA8A 3N51A 4IJ9A 4AUAA 5AV4A 5EQYA 4KB8A 5FLFA 3QXPA 5CWZA 3I7CA 4FI1A 2X7GA 4O83A 3W0RA 3Q6UA 3MSSA 2W1GA 5BYLA 3CS9A 3IK3A 3MV5A 4CVAA 4FTJA 2JDSA 2ITUA 3GEQA 3D4QA 5B2LA 3PYYA 3MVLA 2BMCA 4FIGA 3VUDA 3UTOA 1OL7A 5IQAA 3TDVA 2RFNA 2Y6OA 4IAAA 5H8GA 2QHMA 3UVRA 3MB6A 4O0SA 4FTQA 2VU3A 3COIA 4EK3A 2R3QA 5JFWA 2Y6MA 4O7VA 2G01A 4C2VA 2KTYA 5HTIA 2ZOQA 4F9AA 4Y5QA 4XV2A 2VTPA 3LFQA 4E6DA 3DK7A 3BPRA 3CE3A 4MNFA 4YBKA 3MY0A 3KMUA 3CY3A 5LMBA 3NFFB 1B39A 2PY3A 3SOAA 3V3VA 4KBKA 2A19B 3UYTA 3BYUA 4A4LA 2ERZE 4FIEA 4ACHA 3TV7A 4LUEA 4M66A 3TXOA 4YJVA 2LAVA 5HU3A 4FV5A 2QOHA 4AA4A 2Z7LA 3W2QA 3PIZA 3OOGA 2XIYA 2PPQA 2PE0A 2WTKB 3P9JA 4G6OA 3LAUA 3IS5A 5IQBA 3IW6A 3Q6WA 1M52A 5KMLA 3U55A 5AADA 3ZCLA 4BHNA 4X3FA 5F1ZA 4DLIA 3OF0A 2OFVA 2OU7A 3C4XA 4BI0A 1OBGA 3LCKA 5M4IA 3M1SA 5FEQA 4WG5A 4A06A 4USFA 4QD6A 3HLLA 3DCVA 1H01A 4N57A 5KHXA 1BLXA 4PX6A 1XH4A 2X1NA 3DZQA 3UPXA 3DKCA 4O7YA 3OZ6A 3MW1A 3EJ1A 2P0CA 3IDCA 3QTZA 3E88A 4QDVA 5BUEA 4YPDA 1IR3A 4QMUA 3IOPA 4D2PA 2VWZA 5HU9A 2CNUA 4C57A 4F6WA 2VTAA 2QLQA 5L2TA 1YVJA 2HZNA 3P08A 5HGIA 3VW6A 4MQ2A 5FXSA 5CASA 1QL6A 4CLJA 5M56A 5GJFA 2IPXA 2EWAA 3WF7A 2JIIA 4EC9A 4IWDA 2OH0E 4UMRA 4K33A 4EHEA 4FV8A 4YJTA 4N6ZA 2WHBA 4QNAA 2VWIA 3R8LA 3UBDA 3ZFXA 2R5TA 4U9AA 3QYWA 1DAYA 4DCEA 3HMNA 5HZNA 4AGCA 4JX7A 4WNMA 4AT5A 2F2CB 3KFAA 1WZYA 4O7NA 3ETAA 4Y72A 4ZMEA 2XJ2A 4D9UA 2C5XA 2ITWA 3DBCA 4Y83A 2PK9A 3B8QA 4S33A 3CSVA 4MH7A 3NVMB 3DQWA 4BDGA 2FYSA 4F64A 4HCTA 3R1YA 2R3IA 4C58A 3F61A 5K5XA 2FSLX 4ERKA 3VF9A 3KXNA 3LXLA 3HMIA 4Y8DA 3S4QA 3LOKA 1YXTA 2VZ6A 2W1IA 2WQEA 1BMKA 1P4FA 3PJ8A 4II5A 2A2AA 4ASZA 2VWBA 2BRGA 4F0GA 4N70A 4RX5A 3DDPA 2C47A 3C0IA 3VS0A 