4EHEA

B-raf kinase domain in complex with an aminothienopyrimidine-based inhibitor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
266
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Potent and selective aminopyrimidine-based B-raf inhibitors with favorable physicochemical and pharmacokinetic properties.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 266
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eheA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eheA01
1ZOEA 2VNWA 2R3QA 3P7AA 4TTHB 5JQ8A 1GZOA 4GRBA 4FV0A 2FH9A 3GUBA 2XKDA 3KY2A 5J9ZA 2PYWA 5CXZA 5DRDA 4RQKA 2XMYA 5KMKA 2HW6A 2VTAA 4R77A 2YM8A 3EN6A 4RWKA 4EJ7A 4FTUA 4JIAA 4EUUA 4PDYA 3EJ1A 1J7UA 2ITVA 2PMIA 3ZSIA 4QP2A 2J51A 3A4OX 2DUVA 4NT4A 3HV6A 4CQGA 3RPYA 4FVPA 5IQIA 5AADA 1SVGA 4MD8E 5HE0A 1XR1A 4QMMA 3F2AA 4JDHA 3FZTA 3FUPA 3RHKA 3OXTA 2IZSA 3PLSA 2FUMA 4DAWA 4EHEA 3HMIA 3QUDA 2IPXA 2WQBA 3IW6A 3O8PA 3NLBA 3HZTA 4FSMA 4O96A 2WHBA 4DEHA 5HIEA 2X1NA 2RF9A 2Y4IC 3D9VA 4KA3A 4I41A 4AFJA 5H9BA 3NW5A 4YC8A 4UN0C 5KBQA 4FKQA 5C8KA 3FDNA 4MBLA 4PL4A 5E1SA 4NTSA 4CRSA 2YACA 2XB7A 2B9JA 3MA3A 3P08A 4BL1A 3TNWA 2PMLX 2QOQA 2PUPA 3M42A 5A46A 4QQTA 1H0VA 5CVHA 3DNEA 2WQEA 3BHHA 5J8IA 2RIOA 2QOLA 3PUPA 4ZTNA 4FZAB 1FQ1B 2W1ZA 3BGQA 5BUJA 4DA5A 3D5XA 4IBMA 4J96A 3VUMA 1QCFA 4XV1A 4OTGA 4F7LA 1L8TA 4WG4A 5JSMA 3LQ5A 4BKJA 3UODA 1F5QA 4NUSA 1YHVA 5EKOA 5T3QA 2YIWA 2ERZE 3MH3A 3ODYX 2ITUA 5CSVA 4BKYA 3AT2A 4JRNA 3TZ7A 3AD6A 4DT9A 3IPHA 1FINA 2ZDTA 2X8EA 5DEWA 3FZOA 5AEPA 5J79A 2ZM4A 3EFLA 4LOPA 2J90A 4ACCA 1H27A 3L9NA 4QTDA 5B2LA 4PDPA 1KWPA 2JDOA 3F5GA 4WSQA 1OI9A 3FKOA 4EORA 4EQUA 3KRWA 4I22A 3BHYA 5H2UA 3QKMA 2QLQA 2WAJA 5AFVA 4UALA 1ZMVA 3RAIA 3PP0A 4F08A 3MB7A 3L1SA 3ATTA 1XH5A 4D5HA 3R2BA 1PMUA 1O6YA 2XJ2A 4BDHA 3BQRA 3E88A 3SGCA 4NYEA 2BRHA 3VBTA 3LJ0A 2G15A 4X21A 4XYFA 4BDGA 1KE5A 1UKHA 2CGVA 3R1SA 2YDIA 3A2CA 3BELA 3QWKA 4QYYA 5ANOA 3NZ0A 4M97A 3UZRA 3TIYA 4YZBA 1RW8A 5DOSA 4FV8A 4HJOA 5CF8A 4FTLA 1FVTA 5FM2A 2WMWA 2W1CA 3IECA 2YIQA 4UXQA 1NW1A 4LRKA 3TI1A 2X0GA 3UQGA 4IVAA 1QPDA 5EYMA 2YM5A 4FV1A 4M0ZA 3HMMA 3L8SA 4O21A 2YZLA 4IAKA 4RA4A 4MWIA 4CZTA 4XUFA 3B2WA 4EOOA 2Z7QA 5H8EA 2WTKB 3QTIA 3EMGA 3OVVA 2V5QA 4OBPA 3WBLA 4BCOA 1U54A 4QTEA 2HZ0A 2GS2A 2RKUA 5IMXA 2C5XA 4L7FA 4E73A 1M52A 2IVTA 3F88A 4G9CA 3PSCA 3IGGA 2JAVA 1FGKA 1YDTE 3C7QA 4PDOA 2W05A 4UMQA 5D12A 3KU2A 3FC2A 4MXZA 3OWKA 5FTQA 5I9UA 2IZUA 4BIDA 3R9RA 3NX8A 3CJGA 3DU8A 3O17A 3RJCA 4HVSA 2P33A 4BTMA 1OKYA 2F2CB 2VN9A 2RFEA 2W1FA 5CEPA 3OBGA 4L00A 3TNHA 5CI7A 2XBJA 1BX6A 3MY0A 2DYLA 3NEWA 1STCE 1H00A 3RPVA 4BDFA 2V7OA 3E5AA 4JQ7A 4NEUA 3LCTA 4XG9A 5JFSA 3TDVA 4D2TA 3C50A 2W1DA 4HPTE 4NW6A 5HHWA 4ZMFA 4NZWB 4D2SA 4M68A 2YA9A 2BZJA 4I93A 4LI5A 3T9TA 2R9SA 4B99A 4ZXTA 3NSZA 5HU3A 3UVPA 4F9AA 4D4VA 3KA0A 4PRJA 3DK3A 4Z7GA 2EVAA 5JFXA 4O7NA 4J99A 4DHFA 2OZAA 4EZ3A 1M2QA 3E8CA 3OTVA 1YVJA 3QYWA 4J7BA 4KB8A 2BRBA 2XBAA 2RG6A 4RIWA 5HG7A 4DGNA 3IS5A 4ZTMA 2ETRA 3QU0A 3SDJA 5ETCA 2WZJA 3NW7A 3R83A 3H4JA 3JXWA 3ENHA 4NJ3A 3OOMA 4X6QC 5CALA 4XLVA 3DBEA 4O7YA 4MEDA 2ETMA 3UGCA 2BDFA 3A99A 4YURA 3NYOA 4O27B 3AMBA 3D2KA 2HZ4A 2PVFA 4IVBA 3R7IA 3K2LA 4O84A 2X2LA 4TRLA 2IWIA 2XIYA 4AA0A 5H3QA 4CSVA 2CPKE 1PW2A 3DKFA 3GOKA 4AU8A 4DTBA 3FPMA 4CYIA 3SRVA 2ZYBA 2VGOA 3O50A 4FOBA 2JDTA 5F9EA 4L43A 5LWNA 3MFTA 3NYVA 3R1YA 3OHTA 4LOQA 4USDA 4AW1A 4N6ZA 5T6KA 2I40A 4Y85A 4GT5A 2OJGA 3F2NA 4K8AA 2I0VA 2PHKA 3D14A 4M14A 3W2SA 3O8UA 4EH6A 4C61A 2C5NA 2W4KA 3EIDA 4FZDB 4FEQA 3QRTA 3O51A 1MRVA 2WTVA 5HNBA 5EI8A 5HO6A 2YCFA 5ACKA 5K5XA 5HCYA 4JBPA 5DT0A 2HCKA 2OZOA 5E8VA 5HVYA 3TJDA 4UMTA 2ZM1A 2PVHA 5CEQA 4DGGA 3PY1A 2BFXA 3TKIA 4A07A 2QR8A 4L01A 2VWZA 3IW7A 4G3FA 4GJ3A 4ENYA 3HX4A 2CSNA 3HUBA 4QMOA 1W0XC 3QZFA 2VX1A 5DG5A 3AC3A 1J7IA 2ZM3A 1YXVA 4XV3A 2HZNA 2ZVAA 2VTSA 3FAAA 3K5VA 4NU1A 4FV9A 5IMEA 4B6LA 5TOZA 4BCJA 2OSCA 3S00A 4H58A 3MW1A 2J2IB 4LL0A 5DNRA 4FA2A 4YMJA 3EH9A 4NK9A 2EUFB 2WD1A 3OOGA 4A9SA 4C59A 3A7GA 3F69A 2ITYA 4PTCA 2FSLX 4KKHA 3DKGA 5CWZA 3R8UA 4ALVA 5ITAA 5JQ5A 3G0FA 2V62A 3DA6A 4S33A 4WBOA 5ACBC 4O2PA 4I6HA 5GIPE 4BZNA 4CFFA 4RFYA 5CF4A 4I20A 4M0YA 4U41A 3PTGA 4BN1A 5JZNA 2H96A 2Q0BA 2VO3A 4YJSA 5LVNA 3BGZA 4BDIA 4AOIA 4EK4A 3H10A 3GU6A 3N51A 3W10A 1FMOE 1LUFA 2BVAA 2OG8A 3R04A 1H8FA 4M12A 4W4VA 3ZUVA 5CAQA 4USEA 2FYSA 2EB2A 4BDJA 4FTOA 1NT2A 3Q2MA 3ZLXA 2C1BA 5ICPA 3VS0A 3KULB 2IN6A 4C2VA 2C3LA 4DFUA 4FG7A 3BGPA 3ZLSA 4F1MA 3HYHA 3SD0A 3Q4CA 3WZEA 2FSOX 4E6DA 5CS6A 3OUKA 3TCPA 5HX8A 4D5KA 4NM5A 4BIBA 4Q9ZA 1Z9XA 4TL0A 5FEDA 3G9NA 1XBBA 4AW5A 5EKNA 3H0ZA 4G31A 4O0YA 1PXKA 2WNTA 3ZLYA 3AT3A 3FMHA 3E8DA 2QG5A 4WHZA 2J5FA 1UNLA 2BRMA 4KRDA 5AV2A 4JG8A 1S9IA 3JYAA 3R21A 4EQCA 1J3HA 5I9XA 1YHSA 2XS0A 3QZHA 4JL9A 3CPCA 4EK5A 3AC5A 3FMKA 1J91A 2VWIA 3GU4A 4FKIA 4CKJA 1ZYCA 1RQQA 3BBTB 3W2RA 3GEQA 3DKOA 4RJ7A 2PL0A 2UZTA 4YJVA 4GH2A 4FVQA 2GNHA 4KIQA 4BI0A 4UZDA 2GHGA 4LRMA 4KAOA 4DITA 4I6QA 4U43A 3OCBA 3T3UA 3BRBA 3NAYA 3VF8A 2C6IA 5FGKA 5E8YA 3SOAA 4F7NA 4ANSA 4AOTA 5E4HA 2Q83A 3OROA 2UVZA 3HUCA 