4EHEA

B-raf kinase domain in complex with an aminothienopyrimidine-based inhibitor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
266
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Potent and selective aminopyrimidine-based B-raf inhibitors with favorable physicochemical and pharmacokinetic properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 266
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eheA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eheA01
4FSTA 3UVQA 4UALA 3DB8A 2IG7A 3L9PA 4JOAA 2C5XA 3FZTA 4MF0A 3EYGA 1BI7A 2I0EA 1QPJA 3HV5A 3RALA 3ZSGA 4M0ZA 3RNYA 3ZZEA 3Q4UA 4DTKA 4U44A 5LARA 2Y0AA 1A06A 2PMNX 3OOGA 5AUXA 4R77A 4FV5A 4O0UA 3VUKA 5JRQA 4EC9A 4BY9E 2WQNA 3ZXZA 4TKSA 4LGDA 4ZS4A 3TDWA 4WO5A 3A60A 3LZBA 4TWCA 3EQFA 3FC1X 3I7CA 4NIFB 3W2SA 1O9UA 3KB7A 2WMAA 2OH4A 3DOGA 3PZHA 2IW8A 4CMUA 3KCFA 5HTBA 1Z5MA 3FZRA 3MY1A 4U6RA 4LL5A 5E8WA 3R1YA 2J9MA 5AR4A 3A62A 4GK4A 5AUZA 3WF6A 3R22A 4CKRA 5HIEA 1Q8UA 5M51A 1IAHA 4DINA 1FBNA 3RAIA 4RIYA 2QURA 4IZYA 5JGBA 3MGYA 5AV2A 3R8ZA 3VW8A 3KMMA 4ZY6A 1VEBA 1IAJA 5ANGA 3ROCA 4M67A 4YMJA 5C4KA 5AP4A 3GT8A 4FC0A 4FEVA 5CXHA 3ORXA 2BHHA 4AA4A 3VUGA 3ZOSA 4AT5A 4MCVA 4IFGA 4L00A 4RQKA 4I4EA 1ZZ2A 5GZAA 4MBJA 4D4SA 1TQPA 2OKRA 3R9NA 4FKVA 5FGKA 1UV5A 2X9EA 4P7EA 4EHVA 2GS7A 5L2QA 5AA9A 5FDPA 4L53A 3S3IA 5J8IA 4BC6A 2YIXA 2YCFA 2IWIA 1Q8YA 4R6VA 4WRGA 5DI1A 3DZOA 2GQRA 2YACA 4QMYA 3QKLA 2PYWA 3Q4ZA 4LOQA 3EL8A 3DK3A 3FKNA 3VS0A 1ZYJA 3TV7A 4H39A 4KSQA 4E6DA 4CCUA 1KV2A 3GC9A 4IFCA 3TUDA 4YPDA 1REJA 2CDZA 4RIXB 4AAAA 1PMNA 2VX3A 4BFMA 4CXAA 1Z57A 5EYDA 4ERKA 2OU7A 3OW4A 3MB7A 2V7AA 1KUTA 4JL9A 3ZRMA 3PXRA 3OCBA 4QD6A 3GNIB 3NW6A 4FI1A 1ERKA 2BPMA 4X0MA 4GVJA 5ANJA 