2DWBA 5IH4A 1FPUA 1TQIA 4QMTA 3F69A 4QMQA 2BR1A 1PKGA 4RIWA 3O0GA 4L45A 5JT2A 4DH1A 2R3FA 3HMPA 3TJDA 3GENA 2VX1A 3LE6A 1EH4A 2PU8A 3EL7A 2H6DA 4IAYA 3RALA 3QZIA 4I6HA 3FPQA 5C03A 3U4UA 4DAWA 1CMKE 4FSUA 5HO7A 1OBDA 1OIUA 2HW6A 2P2IA 5DG5A 3FC2A 5KZ0A 2VNYA 2BZIB 3HVCA 4QQ5A 3EQDA 1G8SA 3UIMA 2RFDA 2DS1A 5EW8A 3BWFA 4NU1A 2UW9A 3TKUA 1W83A 3A61A 3AT2A 5AA9A 1OI9A 5J87A 1PRYA 2YHVA 3KMMA 3HECA 4I23A 2WU7A 4K18A 3IW7A 4MXYA 5AP6A 3O8PA 3ZZWA 4RSSA 3NAXA 5IDPA 4H3QA 2BVAA 5HD4A 2X6EA 4WOVA 1XHAA 3EQCA 3QQFA 1KOAA 4RZWA 4YC6A 2J6MA 3EZVA 5I3RA 2P4IA 4D2WA 4AXDA 4FSTA 4AZWA 4ZJVA 4P2KA 3DFCB 3FPMA 3SGCA 3UNZA 4C37A 3L8PA 2ZAZA 1R0EA 3AT4A 4NKAA 4BCMA 4YHFA 4APCA 3D2KA 3S3IA 3MPMA 2QKWB 4JG6A 3R7UA 1H08A 2GNJA 3GUBA 4BDKA 3PVWA 3C7QA 4YJSA 5A6NA 5IA0A 2CKOA 4ZLOA 3ODZX 4IVBA 4A9UA 4CKIA 5DVRA 5HO6A 4EK5A 3I5NA 3ZDIA 4U0IA 5IQFA 4QPSA 2YIRA 4O82A 4DGGA 2WMRA 2WMAA 3KXXA 5FDPA 2CJMA 1ZZ2A 2XH5A 3DGKA 5M44A 5M53A 1BUHA 2PUNA 5M07A 2CHLA 1J7UA 3RPSA 5M4UA 3TUBA 1JWHA 1FGIA 2WAJA 3B2TA 5AP4A 5JZJA 3DK6A 2FUMA 4IZYA 3BGZA 3FJQE 3O17A 3OW4A 3LJ2A 4FOCA 4IWPA 4KS7A 4FTAA 4O4DA 4Z16A 3UO5A 3BGPA 4EOPA 1KUTA 4BY9E 3HA8A 2C5NA 2B9IA 2GQGA 2JBPA 3DBDA 4RPVA 2IWIA 4KIKB 4FODA 1PYXA 4IDVA 3O50A 4A7CA 4C4HA 4EZ3A 2I0EA 3HDMA 2IW9A 5T3QA 3DTCA 5ITAA 2QOQA 4NJ3A 3LMIA 2GS2A 3ACKA 4JXFA 5AUUA 5A6OA 2JC6A 4ZTHA 1UWHA 3TJCA 2UZOA 3FHIA 3QRIA 1R39A 3VBWA 4FSYA 4IVDA 2JBOA 2R2PA 4S31A 4JR7A 4MEDA 4E4LA 5I0BA 4ZLZA 2XB7A 2E9UA 2VWVA 4TRLA 4IX6A 4PY1A 2GNHA 3L8XA 4I5HA 3ZM4A 4FV7A 4A9RA 5LXMA 2BAQA 3DS6A 3EQPA 5LMKC 3VW8A 3V6RA 4X21A 4KIOA 1DS5A 2W4JA 2WMBA 3R7IA 3A7HA 2X2LA 5B2MA 4O7TA 3UQGA 3LM0A 2QLUA 2V55A 