4J95A 2Y4PA 5I9ZA 4PL3A 2C3IB 5IPJA 1Q62A 4MNEA 5CI6A 2ONLA 4S30A 4E4LA 2ITZA 2XIXA 3UQFA 4K9YA 5EW3A 3QQLA 3OCGA 4FIIA 1I09A 4JQ8A 2VWVA 4HVDA 3PJ1A 4XCUA 2B9IA 2JC6A 3DDQA 1G8AA 3VS3A 2W4OA 5JGBA 3Q4TA 4F1OA 3TL8A 1PJKA 2QO9A 4YZCA 4EWHA 3V8WA 3BHVA 3UNJA 4CFVA 4YNEA 4BCGA 3U6JA 3OG7A 4FV3A 2BR1A 3P1AA 3QLFA 3W8QA 3CIKA 5M06A 1ZYJA 4DCEA 3IOPA 4ANOA 1OIUA 2Y6OA 4YTHA 5FEQA 4FT7A 5K4JA 3VS5A 1YWNA 3A8XA 2QURA 5ANJA 1YOJA 4LL5A 3TKUA 3V6RA 4UMPA 5EI2A 3UIBA 2GS6A 4GK3A 5AMNA 3BHTA 4KKEA 3HV7A 5HE3A 3GB2A 3DLSA 3R28A 4D2PA 2BROA 3RALA 2F7ZE 1WMKA 4ZP5A 4RIYA 3VRZA 4F9BA 4APPA 1PXPA 4FX3A 4EOSA 3F7ZA 4UZHA 3A61A 3Q5IA 1F3MC 3DS6A 4YLKA 2XKEA 1OL5A 4FG9A 4LFIA 5CLPA 4BFMA 3OF0A 1YW2A 4Y73A 3QTSA 3L9PA 2AUHA 4I94A 3LMIA 3JY9A 3UZPA 2W1HA 3KEXA 4TYJA 3UJGA 1AD5A 3HRFA 3LFSA 2VGPA 3LXNA 5EYKA 4D9UA 2B9HA 3GCVA 4E93A 4AZSA 4I4EA 4IACA 3LQ8A 4IE9A 4NJDA 3VHKA 5A4TA 5KUPA 1ZY4A 5ETFA 4QP4A 4M69B 3AOXA 4IZYA 4IEBA 3VBQA 4FV6A 5J5TA 3P4KA 3ZUTA 4I6FA 4PV0A 5B2KA 1Q8WA 2CMWA 5M57A 3TG1A 4ANBA 3UIXA 3RPOA 3S3IA 3BEAA 4JQEA 5TKDA 3LMGA 3VUGA 4QMNA 2J7TA 3R8LA 4AZVA 3O0GA 3QTQA 4PUZA 5AAEA 1R1WA 3D2IA 5L4QA 3QRIA 2X7FA 4IFGA 1S9JA 3UC3A 4HGEA 3E8NA 1IA8A 2R3KA 2Y9QA 3WZKA 4D28A 4OTWA 5JRSA 3ROCA 3LJ2A 3FXZA 4BY9E 1ZXEA 4CRLA 3PVWA 4UYAA 5HO8A 4U9AA 3AGLA 4MQ2A 4MX9A 3UIMA 5K5NA 4CFWA 4DFBA 3NIEA 4QQJA 4EL9A 4FKTA 4IVCA 2ZOQA 1J1CA 2B9FA 3QA0A 4F0FA 4EOJA 2C6EA 4FKSA 5HIBA 3JVSA 4ASDA 3ORNA 1U46A 3LVPA 4U8ZA 3LCKA 4L3PA 3RCDA 3F66A 3HMNA 2UW0A 2R5TA 3FZ1A 1MRUA 4ZTRA 5I9YA 2W1GA 3OW3A 3QRUA 2HY81 2RG5A 3DFAA 4J8MA 4KBAA 4YHTA 3MPTA 4H1MA 2YITA 5EM8A 4XLIA 4GSBA 3THBA 1XBAA 3ZXZA 5IQCA 3R7YA 4ZSEA 4WRGA 4J1RA 1VEBA 4JG6A 2C68A 2A1AB 3CE3A 3RGFA 3WZUA 4X0MA 1SVEA 5CY3A 3HDNA 4F63A 2GNFA 4U3ZA 4CEGA 3I81A 3LLAA 3V5PA 2JKKA 1XH8A 3DGKA 3ORZA 5FBOA 3GENA 2C6TA 4RIXA 4R5SA 5IUIA 1XKKA 4C8BA 4FTIA 2X6DA 3ZO3A 1KOAA 4B8MA 3CLYA 3WIGA 1YI6A 4NW5A 3MA6A 4FOCA 3EYHA 3LFQA 4BDKA 3F2RA 3CY3A 2OLCA 4BBFA 1R0EA 5KCVA 3FZSA 3E87A 3MH1A 2Y4IB 3IONA 3L8VA 2EXMA 3Q4ZA 2ZDUA 2WQOA 4G17A 5I3OA 5TO8A 3PY3A 3CQEA 3OP5A 4ACMA 3MSSA 4CMOA 4X2KA 2JFLA 4EC9A 1OUYA 3QHWA 1WZYA 4BCFA 3RHXA 3ALNA 3II5A 5DT4A 2C4GA 3WF5A 3BLHA 4FKUA 4WSYA 3O7LD 5LVLA 3DB8A 5D7VA 4ANLA 4OBOA 5CANA 2YN8A 4EWQA 4L52A 2CKOA 4RX5A 2CGUA 4QO9A 4KIPA 3R8MA 4EK6A 3ZZWA 4NIFA 3EOCA 5KMLA 4O7VA 3MI9A 4E4NA 3Q4UA 2YLFA 3RTPA 3BYSA 4QYEA 4S32A 3WZJA 4ZSAA 5L6OA 3U55A 1GZNA 5EK7A 4DFNA 3FZPA 1JKLA 3D4QA 3HDMA 3VNTA 2HELA 5J9LA 2XNPA 2IVVA 3EL8A 2R7IA 4KSPA 3AD4A 2VAGA 1CKIA 2JBPA 4UBAA 2X4ZA 2XK4A 3GU8A 2PK9A 1H07A 2QKWB 4IC8A 4TW9A 2J5EA 2UW7A 5DR6A 3SQQA 4L9IA 3LPBA 3TM0A 5AIKA 4E1ZA 2R3NA 2VTLA 4XH6A 5C27A 2UW5A 3R71A 2BAJA 4FTAA 4W9WA 5J87A 3ZEWA 2W99B 4ZTHA 2OJJA 3A4PA 4CFMA 2UZBA 1XH4A 3G5DA 4XP0A 5LMKC 5AV1A 4FIHA 4RPVA 5F4NA 3ANQA 3RWQA 3FI2A 4O7WA 4DLJA 5FTGA 3SXFA 4J97A 2YHVA 5K4IA 3DTWA 3I0QA 2REIA 2W1EA 2WTCA 5HCZA 3KMMA 3E93A 3ZO4A 4AX8A 5BX0A 5CAOA 2OF4A 3QGWA 4E6CA 5I9WA 5BMSA 5LCKA 3R7UA 1VZOA 3NCGA 3QD2B 2JKMA 1Q61A 4IADA 5CAPA 3IK3A 4WIHA 3QCQA 4FTRA 4GFGA 3Q5ZA 3Q60A 4JX3A 4L7SA 5FQDC 4R7IA 4Q9SA 5K3YA 1UU8A 3QKKA 3UBDA 3Q2JA 1Q41A 4QTBA 2RFDA 3U87A 4JJRA 4RSSA 3QC4A 3QWJA 5LXMA 3E3PA 4QNYA 5C4KA 4GJ2A 3PXYA 1JSUA 1OL6A 3GC8A 3DQXA 5CQUA 4A9UA 3FV8A 2R3IA 1YXUA 2F7XE 2AC3A 5EM7A 4D1ZA 3W2OA 5BVKA 3ZMMA 3PPJA 4WOVA 3ZRKA 3G9LX 1QMZA 3ACJA 4V0GA 3HP5A 3BIZA 3EKKA 2BALA 4EHGA 4AACA 4O1PA 3TZMA 3EN9A 5H8GA 4G6OA 4D58A 4E6QA 4EBVA 3AGMA 2XNBA 2GMXA 3FI8A 3ZXTA 3M11A 4AP7A 2E9VA 3VRYA 1MQBA 3CTHA 2XM9A 1BUHA 4DEGA 4AG8A 4ZLZA 1KE9A 3KC3A 3NNWA 5D7AA 5DFPA 5DR9A 4ZSJA 1KV1A 1PHKA 3MY1A 2VTTA 5FDXA 5AUXA 3TTJA 4CKRA 5LVMA 5CU4A 3CY2A 3BYMA 5ANKA 3E7VA 2SRCA 2B7AA 4DEAA 3P23A 5HI2A 4DE4A 4HVIA 4GV1A 1HOWA 3TACA 5AV3A 3QC9A 3KRLA 3ZBFA 3LMHA 2BZIB 4MWHA 4V05A 4C3PA 3DY7A 5HE1A 2QOCA 3RAKA 4WO5A 2PE0A 4JR3A 4HYUA 3UG2A 5AV4A 4OTQA 2VWXA 5AR8A 2C5YA 2OI4X 4YJUA 4IB3A 2BDWA 4G3DA 4GU6A 5DBXA 5AX3A 4JT3A 4GUBA 3DBDA 1M14A 3FQHA 3QCSA 3WF9A 4EOIA 5AM6A 4FEWA 2OK1A 1ZAOA 4RVMA 5G1XA 2YIYA 3GNIB 3H3CA 2GDOA 3HA6A 4RBLA 5TF9A 5AUWA 4XHKB 3KK9A 5HBJA 4IX3A 4K33A 3ZFXA 1PRYA 3FSKA 4FSZA 4ALUA 2XUUA 1NXKA 1FPUA 1RE8A 3FPQA 2O2UA 1Y91A 3PSDA 2F49A 4AE6A 2CDZA 1NY3A 4WNPA 5GZ9A 2WEIA 4OTHA 5GJDA 3WF8A 4H39A 3CD3A 3JR1A 4BTFA 2PUUA 4YUQA 4AQCA 5M4FA 3I5NA 2OICA 4YC3A 5A6NA 5IQGA 3VBYA 5A4QA 4Y83A 3M2WA 1ND4A 5BMMA 5IU2A 3ET7A 5EQYA 3K5UA 5KHXA 3ZDUA 3MB6A 3NW6A 5FUTA 3Q9XA 5EM6A 3V8TA 1URWA 3ZHPC 1IAHA 3EFWA 3QX4A 2H34A 3PY0A 2YDJA 2BFYA 2CN8A 3H9FA 3UPXA 3ZM4A 4G9RA 4O7LA 4LV8A 1VYWA 3VUDA 2OIDA 3F61A 3FYKX 4YC6A 5IUGA 2QOIA 3NUPA 5BQ0A 4C35A 3VBXA 5AP5A 2UW4A 3AMYA 3ACKA 3S2PA 4FSTA 2GQRA 3UNZA 4G5JA 3HA8A 2XJ1A 3GVUA 1LR4A 3IO7A 3DXPA 1Z5MA 2GHMA 2WIHA 3DTCA 4NH1A 4FKVA 3U4WA 4C4IA 4DYMA 3DK6A 4BBEA 1W98A 3KMUA 3TJCA 4TNBA 3EQPA 5A14A 3N4UA 2XK6A 2VWUA 4G3CA 2WFYA 2GHLA 4OLIA 4CQEA 1CM8A 1SYKA 2A19B 2W7XA 1QL6A 4L68A 5IH4A 4DEDA 3AC2A 3GC0A 2P2HA 2PMNX 5CU0A 5AP0A 2FVDA 3G6GA 5GJGA 3COHA 4FL3A 1OBGA 3DAJA 