4EONA 1OBGA 4A7CA 5CAQA 3DNEA 1PXNA 4E6CA 4FG8A 4L46A 2V22A 2PVJA 3R8PA 2X7GA 3UO5A 3EOCA 4HOKA 3IS5A 3ZDIA 2XMYA 3HX4A 4NM7A 5K5XA 4F70A 3BRBA 1WAKA 3HUCA 3MPTA 5C9CA 3VS5A 1ZYSA 5FQDC 2H9VA 3UVRA 4DG0E 2XNEA 1H1SA 4JQ7A 3ZBFA 4E93A 1VYWA 4BBMA 3WF5A 4WHZA 5BVOA 3QWJA 5LVLA 4K1BA 1RQQA 1XBBA 1XH8A 3E93A 2KTYA 3P9JA 4ZTQA 3RCDA 4ERWA 4XYFA 3NLBA 5FEEA 3QRTA 3AT3A 3KU2A 3ZEPA 5HBEA 1FPUA 3WZEA 4ASXA 3SDJA 4FEUA 1W7HA 4OW8A 5CU6A 2PE1A 2JAMA 4YJPA 3OS3A 2JDVA 2XYNA 2UW9A 2J0MB 4B8MA 4A06A 1K9AA 1V0PA 3ACKA 3FHIA 4Q5HA 2XBJA 4KS7A 3AC1A 3CJGA 3KF4A 2OF4A 4IWOA 5CWZA 5JZNA 4F0FA 4QYGA 3ERKA 4BWXA 2PL0A 3FC2A 2UUEA 1H1QA 3B2TA 3GC0A 5DHJA 2W4KA 3HRCA 3E8DA 1Q8TA 4B7TA 4E3CA 2OH0E 3EFWA 1FMOE 5FG8A 5BUEA 3SG8A 3DLZA 5C01A 4FEWA 3V51A 2BZKB 3G5DA 3IW8A 3V5WA 3IDPA 4F7NA 3FKOA 1JSVA 2ACXA 3KVWA 4NW5A 4HVSA 1Q5KA 2WTDA 3HDMA 4O2ZA 3VUIA 1SYKA 2CGUA 4XP2A 5L4QA 2BAJA 4OR5A 4DGNA 3AMAA 4ZJIA 3C4ZA 2EVAA 5H8BA 4YC3A 4M69A 4NK9A 4YHTA 3QUEA 4N70A 4OTPA 4U42A 3VWAA 3KREA 1LEWA 5AR3A 4IANA 2QOHA 2YLFA 4IBMA 4BWPA 1GIJA 3UNKA 3F3WA 3LIJA 3Q4CA 4YJQA 4U45A 4C3FA 4JQEA 2PUNA 3R04A 4D9UA 3KCKA 4G3EA 4PMTA 5EM5A 5G1XA 1OITA 1OIUA 3DAJA 4P90A 4D2PA 2GSFA 3MJ1A 4ZMEA 2IZUA 3CGFA 5T6KA 3VBXA 2EXEA 4J97A 4BDAA 2C1BA 3G51A 3WZKA 3BHVA 3DB6A 5I9UA 4EOSA 2JC6A 4TYHB 3DQWA 2ITQA 4ZTLA 3EWHA 2PMIA 2R9SA 4KINA 2HW7A 3MIYA 4EOQA 3LFEA 4JBPA 1XWSA 5K0KA 3ZXTA 4F64A 4AZTA 3KRLA 3GEQA 4TTHB 1H24A 4C4HA 4GIHA 1U54B 3LKMA 1OB3A 5CU4A 3Q2JA 2J2IB 1UNGA 5TOZA 2P2IA 2VTOA 3T9TA 3V5QA 4EH4A 5JRSA 5HVJA 2Y4PA 5A4EA 5AP6A 1YDRE 1PMUA 3QTQA 3VQHA 1W98A 1M14A 4R7HA 3EH9A 4USEA 5H8EA 1DI8A 3ZUVA 2B53A 1OL6A 1GOLA 3QQJA 2XNGA 5HLWA 2JBOA 2ZAZA 2ZJWA 1K3AA 4L42A 5LMBA 3C50A 3FXZA 