3FY2A 5AP3A 3PJ1A 1Y8YA 5HE1A 2PVHA 3UDZA 3R30A 1ZYCA 1OB3A 4FA2A 3IDPA 4U45A 2JDOA 4TYHB 4AGUA 4JIAA 4BIEA 4O0WA 4A4XA 2QOKA 2XCHA 2JDVA 5AV3A 3U87A 3SRVA 1PHKA 2O63A 3DB6A 3FMDA 4O4FA 4FKJA 4E20A 5IQIA 1VEBA 4ZSGA 4MUQA 4JAJA 2XCKA 2AUHA 2WTJA 3ITZA 4GSBA 5DEWA 4C38A 4BCKA 4M67A 4F78A 2R7IA 3I5ZA 3LM5A 3QL8A 3R1SA 3F7ZA 3GOKA 2ONLC 4GIIA 4DFYA 3UGCA 4B8MA 2X2KA 2JFMA 2VX3A 4HYSA 2GNFA 4BI1A 3EQGA 5CSWA 2X4ZA 2WOTA 4WRGA 2Y4IB 3REPA 4DFZE 4UV0A 3VHKA 3TNQB 4HPTE 4AOTA 2YCQA 4FEWA 5FTGA 2DUVA 4O0XA 5E8YA 4FTKA 4V04A 2WTVA 3QA0A 5CEIA 5GIOE 5LVMA 3DXNA 3DY7A 3AT3A 3SW4A 4LRJA 4AXFA 2XK7A 5LCJA 2PTKA 2ZMDA 4V0GA 3NAYA 4JJRA 2OLCA 3R7OA 4YNOA 3TZ9A 4CV8A 4IB5A 4AU8A 2QKRA 5AUTA 1G8KA 3O71A 3BE9A 3NCGA 4KS8A 2VTLA 5M4FA 3ROCA 5AUXA 1YOJA 3O96A 3G33A 2R3GA 2XUUA 2CN8A 4TW9A 4YJOA 3JS2A 3KB7A 4JVGA 2QHNA 5HOAA 3UOKA 2VAGA 2JDTA 3GCUA 4AFJA 4G3EA 2UZNA 2PULA 5CSPA 4MAOA 2Z60A 1CDKA 5HE0A 3COMA 4QEBA 4DBXA 3GU8A 3MH0A 4MD7E 3FZ1A 3PXQA 2VWXA 2YN8A 2PUPA 3HRBA 2XNMA 3R7EA 5M06A 2J5EA 4FV0A 4E5WA 3AKKA 4JBOA 4YC3A 3MFRA 2WIPA 2X7OA 4EONA 3GQIA 4IADA 5AP7A 3GFEA 5ANOA 4ANSA 4H1JA 4XS2A 5AX9A 3KK9A 4BGGA 4ERWA 4M68A 3QRUA 3AD6A 3EFJA 4CG8A 2XYNA 3GC0A 5C4LA 3RTPA 5E1SA 2OZAA 5C8NA 5KO1A 4O21A 4ZTSA 5GZ9A 4XP0A 2AEGA 3EFLA 4E4NA 1K3AA 3DNEA 3DJ5A 3EN5A 3IECA 4QP6A 4M13A 5GIPE 3LJ1A 4JT3A 3FMHA 2YM5A 4QP1A 1XBBA 1S9IA 5L6WL 5BMSA 4IX3A 4WSQA 3DZOA 4QOXA 2WMXA 5AR5A 5B0XA 4AZSA 4YZDA 4EBVA 4FT5A 3CJGA 4XH6A 4DEDA 5IEVA 3A60A 3GC8A 5C8KA 3OBGA 3QHRA 1KE7A 5DLSA 5AX3A 4QYYA 5KKRC 2RF9A 5HLNA 4EH2A 3ZRMA 3WYXA 4IFGA 3R8VA 4MCVA 3AG9A 4P7EA 4QMPA 5FP6A 3TIYA 2NRYA 1XH5A 4GIHA 1WAKA 4U80A 4EK6A 4EJNA 