4ITIA 3A60A 3BKBA 2Z2WA 3C5UA 4EH9A 3C0IA 3QTWA 2GNIA 3V3VA 4F65A 4GEOA 4O83A 2UW3A 4DH5A 2QHMA 5HO7A 3C4FA 3FLZA 3BLRA 3LXKA 3KF7A 2B54A 1JSTA 3VUTA 4YJTA 1JNKA 2J50A 3KN5A 4YBKA 4YO6A 4OTPA 4NKSA 2O5KA 4FUXA 4I6BA 4L6QA 4AGCA 3JY0A 4K6ZA 5EDRA 3CD8A 3Q6UA 4FKLA 2Y0AA 4MQ1A 2WB8A 5GJFA 4EQMA 3BYVA 2VTIA 4PTGA 4EH7A 4W4XA 2WEVA 2IG7A 3QXPA 3FJQE 4CGAA 2CGXA 2XVDA 1WVYA 3FMDA 3ZRMA 3MS9A 4IWOA 4YPDA 2C3KA 4XJ0A 4PPBA 3ZLWA 4IVDA 4IAZA 3FLQA 3U9NA 4LGGA 3WI6A 4BGQA 4Y5QA 3DZOA 3C0HA 4TYGA 4GS6A 5CEOA 3Q96A 1FVVA 4IFCA 3QD4A 3HV5A 4AAAA 3DOGA 4PP7A 5EQPA 3WF7A 2E2BA 2FB8A 1H4LA 3F3ZA 1MUOA 3HP2A 3I6WA 4U81A 1JWHA 2J6MA 2BKKA 5EG3A 1PKDA 4EOPA 2F9GA 3FHRA 3F7WA 1OL2A 3FZRA 2DWBA 4IH8A 4O0VA 3QQHA 4X3FA 4XNEA 3UOJA 4UXLA 2GTNA 2O63A 4C02A 3TNPC 5JT2A 2OIBA 3UMXA 1Q8UA 3DAKA 4BVUA 1K9AA 1GIIA 1YWRA 2OU7A 1VJYA 4JIKA 4BHZA 3KKVA 4KBCA 3VW8A 4TWCA 4DH8A 3ZRLA 5EFQA 3ZFYA 2A4LA 2PVRA 3COKA 5CYIA 3S1HA 4W8DA 1F0QA 4V01A 2C69A 3FMNA 3WILA 3W16A 3MPMA 3PYYA 1XWSA 2JIIA 5IDPA 1M7NA 1OIYA 3CQWA 3PXKA 5HG8A 4GFOA 1Q8YA 2A2AA 4TXCA 4IWQA 4GVJA 4Z16A 3OWJA 2BKZA 2X8DA 1WVXA 4Q2AA 3NNVA 1YDRE 3EL7A 2WMQA 2IVUA 4R3CA 1PKGA 4C4FA 3TIZA 5L6PA 1R3CA 2UZWE 1GIHA 3DK7A 4FVRA 3EHAA 2GQSA 5JK3A 2J0MB 2Z7LA 4IZ5A 5FXRA 5IQBA 1H0WA 4FK3A 2VO7A 4KWPA 1TQIA 4IB0A 4F4PA 1ZWSA 1E1XA 4HGLA 5IQDA 3I5ZA 2J9MA 2NRYA 3DCVA 1P14A 4XOZA 5C8NA 4C4JA 3UQCA 5CT0A 2JBOA 3W32A 4ZY5A 3MESA 3MIAA 2VWWA 4KS7A 3E8EA 3LFDA 5J7BA 3D15A 3PP1A 3PXQA 3DJ5A 3V5TA 4M66A 5FM3A 4YJOA 5EOBA 4FGRA 1Q8TA 5CT7A 3TKHA 4C36A 3GC7A 5AAFA 5CSHA 1J1BA 1OB3A 2GNLA 3DXNA 3EQIA 5B0XA 4DGOA 4C33A 2ZV8A 2XRUA 3ZC5A 5A54A 4ANNA 4O0XA 3UYTA 1JSVA 3MVHA 4FIEA 1SNUA 4UMRA 2W9ZB 2ZV9A 4NCTA 4F09A 1OKZA 2JEDA 2YEXA 3LCSA 2XK3A 5FTOA 5J1VA 4PWNA 2VZ6A 3EZRA 4IM2A 5HX6A 4K18A 2W9FB 5IG1A 3CXWA 3R02A 4IX4A 4RJ5A 3VVHA 4F7JA 3WZDA 1O6LA 3ORPA 4BCNA 5KBRA 2ZV7A 4KIKA 5KMJA 1HCLA 4FIFA 4RVKA 1T45A 2IZTA 4XV9A 3UVRA 3KMWA 1UKIA 3CPBA 1YXSA 3D94A 3N9XA 4EK8A 2R3RA 2GU8A 5EW9A 5IKWA 4JAJA 5L2WA 3D7TB 4NM3A 5DH3A 2IZRA 5IISA 1DI8A 2FA2A 3HV3A 2F57A 1PXJA 4YR8A 4H05A 1M7QA 4MF1A 4OBQA 3UOLA 4QMZA 2VWYA 1IG1A 1H1QA 2PE1A 4JDKA 2GFCA 4CTCA 3TUDA 4HGTA 2XNEA 1B6CB 2W06A 1TQMA 4ZZNA 2B55A 1R39A 4KSQA 4L44A 1M2RA 4QQ5A 1IASA 4RJ4A 5EDQA 4ZJJA 5BVFA 5A6OA 4H3PA 4I5CA 3F3VA 2BTRA 3UE4A 4FKWA 3PIYA 4XG3A 2CJMA 4IJPA 4CV8A 5LWMA 3NUNA 4E3CA 4FG8A 4NM7A 5HU9A 3KCFA 5HD4A 5KMOA 4YGAA 4DEIA 2CNVA 4C3RA 2UW8A 3RNYA 3VN9A 4ID7A 3ZSHA 4EHZA 4ZAUA 4HNIA 3NUYA 4XRLA 4QMTA 3FXWA 4K11A 3F82A 5AUUA 3VUKA 5LOHA 4FEVA 4FSYA 3PZEA 3CSVA 4FSQA 1XJDA 4XEYA 2NNWB 1ZY5A 5BYZA 3ZSGA 4ZTQA 1FVRA 1BKXA 4WD5A 4IW0A 3BX5A 1PMEA 2XCHA 1HCKA 4PNIA 4QOXA 4CT1A 5LQFA 4CT2A 3MBLA 4D55A 1JQHA 1CMKE 3V5LA 1U5RA 2OH4A 4C4GA 4F6SA 2GSFA 3ZH8A 3RZBA 4RZVA 4QQCA 3R22A 4MYGA 4QYHA 5DI1A 3RK7A 4EH3A 3P79A 1PXLA 1OKWA 1OL1A 3O8TA 4CLIA 4E5WA 1H1SA 2RGPA 3QQFA 2IVSA 2ONLC 4ONAA 4CD0A 4AZWA 2X9FA 3PFQA 1W82A 4EOKA 1WBOA 4DBXA 5LARA 3ULZA 4FMQA 2XK8A 4HZRA 2QU6A 4XP2A 5ANEA 4CFXA 2WMUA 1CKPA 4FT3A 1YXXA 4E20A 5KMIA 3ANRA 4IHPA 5CXHA 2QG7A 4MNFA 2QOBA 1QPCA 1BI8A 5CU2A 4DINA 1PXNA 2YIRA 3MH2A 4EYMA 5AJQA 3W8LA 5HBHA 1SMHA 4JOAA 2O8YA 4YTCA 1JBPE 5CQWA 2XF0A 3MN3A 5EH0A 4ZZMA 4RLLA 4YHJA 1REKA 1R0PA 2UVXA 2XYUA 1YKRA 4XBUA 5HBEA 4HCTA 4GL9A 1UU9A 4D2WA 1OUKA 5D11A 2XYNA 4IC7A 4WA9A 1BLXA 3D7ZA 4LRJA 5AAGA 2VU3A 3RVGA 4XG6A 3SOCA 5AP6A 1WAKA 4FL2A 3FY0A 3H9RA 4FTKA 3MY5A 4TYHB 4UWYA 4ZOGA 2WMAA 3VJNA 4DBNA 4RC3A 4RMZA 3HNGA 2ITXA 2QO7A 3POZA 2XNOA 1B38A 4NFMA 2R0IA 3OWPA 4S2ZA 2UZLA 4JBOA 3ODZX 2KULA 3ITZA 3NYXA 3TWJA 1OPJA 4BDAA 2PVLA 4O22A 3OMVA 2JKQA 3I7CA 3PA5A 4Q5EA 4C37A 4QYFA 4RJ8A 5HE2A 5TE0A 3HEGA 4AA5A 3SC1A 4IX5A 2BDJA 4O6EA 2PUIA 4QMVA 1UVRA 2XIZA 3FQEA 5FXQA 4EC8A 3Q9WA 4DGLC 2WU6A 4DLIA 3NWWA 4TKSA 3O96A 4TWOA 3OTUA 1MRYA 1XHAA 2XIKA 2VTHA 1QPEA 4G16A 2VD5A 4AOJA 5JH6A 5AX9A 3AC8A 2JITA 4RWJA 3BU5A 2CCIA 2QOHA 4BTJA 3CP9A 4XV2A 5E9EA 4HCUA 4K1BA 2F4JA 4A9TA 5L2TA 3VW6A 2VTNA 3DFCB 5HQ0A 2LAVA 4I0SA 2B53A 4O2ZA 2A27A 2QLUA 4FNXA 3PVBA 1J7LA 4LYNA 5L8LA 2OJFE 4ASXA 1CTPE 3AT4A 4CMTA 2FSTX 4FTCA 3IOKA 4U44A 1SM2A 4Y95A 5F20A 3P5KA 2UZNA 3DBQA 3KXMA 2BRGA 3G33A 4R5YA 3OEFX 5A3XA 4LUEA 3ZOSA 1TVOA 2QU5A 4IZ7A 2KTYA 3RBWA 4M7IA 3GCUA 1Y6AA 3FHIA 4M3QA 3V01A 4F6WA 2WXVA 4O0SA 4GMYA 3W1FA 3JPVA 4R3RA 2PVNA 3QFVA 5E8ZA 4FEXA 3TDWA 4R6VA 3ZS5A 3V6SA 3UNKA 2OJ9A 3C4XA 2PZ5A 3SLSA 3G51A 4D1XA 5ANDA 3ROYA 4HYIA 2IJMA 2QD9A 5HTCA 2YM3A 4XS2A 4DEBA 3RINA 4FYOA 4KD1A 5DPVA 3W33A 4FNWA 2JD5A 3KL8A 4NWMA 1PXIA 3IQ7A 4I5PA 3R9OA 4F0IA 5L2SA 2ACXA 3N4VA 3EWHA 4E4XA 1KE8A 4NFNA 2CKPA 2BUJA 4RJ6A 3UP2A 3WOWA 2WQNA 2X2MA 4ZLYA 1KUTA 3UOKA 2J4ZA 5M4UA 5E1EA 3VQHA 2YAKA 3A7HA 5HD7A 2UZUE 2BTSA 3FKNA 4CZUA 4ANQA 3SW4A 2C6DA 1JKSA 4FSNA 4QPMA 3V5JA 4FR4A 3D5WA 1A48A 4BF2A 4F1TA 4ALWA 4GFMA 3FI4A 2EXCX 4WBBB 2HAKA 4FZ7A 2VTQA 4KRCA 3UVQA 1V0PA 5JFVA 2W0JA 4MF0A 4UEUA 2CNUA 1GIJA 2AYPA 3KVXA 3F6XA 2WMSA 2X81A 3CR0A 1BYGA 1H24A 3JUHA 3OCTA 4RC2A 4P2KA 1OITA 4R1YA 3OW4A 4FI1A 