4EHEA

B-raf kinase domain in complex with an aminothienopyrimidine-based inhibitor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
266
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent and selective aminopyrimidine-based B-raf inhibitors with favorable physicochemical and pharmacokinetic properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 72
structure length 266
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eheA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eheA01
4R6VA 2Y4IC 4FKTA 2YIXA 4QMPA 4C33A 2E9OA 3FLZA 1PHKA 2QQ7A 2JKOA 3MVMA 1Y8GA 2XM9A 4FV6A 4L8MA 5AUYA 4RJ3A 3TG1A 4C34A 2OLCA 4OTIA 4Y73A 4ZSAA 2AC3A 2PZ5A 2WD1A 2YA9A 3OC1A 5A14A 3O8PA 2CGXA 4DN5A 1R0EA 2FVDA 4ORKA 2P2HA 2DQ7X 3I79A 5ETAA 3FZPA 4BDIA 2NO3A 3BLQA 3OG7A 2VTHA 1W7HA 2QOBA 3EWHA 1FOTA 3R7VA 5CEPA 1OIYA 2YCFA 4EH3A 4FT9A 2YM8A 2W1DA 4JQEA 3TTIA 4AUAA 1ZYLA 1MUOA 3NPCA 2UW8A 5J5TA 3C4FA 1OKZA 1OL5A 5JGBA 4M8TA 4B8LA 2YCQA 3MS9A 2UW0A 4D5HA 4EK4A 5IA1A 4FOCA 2R3NA 5B2MA 4RIXB 3Q6UA 4FC0A 5AMNA 2YM7A 1UNHA 5BUEA 2PZRA 4NWMA 4FL3A 3R30A 5AR7A 5E8YA 3GI3A 1ZAOA 3O50A 3MJ1A 2PVRA 4JQ7A 3GOKA 1JNKA 3G9NA 3LZBA 5J7HA 4YHFA 4OBPA 5L8KA 5D7AA 5I3OA 2VO0A 3LLAA 5A3XA 3AC2A 3WZKA 1UU3A 1P14A 3F3VA 3VBQA 4DH8A 2LAVA 4AT3A 4UX9A 2XS0A 4EWQA 4RJ5A 2OIDA 4I4FA 2RFDA 4L43A 4RFYA 3FZSA 4ZTRA 4BF2A 2G1TA 1KV1A 2CKOA 4LV8A 4QP9A 2W4KA 2GNJA 1SMHA 2YM4A 2IW9A 4ASZA 3S00A 4LM5A 1JSVA 4O0SA 3QRTA 2Y6OA 4BFMA 1IRKA 4ERKA 3DXQA 4WHZA 3NW6A 4FTLA 2V0DA 3MH1A 1WFCA 3OTUA 4JG7A 4O0RA 5IUIA 5BYZA 3W1FA 3NYNA 3VJOA 4M84A 2UVYA 4YJUA 3QQHA 4U3ZA 1ZYJA 4AW2A 3RHKA 4CFWA 2JD5A 2O8YA 4FV8A 3SQQA 4UV0A 3DV3A 3GQLA 2CKEA 3EQIA 2XNGA 4TYHB 4ONAA 4GV1A 3ZMMA 2WQOA 2XRWA 4BIBA 4TN6A 3JPVA 4BWXA 5IQCA 3GGFA 3T8OA 5DRBA 3G0FA 5EOLA 5EH0A 4E6DA 3PLAE 2QG7A 4I5PA 3TZ7A 4MF1A 3NCGA 3HAMA 5HTIA 4YLLA 5GINE 4JLCA 2PUNA 5KMMA 3KREA 4AZEA 4G6LA 3R83A 4DYMA 4IACA 3CQEA 5AP4A 4AGDA 5DT3A 5IA3A 2Y8OA 4EJ7A 5CZHA 3HUCA 2PVHA 4QTBA 3KVXA 5I9UA 4E26A 4ZMEA 2CCHA 3MVHA 2XKDA 2HWOA 3QCQA 4LUDA 3QD3A 2JFMA 1R0PA 2ACXA 4KKHA 3UODA 3ZFYA 1WVXA 4CZTA 3REPA 4RQKA 1UU8A 4D5KA 2WO6A 3BYVA 4XV9A 1WZYA 3VF9A 5T3QA 2BAKA 4MAOA 3PIZA 3GBZA 1P5EA 4K1BA 1FVTA 3TV6A 3UIMA 3SXRA 2XYNA 4USFA 4O0XA 5JRQA 4FKWA 4CXAA 3VW6A 3OF0A 4DH7A 1MQ4A 4JBVA 5DEWA 2BIYA 1UU7A 3MW1A 3QQLA 1ZLTA 3KF7A 5I5ZA 5IDNA 4FZ7A 2PZPA 3PZHA 1HOWA 2B0QA 2IN6A 3I6UA 4I0RA 1E9HA 4E7WA 5KX8A 2RF9A 3BE9A 1QCFA 4RIWA 2ONLA 2VTAA 4ID7A 4M12A 3VC4A 3DGKA 3LJ0A 3VVHA 3FV8A 3ZLSA 5LMBA 4JAJA 2XZSA 4RRVA 3ENMA 3NR9A 4UYAA 2JKMA 4IM2A 4CMUA 4W4WA 3I60A 4BKJA 3R73A 4ZTHA 3LKMA 3GP0A 4YO6A 4I23A 5HU9A 3SG9A 4O2PA 4II5A 2C6DA 5JFWA 4HNIA 3FQSA 4D2PA 5IA0A 3ID6C 2JDSA 2WU7A 1TQMA 2PVJA 3KRWA 3LOKA 3OOMA 3MVLA 1HCLA 4ENXA 2ITZA 4U80A 3AMYA 3D15A 3V04A 4E6QA 5E91A 3IOKA 4OT5A 1YHSA 3LFDA 3QTRA 3SOAA 2YAKA 3VJNA 3QA0A 4JL9A 4A7CA 3QTSA 4HCUA 4MEDA 4XV3A 3FSFA 4YZNA 4CLIA 5TO8A 1M7QA 1IA8A 1GIHA 3VUHA 3GNIB 1SNUA 3I1AA 4NIFA 2C6IA 4J7BA 2XF0A 2XK4A 3EFWA 4QNAA 4WUNA 5CI7A 3SRVB 4EOJA 4TTHB 3RHXA 3LMHA 4U42A 2Z60A 3FXWA 5HNIX 1GOLA 3MFSA 3V6SA 3WZJA 5EKNA 5DI1A 1OL2A 3T3VA 2PULA 2EB3A 3A7FA 3RNYA 3H9RA 4R7BA 3KY2A 5CF5A 1OB3A 4YO4A 3UPZA 2E2BA 3R8VA 4ANBA 2GQSA 2QOIA 3VUKA 3U6HA 4BICA 3D5WA 3GCSA 3PWYA 4UWCA 4ZJIA 2UZEA 3LW0A 2PK9A 5HGIA 4K2RA 5EDRA 2XNOA 3CTJA 4B8MA 4QNYA 2GHGA 4E5BA 4DLJA 3ELJA 5HE3A 2WMXA 3QRJA 5EYKA 3K3JA 3R2BA 4FG9A 5LMKA 3IDCA 4MH7A 5M4FA 1M2RA 3L9PA 5HKMA 3DBFA 5CAOA 3VULA 3TDVA 2WMUA 5FGKA 4YTFA 4DHFA 3PRFA 3ZFXA 2Y0AA 3MV5A 3FLSA 3U9NA 2J50A 3QTXA 4FODA 4WSYA 2YLFA 2O0UA 4GYGA 2BRGA 5BVNA 4EORA 2WELA 3CBLA 3R28A 4RGJA 1YDRE 1YW2A 2QLQA 1FMKA 3A4PA 1NA7A 3P1AA 4HCTA 3ZHPC 3EYHA 2XNNA 4M97A 5JKGA 3PJ3A 4BDHA 1KE7A 1QPJA 2ZM3A 4BKYA 1VYZA 3FC2A 4PTGA 1S9JA 3KMWA 5L6WL 3UVPA 4GT5A 3QFVA 3ZO3A 3ZZWA 4FV4A 4FKPA 4RIXA 4ZLYA 3A7HA 2B54A 3FMKA 3FI3A 4KRCA 5IMXA 3A62A 1YOLA 3GB2A 2WQBA 2XBJA 3EN5A 4DAWA 3RJCA 3T3UA 4XG4A 2GMXA 3ERKA 5DLSA 3EZRA 5IF1A 2X6EA 3U6JA 2HZ0A 2VWUA 3M42A 4AT4A 2EU9A 4ANLA 3OW3A 4WO5A 4IJPA 2OJIA 4C37A 3C13A 4XNEA 2VGOA 3G5DA 3KULA 2XCHA 4ASEA 1OL6A 1I09A 3ZXZA 4DLIA 1PMUA 1PW2A 4JNWA 2GNGA 3IQ7A 3LXNA 5HNBA 3R9RA 2Y7JA 4GK2A 4ZAUA 2ITOA 3CD3A 3MYGA 2C1BA 3O17A 2C6KA 4HYUA 1BL6A 4NKSA 3TIYA 1EH4A 3TEIA 3ZOSA 4JIAA 5LWNA 4FV1A 4GG5A 1Z57A 1CSNA 3POOA 3QRKA 4U0IA 1GNGA 2J2IB 3H9FA 4LGHA 3ZUUA 4X2KA 5GNKA 3E7VA 1OUYA 5CANA 5EW9A 1NVQA 3LPBA 4QMVA 4IM0A 4YJVA 3UP2A 3W2CA 4NFMA 4TYJA 2PU8A 3DOGA 4GT3A 1TKIA 3E3PA 3HEGA 3OW4A 4HGLA 4NU1A 3MIYA 1ZZLA 5CU6A 2W0JA 5EHOA 3KA0A 3PXZA 3BWJA 3E88A 3RWQA 2GNFA 3TXOA 3SXSA 3FKLA 1P4FA 3NEWA 4IVAA 5HQ0A 3KRLA 4S33A 1RDQE 3DK6A 4JRNA 4JRVA 3ZO1A 5EQYA 5J9ZA 4PMPA 1OMWA 2CPKE 5BPYA 5FXRA 1XH5A 4TPTA 4IB5A 1Y91A 2KULA 2OH4A 4MWIA 3SDJA 4L7SA 4L52A 4YU2A 5HORA 3RZBA 3NYVA 4OT6A 1RW8A 1H1SA 3DKOA 3O23A 3KKVA 4L67A 4B99A 4CZUA 1MRVA 1ERKA 3PY0A 3V51A 4L53A 4F99A 4O6EA 2X2KA 3L9MA 4E4MA 4CG8A 3V8TA 4DCAA 1GY3A 1H25A 2VNYA 2Y6MA 3NRMA 5TR6A 5M56A 2VX0A 2ERZE 3V5PA 1OPKA 