4GYIA 2VTIA 2XP2A 1RJBA 4CEGA 1H1SA 2VWUA 4CV9A 1Y57A 5D41A 4EH4A 4K0YA 4FL3A 4K9YA 4O1PA 5IH5A 3UP2A 4RGJA 5CU0A 2PUUA 4IJPA 5CVHA 3W2SA 5TT7A 4EUTA 4M84A 2UW6A 1T46A 2XKEA 4F0IA 4DG2E 5L6PA 4HYUA 4I5MA 2QI8A 5KKRB 4ZJJA 4XP3A 5GNKA 3V5PA 5CXZA 3U6IA 1IG1A 1TQMA 3MFSA 3UG1A 4EWHA 5BQ0A 4ID7A 1GOLA 4CQGA 4HJOA 1SVEA 4C4GA 4JL9A 4AZTA 5H8BA 4NCTA 1WBOA 3BGQA 4RMZA 5CNOA 3VUHA 3R7VA 4BTJA 4AW5A 4CZTA 1FBNA 1Q8TA 3RPYA 3VQUA 2NO3A 3PJ3A 4PMSA 5E8XA 3SD0A 4AZVA 3MIYA 5KMNA 2BRHA 2B54A 4UXLA 1TZDA 3R83A 5M09A 4GT3A 3F5XA 5DR2A 3LCOA 5EM8A 1OM1A 5IQDA 3D15A 2I0VA 4IWOA 3ZEWA 4OTGA 4UWYA 4WIHA 3MESA 3NUUA 4DEEA 5EHOA 4DT9A 2FSMX 5F94A 2AYPA 2RGPA 4H05A 1P2AA 4BTMA 4EYMA 2C6EA 3NNVA 4GKHA 5CI7A 5DT3A 3QZGA 3QD3A 4QMWA 5CZHA 4MXXA 2GHGA 1RW8A 3LPBA 4G3DA 3AC3A 4TY1A 1OKVA 2PUIA 4CLIA 1GIHA 2X0OA 4IC7A 4ANNA 4CTBA 4IW0A 2QR8A 3C5IA 3FQEA 3F88A 2ITQA 4GRBA 4AZEA 2J0IA 1VR2A 1L3RE 3ET7A 3RZFA 3KQ7A 4CKJA 4A4OA 4MTAA 4UZHA 5BVOA 5CSXA 1XMLA 2VO3A 4IVCA 4MNEB 4MBJA 4RVMA 2J2IB 1OL6A 4I92A 5TO8A 3A7IA 3C0GA 1O9UA 3PG1A 4FR4A 3P7AA 5JRSA 4PQNA 3F2NA 3GVUA 3H0ZA 3BCEA 4J1RA 4W9XA 3RINA 4DFLA 3NZ0A 4MVFA 2B9HA 1NVRA 2C6IA 2JEDA 3I7BA 3MI9A 4I20A 5I4NA 1WVXA 4CFMA 2B9FA 2X8EA 3FY0A 3PFYA 5GINE 4EH8A 2H8HA 1P4OA 1REJA 3IQ7A 5DEYA 3GOPA 2PE2A 3HAVA 1M7QA 2BKZA 4FKRA 2A1AB 5K4JA 3PSDA 5LJJA 2VTRA 4UYAA 4WKQA 4XCUA 4JNWA 3LHJA 3LKMA 1A9UA 5HG8A 2VTQA 3MGYA 5E91A 1AQ1A 4DYMA 4RWLA 5EOLA 4WHZA 4L01A 4EOKA 4RJ5A 3E8CA 4OTWA 2V22A 1NA7A 2BFXA 2BZJA 5L8KA 3I6WA 2JKOA 3LMHA 3LFEA 5AUZA 3MDYA 3FLZA 5EM5A 3COKA 5ICPA 4OLIA 5EM7A 3U51A 2QU5A 3Q9YA 5JSMA 4ENXA 4F09A 2C6KA 2PMNX 2GSFA 2WTDA 4U3ZA 5ACBC 1LR4A 4B7TA 