4N6YA 4AT3A 3PE1A 5CSWA 2C0OA 3PJCA 3R01A 4M8TA 1JOWB 4IB5A 3W2QA 2EU9A 4B8LA 4LUDA 4CVAA 5IDNA 4JDJA 2C3JA 4GIHA 4A4LA 5L3AA 2I1MA 5DN3A 4W9XA 4JXFA 4AS0A 1YRPA 5A9UA 3PG3A 3FLNC 4Z55A 5M51A 2WKMA 3SW7A 2XKCA 4QMLA 2OH0E 3MWUA 4NSTA 1JKKA 2BZHB 3G6HA 4ITJA 2WOUA 4FIGA 4XBRA 5E8WA 3WARA 4A4XA 4DG2E 2VX3A 2OIQA 3FMEA 5M4CA 3IW4A 1OKVA 4X3JA 2CLQA 3O2MA 3P7CA 4OTIA 3R7OA 5C01A 2GNJA 3KK8A 4QTCA 1GOLA 1KSWA 5CTPA 4C34A 5HVKA 3QQUA 4JNWA 4EOQA 5GIOE 4XX9A 4EH8A 3FE3A 1BL7A 4JLCA 5AM7A 4O0RA 3QTZA 2UZDA 5M56A 4YSMA 2VUWA 3Q6WA 1ZMUA 1JLUE 1NVSA 1DS5A 1WBPA 5DHJA 4MXOA 2B4SB 3MDYA 2E9OA 3HMPA 1CKJA 2WMRA 4WG5A 5KKRC 3EYGA 4AT4A 3ORKA 1UU3A 5AP7A 2VO0A 3ORMA 4RWLA 3QL8A 3KFAA 5FDPA 5KNJA 4FE2A 1JPAA 4U45A 4BCPA 5AR3A 5CENA 3KXGA 2A0CX 3DAEA 4F99A 1NA7A 5IUHA 2C5VA 3L9LA 2WPAA 3G0EA 3DLZA 3PXZA 3B8QA 4H3BA 3UG1A 4D9TA 3R7EA 4N4SA 4QP7A 4AN2A 2PZYA 2WTIA 2QQ7A 4YP8A 5K9IA 5H8BA 2Y7JA 4GW8A 2QOKA 2CCHA 1Q24A 1LPUA 3PXFA 2QONA 3U8WA 3KULA 4J53A 3NR9A 1ZMWA 3D83A 1OIRA 5HEZA 5AR7A 4BDDA 1W8CA 3COIA 3I1AA 4YZMA 3U54A 1XO2B 5CF5A 3BPRA 3NCZA 3R8ZA 4DH7A 3TTIA 2R7BA 5CF6A 2R3OA 4QMWA 4M67A 5CU3A 3C0GA 4ERKA 3PE2A 3I60A 5B7VA 5J1WA 4FTNA 4MK0A 4AGUA 3ZYAA 4MHAA 1OIQA 3R2YA 1UV5A 1Q3DA 4Y8DA 4BCKA 4KNBA 3BBWA 3KREA 3LFAA 4HZSA 4RG0A 4I0RA 3F3UA 3MYGA 1U54B 3KRRA 2C0TA 4QMYA 4AN9A 1YI3A 2HOGA 3WYYA 5BVNA 2WTJA 2V22A 3GT8A 5CSXA 5E8TA 2HW7A 3P7BA 4WNOA 3OC1A 4HVHA 3MVLA 4AGWA 4EH2A 5D10A 3NNUA 3FBVA 3QKLA 4I23A 2GTMA 5EHLA 5BYLA 2OFVA 3TV7A 4GK2A 5FG8A 5J9YA 4FT9A 4U97A 4ZY6A 3OCSA 3W18A 4I3ZA 2WOTA 2YABA 4L67A 3PG1A 3B8RA 4U0IA 3KN6A 3BU3A 3VS4A 1QPJA 4AE9A 3QZGA 4FTTA 3OUNB 2YJSA 4FGBA 5DWRA 2XNMA 3RK5A 2JLDA 1DM2A 5E8SA 4E26A 2P55A 3A8WA 4FL1A 2UW9A 3E7OA 3HVCA 4FZFB 4BBMA 3F5XA 3GI3A 5E7RA 4GVAA 1ZRZA 4L3JA 5AA8A 4ZMEA 1WCCA 3AC1A 3CJFA 4CTBA 1XH6A 5KZIA 3RM7A 4H3QA 4H1JA 1H1WA 3FEGA 1W84A 1AGWA 3OS3A 1G8SA 5KZ0A 3M1SA 4EBWA 2R3HA 2PSQA 1W83A 4BDCA 1Q99A 2OZAB 4YJPA 5HOAA 2ZMDA 2XNGA 1XBCA 4UY9A 4EZ7A 2Z8CA 4MXXA 4FTJA 4G5PA 4PMTA 3DB6A 4RIWB 1A06A 3QXOA 2ETKA 4PPCA 4ZEGA 4ZLOA 4MXCA 4ANMA 4KABA 3KF4A 3TT0A 5HLPA 3LQ3A 5E8UA 3BYUA 4Q5HA 3VS2A 5IA3A 5BVEA 2OXYA 4FKGA 3POOA 4E8AA 5IF1A 2EB3A 2VTPA 4RVTA 4MBIA 1M2PA 3Q9YA 4HNFA 3DT1A 2WO6A 4XOYA 4I21A 1G5SA 4IB1A 4OTRA 3SRVB 2VNYA 3S4QA 4QPSA 5A4LA 3VS1A 1Q3WA 4RFZA 3CCNA 4HCVA 3R00A 3KB7A 4CKIA 2PVMA 2ITPA 1LEWA 2B52A 4UWCA 1GAGA 5CZHA 3RPRA 4QMQA 5JKGA 2BHHA 3SG9A 5E92A 4DH3A 3CKXA 1PY5A 2GFSA 1X8BA 3C4EA 2FGIA 3KXZA 3MJ2A 1JKTA 3FKLA 4F9WA 2J0IA 3ELJA 3MVMA 3PJ3A 4RFMA 4RRVA 4ZTSA 4B7TA 5TT7A 4RT7A 3EZVA 3H0YA 4PF4A 5CSPA 2PE2A 4JVGA 4TYIA 5C03A 2WELA 4M69A 5FEEA 1OPLA 1P4FA 3RCJA 4ORKA 4BI1A 3UDBA 4OW8A 1U59A 2PVJA 2OFUA 5ANGA 2HZIA 3FY2A 3A7JA 4USFA 2G9XA 5CAUA 2H9VA 4DG0E 4A06A 4AZEA 4A9YA 2F7EE 1IEPA 2QCSA 2XKFA 4IAIA 4K2RA 4JRVA 4L46A 4KKGA 4AZTA 2W1IA 3LZBA 3MGYA 3TV4A 2VTOA 3GOPA 2PTKA 3SHEA 3ERKA 1Y6BA 3RPSA 5DIAA 3QCYA 3QA8A 2UV2A 3D5VA 3EQHA 3CTJA 4J8NA 2P4IA 4W4WA 1OM1A 3MVJA 5CVGA 2W96B 4EKLA 3COMA 2X7OA 5DT3A 4WNMA 5C26A 4G2FA 3JS2A 5IH5A 3E63A 4P7EA 4C62A 1ZARA 3BYOA 3R9NA 5C9CA 4FKPA 3R63A 4FYNA 2QO2A 2W5AA 2UZOA 4GG5A 2PZRA 3AQVA 4OGRA 3P0MA 3EN7A 3TEIA 5DYJA 3BE2A 3OD6X 4JR7A 4M15A 4C7TA 2PPQA 2PULA 1PXOA 5JGDA 5I4NA 4EJNA 5IH6A 5DA3A 5BVOA 1Q97A 5L2QA 3ZC6A 1IRKA 4M13A 4BDEA 2XNNA 4ENXA 3KRXA 2OBJA 3TN8A 5LVPA 4ZTLA 3C9WA 1IR3A 4IDVA 5LMBA 2DQ7X 4QPAA 4DTKA 5AIRA 3FWQA 3SV0A 1V1KA 4MXYA 3LFCA 4FKJA 4FTMA 4JG7A 3TZ8A 1IA9A 2R2PA 4AZFA 4IQ6A 4FSWA 3PRIA 1YOLA 3DQWA 3U6IA 2YCRA 3AMAA 4GCJA 5HKMA 2BZKB 2I0HA 3R6XA 4MKCA 3CC6A 5AP4A 2YJRA 4I0TA 4FNZA 3ZUUA 4AXAA 3TZ9A 4BDBA 3ORIA 5D1JA 4XG7A 4CCBA 2BCJA 3RMFA 1FGIA 3T8OA 4ERWA 4ASEA 2QC6A 3SXSA 4DFYA 1ATPE 4GKHA 4Z3VA 1B39A 5C8MA 5B2MA 3NVKI 2G2IA 3AD5A 2JIVA 4R3PA 3K3JA 3R8PA 3NYNA 3FQSA 1GZ8A 1V0OA 3FC1X 3UO6A 4DCAA 3I6UA 3ULIA 4MTAA 4EH4A 2PUNA 5JRQA 5CVFA 2WU7A 3QYZA 4X3FC 3I0OA 2BPMA 4CCUA 3NMUF 1SVHA 3GC9A 4PPAA 3GCSA 2YISA 2UZVA 3QCXA 2C30A 5E8XA 3HRBA 5AA9A 4YO4A 3F5UA 4MNEB 5HICA 3S0OA 4GIIA 4AT5A 3SA0A 2YCQA 5EOLA 1OECA 4U79A 5BUIA 2GNGA 4CXAA 2ITNA 5IEVA 3GGFA 4O86A 4J98A 3VHEA 2VX0A 4A7CA 3B2TA 1YDSE 3PJ2A 4U5JA 3R7GA 3IW8A 3D5UA 3H30A 3OXIA 3FMJA 3KVWA 4WUAA 5DR2A 5IZFA 3ENMA 4QP6A 4UB7A 2BAKA 4GK4A 3MTFA 2CN5A 5IQEA 3EN5A 2NPQA 5I5ZA 2PU8A 4PQNA 2J0LA 3GXLA 4K0YA 4LM5A 5AUZA 4D0WA 4ZIMA 4C4HA 1CDKA 4D2RA 4PMPA 4RVLA 3VULA 1OPKA 1VR2A 2X6EA 2CHLA 4O81A 5FBNC 2EWAA 3QLGA 5K0XA 4S31A 5M08A 4PMSA 4NM0A 3R73A 4HGSA 2P2IA 4L53A 3R8VA 4V04A 4EUTA 3TV6A 4RIYB 5D41A 5LVOA 2WGJA 1UA2A 3FMLA 4RZWA 4R1VA 4KINA 4R7HA 1XQZA 4X2NA 5EM5A 3DJ6A 4R8QA 3HRCA 4MD7E 4Y72A 5HTIA 2PWLA 4F7SA 4TNDA 2VWBA 4HYSA 4YJNA 4YLLA 3ZU7A 5BUEA 1NVQA 1KE6A 3FMMA 3GBZA 4W8EA 5AR2A 4NL0A 5F94A 4B4LA 1ZOHA 3PIXA 4QRCA 2YERA 5IA5A 4D4SA 4I92A 4J52A 4EONA 3HECA 4ZY4A 1UU7A 4A4OA 2OXXA 4OTDA 5AP2A 4HVGA 3ZTXA 3C5IA 4MH7A 3NNXA 4FIJA 4IIRA 5FD2A 3DPKA 4NCTC 5CEIA 3NVMB 2WMBA 2YCSA 2OGVA 2R64A 2Z60A 3QALE 4FZ6A 4UYNA 4ACHA 1WBWA 5I0BA 3EQGA 5AUVA 5EHOA 1H1PA 