4D2RA 4GMYA 5ETCA 5KZ0A 1LEZA 3PVGA 1SVEA 5KO1A 1QPDA 4DH5A 4LV5A 3VBWA 4OBOA 5I0BA 1ZMWA 4MF0A 4ACHA 1V0OA 2VD5A 3C4ZA 1FPUA 1OPJA 4L46A 4J98A 4X6RA 4XBRA 5AP1A 3IPHA 4DCEA 4KKGA 2VAGA 4QMZA 3KN6A 1ZRZA 4NTTA 4FMQA 1OL7A 2UW3A 3OUNB 2VO3A 3TCPA 3ACJA 4WNOA 3FXXA 2RG5A 2XK7A 3OCGA 5HCXA 4DGLC 3MH0A 5GJGA 4FZFB 4RJ4A 5DVRA 3F3WA 5IEYA 5AV0A 1CKIA 4X2FA 3JXWA 5HE2A 4F09A 3NIEA 2XA4A 5E90A 4S31A 4M14A 4GIHA 3ALOA 5CF4A 4FG7A 2BUJA 2JAVA 3PDTA 1V0PA 5AP3A 4EH5A 3LMIA 3NUXA 4GKHA 4FI1A 1B39A 1YHVA 4OR5A 1U59A 3C4WA 3UIBA 4YP8A 1YXTA 3UPXA 2YITA 4TT7A 3EFJA 1W84A 3ORZA 5E8TA 5CSWA 2ITNA 2GQGA 1Z9XA 4HVDA 2FGIA 4QMWA 3OXIA 1OITA 3R63A 2R3RA 3NNWA 4QOXA 4JDJA 2AUHA 4QD6A 2X39A 3QQJA 3ANRA 3R1QA 1OI9A 4O0YA 3DAKA 5BNJA 4WSQA 2J0LA 3CGFA 2WTKB 4CKJA 2VWYA 4LG4A 3QTZA 4OTPA 1XH8A 4Y85A 4U8ZA 5AIRA 4MKCA 5B7VA 5DYJA 5E9EA 4J8NA 5KHWA 3DKGA 4J99A 3VBYA 3V5WA 5IA4A 3FY2A 1XJDA 5K4JA 4I20A 3POZA 1BMKA 3TZ9A 3WBLA 4ZJVA 2YDKA 4QMXA 4KIKA 4QQJA 4U40A 5L6PA 2W99B 4DGOA 3W18A 2CMWA 3BLHA 3FLYA 5K0XA 4BBMA 2NRUA 4FYNA 1KUTA 5CU4A 4DF3A 3CE3A 5I3RA 2PMOX 1H8FA 3AT3A 3P4KA 3AT4A 5H9BA 4MQ1A 3WOWA 3DB6A 3NCZA 4E4NA 4G3FA 3W10A 3LFBA 2CLXA 4TYHA 3O7LD 1JKSA 5CU3A 2E9UA 3ZM4A 5CWZA 5HTBA 3KMMA 3K5VA 1OM1A 1WBOA 3GC0A 3GCQA 4G5JA 5A4LA 4YJPA 4R3RA 3GFWA 4EH6A 4QYYA 2ZB0A 4F9CA 2NNWB 2R0UA 3V8WA 4R78A 2ZVAA 3SXFA 3WE4A 4O7YA 1T46A 5HZNA 3S1HA 2F7EE 3E87A 2CJMA 2R3OA 2RG6A 3PP0A 4RWJA 4FGRA 4BTMA 5K3YA 1NXKA 2FB8A 3DK3A 3DPKA 4OW8A 5LOHA 5M53A 5IISA 2QU5A 4BDAA 2WTJA 1STCE 2EB2A 1TQPA 2HAKA 3ZH8A 3PP1A 5K5XA 3VQHA 1BLXA 4JDHA 5DR9A 4RG0A 4GK3A 5A6OA 2R2PA 1IEPA 4UMUA 5F95A 4H05A 5M09A 3CD8A 2XNPA 2XMYA 3Q2MA 1U5RA 2JIUA 4I92A 3PYYA 5EG3A 4UEUA 4GVAA 3D9VA 3I7BA 2F7ZE 2XRUA 5AP7A 4NEUA 1LPUA 4AS0A 4IAYA 4EUUA 5EM5A 2H8HA 4FKOA 5J9YA 3N51A 2PUIA 5KNJA 4GG7A 4FZ6A 3RM7A 2WKMA 3G9LX 3TZMA 3KXZA 5FP5A 3AMBA 4ALVA 5CF8A 3MESA 3BPRA 3LXPA 4LFIA 3HX4A 4BTKA 3DNEA 3BU6A 4EWHA 4EH9A 5JGAA 2H96A 3GCUA 1JKLA 3QYWA 3RBWA 3WF9A 2YIWA 2W9FB 2YAAA 1K3AA 3C51A 3ZSGA 4B6LA 3ZM9A 4BCFA 2PMIA 3D7ZA 1XQZA 4MNFA 2F7XE 3I5ZA 1IR3A 4EQCA 1GAGA 2YLEA 3AD6A 2HIWA 2ITTA 3KXMA 4I24A 1NT2A 4M69A 2R9SA 2I40A 4OTFA 2C47A 5D7VA 4BDEA 3TJDA 1ZXEA 1JKTA 2CKQA 3BEGA 4YC8A 4TNBA 3PY1A 3UMXA 1LUFA 4H1JA 3PXQA 3UVQA 3TUCA 3JR1A 1KE5A 4QQ5A 3KULB 3I6WA 4CQGA 3RP9A 1PXKA 5EOBA 3I5NA 4NTSA 3F6XA 4YTHA 2IW8A 3ZZEA 2BRMA 4ANSA 1OIUA 3OHTA 5J1WA 3ZUVA 3MTLA 3ZC5A 1PMVA 3ORKA 4R1YA 4A9SA 2BHHA 2PZYA 4QRCA 3COHA 3PIXA 4PNIA 3M2WA 1Q97A 2G9XA 5HI2A 5HE1A 2C6OA 2XUUA 4Z9LA 5HLNA 1U4DA 4QT1A 4C3FA 2ITVA 5AM7A 4U81A 4R3CA 4UMTA 3R9HA 3EL7A 2F49A 4MBJA 4FTJA 5JZJA 3QUPA 4IZYA 3WZEA 3QLGA 4DG2E 2VTMA 3MTFA 3RINA 2BZJA 3BV2A 4CQEA 1FBNA 3WARA 5CNOA 4UMQA 4JX7A 4QP7A 5KCVA 2GTNA 1OZ1A 3PJ2A 2R3JA 5AEPA 1SVGA 4RQVA 2QD9A 3M11A 3RM6A 3ZRMA 1V0BA 4E5WA 3CP9A 3I0OA 5IEVA 3GUBA 3DA6A 3ZONA 5AM6A 2WEVA 2JKKA 3SV0A 5J7BA 2VWVA 4X21A 3ET7A 4MWHA 4CVAA 3ZEPA 3W16A 1ZARA 5F1ZA 5FXQA 5AAGA 2ESMA 3QQUA 4KBCA 4NJ3A 4O27B 4BDFA 4L42A 5JK3A 3G15A 4ZY4A 5EHYA 5KZIA 2PMNX 3WE8A 4RJ6A 4GJ3A 4LOQA 4ZJJA 1XBAA 2HZIA 4WG3A 2VZ6A 3NNVA 3QHRA 5E8VA 3EB0A 3LJ2A 4JBPA 5A9UA 2BROA 1VR2A 2FSLX 4M3QA 2X6DA 4LOPA 1ZY4A 4RZVA 5HX8A 3BE2A 4YZDA 3BU3A 4AN2A 1Q5KA 5L2QA 4PX6A 4AE9A 4HGSA 3R04A 2Y9QA 4YZMA 3MH3A 2XH5A 3FBVA 2UVXA 4CFXA 4GUBA 2BALA 3OXTA 1ZZ2A 3RPYA 2OWBA 4I5HA 5IH6A 2BFYA 3ZSHA 5DWRA 4HZRA 4R77A 3QTWA 1WVWA 4IX5A 2PUPA 3B8QA 4N6YA 3MFUA 3SD0A 5CU0A 5GIPE 3FC1X 2FUMA 2ZDTA 3GC7A 3Q4TA 4AE6A 4N57A 3I81A 3QKKA 3F5GA 4W8EA 4ZSLA 1BX6A 3A8XA 4LRJA 3V5JA 2A19B 2ITXA 3EKNA 4AA5A 5GZ8A 5KMNA 3FZ1A 3KL8A 3PG3A 3MGYA 2W9ZB 3QGWA 4IC8A 4G6NA 3QXOA 4FKRA 4BB4A 2I0EA 3EN6A 3EQHA 3LJ1A 4HPTE 4XHKB 5FEQA 5HOAA 4A07A 4NZWB 2W7XA 3AC1A 3D2IA 4NSTA 1J3HA 3PA3A 2I1MA 3JY0A 1PYEA 4GRBA 1REKA 1W82A 1ZWSA 3N9XA 4FTQA 3Q53A 4S34A 2JFLA 4HJOA 4KINA 4G6OA 3DJ6A 5B0XA 3ZU7A 4WRSA 4ARKA 3QQKA 5I9WA 1RQQA 4FTTA 5IUHA 4IFGA 4PTEA 4U44A 2B4SB 2IVTA 4D2SA 4BWKA 4I5MA 2XIRA 4NJDA 5HD4A 3GU7A 1CTPE 4JI9A 5AX9A 5AADA 1F5QA 3HL7A 4FYOA 2YCSA 3R7EA 4WNPA 4FUYA 5TT7A 3UG1A 4BC6A 4DGNA 2G2IA 4M69B 3ATSA 1RJBA 4FX3A 4FTIA 4DFZE 1CKJA 2BAJA 3Q2JA 2JDVA 4YMJA 2JBPA 2OJJA 4EYMA 2JGZA 5JT2A 3A99A 3CJFA 3KB7A 4FOBA 3K3IA 3TI1A 5FTOA 1CKPA 4BGGA 3R8ZA 3WZUA 1PF8A 1Q3DA 4E93A 3C0GA 1M14A 4JR3A 1JLUE 1BKXA 3QF9A 5AR2A 4ACDA 3DXNA 5L8JA 1J7IA 4L45A 3UE4A 1KOBA 4FG8A 5LWMA 3TNWA 2PL0A 2W1ZA 3BHTA 3ORNA 2FA2A 2QG5A 4IHPA 4J97A 3HP2A 1R1WA 4HGEA 2Z8CA 5AUVA 3HV7A 3OCSA 3S2PA 1WBVA 4YC6A 4UMRA 4XG8A 3F5XA 5HVKA 1OKWA 2DUVA 2H9VA 3IW7A 4BCPA 1W98A 1K2PA 4P4CA 4HCVA 3RNIA 4FV0A 2O5KA 5FTQA 3QD4A 4BHNA 2C3IB 4QMNA 3F2RA 3L1SA 3GC9A 2YWVA 2WTDA 5JEBA 3EFLA 3O2MA 4OAUC 3HV4A 4YR8A 5HO7A 2B9IA 5J79A 5E92A 5LCJA 1YXVA 3BEAA 2EWAA 3AXWA 3MY0A 4DEBA 3IOPA 5BUJA 4UY9A 1HCKA 2J9MA 3LM5A 4RVKA 4DG3E 2VN9A 4XG2A 4AGCA 5CEOA 4EOLA 4FF8A 2RKUA 2C4GA 3PVBA 5IA5A 3VS1A 3CPCA 5I9VA 3PSCA 1U5QA 4C57A 3UOHA 3FE3A 4AT5A 2OF2A 4OAVB 3ULZA 5ETIA 4W8DA 1GIJA 4OTQA 4EUTA 2ETRA 1MP8A 2W06A 4FZAB 4YJSA 