4W9WA 4M69A 2X9FA 4FOBA 3EKKA 4KKHA 1WVYA 2HXLA 5HNIX 2XEZA 5C8MA 4P5QA 4FTIA 3PA4A 3L9NA 2C5VA 2BDJA 3ZYAA 2XNNA 5CU3A 4FSZA 3TUDA 4MHAA 4CFXA 3V51A 4PP7A 5EFQA 4O0UA 3RK5A 4D4RA 3NCZA 2PHKA 4ASXA 3WZUA 5E9EA 3M2WA 3KULA 4I4EA 5CF8A 2RFSA 5JFVA 3PJCA 1XKKA 4EOOA 4RZVA 4G9RA 3BIZA 4IZ5A 2IZUA 4J95A 5CT0A 3UNJA 2C6DA 4M0ZA 3CGFA 2HIWA 1OGUA 4DHFA 3R2YA 2BZKB 2HENA 2QO7A 4OTPA 4FICA 5HCXA 3MVMA 1OIRA 3LFSA 3GT8A 4AT3A 3LVPA 4M97A 3A8WA 3FL5A 3MA6A 1JBPE 4IZAA 1IASA 3CTQA 3VS3A 1YKRA 2RIOA 2QQ7A 3G6GA 4O4BB 4JS8A 4LUDA 4FE2A 2LGCA 3VBYA 2QCSA 5LWMA 3W10A 3H30A 4J96A 4UALA 4U97A 5D12A 3TL8A 4G6LA 5DA3A 3FZPA 4EEVA 4GUBA 3HV5A 3RPRA 3UMWA 3NYVA 4YU2A 2PWLA 3F5UA 3OY1A 4TWOA 4Y46A 4KRCA 4C3PA 4M3QA 5ANJA 4EKKA 2V7AA 4E93A 2W7XA 5FD2A 5HX6A 3GU6A 3GU7A 4FKIA 1ZYSA 4O7RA 1BYGA 4UXQA 3GGFA 4FG9A 5IUIA 2HXQA 2W4OA 4IQ6A 1K2PA 3RAWA 3TTIA 4GYGA 5CEKA 4IACA 3OFMA 3QKKA 4L7SA 3C4EA 2UW8A 3FLYA 3PY0A 3I79A 5CY3A 2C30A 4Q5HA 4Q9SA 4K8AA 2C6OA 3PIXA 1UV5A 3C51A 3TV6A 2QOCA 3LZBA 4WRSA 5CSHA 2ZDUA 1PMUA 1JVPP 3AXWA 3DBQA 5A4LA 5I9WA 3P1AA 4G3GA 3HMOA 1URWA 3NX8A 1IAHA 5IF1A 3FI8A 3BV3A 4KD1A 2VO0A 3GC9A 4GU6A 3CXWA 4G2FA 5LCKA 4GL9A 3DK3A 4YC8A 4XV3A 3W55A 3IOKA 4O96A 5K0XA 3Q96A 3QC4A 4E6AA 3RMFA 4KIPA 5LVOA 3P7BA 2XKFA 2ITTA 1QMZA 2X39A 4DG3E 3KGAA 3ORIA 2AC5A 3ZO2A 4CMOA 3HDNA 2R7BA 2E2BA 1ZOGA 2PVJA 5J79A 5J9LA 2ZMCA 1NT2A 4GU9A 2G2IA 5EW3A 4YLJA 3RWPA 1JAMA 2F9GA 2FO0A 2JKKA 4FV4A 4I0TA 2UZTA 4GV1A 4M15A 3W2PA 3HV7A 4XHKB 3ZMMA 4BCIA 4ZS4A 4U5JA 4EH7A 1G8AA 4KRDA 4PWNA 5TR6A 3OCSA 4FNYA 3EOCA 4ACMA 2BHHA 3GCVA 3UODA 2HAKA 1K9AA 3L9PA 3MPAA 3IW5A 2HWOA 3QZFA 1YXUA 3A7JA 4O22A 3AQVA 4PPAA 3WOWA 