5AA8A 5AMNA 2R2PA 2Y9QA 5ANEA 2HOGA 3AOXA 3UZRA 4NCTA 4D1SA 3PSBA 4FGRA 2VD5A 3MH1A 3ZM4A 2X1NA 3VRZA 4AW2A 4ACCA 4DA5A 2QOKA 4XG7A 4EQCA 2GHGA 2VN9A 2W0JA 4GFOA 4ARKA 2W4JA 3VO3A 1E9HA 4GT3A 5JFXA 4D5HA 1LEZA 4DH8A 3EN6A 3VUMA 1XH4A 2JD5A 4KRCA 1KE5A 5CZHA 4N6YA 4C62A 5IH6A 3WARA 2ITTA 2YISA 3HP2A 3M1SA 3Q52A 5HGIA 3UQGA 5M09A 1H0VA 4CGAA 3UOHA 4F9AA 3BI6A 4NKSA 2EUFB 3R1SA 4RWLA 4XLIA 3FSKA 3COIA 4HCUA 4UYAA 4C57A 1S9JA 5HX6A 1Q97A 5FXSA 4FG9A 4BCPA 3AD6A 4AGWA 3MS9A 3RHKA 2Q0NA 5GNKA 3FZ1A 5HKMA 3KK8A 5KHXA 3VUHA 3KRXA 1YOLA 5CANA 1A48A 1NT2A 3VBWA 1PXPA 5CYIA 1WVYA 3H9FA 3LXLA 5IH5A 4RJ6A 2Z7RA 3BLRA 4AZFA 1WBOA 4HPUE 4B0GA 5IMXA 2BRNA 2AYPA 3Q4TA 3KC3A 3RTPA 3HEGA 3V5LA 4R1VA 1PMEA 3BX5A 3OC1A 3D5XA 5CSWA 4C7TA 5LCKA 4F0GA 4MX9A 2DYLA 4WBOA 4U79A 2GTMA 4FKPA 3QTUA 3U54A 4HYIA 1NVSA 2VU3A 3NRMA 2GNHA 1I44A 2A0CX 4RVTA 1GZOA 1JSTA 3SV0A 3UYTA 5EI8A 3DFCB 4FX3A 3ZHPC 4WRSA 5FTGA 4DE4A 3GQLA 3Q04A 3FWQA 3JUHA 3U9CA 4PTGA 1STCE 2RL5A 4U3ZA 1YI6A 3R28A 4ZJJA 1HCKA 2FA2A 3PXZA 3F3ZA 2WQBA 2YABA 2VUWA 1H0WA 2QOLA 2VTJA 2J5EA 4ORKA 1OECA 3QCYA 3I7BA 5EK7A 3BV2A 4FKQA 2DWBA 2RSVA 4PDPA 5GJDA 1JKSA 3T9IA 2WMQA 3C4XA 2R3NA 4QQTA 3UQCA 3BU3A 4BCKA 1YRPA 2PZIA 1JSUA 2SRCA 5HIDA 4O7RA 2HK5A 2QOCA 4UZHA 3FL4A 1OI9A 2VWBA 3A2CA 3C4WA 2XNBA 3GBZA 2EB2A 5HNGA 3G15A 5AP7A 2ZMDA 2PZ5A 3O50A 2ITOA 4YJUA 2O64A 1WZYA 4CVAA 3W32A 3MW1A 4ZTRA 3LCSA 1APME 2JGZA 3GENA 2ZMCA 4ZXTA 2VTSA 1YI3A 4R3CA 2HCKA 2X8IA 4XBUA 4OTGA 4ANSA 4GKHA 4I24A 2JIUA 4M68A 2PVRA 2FSLX 4NJDA 3RHXA 3P78A 2DUVA 2WO6A 3GOKA 4W8DA 5GINE 5C8KA 2R5TA 4MAOA 2BHEA 5CASA 3WBLA 3R9RA 4O86A 5IUIA 4QMQA 4BIEA 3KMWA 4ASZA 1CMKE 2PULA 3KXMA 4IB3A 3R83A 2OBJA 2YDJA 3O8PA 4CT2A 1Q8ZA 4IM3A 3ZCLA 