3FJQE 5DR2A 5FEEA 3U55A 3A7JA 1OGUA 4P5ZA 2Q83A 3Q4CA 3CR0A 4HZSA 4QP3A 5EW8A 3UQFA 2ETMA 2X8IA 4O0TA 4D0WA 3PG1A 3PLSA 3W2OA 4U5JA 3KCKA 2UVZA 5FM2A 2DS1A 2HY0A 2VWZA 2XJ0A 3NW7A 2GS7A 4WBBB 3F66A 5C01A 5ANDA 2A0CX 3G2FA 3ZRKA 3VIDA 4AOIA 3TDWA 2OICA 4DTBA 3QRUA 4W4XA 4BGHA 4ZTSA 2Y4PA 1LEWA 4NW5A 3TNPC 3VW8A 5F94A 4QQTA 4C7TA 2WMQA 1O6YA 4MCVA 4FVQA 4LRMA 3JS2A 4RJ7A 3VNTA 2ITWA 3E63A 4XH6A 3C1XA 4N4SA 5AP5A 1QPEA 4RVTA 1UWHA 3P79A 5AR5A 4Q9ZA 4PRJA 2QODA 3QGYA 4NM7A 5LVOA 4GW8A 2R3FA 1E1XA 4O0UA 5EM6A 2C5VA 4WKQA 4PDPA 3MDYA 1Y57A 3AC5A 3NAYA 4DFNA 3IGGA 3BGQA 3PFQA 1YXXA 1DI8A 2QKRA 3RAWA 4G16A 5EDQA 2PVYA 4L7FA 2VTJA 4BRXA 4BYIA 4IANA 1GIIA 4X3FC 4NCTA 4RVLA 2OJ9A 2WPAA 4HYIA 3R7GA 1KSWA 4R5YA 2XKFA 2CDZA 4FT5A 3QQGA 2IZSA 4BHZA 4KB8A 2WQNA 5HG7A 4FUXA 3DZOA 2GU8A 2I6LA 5A4QA 4QYHA 4C0TA 4CV9A 2QOLA 1YHWA 2A4LA 4EOKA 3LFQA 3Q32A 1WBTA 2J7TA 4WBOA 4D0XA 3IW4A 3ZTXA 3V8SA 2C6MA 4BCKA 1OKVA 3BIZA 4W4VA 1WBNA 3NZ0A 4C58A 5C26A 1T45A 4E1ZA 2C6TA 4I0SA 3ORIA 1GZNA 3ANQA 3MI9A 3VBTA 3NWWA 4GH2A 1A9UA 5AUUA 4PMSA 4ANQA 3BELA 3KN5A 5H8EA 5FXSA 2C5XA 1DAYA 4YJTA 4L01A 1YI6A 4EI4A 4UZHA 3PJ1A 5CU2A 4RT7A 5EQEA 3NAXA 4L44A 4WT6A 3FKOA 3NLBA 3R6XA 3FHRA 1NVSA 2J5FA 4OUCA 3CIKA 3OZ6A 1DM2A 2WTWA 3EQBA 3DNDA 3MN3A 1W83A 3D7TB 3E3BX 4V0GB 4BTFA 1NVRA 4CFMA 3D14A 2OZOA 4PTCA 5E8ZA 2DYLA 2BRHA 4FKSA 3GXLA 4MD8E 3WYXA 4J71A 3AG9A 4IWQA 4BBEA 2XNEA 3ACKA 5B2KA 4ZY5A 1F3MC 2PUUA 4BKZA 4MD7E 4RLLA 3TN8A 4U41A 2QO2A 3C4XA 4RJ8A 5FBNC 5L2IA 5AFVA 3TZ8A 2HXQA 4R7HA 3FZOA 4FKJA 5EI8A 1Q8YA 3CKWA 4IMYA 4K11A 4TYGA 5LCKA 5FM3A 4EK3A 2OXDA 4YUQA 2B9HA 4I6BA 5CI6A 1R78A 2UZDA 2X8EA 4RWIA 3VBVA 4XP0A 2QLUA 2XIYA 3F5PA 2HZ4A 4Y46A 4RSSA 5E8WA 3O71A 3ZLYA 2YIYA 4FNXA 4LUEA 4F65A 3PIYA 4RX7A 4RC3A 4BDCA 2JC6A 1KE9A 4XBUA 3A8WA 2HW6A 3NIZA 4K8AA 5DN3A 4ENYA 4RLKA 5H2UA 3TIZA 3TKIA 4IEBA 4L68A 2VWBA 3DFCB 4JAIA 3AC8A 5E8XA 4ZTNA 2OIQA 3TKUA 3RTPA 1AGWA 3CTHA 1Q8WA 3Q9YA 4Y8DA 3RPRA 3VUMA 2E9NA 1FGIA 1SVHA 2GNIA 2WAJA 3AGMA 4EOQA 4DFLA 5EI2A 2WMSA 3DT1A 4TWOA 3CC6A 4RFZA 4FEVA 2B7AA 5CEKA 2V62A 3SVVA 2O2UA 1W8CA 1JSUA 4R5SA 1GZKA 3FHIA 5CYIA 5A4TA 4IB1A 1YI4A 2IVVA 4AGUA 5D11A 4FEXA 4O82A 4CGAA 2ZV2A 3LLTA 3TL8A 2CSNA 4J53A 5JFVA 2BILB 4RWKA 4I22A 4DINA 3COKA 3ZYAA 3VWAA 5GIOE 4IE9A 4UMPA 3ZO2A 2WIPA 2GS2A 3WILA 3DBDA 2YEXA 1Q8ZA 2VTRA 1H08A 2O3PA 1G3NA 1OIRA 1YRPA 5CEIA 3ZEWA 4GK4A 2UW6A 4RBLA 3EQCA 3HMMA 3OCTA 2REIA 2B55A 4S30A 2R5TA 4L3LA 3GVUA 4EKLA 5F4NA 3Q9WA 1H27A 1YXSA 4C62A 5M44A 2GCDA 1L3RE 3BQCA 4FL1A 4PP9A 4NCTC 4A4OA 2HENA 3COIA 1W0XC 3L8VA 2PVNA 3KQ7A 3NNXA 4XUFA 2C3LA 2VUWA 3MH2A 1Q41A 1Q62A 3QKMA 5EYMA 2R3HA 4B4LA 3OT3A 4YJQA 4QMMA 3LVPA 4LMNA 3OFMA 1PRYA 2NRYA 3VHEA 3G33A 2QO7A 3KK9A 2VU3A 4QMUA 5BMSA 3DAEA 2C68A 2X4FA 3UGCA 1OECA 2X7OA 4M0YA 4X2JA 5KMLA 4BDJA 4UN0C 3F69A 3QALE 3UZRA 3TWJA 3HDMA 4DE4A 2QOOA 4EH7A 5LVPA 2FSOX 5EI6A 5A6NA 4C59A 4PDSA 3BYSA 3C4EA 1YKRA 3MY5A 3DK7A 4ZS0A 2I0HA 4NM0A 3SKCA 5ICPA 2R3IA 3U54A 1PYXA 2IVUA 2CCIA 3VS6A 2VRXA 4MK0A 3AD5A 3LCTA 5FWKK 4YZCA 2HW7A 4MNEB 3E8NA 2DWBA 2J0IA 4KSQA 3NX8A 3QYZA 1JVPP 4O6LA 5CT7A 1PXNA 5CAQA 4CTCA 3ZSIA 2OXXA 3O8UA 4OBQA 3KGAA 2OH0E 1PY5A 5D10A 3FI4A 4D1ZA 2BVAA 1IAJA 1XH6A 3UC4A 3OXZA 2JDOA 5CQWA 2QOFA 2W17A 3A2CA 5FLFA 2XNMA 4BCIA 4C3PA 3FL5A 4IAAA 3NUSA 3UYSA 2XEYA 3KXGA 4P7EA 3VS7A 4CTBA 4XCUA 3PE2A 3UQGA 4F0FA 4RVMA 3BYMA 4HVIA 4YBJA 3R9NA 3DXPA 1JQHA 1OIQA 4F9BA 5BVFA 2JBOA 3EN7A 3FQEA 2O63A 3R22A 2WOTA 2JKQA 3DQWA 4FKVA 1M52A 3RK7A 4KD1A 3S4QA 4IB0A 5FBOA 5J8IA 4FIFA 3TNHA 2VGPA 3DZQA 4TWNA 5AWMA 5L6OA 2OBJA 4LYNA 4UB7A 5T6KA 1UV5A 2BKKA 1PXLA 3KK8A 5AIKA 3OEZA 3UBDA 4FK3A 3CS9A 4Q5HA 4ANOA 3C0HA 5HNGA 3TNQB 5IA2A 3R7OA 3SW7A 1KOAA 4TY1A 1PXPA 4MBIA 2CKPA 4NK9A 3EQFA 2WMAA 2XKCA 3JY9A 3FUPA 3LQ8A 3L8XA 4PWNA 4JVGA 4BGQA 5CY3A 3BYUA 4X6QC 3C0IA 2RSVA 5D9HA 3SG8A 3FMHA 2WIHA 3D94A 4OLIA 1E1VA 1VYWA 4BY9E 4FSUA 3MPTA 5IQHA 2JDRA 2QCSA 4JXFA 2YN8A 4FSQA 5JGDA 2WQEA 5TF9A 4D4RA 4C2VA 4WNKA 3OBGA 4HVHA 3EOCA 1A06A 2BHEA 3H0ZA 1CM8A 4MVFA 2WU6A 3MWUA 4V0GA 5HG9A 3LCDA 3VBXA 3VN9A 2VWWA 3M1SA 4ACCA 4O84A 4MHAA 3HLLA 3AQVA 2WMRA 3CTQA 3DKFA 5CVGA 3WF5A 2YJRA 4AZSA 4M15A 4CCBA 4I94A 3H30A 2PE1A 4UXLA 4MX9A 3R0TA 4C36A 2UW9A 5EQPA 1XBBA 2RFNA 4AP7A 3FWQA 4F0GA 2W5BA 1L8TA 5DH3A 2QOKA 1SZMA 3MFTA 3P08A 4X3FB 4BDDA 2V5QA 3OVVA 3PA5A 4ACMA 3RPSA 4CEGA 4A9YA 3QLFA 2R3MA 4NFNA 3ZC6A 4E6AA 4EH8A 3GEQA 5HE0A 4N6ZA 1DI9A 4ANMA 4I6HA 2EXCX 1LR4A 4X7QA 3LM0A 4FR4A 1CMKE 2OKRA 5TKDA 3PXFA 3QTUA 3W2RA 3ZDIA 4CFNA 4ZTMA 2GFSA 3UQCA 3ATTA 3DS6A 3WI6A 4JG8A 3BHHA 5CSVA 4EK5A 3FLNC 3DBQA 4PNKA 1APME 5KBRA 4UWYA 3SW4A 2WMVA 4AQCA 3FAAA 5J87A 3RPVA 1OPLA 2A2AA 2G2FA 3EL8A 4B7TA 4G9CA 3U9CA 3OY3A 2WTKC 4IWOA 2QOQA 4A9UA 4QTCA 1ATPE 2Z7RA 2CN5A 3OWKA 4FKGA 3W2PA 2E9VA 3L9NA 2WMBA 4NM3A 3UNZA 2IZTA 3UYTA 1XR1A 4YJRA 5HO8A 3QA8A 2YDIA 4I6FA 4GCJA 3K5UA 4PPAA 5D1JA 3OP5A 4EOPA 1KE6A 4KRDA 5KKRB 1Q24A 2BMCA 4IZAA 3PTGA 4C4FA 3D2KA 3D5UA 4KKEA 4QMLA 4V05A 5FTGA 4XMOA 4PL5A 2OJFE 4O1OA 5EM7A 4QP1A 3OBJA 4FV7A 