4F70A 3ZC5A 4EYJA 4PNKA 4H39A 3BX5A 2QC6A 2VN9A 3ZRKA 3QHWA 1R1WA 5ETIA 3A4PA 2OJJA 2C3IB 3NUSA 1XH8A 3QQKA 3PZEA 4LGGA 4ZS0A 4YHJA 4IB3A 4WUNA 3I1AA 4MD8E 3ANQA 1ZMVA 2HWPA 3FV8A 3UQFA 4OAUC 4J99A 1ST4A 4QMMA 2HK5A 4R78A 3QUDA 4L3JA 3DJ7A 2HW7A 5CAVA 2PVYA 4BCFA 2UZWE 4GVJA 1PXOA 4UMPA 4ZEGA 4QT1A 5JGAA 4C8BA 3HZTA 2HZ4A 1BL7A 5JRQA 1IAJA 5J9ZA 2XANA 4XBRA 5CQWA 4AW0A 4XV9A 5EYDA 3TIZA 3MBLA 3R00A 1U54A 4C2WA 3GFWA 3ZU7A 1FVVA 2C5YA 1BI8A 5AAGA 4DFXE 4BR3A 4O7SA 4UMUA 2F7ZE 5F9EA 2V62A 2JDRA 1M7NA 5IEYA 5CZIA 5ANKA 4W4YA 3HUBA 4M8TA 3F3TA 1O6YA 4DEBA 4G5JA 5BVWA 2EXCX 5A4QA 5JQ5A 4ITJA 2NRUA 3FKNA 4OUCA 3KA0A 4IZ7A 3P5JC 2YACA 2WTKC 3EZRA 4PNIA 2YISA 2PE1A 4DC2A 4EH6A 2CSNA 3AC2A 3Q5IA 4DN5A 5K4IA 1OUYA 4EOLA 3PPZA 5L2IA 4YTIA 5EHLA 4RC4A 3BBWA 3QUPA 3KXMA 5HG7A 1OITA 3AMYA 4UMQA 4BC6A 4EHVA 4ACCA 4OAVB 4C4FA 3NVKI 3NYOA 1NVSA 3E3BX 1JKTA 3E8NA 3G9LX 3BYSA 2QODA 4Y85A 3PUPA 1YDRE 3QRKA 3G90X 3ORXA 3TACA 3W0MA 1H1QA 2VTMA 4E5AX 3F2RA 2WZJA 2J0KA 2ITOA 4ZY6A 4IC8A 5HLPA 4RG0A 3PXZA 3ZS5A 1STCE 3FXZA 4ANMA 1MRVA 4CSVA 3ZO4A 3LCDA 3DBEA 3FMNA 5KX8A 3R8MA 5J7HA 4NZWB 3C50A 3V5QA 2WELA 4RVKA 3NUAA 2HELA 3RK9A 3JYAA 3PFQA 3FMMA 4G3FA 4I5PA 4D55A 3F5PA 3WARA 4E7WA 5E90A 4F7SA 3BYMA 5ANGA 3S95A 4U40A 2R3MA 2ZFYA 3MB7A 2I40A 4QP9A 4J8NA 3EIDA 4X6QC 4LI5A 2J7TA 4YR8A 1FMKA 4K1BA 3MWUA 3U9CA 4GK2A 4DFNA 3KRLA 2GFCA 2FSOX 4XBUA 4RRVA 5DT0A 2OJ9A 3CD8A 2P2HA 3OTUA 3QZHA 4RQVA 4M14A 3RNIA 3OP5A 3TTJA 4FYNA 4AT4A 4BDEA 2Z7QA 2F7XE 4UWBA 3VBXA 2Z8CA 3GNIB 3Q4TA 4OBQA 3H9FA 3E64A 3NUYA 5AWMA 2Q83A 3KC3A 3PPJA 3S00A 3PJ2A 2QG5A 2BDWA 3AD5A 5IA2A 2WEVA 3Q3BA 3ROYA 4RA4A 3R73A 3I4BA 4W4VA 3E62A 4QTEA 4RJ8A 