3EQCA 2HYYA 3OT3A 3VF9A 5JGAA 3MV5A 4L42A 3LHJA 4PX6A 5GZAA 4DGMA 2BIYA 3K3IA 4N70A 3C51A 4FUYA 1ZYSA 5IA0A 1E9HA 2BAQA 5LCJA 4IWPA 4UWBA 2NRUA 1O9UA 4AW0A 4K77A 3UIUA 4B0GA 2C6KA 3TNIA 3GU7A 2GCDA 1P5EA 3RWPA 3MPAA 3UOHA 3BWFA 3FLWA 2BILB 5EDPA 3MFSA 3TUCA 5DGZA 3UPZA 5C4LA 3TXOA 4AF3A 2BIKB 3QUPA 1ZYLA 2B1PA 1I44A 2YAAA 3DBFA 3QBNA 3R0TA 4U3YA 4FT5A 2RSVA 3L9MA 3PDTA 2WMXA 2X39A 4YTIA 3GQLA 5HLNA 4UMUA 2IO6A 3F9NA 1KE7A 1K2PA 4TPTA 2XA4A 2G01A 4QMPA 4IANA 4G3EA 4XP3A 4IDTA 2XIRA 3LIJA 3LM5A 3QTRA 2YM4A 3BI6A 5M07A 3OT8A 4TY1A 3HL7A 2WTDA 4FV7A 4DN5A 4X6RA 3U51A 2YWVA 4YU2A 2WTWA 4EKKA 3NUAA 4DC2A 1H08A 2OWBA 4ZS0A 3ZBXA 5AV0A 2XRWA 4FBXA 3LAUA 3I4BA 3RP9A 3ORTA 2OF2A 2CKQA 4ZZOA 5CNOA 2GS7A 3PVUA 3IGOA 3TNQB 3FXXA 1H1RA 4LMUA 3NUSA 4BI2A 1TKIA 3Q3BA 4OUCA 2W5BA 3R1QA 3FL4A 4YJRA 2R4BA 5DLSA 3VUIA 5D9HA 3EFKA 4YBJA 5HG5A 4KS8A 2WQMA 2QVSE 3UZTA 1JVPP 3HV4A 4L45A 2FSMX 3KQ7A 2ESMA 4HYHA 3ZEPA 3EQRA 1UWHA 5L8JA 4XRJA 2C47A 1RJBA 3Q53A 1Q8ZA 4G6LA 4U42A 4C2WA 3IDBA 3BU6A 4RIXB 5CZIA 1DAYA 4FKOA 2BRNA 4JX7A 2P3GX 3VS6A 5FP6A 4LV5A 4C57A 3MH0A 4PTEA 4AN3A 1LEZA 3PA4A 4O82A 4X2JA 2E9UA 3PWDA 4YZ9A 2PZPA 4JI9A 4AW2A 5CASA 3VBVA 4EYJA 5HG9A 2ZAZA 4KBKA 4QP9A 3VUHA 1XH9A 1H26A 5BVWA 4ACDA 5BYYA 3SX9A 5A4CA 5FP5A 4YNOA 4L8MA 4BZOA 2I6LA 2GQGA 4MBJA 2IW9A 4PDSA 2R3MA 4MVFA 2XEYA 3RZFA 2O64A 2X4FA 3BLQA 4WT6A 3VQUA 3REPA 4YHFA 3NUUA 4PP9A 4CG9A 3U6HA 3QHRA 4M84A 4NIFB 3FLSA 3CTQA 3CGFA 1P4OA 3GP0A 2YM7A 3OFMA 3QQKA 3BEGA 3I7BA 3KRJA 2I0YA 2ERKA 2EXEA 2WIPA 1M17A 3HGKA 3LFFA 5EYCA 3W55A 3SVVA 2XCKA 5K0KA 3P78A 3PPZA 5KKRB 2Z02A 4LG4A 3F3WA 3QD3A 4O0WA 4YZDA 5KX8A 2O65A 4Z7HA 5HNIX 2R3GA 3U9CA 2Y8OA 2JIUA 3RAWA 4ZSLA 4F6UA 4CFUA 3CS9A 4I5HA 4RGJA 5BPYA 2QOFA 3OWLA 4X2FA 1V0BA 4EZ5A 4ACGA 1U4DA 4IAYA 4MAOA 3KXXA 4APCA 3QQGA 5CEMA 1Y8YA 2I7QA 1R78A 3BV2A 4IM0A 3LCDA 3ZO2A 2O0UA 1H01A 2HXQA 3ZM9A 4JDIA 3QD0A 4YLJA 2WTKC 2LGCA 5ANIA 4E5AX 2VTRA 3HKOA 4L3LA 1PMVA 4II5A 2JFMA 1H25A 2CLXA 3BE9A 3O71A 4PY1A 4QNAA 5DEYA 4D2VA 3GQIA 2BHEA 1AQ1A 4F9YA 2UZEA 1PXMA 1YOMA 4BGGA 4RX8A 3RKBA 4UV0A 4S34A 4YZNA 4F0GA 2QKRA 5C1QB 3UO5A 1GJOA 3FSFA 2F2UA 3QRJA 5FLFA 5HVJA 4WUNA 5JEBA 5HNGA 5KMMA 3ZDIA 3LM0A 4OT5A 2OO8X 2H6DA 3E92A 2XK9A 4X7QA 5J7HA 4BWKA 3DDPA 5DMZA 4TT7A 2W5HA 4IMYA 2G1TA 4QP8A 1K3AA 1EH4A 3ATSA 1ZZ2A 4IAFA 4ZJIA 4TYEA 1PYEA 3G2FA 4IJ9A 4DF3A 4RC4A 3NIZA 2HENA 4QMSA 4XG8A 2XJ0A 4HW7A 2VV9A 2BMCA 5IQHA 4GUEA 5M44A 3Q52A 4QD6A 4C0TA 3MIYA 4CZYB 3DXQA 3R30A 4BYIA 3O23A 2C5OA 2XEZA 3CEKA 3WE8A 3CGOA 3QUEA 3KGAA 2R0UA 4GYGA 2YLEA 3D0EA 4FK6A 4OAUC 2WMVA 4X2GA 4CMUA 4V0GB 3HMOA 4WKQA 4WG3A 4ARKA 4ZJVA 3N4TA 4C3FA 5IQAA 3LCOA 3VO3A 2UW6A 3F3TA 4GG7A 4BWXA 4F70A 3PPKA 5J5SA 5EI6A 4YTFA 2ITQA 3U4UA 3QQJA 3BWJA 4O7SA 5GINE 3NRMA 3W2PA 3LXPA 3PIZA 3QZIA 5J95A 4E4MA 3DKCA 3E64A 1Y57A 1MQ4A 3TUBA 4E7WA 4U6RA 4WRSA 5ETAA 3OZ6A 3MJ1A 5L2IA 4FNYA 5F95A 4BC6A 2XZSA 3LE6A 3IKAA 5EYDA 5A4EA 1FBNA 2C6LA 4QT1A 1PMNA 4GT3A 4EHVA 3LFBA 4D4RA 2E9PA 2QOOA 3OY3A 2AC5A 2VRXA 4KIOA 4PMMA 5CU6A 1WBVA 4RWIA 4BCMA 3OEZA 1RDQE 4CYJA 5HESA 4NKAA 3P9JA 3ORXA 3PRFA 5EQEA 2QI8A 2ZV2A 4FKRA 2J0KA 1FOTA 2ZJWA 1P2AA 3LFEA 2C6OA 4IWDA 1ZYDA 4RLKA 5FXSA 1BL6A 3E62A 5M55A 1ZZLA 2FO0A 3FLYA 3LW0A 4G1WA 3UC4A 3UMWA 3VJOA 4PL5A 3BCEA 4IXPA 4QP3A 4I4FA 5IA2A 1OVEA 2DS1A 1WVWA 4CNHA 2I0EA 5M53A 3DNDA 3PA3A 1YI4A 4EOMA 4RQVA 5HTBA 4RX9A 4ZS4A 2Y6MA 5AR5A 3R9HA 3PWYA 3RAHA 1G3NA 5IEXA 4AWIA 4OTFA 2W4JA 3WE4A 3GU5A 5AUTA 3BHUA 4FV4A 4H36A 1KV2A 3A7FA 5CNNA 1WBTA 3LLTA 5M09A 2HWOA 3R7VA 3LJ1A 2PVYA 4GKIA 1TQPA 2V55A 3G90X 4O0UA 3EQFA 1Z57A 5I3RA 3BV3A 1LP4A 2R3JA 4R7BA 3E3BX 5F1ZA 3UYSA 5IA1A 3LXLA 2RFNA 3ZONA 3DV3A 4N0SA 3V04A 4BTKA 1ERKA 4N57A 2YZAA 3EB0A 1UNGA 3R1NA 2R3FA 5IEYA 4TWNA 5L8KA 3RK9A 4FODA 4OT6A 3HAMA 3NDMA 3RM6A 5IQFA 3RI1A 2ITTA 4UX9A 2HY0A 3VIDA 4O7RA 4MD9E 2VTMA 2JDRA 3EN4A 4AUAA 2R3LA 4FEUA 2OW3A 1WBNA 3QTXA 4LMNA 3C1XA 5KMNA 5HGIA 3V8SA 4P90A 4WNKA 4BICA 4IM3A 1ZLTA 3DJ7A 1FMKA 3NS9A 3A7IA 1BI7A 1U5QA 3PJ8A 4FV5A 4CV9A 4O0TA 3ZO1A 3D7TA 4U80A 4O7ZA 5HLWA 1IAJA 4HPUE 3QF9A 3BZ3A 4I1ZA 4BWPA 3G15A 1NVRA 3OY1A 4F64A 4TWPA 2CGWA 3V5QA 3OXZA 1ZOGA 2V0DA 3PVGA 3Q04A 3CQUA 3ORLA 3EQDA 4BCIA 1BMKA 1OL7A 3ZZEA 3VC4A 4LQMA 1Q5KA 2GPHA 4O1OA 1OBDA 4TZRA 1O6KA 4FSRA 4QP1A 2NP8A 5HZNA 4C58A 3IW5A 5LMAA 5ETIA 5E90A 5EW8A 3W2CA 4I24A 4FT0A 4AFEA 4EI4A 5JMSA 4DT8A 4G6NA 4KUJA 3EKNA 4YJQA 2HXLA 5DRBA 3NPCA 3OBJA 3QGYA 4LGDA 2QODA 4RX7A 2QNJA 4BZDA 5KHWA 2B0QA 3GFEA 2OKRA 3Q32A 3QRKA 3A62A 4FF8A 4Y5HA 4ZSGA 4C4EA 4XG2A 3NUXA 4DH1A 4LOOA 2IW8A 3I79A 5TR6A 1UNHA 1YQJA 2YIXA 3IG7A 3NGAA 2CKEA 3IDCA 5FRIA 5GNKA 4ASZA 1PF8A 4EH5A 1Q4LA 4IX6A 4BIEA 4BR3A 1Y8GA 1A9UA 3K54A 3LKMA 3V51A 3UTOA 3MFRA 4O38A 2H8HA 4OR5A 2X7GA 2JDVA 2VTJA 1XH7A 2UVYA 1KOBA 1E1VA 4AA4A 4FSUA 4CFNA 3ALOA 4BB4A 1JAMA 4P5ZA 5AP1A 3EQBA 4JS8A 4O6LA 5E91A 3KCKA 3O7LB 3UP7A 2CNQA 2P0CA 2PMOX 2X8IA 3BQCA 4YPSA 1VYZA 1OMWA 2ZMCA 3H9OA 2G2FA 4RIOA 5T68A 5GHVA 2WMTA 4IAAA 1GY3A 5LJJA 4OAVB 2XH5A 2UUEA 3FI3A 4XMOA 3V5WA 2JGZA 4C38A 