3TT0A 3R00A 2QHNA 3THBA 3R8UA 1PMEA 3I7CA 2CHLA 3E8DA 3O0GA 4U45A 3DLZA 2YM3A 2PPQA 3Q6WA 4CRSA 4XP2A 1LP4A 2OG8A 5GZ9A 3CQWA 4AA4A 2X9EA 5AUZA 1H24A 3EN9A 3C9WA 2JDTA 2YZAA 3QWKA 4FKQA 4I5CA 4A06A 5L4QA 4GL9A 4ZMFA 5F20A 4EK8A 2RFEA 4I6QA 4M67A 4EHEA 4TRLA 3VAPA 4DBNA 1RE8A 5BX0A 2EVAA 3E7OA 3ETAA 3PRIA 4D55A 4L3JA 4ERWA 2HYYA 2X8DA 3AT2A 4FV3A 3O96A 5JSMA 4QPSA 3CEKA 3GOPA 3IECA 3MB7A 3QC9A 4FSNA 2X2LA 3KRRA 4H3PA 4IVDA 4RIYB 4TW9A 4DH1A 3F2NA 1BUHA 4L3PA 3RWPA 4EC8A 3FMLA 4XEYA 4Z7HA 3BBWA 2XKEA 3BQRA 3KXXA 3IW5A 3UTOA 3GT8A 1JKKA 3PJCA 4NW6A 3IG7A 3BCEA 3P7CA 4H36A 3E64A 4G31A 4G9RA 3ZRLA 1VZOA 2P0CA 2VX3A 3A7GA 3FI8A 4JR7A 3EQPA 2B9FA 2J0JA 4BCHA 3FLQA 1M7NA 2HXLA 2FSTX 1V1KA 4YLKA 3R8LA 4RX5A 4PL4A 3OY1A 2XCKA 1JBPE 3HUBA 2VO6A 4WD5A 5EFQA 5T68A 4ZLOA 3CLYA 5LMAA 3KEXA 3Q04A 5CSPA 3UG2A 4KABA 4RX9A 2GSFA 3D7TA 5M55A 1UNLA 5AUWA 5KBQA 2UZOA 2OW3A 3QRIA 4FK6A 1BI7A 4BDBA 3OD6X 4IWPA 3U87A 4PUZA 2C0OA 4XV1A 5GJFA 3G90X 3K54A 5EDPA 3ORTA 4LL5A 3BU5A 4IW0A 3FMJA 2ITYA 3R1YA 4AACA 4O7LA 3VUDA 4FNWA 4HYHA 3EZVA 3WYYA 3AOXA 3TTJA 2BZIB 4QYEA 4CRLA 5LVNA 3P86A 4XLVA 4B0GA 4EJNA 3KU2A 3MJ2A 5IPJA 3E5AA 2JIIA 1NW1A 3GU8A 2PVFA 1P2AA 3N4UA 4AZWA 3FQHA 4YPSA 3UNJA 2XK9A 3E62A 4IAZA 3ROYA 4FTRA 3GU6A 5FP6A 4EC9A 4QYGA 4FNYA 4PMTA 5DE2A 4YTCA 1OUKA 2QOCA 2H6DA 4U43A 4AW0A 5HG5A 3ZXTA 3BHUA 4C8BA 4F6WA 1AQ1A 3IONA 2IG7A 5J95A 5DHJA 4DH3A 3D0EA 1R3CA 3FY0A 2ZAZA 4IZ5A 4XRJA 2P4IA 5C4KA 3R7UA 2KTYA 4AA0A 3KRXA 1X8BA 3NUPA 5AP6A 2Z7SA 3IW6A 4N0SA 5H8GA 4EL9A 4PDOA 4KA3A 3V6RA 5CVHA 3KCFA 3PXYA 3I4BA 3Q60A 3AC4A 4O7ZA 5CNNA 5E8SA 3SC1A 2J4ZA 5HCZA 1TQIA 4JDKA 5DNRA 3GU5A 4BIEA 4ZK5A 3GU4A 5ANOA 5AV2A 4I93A 2C5YA 4JT3A 3F3ZA 2ONLC 3DKCA 3QU0A 4OTHA 3LFEA 4X3FA 4LOOA 2IPXA 4I41A 1PXJA 2WTIA 1XH4A 1O6KA 4EH4A 3UZTA 2ITPA 5BVOA 2A1AB 1REJA 3U51A 3FSKA 4AW5A 4C4JA 4F4PA 1Q8TA 4FV9A 4WRGA 3T9TA 2C1AA 3H0YA 3UC3A 1IAHA 3SRVA 3FEGA 1O6LA 3VS5A 3TKHA 2BDFA 3E92A 3HRFA 2IO6A 4F6UA 1FGKA 4GYIA 4N70A 4G17A 3UVRA 2B53A 5C8KA 3ODYX 1SM2A 2WTVA 2CN8A 4IJ9A 4YSJA 3O51A 5LARA 2QI8A 4IQ6A 2C69A 3BBTB 3OTVA 4V01A 2UV2A 2WB8A 2XBAA 4O96A 2JITA 5ANEA 3UIUA 1H1RA 4DEHA 4IVBA 4PP7A 4NH1A 2C0TA 3KXNA 2BRBA 4C4EA 1QL6A 5KHXA 1J1BA 1Q3WA 2P55A 5IQIA 5HO6A 3R1SA 2HCKA 2XK6A 5HD7A 2GS6A 3BRBA 4FTKA 2VTPA 4U79A 5DOSA 1Y6BA 5AAFA 4E73A 5ITAA 4IAIA 4D1SA 2R4BA 3QZGA 4O1PA 5FRIA 3BZ3A 3QQFA 4FZDB 4CD0A 4KSPA 4DFBA 2QC6A 3EMGA 4D1XA 4Z16A 3QZFA 4IZ7A 3RPOA 1I44A 2HOGA 3DJ5A 3WF8A 5A4CA 5J5SA 5JMSA 2C3JA 1R39A 2ZYBA 2XVDA 3JUHA 3W55A 5M08A 3PXRA 2PVKA 3IDPA 2IZUA 3N4TA 2Z2WA 4RIWB 5LJJA 4MD9E 3QBNA 3MVJA 4GT4A 1CDKA 3PE1A 2GDOA 3H9OA 4RA4A 4D4YA 2PVMA 4F0IA 5HTCA 4G1WA 3Q9ZA 3NUYA 1ZOEA 4E3CA 4U6RA 5G6VA 4CFFA 1JOWB 5JZNA 4F7SA 4X2NA 5LMKC 4R7IA 5AX3A 5HX6A 3R21A 4H3QA 4BTJA 3LQ3A 4IXPA 4K77A 2QU6A 5KMOA 5AR3A 2UZNA 2CNQA 5BMMA 3W8QA 2OK1A 4O86A 4M0ZA 4FVPA 2W1EA 4MTAA 2C5OA 4ZY6A 5C1QB 4LQMA 2UZVA 4FGBA 4JOAA 2VTTA 5AP0A 4QP8A 4U9AA 4Y5QA 2I0YA 3HV6A 2XM8A 4AAAA 4R3PA 4PPBA 5GJDA 5E1SA 2ETKA 5HLPA 3ZCLA 3HAVA 1H01A 4RC2A 4HPUE 5D41A 4E20A 2OFUA 2ZV8A 4D9UA 3NS9A 2V55A 1PJKA 2VTLA 4JQ8A 1FMOE 4NM5A 4FKUA 2R3QA 4K6ZA 5HBHA 5C27A 3VO3A 4F7LA 2A27A 5A46A 3EYGA 3EHAA 4ITIA 4GU9A 2GFCA 3UOLA 2JLDA 4C4HA 5IQAA 2BDJA 1Q4LA 3R8MA 4CT2A 4QPAA 4BIDA 3MB6A 3C7QA 2F2UA 1G8SA 4C4GA 4EHZA 5AUXA 5DIAA 3U4UA 2YERA 2QONA 5I9XA 1XH7A 3OOGA 4FKLA 4USEA 3ULIA 3RK5A 3RALA 5IQBA 1ZYCA 3F3TA 3IK3A 5CALA 3R7IA 4DG0E 1H00A 3NW5A 2QKWB 2GTMA 4G5PA 4A4XA 5IUGA 4U97A 4GFGA 4YSMA 3KXHA 1AD5A 4H3BA 3V5QA 2PE0A 1IASA 3IO7A 4F08A 3FMDA 5C9CA 5M51A 2XK8A 5AV1A 3CGOA 1WBPA 1YOJA 4IWDA 4LMUA 4DBXA 4C2WA 2YM6A 4EBVA 5EW3A 5IEXA 5DPVA 4D4SA 5M07A 5CXZA 2QR8A 2WGJA 2ZV7A 3UP7A 3DLSA 3LFAA 4LGDA 4BDKA 3QXPA 3ORMA 4XG9A 1OKYA 3GFEA 1GZOA 5BVDA 2BTRA 1WMKA 5AA8A 4XP3A 4CT1A 1J7UA 2X1NA 3R7YA 5JFXA 3FZRA 3OMVA 4KBKA 4YNEA 4PL3A 3NYXA 3PVUA 4IB3A 4PPCA 1M2QA 3R8PA 5CAUA 4F1TA 4YJOA 3DB8A 5CEQA 3KVWA 4EH2A 5I4NA 3PUPA 5L3AA 3TUDA 3RGFA 3ORPA 5ACKA 4PY1A 2BAQA 3LMGA 4F1OA 4JJRA 1MQBA 4Q9SA 3BLRA 3QHWA 4IIRA 4KIPA 3ZDUA 2LGCA 2PY3A 3II5A 3DTWA 3QD0A 4FL2A 2I7QA 4HGTA 4NL0A 3DAJA 4MXZA 4APPA 4E4LA 1ZY5A 2JEDA 2BTSA 3CPBA 3CY2A 5IKWA 2Q0BA 5CSHA 3RCDA 4Y72A 4AZVA 4GUEA 4EOOA 3UNKA 2F9GA 5IU2A 2WHBA 5M4UA 2UW7A 2WTCA 4XG7A 4YGAA 2XK3A 3DCVA 4BR3A 1U54A 4FBXA 2J6MA 4XG6A 4EK6A 3OT8A 3PA4A 2W1HA 3DBEA 3QC4A 1YWVA 3PWDA 4YPDA 4AN9A 4ASDA 4F1MA 2FH9A 2WMTA 4DGMA 5AR8A 3EH9A 1GZ8A 5L2WA 3FKNA 4BZNA 4O7NA 4FEQA 4ITHA 5EKOA 5D12A 3SX9A 3TUBA 3L8PA 5C03A 2OGVA 4L00A 5ANKA 5HESA 3LFCA 4M66A 4RWLA 2GNLA 2ZJWA 4IC7A 4YTIA 5CAVA 3B8RA 1H28A 3JVSA 3MPAA 4G3EA 1PKGA 4BI0A 4RA5A 5KMJA 3P5KA 2R0IA 5BUIA 5CLPA 1DS5A 5CVFA 4TKSA 3DDPA 5CSXA 3V5TA 2XIXA 4YURA 4O7RA 4JBQA 3BX5A 4CFVA 4IFCA 4O81A 3W2QA 4RX8A 3V5LA 5CZIA 4GSBA 3TJCA 1IG1A 3GQIA 4UALA 5M57A 1B38A 2FO0A 3NUNA 4QPMA 5DBXA 4ALUA 4CMTA 3DQXA 4WOVA 4CSVA 4EHVA 4O91A 3FZTA 4O83A 2GQRA 3AMAA 3DDQA 4DTAA 4AF3A 5JQ8A 2W1GA 1JAMA 5ETFA 4OTRA 4B9DA 4C35A 3KC3A 3NDMA 4IDVA 3FI2A 5IH5A 3UOKA 