2H96A 3PUFC 5J5SA 1YWNA 3LCTA 3WBLA 4UYNA 2OF2A 5HD7A 4RX8A 4EZ7A 3VJNA 3PE1A 4UWCA 5IKWA 3HAMA 3GCSA 2WMUA 3V5JA 3ZSHA 5IH6A 3ORNA 3QFVA 3R71A 4PTCA 3O2MA 2GTMA 4I41A 3VUMA 4TNDA 3R28A 3EL8A 3D94A 2OIBA 4D1SA 5J1WA 1Z9XA 3AKLA 3UDTA 1Q8YA 5HBEA 3MY5A 4KKEA 3E5AA 3CY2A 5GZAA 4XX9A 3GCQA 3TDWA 3UZPA 1V0OA 4MYGA 3QTQA 2OG8A 4FSQA 2IZSA 4FV1A 4BBEA 3R21A 5HG5A 5DI1A 3GQLA 3OD6X 4ZSJA 4DH5A 5AIRA 3OCGA 5CT7A 1LPUA 1FVRA 3B8RA 5DPVA 5EI8A 3C4CA 4G6NA 4AWIA 2OIDA 4U41A 3FKOA 1OL5A 4FKVA 2VRXA 3OWKA 3BL7A 3JR1A 1P5EA 5FEDA 3OXIA 5HEZA 4FIIA 4ENYA 4AXEA 3KU2A 4QPMA 4KSQA 4L46A 1J7IA 3BHTA 1T45A 3HKOA 2IVTA 2Q0NA 3RBWA 4ZLYA 4D4VA 3F3UA 4S32A 4QDEA 5KUPA 3CQWA 1NY3A 2OO8X 4GMYA 2CGVA 2W9ZB 5LVLA 3PA5A 2VTOA 4AOJA 3H9OA 3SDJA 3T3UA 3R63A 3O5AA 1Y6AA 3NNUA 4H3BA 4LOOA 1ZOHA 4E5BA 4GKIA 4DA5A 1GZNA 3P7CA 5AM6A 4NH1A 3F3WA 2QD9A 3PLSA 5IDNA 3BWJA 1PMVA 4DBNA 4MF1A 4LGDA 4BDBA 3G6HA 3NYNA 3VS6A 5JKGA 4WSYA 2EB2A 2EXMA 5T6KA 3OXTA 1WBNA 3DT1A 4KIKA 2ZV7A 1AD5A 5AV2A 3UVQA 3UMXA 4BCHA 4QQTA 4IDTA 1JKSA 3EQBA 2CGWA 2CMWA 2W5AA 5BPYA 3R02A 5E8SA 2YIYA 2B7AA 3QTRA 4TYGA 2C6MA 4E6QA 2R3KA 5BUJA 3CEKA 5LWNA 5KBRA 3R9NA 3W1FA 2RSVA 4DH7A 4GG7A 2W17A 3PWYA 4C4EA 5IUGA 2ERKA 5E8WA 1PJKA 2UVXA 3PPKA 3ZC6A 5IQCA 4D4YA 4IWQA 1SVHA 2YJRA 2W1FA 4YZCA 3TN8A 4BKJA 3ML1A 4QMZA 5IQHA 4RIWB 4R6VA 2VTJA 4LOQA 5IQEA 4QMSA 4I24A 3W16A 3II5A 4R3PA 2FGIA 3KIOC 3RJCA 2C4GA 1JSTA 3FI4A 3KN6A 3KRRA 4LV8A 4HNFA 5CF4A 1J91A 4D2RA 3DKGA 3F82A 2XKCA 4E26A 2JFLA 4BKZA 1CSNA 1YWRA 3COHA 1G5SA 1Q5KA 4TYHA 2JAVA 3QQLA 1W7HA 4XJ0A 3CTJA 5LMKA 3QX4A 3PY3A 4ZTNA 1UU9A 4M7IA 5CF6A 4C36A 4R77A 4FG7A 5DFPA 1CTPE 3R7GA 4YLLA 1PYEA 4YZMA