2VO6A 4MCVA 3VAPA 1UWJA 3VS7A 2PY3A 4JBVA 5G6VA 2OJIA 5HIDA 4GU9A 5I9VA 4RJ3A 4X3FB 3QAME 4DG3E 3PLAE 3GFWA 1H28A 4D4YA 5CEKA 5DE2A 3L8XA 3DBCA 5HCXA 1APME 4O91A 1CSNA 4Z9LA 4J71A 4E5BA 2JAMA 5AP3A 2YFXA 4CLJA 1GZKA 2YWPA 1OGUA 2ITOA 3JVRA 4TYHA 2HWPA 3MFUA 4GT4A 4GYIA 3SAYA 1SNXA 4EEVA 1MP8A 5HORA 2G2HA 4FC0A 2XM8A 3AC4A 5AR4A 4QYGA 4PNKA 5BNJA 4HOKA 5EHYA 4P4CA 1YXTA 3SG8A 4YSJA 1URCA 3ETAA 4G34A 2HIWA 3C13A 3P86A 4B9DA 2Z7RA 4QMUA 4RA5A 4D1SA 5GZ8A 5JFWA 3MTLA 3SKCA 4EOLA 2ZB0A 4EK3A 5BVDA 3F5PA 3AG9A 2C0IA 2QHNA 2E9NA 4O7TA 4FV2A 2O3PA 1WFCA 2J0JA 4BKZA 3EFJA 4U40A 3VWAA 2RL5A 1YHWA 3CBLA 4DEEA 1GNGA 5DVRA 2YDKA 2C1AA 4D0XA 5LMKA 2ITWA 5CAVA 4A9RA 2W17A 2Z7SA 4DFLA 2HK5A 3DZQA 3Q9ZA 3NAXA 4FICA 4NTTA 3KXHA 2OXDA 4IZAA 2ZB1A 3VBWA 5KO1A 4QTAA 3ZCLA 3GCQA 3T9IA 4TN6A 4AGDA 2PVKA 3PXRA 4BCHA 5CX9A 2XK7A 2XP2A 3QX2A 3ZFMA 4I5MA 4BRXA 3AXWA 4DTAA 2QR7A 3HLLA 5KE0A 3LOKA 1WBSA 1DAWA 4ITHA 1PYXA 3C4WA 4P5QA 1W7HA 3WF6A 4CG8A 1T46A 4XG4A 2JDSA 4F9CA 1L3RE 5AUYA 3IDPA 3C4CA 3S95A 3HAVA 4U7ZA 3LFNA 3L8PA 2V7AA 2Q0NA 4BYJA 4W4YA 2YM6A 3T3VA 5AWMA 3PSBA 3GCPA 3ID6C 4G3GA 4MXAA 2X9EA 3WIKA 4Y46A 4DFZE 4DFXE 3CKWA 3RNIA 2C6MA 2X2KA 4KIKB 3C4ZA 4BGHA 5JZJA 4QMXA 2IW6A 5M4IA 3FL5A 4JBQA 3WYXA 1YWVA 5JN2A 4R78A 2R3PA 2PZIA 3UO4A 5L6WL 3QTUA 4BHNA 3FYJX 4LGHA 4E6AA 2RFSA 3SXRA 1REJA 1DI9A 1SZMA 5IA4A 3R9DA 4FTQA 1OZ1A 4JAIA 4ZK5A 4BCQA 3PZHA 5FWKK 2NO3A 3KXNA 2JKOA
chains in the Genus database with same CATH superfamily
1ZOEA 2VNWA 2R3QA 3P7AA 4TTHB 5JQ8A 1GZOA 4GRBA 4FV0A 2FH9A 3GUBA 2XKDA 3KY2A 5J9ZA 2PYWA 5CXZA 5DRDA 4RQKA 2XMYA 5KMKA 2HW6A 2VTAA 4R77A 2YM8A 3EN6A 4RWKA 4EJ7A 4FTUA 4JIAA 4EUUA 4PDYA 3EJ1A 2AEGA 1J7UA 2ITVA 2PMIA 3ZSIA 4QP2A 2J51A 3A4OX 2DUVA 4NT4A 3HV6A 4CQGA 3RPYA 4FVPA 5IQIA 5AADA 1SVGA 4MD8E 5HE0A 1XR1A 4QMMA 3F2AA 4JDHA 3FZTA 3FUPA 3RHKA 3OXTA 2IZSA 3PLSA 2FUMA 4DAWA 4EHEA 3HMIA 3QUDA 2IPXA 2WQBA 3IW6A 3O8PA 3NLBA 3HZTA 4FSMA 4O96A 2WHBA 4DEHA 5HIEA 2X1NA 2RF9A 2Y4IC 3D9VA 4KA3A 4I41A 4AFJA 5H9BA 3NW5A 4YC8A 4UN0C 5KBQA 4FKQA 5C8KA 3FDNA 4MBLA 4PL4A 2IEWA 4NTSA 5E1SA 4CRSA 2YACA 2XB7A 2B9JA 3MA3A 3P08A 4BL1A 3TNWA 2PMLX 2QOQA 2PUPA 3M42A 5A46A 4QQTA 1H0VA 5CVHA 3DNEA 2WQEA 3BHHA 5J8IA 2RIOA 2QOLA 3PUPA 4ZTNA 4FZAB 1FQ1B 2W1ZA 3BGQA 5BUJA 4DA5A 3D5XA 4IBMA 4J96A 3VUMA 1QCFA 4XV1A 4OTGA 4F7LA 1L8TA 4WG4A 5JSMA 2NYAA 3LQ5A 4BKJA 3UODA 1F5QA 4NUSA 1YHVA 5EKOA 5T3QA 2YIWA 2ERZE 3MH3A 3ODYX 2ITUA 5CSVA 4BKYA 3AT2A 4JRNA 3TZ7A 3AD6A 4DT9A 3IPHA 1FINA 2ZDTA 2X8EA 5DEWA 3FZOA 5AEPA 5J79A 2ZM4A 3EFLA 4LOPA 2J90A 4ACCA 1H27A 3L9NA 4QTDA 5B2LA 4PDPA 1KWPA 2JDOA 3F5GA 4WSQA 1OI9A 3FKOA 4EORA 4EQUA 3KRWA 4I22A 3BHYA 5H2UA 3QKMA 2QLQA 2WAJA 5AFVA 4UALA 1ZMVA 3RAIA 3PP0A 4F08A 3MB7A 4MUQA 3L1SA 3ATTA 1XH5A 4D5HA 3R2BA 1PMUA 1O6YA 2XJ2A 4BDHA 3BQRA 3E88A 3SGCA 4NYEA 2BRHA 3VBTA 3LJ0A 2G15A 4X21A 4XYFA 4BDGA 1KE5A 1UKHA 2CGVA 3R1SA 2YDIA 3A2CA 3BELA 3QWKA 4QYYA 5ANOA 3NZ0A 4M97A 3UZRA 3TIYA 4YZBA 1RW8A 5DOSA 4FV8A 4HJOA 5CF8A 4FTLA 1FVTA 5FM2A 2WMWA 2W1CA 3IECA 2YIQA 4UXQA 1NW1A 4LRKA 3TI1A 2X0GA 3UQGA 4IVAA 1QPDA 5EYMA 2YM5A 4FV1A 2XANA 4M0ZA 2ZFYA 3BL9A 3HMMA 3L8SA 4O21A 2YZLA 4IAKA 4RA4A 4MWIA 4CZTA 4XUFA 3B2WA 4EOOA 2Z7QA 5H8EA 2WTKB 3QTIA 3EMGA 3OVVA 2V5QA 4OBPA 3WBLA 4BCOA 1U54A 4QTEA 2HZ0A 2GS2A 2RKUA 5IMXA 2C5XA 4L7FA 4E73A 1M52A 2IVTA 3F88A 4G9CA 3PSCA 3IGGA 2JAVA 1FGKA 1YDTE 3C7QA 4PDOA 2W05A 4UMQA 5D12A 3KU2A 3FC2A 4MXZA 3OWKA 5FTQA 5I9UA 2IZUA 4BIDA 3R9RA 3NX8A 3CJGA 3DU8A 3O17A 3RJCA 4HVSA 2P33A 4BTMA 1OKYA 2F2CB 2VN9A 2RFEA 2W1FA 5CEPA 3OBGA 4L00A 3TNHA 5CI7A 2XBJA 1BX6A 3MY0A 2DYLA 3NEWA 1STCE 1H00A 3RPVA 4BDFA 2V7OA 3E5AA 4JQ7A 4NEUA 3LCTA 4XG9A 5JFSA 3TDVA 4D2TA 3C50A 2W1DA 4HPTE 4NW6A 5HHWA 4ZMFA 4NZWB 4D2SA 4M68A 2YA9A 2BZJA 4I93A 4LI5A 3T9TA 2R9SA 4B99A 4ZXTA 3NSZA 5HU3A 3UVPA 4F9AA 4D4VA 3KA0A 4PRJA 3DK3A 4Z7GA 2EVAA 5JFXA 4O7NA 4J99A 4DHFA 2OZAA 4EZ3A 1M2QA 3E8CA 3OTVA 1YVJA 3QYWA 4J7BA 4KB8A 2BRBA 2XBAA 2RG6A 4RIWA 5HG7A 4DGNA 3IS5A 4ZTMA 2ETRA 3QU0A 3SDJA 5ETCA 2WZJA 3NW7A 3R83A 3H4JA 3JXWA 3ENHA 4NJ3A 3OOMA 4X6QC 5CALA 4XLVA 3DBEA 4O7YA 4MEDA 2ETMA 3UGCA 2BDFA 3A99A 4YURA 3NYOA 4O27B 3AMBA 3D2KA 2HZ4A 2PVFA 4IVBA 3R7IA 4BJJB 3K2LA 4O84A 3AKKA 2X2LA 4TRLA 2IWIA 2XIYA 4AA0A 5H3QA 4CSVA 2CPKE 1PW2A 3DKFA 3GOKA 4AU8A 4DTBA 3FPMA 4CYIA 3SRVA 3AKJA 2ZYBA 2VGOA 3O50A 4FOBA 2JDTA 5F9EA 4L43A 5LWNA 3MFTA 3NYVA 3R1YA 3OHTA 4LOQA 4USDA 4AW1A 4N6ZA 5T6KA 2I40A 4Y85A 4GT5A 2OJGA 3F2NA 4K8AA 2I0VA 2PHKA 3D14A 4M14A 3W2SA 3O8UA 4EH6A 4C61A 2C5NA 2W4KA 3EIDA 4FZDB 4FEQA 3QRTA 3O51A 1MRVA 2WTVA 5HNBA 5EI8A 5HO6A 2YCFA 5ACKA 5K5XA 5HCYA 4JBPA 5DT0A 2HCKA 3NFGB 2OZOA 5E8VA 5HVYA 3TJDA 4UMTA 2ZM1A 2PVHA 5CEQA 4DGGA 3PY1A 2BFXA 3TKIA 4A07A 2QR8A 4L01A 2VWZA 3IW7A 4G3FA 4GJ3A 4ENYA 3HX4A 2CSNA 3HUBA 4QMOA 1W0XC 3QZFA 2VX1A 5DG5A 3AC3A 1J7IA 2ZM3A 1YXVA 4XV3A 2HZNA 2ZVAA 2VTSA 3FAAA 3K5VA 4NU1A 4FV9A 5IMEA 4B6LA 2A98A 5TOZA 4BCJA 2OSCA 3S00A 3BL7A 4H58A 3MW1A 2J2IB 4LL0A 5DNRA 4FA2A 4YMJA 3EH9A 4NK9A 2EUFB 2WD1A 3OOGA 4A9SA 4C59A 