1WVYA 2R7IA 4O22A 5AJQA 5JFSA 3FLWA 3HV5A 3ORXA 4RC4A 4F9WA 3F88A 1Q99A 3DY7A 4LL0A 5DT4A 2YWPA 2OO8X 4EQUA 2QURA 3AD4A 2P3GX 1XO2B 4E5AX 4RIOA 4CLJA 2EUFB 4IDTA 1H07A 1YDTE 4O21A 4QQCA 4TXCA 1YQJA 3TM0A 1SYKA 5K9IA 5K0KA 3N4VA 3PJ8A 5IQDA 3SOCA 4Z55A 1WCCA 2I0VA 4FT3A 4IX3A 5C8MA 3GCVA 4C4IA 4DEGA 5M06A 4O7SA 2W5AA 3PPKA 5EYDA 3AC3A 5KUPA 4P90A 4W4YA 5HEZA 3LE6A 3CKXA 3ROCA 3UMWA 1K9AA 5CXHA 4FICA 2YFXA 4KIQA 4GFOA 4MXCA 4RZWA 4Y5HA 2J0MB 4ITJA 3RAHA 2HY81 3ZO4A 2XIZA 4MNEA 4BZOA 2C30A 2JAMA 1UNGA 4YHTA 2CNVA 2P2IA 2G01A 2YCRA 2G15A 3QUDA 3L8SA 2WNTA 3O7LB 3TNIA 5IQGA 4ZSEA 3LCOA 3VF8A 3EQDA 4AG8A 3S0OA 1XHAA 4F70A 3U6IA 2PVLA 3L9LA 2IZRA 4L9IA 3R9OA 2R7BA 5HIBA 3FMNA 3QX4A 5CT0A 2OXYA 3U4WA 3D83A 4CZYB 2W4JA 3W8LA 4JIKA 4KS8A 2ERKA 2F2CB 1WBWA 4XOYA 3T9IA 3HMNA 4M13A 3RAKA 3VUGA 5F9EA 5C8NA 5GZAA 5FUTA 4HOKA 2Q0NA 3QCXA 2YIRA 4G2FA 2UW4A 4LRKA 5E1EA 2ZM1A 5HU3A 3OWPA 2UUEA 2OZAA 5DRDA 3OEFX 4QP6A 4C61A 4O2ZA 1Y8YA 4QMSA 4D58A 5IG1A 4NKAA 3SA0A 4U7ZA 1BL7A 2BIKB 4O7VA 3C5UA 4LGGA 2YHVA 4BCJA 3VHKA 1JPAA 3S3IA 3A60A 5FQDC 4OTDA 4X2GA 3QZHA 4YNOA 2OIBA 2HZNA 3LQ5A 4AWIA 2WOUA 2OJGA 3HA8A 5CENA 2PMLX 1PXMA 2ZV9A 4AFJA 4BCOA 4H1MA 1H1PA 4KIKB 2P33A 2IWIA 2UZWE 4F7NA 4QYFA 3ZFMA 4FVRA 4Q5EA 4D2TA 4FSMA 2X9FA 3GCPA 3P0MA 3NVMB 4XS2A 4E8AA 5M4CA 5L2SA 4FKIA 3EIDA 4CKRA 3HP5A 4C02A 3D5VA 4F9YA 4Y83A 2YJSA 3ZUTA 1YI3A 5EM8A 2J5EA 3F7ZA 3NSZA 4GIIA 5BVEA 4C38A 4QTEA 4LI5A 4FSTA 4FSRA 5TOZA 1QPCA 3Q52A 4FV2A 5AUTA 1OVEA 2BCJA 2FYSA 3QWJA 5LQFA 5HHWA 1G5SA 2YM5A 5LVMA 3H4JA 3ZS5A 1FINA 4MYGA 4RFMA 5IMEA 3MPMA 3OS3A 4QTDA 3OWJA 4DEDA 4ZSGA 4M7IA 1DAWA 3VQUA 2AC5A 2XNBA 4KAOA 4F64A 4FTUA 5IQFA 3IW8A 3UO6A 2EXEA 1UVRA 4IADA 3H10A 4YC3A 4EYJA 2X81A 4ZXTA 4TL0A 2Z7LA 3VRZA 3CQUA 1XKKA 2PE2A 4D2VA 2UZBA 5GHVA 2FSMX 5HIDA 3V01A 2YACA 4DITA 5IDPA 4X0MA 5HBEA 3NVKI 2B1PA 2WMWA 4IBMA 4MXXA 3PZEA 3R9DA 5CEMA 5K4IA 4FIJA 5L8LA 5DMZA 3P78A 4JS8A 2PYWA 1J91A 4WA9A 2C5NA 5AV3A 2PTKA 1YVJA 2W1IA 3FMMA 4QMYA 3TV4A 5CASA 2VX1A 1OBGA 2VTIA 2CGUA 2WZJA 3RI1A 2X4ZA 1XWSA 1ZOHA 2JIVA 3VUIA 1UWJA 5HVYA 2GNHA 5AR4A 4IM3A 4ZS4A 4CNHA 4ZP5A 4IAKA 3UZPA 4S32A 1Z5MA 1H1QA 2YDJA 4A9RA 5IH4A 4JG6A 2O64A 2ZMDA 4FSZA 5DFPA 4ZZOA 3F2AA 4NYEA 4UBAA 2ZB1A 2UW5A 4ZEGA 5DG5A 1Q8UA 1PXIA 3VS3A 1H26A 5JQ5A 3LHJA 1URCA 1XH9A 4DTKA 1XBCA 3P7BA 2Z7QA 5KE0A 4ZIMA 4XLIA 1BI8A 1YWNA 4BCQA 4OTGA 1URWA 2VTOA 3F5UA 4ANNA 5KMKA 4BZDA 1G8AA 3Q4UA 1H1WA 3R2YA 3CY3A 4FSWA 1YWRA 4S2ZA 4EOMA 3RCJA 4EKKA 1YXUA 3WIKA 2QNJA 3JYAA 5H8BA 5AP2A 4FNZA 4ACGA 4UXQA 2IW6A 4QP2A 4ZTQA 2OSCA 3ZLXA 3K2LA 5E7RA 4ALWA 4GKIA 4XX9A 3Q4ZA 3V3VA 4FTCA 2ITUA 4PMMA 4H39A 3EKKA 3PSDA 3BHYA 4WG5A 2CLQA 4AW1A 4FTNA 3PY3A 2WEIA 4EZ5A 1PXOA 3HMOA 4NIFB 4QMTA 5M4IA 4K0YA 1UA2A 5G1XA 4CKIA 4BYJA 4BL1A 3G6GA 5E4HA 1UKIA 3VS0A 1J1CA 3MIAA 3F82A 4FT0A 4JX3A 3VS2A 3KFAA 3DTCA 1IA9A 4UZDA 5J9LA 5HBJA 4DT8A 4DGGA 4AOTA 4FIIA 3NUUA 5ANJA 2CGVA 3BGPA 3QKLA 4MXYA 2GPHA 3D5XA 4CV8A 3E8EA 3Q5ZA 4FTOA 4MQ2A 2G2HA 2V7AA 2X7GA 4I21A 4PQNA 4QMOA 5BVKA 4GFMA 3RMFA 3NNUA 4WUAA 2NP8A 4F63A 3PXKA 4AOJA 2VNWA 4H58A 3H3CA 5BVWA 3HGKA 4AU8A 4D9TA 4TNDA 3WF7A 4ZZNA 5CAPA 4QMQA 1A48A 2QOHA 4DEAA 5ANGA 3LFNA 3B2WA 3LFFA 5JN2A 4XG3A 4M68A 5CF6A 4EQMA 4V04A 4KUJA 5H3QA 4C3RA 2PHKA 4FIEA 1MRYA 3OROA 2YISA 4EOIA 3D4QA 4CCUA 3MA3A 2VTSA 3RKBA 3LAUA 1YDSE 2XYUA 3JVRA 4GS6A 5FEDA 3S95A 4CYIA 3BI6A 3HRCA 5CQUA 4YZBA 4EBWA 1FVRA 4FSYA 1U54B 4KS7A 3MY1A 4EEVA 2BZKB 3HMPA 4QTAA 3G6HA 2XEZA 3ZBFA 4ZZMA 4IVCA 3F61A 3LCSA 5A54A 3NUAA 1OBDA 1F0QA 2B9JA 3IGOA 3QD2B 4FA2A 4BI2A 3BV3A 3HZTA 3E93A 4FIGA 3A7IA 4PF4A 2PWLA 2XB7A 3HRBA 4I3ZA 3UIXA 3F9NA 4HNFA 4F7JA 3HMIA 2ZDUA 3A61A 3PPZA 3VUTA 2ZMCA 4BDGA 2J90A 5DEYA 2VTQA 4R8QA 3W32A 4FEUA 4ZOGA 5ANIA 2J51A 2SRCA 2WQMA 4AN3A 5HIEA 4K33A 1ND4A 3AGLA 3R01A 2OU7A 3Q96A 4J1RA 4PDYA 3I0QA 5LXMA 3GC8A 4FV5A 2Y4IB 2V7OA 4CFUA 3BGZA 2V22A 5HVJA 3P23A 3QCYA 4J52A 4JDIA 3RZFA 1SNXA 4EZ3A 5DGZA 2BR1A 3KMUA 4AXAA 4APCA 4XYFA 4BBFA 5HLWA 4DFUA 4BCGA 4YLJA 4XOZA 4ASXA 2H34A 4CMOA 4KIOA 5CX9A 4O7TA 5JRSA 3IS5A 4UYNA 3CXWA 4A4LA 5KKRC 1H4LA 4A9TA 2R3GA 1TVOA 1S9IA 2UZTA 4E4XA 4K9YA 4ZTLA 2UZUE 4YJNA 4IAFA 3DJ7A 3E8CA 3G0EA 5DT0A 3TV7A 5EK7A 2OZAB 3HNGA 3Q9XA 3ZBXA 3UOJA 4AGWA 4R1VA 4OGRA 4Z7GA 3ODZX 4AZFA 4DC2A 3ITZA 4ZLZA 4FEWA 1NY3A 3KF4A 3MSSA 3QUEA 4E6CA 3ORLA 4YZ9A 3G51A 3UO4A 2XIKA 4PV0A 4U3YA 5I9ZA 1JWHA 3FPQA 2BRNA 4P2KA 3QL8A 2W05A 5CTPA 3F7WA 2YZLA 4O0WA 2NPQA 3CJGA 4UWBA 3RAIA 4D28A 2ZM4A 4BN1A 5K5NA 2WFYA 1H0VA 1KV2A 3PVWA 2B52A 4IH8A 2R64A 4RPVA 1UU9A 4MXOA 3CSVA 3LCKA 5DA3A 3DU8A 2BFXA 4I1ZA 1VJYA 2XP2A 3MA6A 5EHLA 4CG9A 2VV9A 5FDXA 3O8TA 4KNBA 4WNMA 1ZYSA 4DEIA 2X7FA 2VO7A 3OWLA 5AA9A 5KMIA 3EFKA 3B2TA 3EQRA 2O65A 1YOMA 3BHVA 5FDPA 4DEEA 3SLSA 3HA6A 3FYJX 3IKAA 3PPJA 5HICA 4XJ0A 2W1FA 4EZ7A 3GENA 4F6SA 3HV3A 4HW7A 2C6LA 2RIOA 4X3JA 3Q3BA 5TE0A 4DA5A 2WXVA 1JSTA 2CNUA 1VEBA 1MRUA 2HK5A 3NYOA 4O38A 4TWPA 5DR6A 4BWPA 3FMEA 4FIHA 5CS6A 3FYKX 2W5HA 4RIYA 4G34A 3VS4A 3UDBA 1ZMUA 1H0WA 4NUSA 2PZIA 3WIGA 2BZHB 2J0KA 3PSBA 5J1VA 2RL5A 1FQ1B 4EONA 4DT9A 4DFYA 4K18A 2QR7A 4I4EA 1M17A 2R3LA 2IJMA 3QTQA 3FPMA 4EHGA 1P4OA 2PSQA 2QHMA 1Y6AA 2QO9A 2R3KA 5EYCA 3SAYA 3HVCA 4YBKA 4KBAA 1Q61A 3WZDA 1ZYDA 3QX2A 1WAKA 2RGPA 4TYEA 3W2SA 4Z3VA 5I9YA 3F3UA 4Y95A 5C4LA 3P7AA 4AFEA 4USDA 4MXAA 2BDWA 3WF6A 3LIJA 3QZIA 4GU6A 4XRLA 3SGCA 1ZOGA 3SHEA 2W1CA 4TZRA 4GJ2A 3HYHA 2GHMA 3FL4A 4FTAA 2ITQA 2C6EA 3W33A 2IVSA 2RFSA 3BWFA 3MBLA 4D4VA 5ACBC 2UZLA 1KWPA 2YABA 5JH6A 4IX6A 3EJ1A 1U46A 4WIHA 4CYJA 3HKOA 4G3CA 4O0VA 3BKBA 1BYGA 5HG8A 5LVLA 1KE8A 2F57A 3R1NA 3ZLWA 2OF4A 2OI4X 4RMZA 2W4OA 4HVSA 4D2WA 3C4CA 3OCBA 3VRYA 3FDNA 4NT4A 5FD2A 5B2LA 4G3GA 1B6CB 3LFSA 1J7LA 1GJOA 2BPMA 4J95A 5BYLA 2OFVA 1UKHA 2Z02A 3COMA 4IX4A 3QCSA 5BYYA 2E9PA 3ENHA 3NGAA 4GEOA 3RK9A 1WBSA 2ZOQA 4KWPA 4HVGA 5AV4A 3UO5A 4FE2A 2GHLA 2C3KA 3IDBA 3QAME 2YIQA 2QVSE 4JBOA 5FG8A 2F4JA 5BQ0A 3KRJA 4BI1A 2EXMA 3C50A 5L2TA 4Q2AA 4I0TA 4OTWA 4F9AA 3EQGA 3Q5IA 3RVGA 5IQEA 2VWIA 4AZTA 2X0GA 2VTNA 3P9JA 4FT7A 4XV2A 4W9XA 5HCYA 5A4EA 1OL1A 3FXZA 3LXKA 2VWXA 3EN4A 3DBCA 4BVUA 1O9UA 4J96A 3DFAA 4TWCA 5AAEA 2CGWA 2X2MA 2R3PA 3HDNA 4P5QA 4WG4A 3HECA 4QO9A 2AYPA 3UJGA 4TYIA 2XJ1A 2BKZA 3U8WA 4ZSJA 3CCNA 2XJ2A 3C5IA 3ALNA 4J8MA 3MFRA 1M2PA 3QTIA 4QP4A 2HELA 3TACA 3OUKA 4YHJA 5IZFA 4AX8A 3LXLA 1PMNA 1ZMVA 4EOSA 1FVVA 4L6QA 4G3DA 4DFXE 3R71A 4FTMA 4W9WA 3A4OX 1QMZA 2HWPA 4GVJA 4BCMA 1PKDA 3BYOA 4O7WA 5E8UA 3NMUF 4HYSA 2C0IA 4BCNA 4MBLA 2W96B 3R02A
chains in the Genus database with same CATH superfamily
4R6VA 2Y4IC 4BJJB 4FKTA 2YIXA 4QMPA 4C33A 2E9OA 3FLZA 1PHKA 2QQ7A 2JKOA 3MVMA 1Y8GA 2XM9A 4FV6A 4L8MA 5AUYA 4RJ3A 3TG1A 4C34A 1G8JA 4OTIA 4Y73A 2OLCA 4ZSAA 2AC3A 2PZ5A 2WD1A 2YA9A 3OC1A 5A14A 3O8PA 2CGXA 4DN5A 1R0EA 2FVDA 4ORKA 2P2HA 2DQ7X 3I79A 5ETAA 3FZPA 4BDIA 2NO3A 4QDVA 3BLQA 3OG7A 2VTHA 1W7HA 2QOBA 3EWHA 1FOTA 3R7VA 2NYAA 5CEPA 1OIYA 2YCFA 4EH3A 4FT9A 2YM8A 2W1DA 4JQEA 3TTIA 4AUAA 1ZYLA 1MUOA 3NPCA 2UW8A 5J5TA 3C4FA 1OKZA 1OL5A 5JGBA 4M8TA 4B8LA 2YCQA 3MS9A 2UW0A 4D5HA 4EK4A 5IA1A 4FOCA 2R3NA 5B2MA 4RIXB 3Q6UA 4FC0A 5AMNA 2YM7A 1UNHA 5BUEA 2PZRA 4NWMA 4FL3A 3R30A 5AR7A 5E8YA 3GI3A 1ZAOA 3O50A 3MJ1A 2PVRA 4JQ7A 3GOKA 1JNKA 3G9NA 3LZBA 5J7HA 4YHFA 4OBPA 5L8KA 5D7AA 5I3OA 2VO0A 3LLAA 5A3XA 3AC2A 3WZKA 1UU3A 1P14A 3F3VA 3VBQA 4DH8A 2LAVA 4AT3A 4UX9A 2XS0A 4EWQA 4RJ5A 2OIDA 4I4FA 2RFDA 4L43A 4RFYA 3FZSA 4ZTRA 4BF2A 2G1TA 1KV1A 2CKOA 4LV8A 4QP9A 2W4KA 2GNJA 1SMHA 2YM4A 2IW9A 4ASZA 3S00A 4LM5A 1JSVA 4O0SA 3QRTA 2Y6OA 4BFMA 1IRKA 4ERKA 3DXQA 4WHZA 3NW6A 4FTLA 2V0DA 3MH1A 1WFCA 3OTUA 4JG7A 4O0RA 5IUIA 5BYZA 3W1FA 3NYNA 3VJOA 4M84A 2UVYA 4YJUA 3QQHA 4U3ZA 1ZYJA 4AW2A 3RHKA 4CFWA 2JD5A 2O8YA 4FV8A 3SQQA 4UV0A 1ST4A 3DV3A 3GQLA 2CKEA 3EQIA 2XNGA 4TYHB 4ONAA 4GV1A 3ZMMA 2WQOA 2XRWA 4BIBA 4TN6A 3JPVA 4BWXA 5IQCA 3GGFA 3T8OA 5DRBA 3G0FA 5EOLA 5EH0A 4E6DA 3PLAE 2QG7A 4I5PA 3TZ7A 4MF1A 3NCGA 3HAMA 5HTIA 4YLLA 5GINE 4JLCA 2PUNA 5KMMA 3KREA 4AZEA 4G6LA 3R83A 4DYMA 4IACA 3CQEA 5AP4A 4AGDA 5DT3A 5IA3A 2Y8OA 4EJ7A 5CZHA 3HUCA 2PVHA 4QTBA 3KVXA 5I9UA 4E26A 4DDGA 4ZMEA 2CCHA 3MVHA 2XKDA 2HWOA 3QCQA 4LUDA 3QD3A 2JFMA 1R0PA 4O4EA 2ACXA 4KKHA 3UODA 3ZFYA 1WVXA 4CZTA 3REPA 4RQKA 1UU8A 4D5KA 4DDIA 2WO6A 3BYVA 4XV9A 1WZYA 3VF9A 5T3QA 2BAKA 4MAOA 3PIZA 3GBZA 1P5EA 4K1BA 1FVTA 3TV6A 3UIMA 3SXRA 2XYNA 4USFA 4O0XA 5JRQA 4FKWA 4CXAA 3VW6A 3OF0A 4DH7A 1MQ4A 4JBVA 5DEWA 2BIYA 1UU7A 3MW1A 3QQLA 1ZLTA 3KF7A 5I5ZA 5IDNA 4FZ7A 2PZPA 3PZHA 1HOWA 2B0QA 2IN6A 3I6UA 4I0RA 1E9HA 4E7WA 5KX8A 2RF9A 3BE9A 1QCFA 4RIWA 2ONLA 2VTAA 4ID7A 4M12A 3VC4A 3DGKA 3LJ0A 3VVHA 3FV8A 3ZLSA 5LMBA 4JAJA 2XZSA 4RRVA 3ENMA 3NR9A 4UYAA 2JKMA 4IM2A 4CMUA 4W4WA 3I60A 4BKJA 3R73A 4ZTHA 3LKMA 3GP0A 4YO6A 4I23A 5HU9A 3SG9A 4O2PA 4II5A 2C6DA 5JFWA 4HNIA 3FQSA 4D2PA 5IA0A 3ID6C 2JDSA 2WU7A 1TQMA 2PVJA 3KRWA 3LOKA 3OOMA 3MVLA 1HCLA 4ENXA 2ITZA 4U80A 3AMYA 3D15A 3V04A 4E6QA 5E91A 3IOKA 3NFGB 4OT5A 1YHSA 3LFDA 3QTRA 3SOAA 2YAKA 3VJNA 3QA0A 4JL9A 4A7CA 3QTSA 4HCUA 4MEDA 4XV3A 3FSFA 4YZNA 4CLIA 5TO8A 1M7QA 1IA8A 1GIHA 3VUHA 3GNIB 1SNUA 3I1AA 4NIFA 2C6IA 4J7BA 2XF0A 2XK4A 3EFWA 4QNAA 4WUNA 5CI7A 3SRVB 4EOJA 4TTHB 3RHXA 3LMHA 4U42A 2Z60A 3FXWA 5HNIX 1GOLA 3MFSA 3V6SA 3WZJA 5EKNA 5DI1A 1OL2A 3T3VA 2PULA 2EB3A 3A7FA 3RNYA 3H9RA 4R7BA 3KY2A 5CF5A 1OB3A 4YO4A 3UPZA 2E2BA 3R8VA 4ANBA 2GQSA 2QOIA 3VUKA 3U6HA 4BICA 3D5WA 3GCSA 3PWYA 4UWCA 4ZJIA 2UZEA 3LW0A 2PK9A 5HGIA 4K2RA 5EDRA 2XNOA 3CTJA 4B8MA 4QNYA 2GHGA 4E5BA 4DLJA 3ELJA 5HE3A 2WMXA 3QRJA 5EYKA 3K3JA 3R2BA 4FG9A 5LMKA 3IDCA 4MH7A 5M4FA 1M2RA 3L9PA 5HKMA 3DBFA 5CAOA 3VULA 3TDVA 2WMUA 5FGKA 4YTFA 4DHFA 3PRFA 3ZFXA 2Y0AA 3MV5A 3FLSA 3U9NA 2J50A 3QTXA 4FODA 4WSYA 2YLFA 2O0UA 4GYGA 2BRGA 5BVNA 4EORA 2WELA 3CBLA 3R28A 4RGJA 1YDRE 1YW2A 2QLQA 1FMKA 3A4PA 1NA7A 3P1AA 4HCTA 3ZHPC 3EYHA 2XNNA 4M97A 5JKGA 3PJ3A 4BDHA 1KE7A 1QPJA 2ZM3A 4BKYA 1VYZA 3FC2A 4PTGA 1S9JA 3KMWA 3UDSA 5L6WL 3UVPA 4GT5A 3QFVA 3ZO3A 3ZZWA 4FV4A 4FKPA 4RIXA 4ZLYA 3A7HA 2B54A 3FMKA 3FI3A 4KRCA 5IMXA 3A62A 1YOLA 3GB2A 2WQBA 2XBJA 3EN5A 1TFFA 4DAWA 3RJCA 3T3UA 4XG4A 2GMXA 3ERKA 5DLSA 3EZRA 