3A7GA 3F69A 2ITYA 4PTCA 2FSLX 4KKHA 3DKGA 5CWZA 3R8UA 4ALVA 5ITAA 5JQ5A 3G0FA 2V62A 3DA6A 4S33A 4WBOA 5ACBC 4O2PA 4I6HA 5GIPE 4BZNA 4CFFA 3ML1A 4RFYA 5CF4A 4I20A 4M0YA 4U41A 3PTGA 4BN1A 5JZNA 2H96A 2Q0BA 2VO3A 4YJSA 5LVNA 3BGZA 4BDIA 4AOIA 4EK4A 3H10A 3GU6A 3N51A 3W10A 1FMOE 1LUFA 2BVAA 2OG8A 3R04A 1H8FA 4M12A 4W4VA 3ZUVA 5CAQA 4USEA 2FYSA 2EB2A 4BDJA 4FTOA 1NT2A 3Q2MA 3ZLXA 2C1BA 5ICPA 3VS0A 3KULB 2IN6A 4C2VA 2C3LA 4DFUA 4FG7A 3BGPA 3ZLSA 4F1MA 3HYHA 3SD0A 3Q4CA 3WZEA 2FSOX 4E6DA 5CS6A 3OUKA 3TCPA 5HX8A 4D5KA 4NM5A 4BIBA 4Q9ZA 1Z9XA 4TL0A 5FEDA 3G9NA 1XBBA 4AW5A 5EKNA 3H0ZA 4G31A 4O0YA 1PXKA 2WNTA 3ZLYA 3AT3A 3FMHA 3E8DA 2QG5A 4WHZA 2J5FA 1UNLA 2BRMA 4KRDA 5AV2A 4JG8A 3O5AA 1S9IA 3JYAA 3R21A 4EQCA 1J3HA 5I9XA 1YHSA 2XS0A 3QZHA 4JL9A 3CPCA 4EK5A 3AC5A 3FMKA 1J91A 2VWIA 3GU4A 4FKIA 3W0OA 4CKJA 1ZYCA 1RQQA 3BBTB 3W2RA 3GEQA 3DKOA 4RJ7A 2PL0A 2UZTA 4YJVA 4GH2A 4FVQA 2GNHA 4KIQA 4BI0A 4UZDA 2GHGA 4LRMA 4KAOA 4DITA 4I6QA 4U43A 3OCBA 3T3UA 3BRBA 3NAYA 3VF8A 2C6IA 5FGKA 5E8YA 3SOAA 4F7NA 4ANSA 4AOTA 3PFYA 2Q83A 5E4HA 3OROA 2UVZA 3HUCA 4J95A 2Y4PA 5I9ZA 4PL3A 2C3IB 5IPJA 1Q62A 4MNEA 5CI6A 2ONLA 4S30A 4E4LA 2ITZA 2XIXA 3UQFA 4K9YA 5EW3A 3QQLA 3OCGA 4FIIA 1I09A 4JQ8A 3NFFB 2VWVA 4HVDA 3PJ1A 4XCUA 2B9IA 2JC6A 3DDQA 1G8AA 3VS3A 2W4OA 5JGBA 3Q4TA 4F1OA 3TL8A 1PJKA 2QO9A 4YZCA 4EWHA 3V8WA 3BHVA 3UNJA 4CFVA 4YNEA 4BCGA 3U6JA 3OG7A 4FV3A 2BR1A 3P1AA 3QLFA 3W8QA 3CIKA 5M06A 1ZYJA 4DCEA 3IOPA 4ANOA 1OIUA 2Y6OA 4YTHA 5FEQA 4FT7A 5K4JA 3VS5A 1YWNA 3A8XA 2QURA 5ANJA 1YOJA 4LL5A 3TKUA 3V6RA 4UMPA 5EI2A 3UIBA 2GS6A 4GK3A 5AMNA 3BHTA 4KKEA 3HV7A 5HE3A 3GB2A 3DLSA 3R28A 4D2PA 2BROA 3RALA 2F7ZE 1WMKA 4ZP5A 4RIYA 3VRZA 4F9BA 4APPA 1PXPA 4FX3A 4EOSA 3F7ZA 4UZHA 3A61A 3Q5IA 1F3MC 3DS6A 4YLKA 2XKEA 1OL5A 4FG9A 4LFIA 5CLPA 4BFMA 3OF0A 1YW2A 4Y73A 3QTSA 3L9PA 2AUHA 4I94A 3LMIA 3JY9A 3UZPA 2W1HA 3KEXA 4TYJA 3UJGA 1AD5A 3HRFA 3LFSA 2VGPA 3LXNA 5EYKA 4D9UA 2B9HA 3GCVA 4E93A 4AZSA 4I4EA 4IACA 3LQ8A 4IE9A 4NJDA 3VHKA 5A4TA 5KUPA 1ZY4A 5ETFA 4QP4A 4M69B 3AOXA 4IZYA 4IEBA 3VBQA 4FV6A 5J5TA 3P4KA 3UDSA 3ZUTA 4I6FA 4PV0A 5B2KA 1Q8WA 2CMWA 5M57A 3TG1A 4ANBA 3UIXA 3RPOA 3S3IA 3BEAA 4JQEA 5TKDA 3LMGA 3VUGA 4QMNA 2J7TA 3R8LA 4AZVA 3O0GA 3QTQA 4PUZA 5AAEA 1R1WA 3D2IA 5L4QA 5BV3A 3QRIA 2X7FA 4IFGA 1S9JA 3UC3A 4HGEA 4F78A 3E8NA 1IA8A 2R3KA 2Y9QA 3WZKA 4D28A 4OTWA 5JRSA 3ROCA 3LJ2A 3FXZA 4BY9E 1ZXEA 4CRLA 3PVWA 4O4FA 4UYAA 5HO8A 4U9AA 3AGLA 4MQ2A 4MX9A 3UIMA 5K5NA 4CFWA 4DFBA 3NIEA 4QQJA 4EL9A 4FKTA 4IVCA 2ZOQA 1J1CA 2B9FA 3QA0A 4F0FA 4EOJA 2C6EA 4FKSA 5HIBA 3JVSA 4ASDA 3ORNA 1U46A 3LVPA 4U8ZA 3LCKA 4L3PA 3RCDA 3F66A 3HMNA 2UW0A 2R5TA 3FZ1A 1MRUA 4ZTRA 5I9YA 2W1GA 3OW3A 3QRUA 2HY81 2RG5A 3DFAA 4J8MA 4KBAA 4YHTA 3MPTA 4H1MA 2YITA 5EM8A 4DHJA 4XLIA 4GSBA 3THBA 4O4BB 1XBAA 3ZXZA 5IQCA 3R7YA 4ZSEA 4WRGA 4J1RA 1VEBA 4JG6A 2C68A 2A1AB 3CE3A 3RGFA 3WZUA 4X0MA 1SVEA 5CY3A 3HDNA 4F63A 2GNFA 4U3ZA 4CEGA 3I81A 3LLAA 3V5PA 2JKKA 1XH8A 3DGKA 3ORZA 4DDGA 5FBOA 4JMQA 3GENA 2C6TA 4RIXA 4R5SA 5IUIA 1XKKA 4C8BA 4FTIA 2X6DA 3ZO3A 1KOAA 4B8MA 3CLYA 3WIGA 1YI6A 4NW5A 3MA6A 4FOCA 3EYHA 3LFQA 4BDKA 3F2RA 3CY3A 2OLCA 4BBFA 1R0EA 5KCVA 3FZSA 4AXDA 3E87A 3MH1A 2Y4IB 3IONA 3L8VA 2EXMA 3Q4ZA 2ZDUA 2WQOA 4G17A 5I3OA 5TO8A 3PY3A 3CQEA 3OP5A 4ACMA 3MSSA 4CMOA 4X2KA 2JFLA 4EC9A 1OUYA 3QHWA 1WZYA 4BCFA 3RHXA 3ALNA 3II5A 5DT4A 2C4GA 3WF5A 3BLHA 4FKUA 4WSYA 3O7LD 5LVLA 3DB8A 5D7VA 4ANLA 4OBOA 5CANA 2YN8A 4EWQA 4L52A 2CKOA 4RX5A 2CGUA 4QO9A 4KIPA 4O4CA 3R8MA 4EK6A 3ZZWA 4NIFA 3EOCA 5KMLA 4O7VA 3MI9A 4E4NA 3Q4UA 2YLFA 3RTPA 3BYSA 4QYEA 4S32A 3WZJA 4ZSAA 5L6OA 3U55A 1GZNA 5EK7A 4DFNA 3FZPA 1JKLA 3D4QA 3HDMA 3VNTA 2HELA 5J9LA 2XAOA 2XNPA 2IVVA 3EL8A 2R7IA 4KSPA 3AD4A 2VAGA 1CKIA 2JBPA 4UBAA 2X4ZA 2XK4A 3GU8A 2PK9A 1H07A 2QKWB 2X0QA 4IC8A 4TW9A 2J5EA 2UW7A 5DR6A 3SQQA 4L9IA 3LPBA 3TM0A 5AIKA 4E1ZA 2R3NA 2VTLA 4XH6A 5C27A 2UW5A 3R71A 2BAJA 4FTAA 4W9WA 5J87A 3ZEWA 2W99B 4ZTHA 2OJJA 3A4PA 4CFMA 2UZBA 1XH4A 3G5DA 4XP0A 5LMKC 5AV1A 4FIHA 4RPVA 5F4NA 3ANQA 3RWQA 3FI2A 4O7WA 4DLJA 5FTGA 3SXFA 4J97A 2YHVA 5K4IA 3DTWA 3I0QA 2REIA 2W1EA 2WTCA 5HCZA 3KMMA 3E93A 3ZO4A 4AX8A 5BX0A 5CAOA 2OF4A 3QGWA 4E6CA 5I9WA 5BMSA 5LCKA 3R7UA 1VZOA 3NCGA 3QD2B 2JKMA 1Q61A 4IADA 5CAPA 3IK3A 4WIHA 3QCQA 4FTRA 4GFGA 3Q5ZA 3Q60A 4JX3A 4L7SA 5FQDC 4R7IA 4Q9SA 5K3YA 1UU8A 3QKKA 3UBDA 3Q2JA 1Q41A 4QTBA 2RFDA 3U87A 4JJRA 4RSSA 3QC4A 3QWJA 5LXMA 3E3PA 4QNYA 5C4KA 4GJ2A 3PXYA 1JSUA 1OL6A 3GC8A 3DQXA 5CQUA 4A9UA 3FV8A 2R3IA 1YXUA 2F7XE 2AC3A 5EM7A 4D1ZA 3W2OA 5BVKA 3ZMMA 3PPJA 4WOVA 3ZRKA 3G9LX 1QMZA 3ACJA 4V0GA 3HP5A 3BIZA 3EKKA 2BALA 4EHGA 4AACA 4O1PA 3TZMA 3EN9A 5H8GA 4G6OA 4D58A 4E6QA 4EBVA 3AGMA 2XNBA 2GMXA 3FI8A 3ZXTA 3M11A 4AP7A 2E9VA 3VRYA 1MQBA 3CTHA 2XM9A 1BUHA 4DEGA 4AG8A 4ZLZA 1KE9A 3KC3A 3NNWA 5D7AA 5DFPA 5DR9A 4ZSJA 1KV1A 1PHKA 3MY1A 2VTTA 5FDXA 5AUXA 3TTJA 4CKRA 5LVMA 5CU4A 3CY2A 3BYMA 5ANKA 3E7VA 2SRCA 2B7AA 4DEAA 3P23A 5HI2A 4DE4A 4HVIA 4GV1A 1HOWA 3TACA 5AV3A 2IF8A 3QC9A 3KRLA 3ZBFA 3LMHA 2BZIB 4MWHA 4V05A 4C3PA 3DY7A 5HE1A 2QOCA 3RAKA 