5IF1A 2X6EA 3U6JA 2HZ0A 2VWUA 3M42A 4AT4A 2EU9A 4ANLA 3OW3A 4WO5A 4IJPA 2OJIA 4C37A 3C13A 4XNEA 2VGOA 3G5DA 3W0QA 3KULA 2XCHA 4ASEA 1OL6A 1I09A 3ZXZA 4DLIA 1PMUA 1PW2A 4JNWA 2GNGA 3IQ7A 3LXNA 5HNBA 3R9RA 2Y7JA 4GK2A 4ZAUA 2ITOA 3CD3A 3MYGA 2C1BA 3O17A 2C6KA 4HYUA 1BL6A 4NKSA 3TIYA 1EH4A 3TEIA 3ZOSA 4JIAA 5LWNA 4FV1A 4GG5A 1Z57A 1CSNA 3POOA 3QRKA 4U0IA 1GNGA 2J2IB 3H9FA 4LGHA 3ZUUA 4X2KA 5GNKA 3E7VA 1OUYA 5CANA 5EW9A 1NVQA 3LPBA 4QMVA 4IM0A 4YJVA 3UP2A 3W2CA 4NFMA 4TYJA 2PU8A 3DOGA 4GT3A 1TKIA 3E3PA 3HEGA 3OW4A 4HGLA 4NU1A 3MIYA 1ZZLA 5CU6A 2W0JA 5EHOA 3KA0A 3PXZA 3BWJA 3E88A 3RWQA 2GNFA 3TXOA 3SXSA 3FKLA 1P4FA 3NEWA 4IVAA 5HQ0A 3KRLA 4S33A 1RDQE 3DK6A 4JRNA 4JRVA 3ZO1A 5EQYA 5J9ZA 4PMPA 1OMWA 2CPKE 5BPYA 5FXRA 1XH5A 4TPTA 4IB5A 1Y91A 2KULA 2OH4A 4MWIA 3SDJA 4L7SA 4L52A 4YU2A 5HORA 3RZBA 3NYVA 4OT6A 1RW8A 1H1SA 3DKOA 3O23A 3KKVA 4L67A 4B99A 4CZUA 1MRVA 1ERKA 3PY0A 3V51A 4L53A 4F99A 4O6EA 2X2KA 3L9MA 4E4MA 4CG8A 3V8TA 4DCAA 1GY3A 1H25A 2VNYA 2Y6MA 3NRMA 5TR6A 5M56A 2VX0A 2ERZE 3V5PA 1OPKA 4D2RA 4GMYA 5ETCA 5KZ0A 1LEZA 3PVGA 1SVEA 5KO1A 1QPDA 4DH5A 4LV5A 3VBWA 4OBOA 5I0BA 1ZMWA 4MF0A 4ACHA 1V0OA 2VD5A 3C4ZA 1FPUA 1OPJA 4L46A 4J98A 4X6RA 4XBRA 5AP1A 3IPHA 4DCEA 4KKGA 2VAGA 4QMZA 3KN6A 1ZRZA 4NTTA 4FMQA 1OL7A 2UW3A 3OUNB 2VO3A 3TCPA 3ACJA 4WNOA 3FXXA 2RG5A 2XK7A 3OCGA 5HCXA 4DGLC 3MH0A 5GJGA 4FZFB 4RJ4A 4I6LA 5DVRA 3F3WA 5IEYA 5AV0A 1CKIA 4X2FA 3JXWA 5HE2A 4F09A 3NIEA 2XA4A 5E90A 4S31A 4M14A 4GIHA 3ALOA 5CF4A 4FG7A 2BUJA 2JAVA 3PDTA 1V0PA 5AP3A 4EH5A 3LMIA 3NUXA 4GKHA 4FI1A 1B39A 1YHVA 4OR5A 1U59A 3C4WA 3UIBA 4YP8A 1YXTA 3UPXA 2YITA 4TT7A 3EFJA 1W84A 3ORZA 5E8TA 5CSWA 2ITNA 2GQGA 1Z9XA 4HVDA 2FGIA 4QMWA 3OXIA 1OITA 3R63A 2R3RA 3NNWA 4QOXA 4JDJA 2AUHA 4QD6A 2X39A 3QQJA 3ANRA 3R1QA 1OI9A 4O0YA 3DAKA 5BNJA 4WSQA 2J0LA 3CGFA 2WTKB 4CKJA 2VWYA 4LG4A 3QTZA 4OTPA 1XH8A 4Y85A 4U8ZA 5AIRA 4MKCA 5B7VA 5DYJA 5E9EA 4J8NA 5KHWA 3DKGA 4J99A 3VBYA 3V5WA 5IA4A 3FY2A 1XJDA 5K4JA 4I20A 3POZA 1BMKA 3TZ9A 3WBLA 4ZJVA 2YDKA 4QMXA 4KIKA 4QQJA 4U40A 5L6PA 2W99B 4DGOA 3W18A 2CMWA 3BLHA 3FLYA 5K0XA 4BBMA 2NRUA 4FYNA 1KUTA 5CU4A 4DF3A 3CE3A 5I3RA 2PMOX 1H8FA 3AT3A 3P4KA 3AT4A 5H9BA 4MQ1A 3WOWA 3DB6A 3NCZA 4E4NA 4G3FA 3W10A 3LFBA 2CLXA 4TYHA 3O7LD 1JKSA 5CU3A 2E9UA 3ZM4A 5CWZA 5HTBA 3KMMA 3K5VA 1OM1A 1WBOA 3GC0A 3GCQA 4G5JA 5A4LA 4YJPA 4R3RA 3GFWA 4EH6A 4QYYA 2ZB0A 4F9CA 2NNWB 2R0UA 3V8WA 4R78A 2ZVAA 3SXFA 3WE4A 4O7YA 1T46A 5HZNA 3S1HA 2F7EE 3E87A 2CJMA 2R3OA 2RG6A 3PP0A 4RWJA 4FGRA 4BTMA 5K3YA 3DK3A 1NXKA 2FB8A 3DPKA 4OW8A 5LOHA 5M53A 5IISA 2QU5A 4BDAA 2WTJA 1STCE 2EB2A 1TQPA 2HAKA 3ZH8A 3PP1A 5K5XA 3VQHA 1BLXA 4JDHA 5DR9A 4RG0A 4GK3A 5A6OA 2R2PA 1IEPA 4UMUA 5F95A 4H05A 5M09A 3CD8A 2XNPA 2XMYA 3Q2MA 1U5RA 2JIUA 4I92A 3PYYA 5EG3A 4UEUA 4GVAA 3D9VA 3I7BA 2F7ZE 2XRUA 4O4BB 4NEUA 1LPUA 5AP7A 4AS0A 4IAYA 4EUUA 5EM5A 2H8HA 4FKOA 5J9YA 3N51A 2PUIA 5KNJA 4GG7A 4FZ6A 3RM7A 2WKMA 3G9LX 3TZMA 3KXZA 5FP5A 3AMBA 4ALVA 5CF8A 3MESA 3BPRA 3LXPA 4LFIA 3HX4A 4BTKA 3DNEA 3BU6A 4EWHA 4EH9A 5JGAA 2H96A 3GCUA 1JKLA 3QYWA 3RBWA 3WF9A 2YIWA 2W9FB 2YAAA 1K3AA 3C51A 3ZSGA 4B6LA 3ZM9A 4BCFA 2PMIA 3D7ZA 1XQZA 4MNFA 2F7XE 3I5ZA 1IR3A 4EQCA 1GAGA 2YLEA 3AD6A 2HIWA 2ITTA 3KXMA 4I24A 1NT2A 4M69A 2R9SA 2I40A 4OTFA 2C47A 5D7VA 4BDEA 3TJDA 1ZXEA 2ZFYA 1JKTA 3UDZA 2CKQA 3BEGA 4YC8A 4TNBA 2XAMA 3PY1A 3UMXA 1LUFA 4H1JA 3PXQA 3UVQA 3TUCA 3JR1A 1KE5A 4QQ5A 3KULB 3I6WA 4CQGA 3RP9A 1PXKA 5EOBA 3I5NA 4NTSA 3F6XA 4YTHA 2IW8A 3ZZEA 2BRMA 4ANSA 1OIUA 3OHTA 5J1WA 3ZUVA 3MTLA 3ZC5A 1PMVA 3ORKA 4R1YA 4A9SA 2BHHA 2PZYA 4QRCA 3COHA 3PIXA 4PNIA 3M2WA 1Q97A 2G9XA 5HI2A 5HE1A 2C6OA 2XUUA 4Z9LA 5HLNA 1U4DA 4QT1A 4C3FA 2ITVA 5AM7A 4U81A 4R3CA 4UMTA 3R9HA 3EL7A 2F49A 4MBJA 4FTJA 5JZJA 3QUPA 4IZYA 3WZEA 3QLGA 4DG2E 2VTMA 3MTFA 3RINA 2BZJA 3BV2A 4CQEA 1FBNA 3WARA 5CNOA 2AQXA 4UMQA 4JX7A 4QP7A 5KCVA 2GTNA 1OZ1A 3PJ2A 2R3JA 5AEPA 1SVGA 4RQVA 2QD9A 3M11A 3RM6A 3ZRMA 1V0BA 4E5WA 3CP9A 3I0OA 5IEVA 3GUBA 3DA6A 3ZONA 5AM6A 2WEVA 2JKKA 3SV0A 5J7BA 2VWVA 4X21A 3ET7A 4MWHA 4CVAA 3ZEPA 3BL7A 3W16A 1ZARA 5F1ZA 5FXQA 5AAGA 2ESMA 3QQUA 4KBCA 4NJ3A 4O27B 4BDFA 4L42A 5JK3A 3G15A 4ZY4A 5EHYA 5KZIA 2PMNX 3WE8A 4RJ6A 4GJ3A 4LOQA 4ZJJA 1XBAA 2HZIA 4WG3A 2VZ6A 3NNVA 3QHRA 5E8VA 3EB0A 3LJ2A 4JBPA 5A9UA 2BROA 1VR2A 2FSLX 4M3QA 2X6DA 4LOPA 1ZY4A 4RZVA 5HX8A 3BE2A 4YZDA 3BU3A 4AN2A 1Q5KA 5L2QA 4PX6A 4AE9A 4HGSA 3R04A 2Y9QA 4YZMA 3MH3A 2XH5A 3FBVA 2UVXA 4CFXA 4GUBA 2X0PA 2BALA 3OXTA 1ZZ2A 3RPYA 2OWBA 4I5HA 5IH6A 2BFYA 3ZSHA 5DWRA 4HZRA 4R77A 3QTWA 1WVWA 4IX5A 2PUPA 3B8QA 4N6YA 3MFUA 3SD0A 5CU0A 5GIPE 3FC1X 2FUMA 2ZDTA 3GC7A 3Q4TA 4AE6A 4N57A 3I81A 3QKKA 3F5GA 4W8EA 4ZSLA 1BX6A 3A8XA 4LRJA 3V5JA 2A19B 2ITXA 3EKNA 4AA5A 5GZ8A 5KMNA 3FZ1A 3KL8A 3PG3A 3MGYA 2W9ZB 3QGWA 4IC8A 4G6NA 3QXOA 4FKRA 4BB4A 2I0EA 3EN6A 3EQHA 3LJ1A 4HPTE 4XHKB 5FEQA 5HOAA 4A07A 2XANA 4NZWB 2W7XA 3AC1A 3D2IA 4NSTA 1J3HA 3PA3A 2I1MA 3JY0A 1PYEA 4GRBA 1REKA 1W82A 1ZWSA 3N9XA 4FTQA 3Q53A 4S34A 2JFLA 4HJOA 4KINA 4G6OA 3DJ6A 5B0XA 3ZU7A 4WRSA 4ARKA 3QQKA 5I9WA 1RQQA 4FTTA 5IUHA 4IFGA 4PTEA 4U44A 2B4SB 2IVTA 4D2SA 4BWKA 4I5MA 2XIRA 4NJDA 5HD4A 3GU7A 1CTPE 4JI9A 5AX9A 5AADA 1F5QA 3HL7A 4FYOA 2YCSA 3R7EA 4WNPA 4FUYA 5TT7A 3UG1A 4BC6A 4DGNA 2AEGA 2G2IA 4M69B 3ATSA 1RJBA 4FX3A 4FTIA 4DFZE 1CKJA 2BAJA 3BLAA 2JDVA 4YMJA 2JBPA 2OJJA 4EYMA 2JGZA 5JT2A 3A99A 4FJVA 3CJFA 3KB7A 4FOBA 3K3IA 3TI1A 5FTOA 1CKPA 4BGGA 1W2CA 3R8ZA 3WZUA 1PF8A 1Q3DA 4E93A 3C0GA 1M14A 4JR3A 1JLUE 1BKXA 3QF9A 5AR2A 4ACDA 3DXNA 5L8JA 1J7IA 4L45A 3UE4A 1KOBA 4FG8A 5LWMA 3TNWA 2PL0A 2W1ZA 3BHTA 3ORNA 2FA2A 2QG5A 4IHPA 4J97A 3HP2A 1R1WA 4HGEA 2Z8CA 5AUVA 3HV7A 3OCSA 3S2PA 1WBVA 4YC6A 4UMRA 2XALA 4XG8A 3F5XA 5HVKA 1OKWA 2DUVA 2H9VA 3IW7A 4BCPA 1W98A 1K2PA 4P4CA 4HCVA 3RNIA 4FV0A 2O5KA 5FTQA 3QD4A 4BHNA 2C3IB 4QMNA 3F2RA 3L1SA 3GC9A 2YWVA 2WTDA 5JEBA 3EFLA 3O2MA 4OAUC 3HV4A 4YR8A 5HO7A 2B9IA 5J79A 5E92A 5LCJA 1YXVA 3BEAA 2EWAA 3AXWA 3MY0A 4DEBA 3IOPA 5BUJA 4UY9A 1HCKA 2J9MA 3LM5A 4RVKA 4DG3E 2VN9A 4XG2A 4AGCA 5CEOA 4EOLA 4FF8A 2RKUA 2C4GA 3PVBA 5IA5A 3VS1A 2X0QA 3CPCA 5I9VA 3PSCA 1U5QA 4C57A 3UOHA 3FE3A 3VONA 4AT5A 2XAOA 1W2DA 2OF2A 4OAVB 4O4FA 3ULZA 5ETIA 4W8DA 1GIJA 4OTQA 4EUTA 2ETRA 1MP8A 2W06A 4FZAB 4YJSA 3FJQE 5DR2A 5FEEA 3U55A 3UDTA 3A7JA 1OGUA 3AKLA 4P5ZA 2Q83A 3Q4CA 3CR0A 4HZSA 4QP3A 5EW8A 3UQFA 2ETMA 2X8IA 4O0TA 4D0WA 3PG1A 3PLSA 3W2OA 4U5JA 3KCKA 2UVZA 5FM2A 2DS1A 2HY0A 2VWZA 2XJ0A 3NW7A 2GS7A 4WBBB 3F66A 5C01A 5ANDA 2A0CX 3G2FA 3ZRKA 3VIDA 4AOIA 3TDWA 2OICA 4DTBA 3QRUA 4W4XA 4BGHA 4ZTSA 2Y4PA 1LEWA 4NW5A 3TNPC 3VW8A 5F94A 4QQTA 4C7TA 2WMQA 1O6YA 4MCVA 4FVQA 4LRMA 3JS2A 4RJ7A 3VNTA 2ITWA 3E63A 4XH6A 3C1XA 4N4SA 5AP5A 1QPEA 4RVTA 1UWHA 3P79A 5AR5A 4Q9ZA 4PRJA 3TYKA 2QODA 3QGYA 4NM7A 5LVOA 4GW8A 2R3FA 1E1XA 4O0UA 5EM6A 2C5VA 4WKQA 4PDPA 3MDYA 1Y57A 3AC5A 3NAYA 4DFNA 3IGGA 3BGQA 3PFQA 1YXXA 1DI8A 2QKRA 3RAWA 4G16A 5EDQA 2PVYA 4L7FA 2VTJA 4BRXA 4BYIA 4IANA 1GIIA 4X3FC 4NCTA 4RVLA 2OJ9A 2WPAA 4HYIA 3R7GA 1KSWA 4R5YA 2XKFA 2CDZA 4FT5A 3QQGA 2IZSA 4BHZA 4KB8A 2WQNA 5HG7A 4FUXA 3DZOA 2GU8A 2I6LA 5A4QA 4QYHA 4C0TA 4CV9A 2QOLA 1YHWA 2A4LA 4EOKA 3LFQA 3Q32A 1G8KA 1WBTA 2J7TA 4WBOA 4D0XA 3IW4A 3ZTXA 3V8SA 2C6MA 4BCKA 1OKVA 3BIZA 4W4VA 1WBNA 3NZ0A 4C58A 5C26A 1T45A 4E1ZA 2C6TA 4I0SA 3ORIA 1GZNA 3ANQA 3MI9A 3VBTA 3NWWA 4GH2A 1A9UA 5AUUA 4PMSA 4ANQA 3BELA 3KN5A 5H8EA 5FXSA 2C5XA 1DAYA 4YJTA 4L01A 1YI6A 4LV7A 4EI4A 4UZHA 3PJ1A 5CU2A 4RT7A 5EQEA 3TMOA 3NAXA 4L44A 4WT6A 3FKOA 3NLBA 3R6XA 3FHRA 1NVSA 2J5FA 4OUCA 3CIKA 3OZ6A 1DM2A 2WTWA 3EQBA 3DNDA 3MN3A 1W83A 3D7TB 3E3BX 4V0GB 4BTFA 1NVRA 4CFMA 3D14A 2OZOA 4PTCA 5E8ZA 2DYLA 2BRHA 4FKSA 3GXLA 4MD8E 3WYXA 4J71A 4DHZA 3AG9A 4IWQA 4BBEA 2XNEA 3ACKA 5B2KA 4ZY5A 1F3MC 2PUUA 4BKZA 4MD7E 4RLLA 3TN8A 4U41A 2QO2A 3C4XA 4RJ8A 5FBNC 5L2IA 5AFVA 3TZ8A 2HXQA 4R7HA 3FZOA 4FKJA 5EI8A 1Q8YA 3CKWA 4IMYA 4K11A 4TYGA 5LCKA 5FM3A 4EK3A 2OXDA 4YUQA 2B9HA 4I6BA 5CI6A 1R78A 2UZDA 2X8EA 4RWIA 3VBVA 4XP0A 2QLUA 2XIYA 3F5PA 2HZ4A 4Y46A 4RSSA 5E8WA 3O71A 3ZLYA 2YIYA 4FNXA 4LUEA 4F65A 3PIYA 4RX7A 4RC3A 4BDCA 2JC6A 1KE9A 4XBUA 3A8WA 2HW6A 3NIZA 4K8AA 5DN3A 4ENYA 4RLKA 5H2UA 3TIZA 3TKIA 4IEBA 4L68A 2VWBA 3DFCB 4JAIA 3AC8A 5E8XA 4ZTNA 2OIQA 3TKUA 3RTPA 1AGWA 3CTHA 1Q8WA 3Q9YA 4Y8DA 3RPRA 3VUMA 2E9NA 1FGIA 1SVHA 2GNIA 2WAJA 3AGMA 4EOQA 4DFLA 5EI2A 2WMSA 3DT1A 4TWOA 3CC6A 4RFZA 4FEVA 2B7AA 5CEKA 2V62A 3SVVA 2O2UA 1W8CA 1JSUA 3W0RA 4R5SA 1GZKA 3FHIA 5CYIA 5A4TA 4IB1A 1YI4A 2IVVA 4AGUA 5D11A 4FEXA 4O82A 4CGAA 2ZV2A 3LLTA 3TL8A 2CSNA 4J53A 5JFVA 2BILB 4RWKA 4I22A 4DINA 3COKA 3ZYAA 3VWAA 5GIOE 4IE9A 4UMPA 3ZO2A 2WIPA 2GS2A 3WILA 3DBDA 2YEXA 1Q8ZA 2VTRA 1H08A 2O3PA 1G3NA 1OIRA 1YRPA 5CEIA 3ZEWA 4GK4A 2UW6A 4RBLA 3EQCA 3HMMA 3OCTA 2REIA 2B55A 4S30A 2R5TA 4L3LA 3GVUA 4EKLA 5F4NA 3Q9WA 1H27A 3AKJA 1YXSA 4C62A 5M44A 2A98A 2GCDA 1L3RE 3BQCA 4FL1A 4PP9A 4NCTC 4A4OA 2HENA 3COIA 1W0XC 3L8VA 2PVNA 3KQ7A 3NNXA 4XUFA 2C3LA 2VUWA 3MH2A 1Q41A 1Q62A 3QKMA 5EYMA 2R3HA 4B4LA 3OT3A 4YJQA 4QMMA 3LVPA 4LMNA 3OFMA 1PRYA 2NRYA 3VHEA 3G33A 2QO7A 3KK9A 2VU3A 4QMUA 5BMSA 3DAEA 2C68A 2X4FA 3UGCA 1OECA 2X7OA 4M0YA 4X2JA 5KMLA 4BDJA 4UN0C 3F69A 3QALE 3UZRA 3TWJA 3HDMA 4DE4A 2QOOA 4EH7A 5LVPA 2FSOX 5EI6A 5A6NA 4C59A 4PDSA 3BYSA 3C4EA 1YKRA 3MY5A 3DK7A 4ZS0A 2I0HA 4NM0A 3SKCA 5ICPA 2R3IA 2IEWA 3U54A 1PYXA 2IVUA 2CCIA 3VS6A 2VRXA 4MK0A 3AD5A 3LCTA 5FWKK 4YZCA 2HW7A 4MNEB 3E8NA 2DWBA 2J0IA 4KSQA 3NX8A 3QYZA 1JVPP 4O6LA 5CT7A 1PXNA 5CAQA 4CTCA 3ZSIA 2OXXA 3O8UA 4OBQA 2XARA 3KGAA 2OH0E 1PY5A 5D10A 3FI4A 4D1ZA 2BVAA 1IAJA 1XH6A 3UC4A 3OXZA 2JDOA 5CQWA 2QOFA 2W17A 3A2CA 5FLFA 2XNMA 4BCIA 4C3PA 3FL5A 4IAAA 3NUSA 3UYSA 2XEYA 3KXGA 4P7EA 3VS7A 4CTBA 4XCUA 3PE2A 3UQGA 4F0FA 4RVMA 3BYMA 4HVIA 4YBJA 3R9NA 3DXPA 1JQHA 1OIQA 4F9BA 5BVFA 2JBOA 3EN7A 3FQEA 2O63A 3R22A 2WOTA 2JKQA 3DQWA 4FKVA 1M52A 3RK7A 4KD1A 3S4QA 4IB0A 5FBOA 5J8IA 4FIFA 3TNHA 2VGPA 3DZQA 4TWNA 5AWMA 5L6OA 2OBJA 4LYNA 4UB7A 5T6KA 1UV5A 2BKKA 1PXLA 3KK8A 5AIKA 3OEZA 3UBDA 4FK3A 3CS9A 4Q5HA 4ANOA 3C0HA 5HNGA 3TNQB 5IA2A 3R7OA 3SW7A 1KOAA 4TY1A 1PXPA 4MBIA 2CKPA 4NK9A 3EQFA 2WMAA 2XKCA 3JY9A 3FUPA 3LQ8A 3L8XA 4PWNA 4JVGA