4WO5A 2PE0A 4JR3A 4HYUA 3UG2A 5AV4A 4OTQA 2VWXA 5AR8A 2C5YA 2OI4X 4YJUA 4IB3A 2BDWA 4G3DA 4GU6A 5DBXA 5AX3A 4JT3A 4GUBA 3DBDA 1M14A 3FQHA 3QCSA 3WF9A 4EOIA 5AM6A 4FEWA 2OK1A 1ZAOA 4RVMA 5G1XA 2YIYA 3GNIB 3H3CA 2GDOA 3HA6A 4RBLA 5TF9A 5AUWA 4XHKB 3KK9A 5HBJA 4IX3A 4K33A 3ZFXA 1PRYA 3FSKA 4FSZA 4ALUA 2XUUA 1NXKA 1FPUA 1RE8A 3FPQA 2O2UA 1Y91A 3PSDA 2F49A 4AE6A 2CDZA 1NY3A 4WNPA 5GZ9A 2WEIA 4OTHA 5GJDA 3WF8A 4H39A 3CD3A 1G8KA 3JR1A 4BTFA 2PUUA 4YUQA 4AQCA 5M4FA 3I5NA 2OICA 4YC3A 5A6NA 5IQGA 3VBYA 5A4QA 4Y83A 3M2WA 1ND4A 5BMMA 5IU2A 3ET7A 5EQYA 3K5UA 5KHXA 3ZDUA 3MB6A 3NW6A 5FUTA 3Q9XA 5EM6A 3V8TA 1URWA 3ZHPC 1IAHA 3EFWA 3QX4A 2H34A 3PY0A 2YDJA 2BFYA 2CN8A 3H9FA 3UPXA 3ZM4A 4G9RA 4O7LA 4LV8A 1VYWA 3VUDA 2OIDA 3F61A 3FYKX 4YC6A 5IUGA 2QOIA 3NUPA 5BQ0A 4C35A 3VBXA 5AP5A 2UW4A 3AMYA 3ACKA 3S2PA 4FSTA 2GQRA 3UNZA 4G5JA 3HA8A 2XJ1A 3GVUA 1LR4A 3IO7A 3DXPA 1Z5MA 2GHMA 2WIHA 3DTCA 4NH1A 4FKVA 3U4WA 4C4IA 4DYMA 3DK6A 4BBEA 1W98A 3KMUA 3TJCA 4TNBA 3EQPA 5A14A 3N4UA 2XK6A 2VWUA 4G3CA 2WFYA 2GHLA 4OLIA 4CQEA 1CM8A 1SYKA 2A19B 2W7XA 1QL6A 4L68A 2X0PA 5IH4A 4DEDA 3AC2A 3GC0A 2P2HA 2PMNX 5CU0A 5AP0A 2FVDA 3G6GA 3W0QA 5GJGA 3COHA 4FL3A 1OBGA 3DAJA 4ITIA 3A60A 3BKBA 2Z2WA 3C5UA 4EH9A 3TYKA 2X0OA 3C0IA 3QTWA 2GNIA 3V3VA 4F65A 4GEOA 4O83A 2UW3A 4DH5A 2QHMA 5HO7A 3C4FA 3FLZA 3BLRA 3LXKA 3KF7A 2B54A 1JSTA 3VUTA 4YJTA 1JNKA 2J50A 3KN5A 4YBKA 4YO6A 4OTPA 4NKSA 2O5KA 4FUXA 4I6BA 4L6QA 4AGCA 3JY0A 4K6ZA 5EDRA 3CD8A 3Q6UA 4FKLA 2Y0AA 4MQ1A 2WB8A 5GJFA 4EQMA 3BYVA 2VTIA 4PTGA 4EH7A 4W4XA 2WEVA 2IG7A 3QXPA 3FJQE 4CGAA 2CGXA 2XVDA 1WVYA 3FMDA 3ZRMA 3MS9A 4IWOA 4YPDA 2C3KA 4XJ0A 4PPBA 3ZLWA 4IVDA 4IAZA 3FLQA 3U9NA 4LGGA 3WI6A 4BGQA 4Y5QA 3DZOA 3C0HA 4TYGA 4GS6A 5CEOA 3Q96A 1FVVA 4IFCA 3QD4A 3HV5A 4AAAA 3DOGA 4PP7A 5EQPA 3WF7A 2E2BA 2FB8A 1H4LA 3F3ZA 1MUOA 3HP2A 3I6WA 4U81A 1JWHA 2J6MA 2BKKA 5EG3A 1PKDA 4EOPA 2F9GA 3FHRA 3F7WA 1OL2A 3FZRA 2DWBA 4IH8A 4O0VA 3QQHA 4X3FA 4XNEA 3UOJA 4UXLA 2GTNA 2O63A 4C02A 3TNPC 5JT2A 2OIBA 3UMXA 1Q8UA 3DAKA 4BVUA 1K9AA 1GIIA 1YWRA 2OU7A 1VJYA 4JIKA 4BHZA 3KKVA 4KBCA 3VW8A 4TWCA 4DH8A 3ZRLA 5EFQA 3ZFYA 2A4LA 2PVRA 3COKA 5CYIA 3S1HA 4W8DA 1F0QA 4V01A 2C69A 3FMNA 3WILA 3W16A 3MPMA 3PYYA 1XWSA 2JIIA 5IDPA 1M7NA 1OIYA 3CQWA 3PXKA 5HG8A 4GFOA 1Q8YA 2A2AA 4TXCA 4IWQA 4GVJA 4Z16A 3OWJA 2BKZA 2X8DA 1WVXA 4Q2AA 3NNVA 1YDRE 3EL7A 2WMQA 2IVUA 4R3CA 1PKGA 4C4FA 3TIZA 5L6PA 1R3CA 2UZWE 1GIHA 3DK7A 4FVRA 3EHAA 2GQSA 5JK3A 2J0MB 2Z7LA 4IZ5A 5FXRA 5IQBA 1H0WA 4FK3A 2VO7A 4KWPA 1TQIA 4IB0A 4F4PA 1ZWSA 1E1XA 4HGLA 5IQDA 3I5ZA 2J9MA 2NRYA 3DCVA 1P14A 4XOZA 5C8NA 4C4JA 3UQCA 5CT0A 2JBOA 3W32A 4ZY5A 3MESA 3MIAA 2VWWA 4KS7A 3E8EA 3LFDA 1W2CA 5J7BA 3D15A 3PP1A 3PXQA 3DJ5A 3V5TA 4M66A 5FM3A 4YJOA 5EOBA 4FGRA 1Q8TA 5CT7A 3TKHA 4C36A 3GC7A 5AAFA 5CSHA 1J1BA 1OB3A 2GNLA 3DXNA 3EQIA 5B0XA 4DGOA 4C33A 2ZV8A 2XRUA 3ZC5A 5A54A 4ANNA 4O0XA 3UYTA 1JSVA 3MVHA 4FIEA 1SNUA 4UMRA 2W9ZB 2ZV9A 4NCTA 4F09A 1OKZA 2JEDA 2YEXA 3LCSA 2XK3A 5FTOA 5J1VA 4PWNA 2VZ6A 3EZRA 4IM2A 5HX6A 4K18A 4O4EA 2W9FB 5IG1A 3CXWA 3R02A 4IX4A 4RJ5A 3VVHA 2AQXA 4F7JA 3WZDA 1O6LA 3ORPA 4BCNA 5KBRA 2ZV7A 4KIKA 5KMJA 1HCLA 4FIFA 4RVKA 1T45A 2IZTA 4XV9A 3UVRA 3KMWA 1UKIA 3CPBA 1YXSA 3D94A 3N9XA 4EK8A 2R3RA 2GU8A 5EW9A 5IKWA 4JAJA 5L2WA 3D7TB 4NM3A 5DH3A 2IZRA 5IISA 1DI8A 2FA2A 3HV3A 2F57A 1PXJA 4YR8A 4H05A 1M7QA 4MF1A 4OBQA 3UOLA 4QMZA 2VWYA 1IG1A 1H1QA 2PE1A 4JDKA 2GFCA 4CTCA 3TUDA 4HGTA 2XNEA 1B6CB 2W06A 1TQMA 4ZZNA 2B55A 1R39A 4KSQA 4L44A 1M2RA 4QQ5A 1IASA 4RJ4A 5EDQA 4ZJJA 5BVFA 5A6OA 4H3PA 4I5CA 3F3VA 2BTRA 3UE4A 4FKWA 3PIYA 4XG3A 2CJMA 4IJPA 4CV8A 5LWMA 3NUNA 4E3CA 4FG8A 4NM7A 5HU9A 3KCFA 5HD4A 5KMOA 4YGAA 4DEIA 2CNVA 4C3RA 2UW8A 3RNYA 3VN9A 4ID7A 3ZSHA 4EHZA 4ZAUA 4HNIA 3NUYA 4XRLA 4QMTA 3FXWA 4K11A 3F82A 5AUUA 3VUKA 5LOHA 4FEVA 4FSYA 3PZEA 3CSVA 4FSQA 1XJDA 4XEYA 2NNWB 1ZY5A 5BYZA 3ZSGA 4ZTQA 1FVRA 3W0NA 1BKXA 4WD5A 4IW0A 3BX5A 1PMEA 2XCHA 1HCKA 4PNIA 4QOXA 4CT1A 5LQFA 4CT2A 3MBLA 4D55A 1JQHA 1CMKE 3V5LA 1U5RA 2OH4A 4C4GA 4F6SA 2GSFA 3ZH8A 3RZBA 4RZVA 4QQCA 3R22A 4MYGA 4QYHA 5DI1A 3RK7A 4EH3A 3P79A 1PXLA 1OKWA 1OL1A 3O8TA 4CLIA 4E5WA 1H1SA 2RGPA 3QQFA 2IVSA 2ONLC 4ONAA 4CD0A 4AZWA 2X9FA 3PFQA 1W82A 4EOKA 1WBOA 4DBXA 5LARA 3ULZA 4FMQA 2XK8A 4HZRA 2QU6A 4XP2A 5ANEA 4CFXA 2WMUA 1CKPA 4FT3A 1YXXA 4E20A 5KMIA 3ANRA 4IHPA 5CXHA 2QG7A 4MNFA 2QOBA 1QPCA 1BI8A 5CU2A 4DINA 1PXNA 2YIRA 3MH2A 4EYMA 5AJQA 3W8LA 5HBHA 1SMHA 4JOAA 2O8YA 4YTCA 1JBPE 5CQWA 2XF0A 3MN3A 5EH0A 4ZZMA 4RLLA 4YHJA 1REKA 1R0PA 2UVXA 2XYUA 1YKRA 4XBUA 5HBEA 4HCTA 4GL9A 1UU9A 4D2WA 1OUKA 4O4DA 5D11A 2XYNA 4IC7A 4WA9A 1BLXA 3D7ZA 4LRJA 5AAGA 2VU3A 3RVGA 4XG6A 3SOCA 5AP6A 1WAKA 4FL2A 3FY0A 3H9RA 4FTKA 3MY5A 4TYHB 4UWYA 4ZOGA 2WMAA 3VJNA 4DBNA 4RC3A 4RMZA 3HNGA 2ITXA 4AXCA 2QO7A 3POZA 2XNOA 1B38A 4NFMA 2R0IA 3OWPA 4S2ZA 2UZLA 4JBOA 3ODZX 2KULA 3ITZA 3NYXA 3P5JC 3TWJA 1OPJA 4BDAA 2PVLA 4O22A 3OMVA 2JKQA 3I7CA 3PA5A 4Q5EA 4C37A 4QYFA 4RJ8A 5HE2A 5TE0A 3HEGA 4AA5A 3SC1A 4IX5A 2BDJA 4O6EA 2PUIA 4QMVA 1UVRA 2XIZA 3FQEA 5FXQA 4EC8A 3Q9WA 4DGLC