4BZOA 4RVMA 1U5QA 4ALWA 4F9YA 4Y5HA 4EH7A 4RC4A 4UWBA 5FXRA 3GB2A 4KIQA 5BVDA 1DI9A 2AUHA 3ZSIA 3EKKA 3UQFA 3QTIA 3DZQA 4JBOA 1JVPP 2WMUA 5CF6A 2XA4A 5M4UA 2FB8A 3PWYA 3VBQA 5LOHA 2IW6A 1LPUA 2BIKB 3EN9A 2ZV2A 3FE3A 1X8BA 4JIAA 4WG4A 5F20A 3C13A 1Q62A 2F57A 4K77A 4AE9A 1OIQA 2BDFA 3EJ1A 3UP2A 5CSXA 3IDBA 1F3MC 3VN9A 2E9PA 1TKIA 2VTNA 2W4OA 3S1HA 5L8LA 3VBYA 3HECA 3ZONA 5JT2A 3A99A 4IACA 4OTRA 3BIZA 3T8OA 2OZOA 3CE3A 3R7UA 3VS6A 5J87A 4BYJA 3Q5IA 4IM2A 4KA3A 4GW8A 4MNFA 4DEHA 1YXVA 4U97A 1QMZA 3UO4A 4BN1A 2YDIA 4EYJA 4HVGA 3SKCA 4JDJA 4J53A 3QTRA 3SX9A 2X4FA 2WNTA 4FL1A 1AGWA 1BL7A 4XRJA 2GS6A 3K2LA 2R3QA 4F6SA 1QPCA 4JAJA 4MNEB 4EK3A 5E4HA 3BCEA 3ORZA 2BAQA 4G34A 3H0YA 5C4LA 1RJBA 4K2RA 4TW9A 3RVGA 3DT1A 4GV1A 4ZOGA 3RP9A 4DEAA 4O0XA 4IZAA 4O0VA 2X6EA 1H27A 4GFGA 2BRMA 5M56A 1NA7A 2IW9A 4QTCA 3F9NA 2XNPA 1U4DA 3UO6A 4EHEA 5CEMA 4XJ0A 2W9FB 2OK1A 5FBOA 3BWJA 4J96A 2W17A 3CXWA 2R3LA 4FNYA 3G9LX 1TVOA 3UE4A 5J1VA 5J9LA 5B2KA 3TNQB 4A9SA 3PA5A 1MP8A 3DBCA 4JDIA 1DS5A 3KKVA 3D5UA 3FMEA 5A54A 1UU3A 5GJFA 3EZRA 3P08A 4BTKA 2ZV7A 2ERZE 2WU7A 5CSVA 3ZC6A 3ZC5A 2CKQA 2RKUA 4V05A 5DLSA 3W10A 3VQUA 3ZYAA 2E9VA 4GKIA 4PWNA 3UZTA 4GFMA 5A4QA 1CKJA 3DKOA 4QPSA 4RJ4A 2VNYA 3LFQA 3W16A 3U6IA 2UZBA 4GVAA 4M97A 2Y7JA 5BVEA 4CSVA 2W1EA 4J8MA 4DH7A 2WFYA 1S9IA 3PE1A 4K8AA 3WILA 2G2FA 2CCHA 4JVGA 1E1XA 4FKWA 3OXZA 2HZ4A 4DC2A 2PWLA 3ITZA 3OXIA 4N4SA 4GS6A 3F61A 5DR6A 3ATTA 4IB1A 2QVSE 5KO1A 5ACBC 4MXZA 4BDHA 2WHBA 5JQ5A 3W33A 4GUEA 5CEPA 3MFRA 4FT9A 4FKGA 4MD7E 3G6HA 3HUBA 2R3FA 3KXGA 2VTLA 2VX0A 3KRWA 4FKLA 4IVDA 4FK6A 3NVKI 1YHWA 2GNGA 1CKPA 5IQFA 3NUUA 4DAWA 4I0SA 4KUJA 3ORNA 4HVIA 3VHEA 4OTHA 2R3OA 2WD1A 4KIKB 3F5GA 3C51A 2GMXA 4RRVA 5HE2A 3NIZA 4XEYA 4KWPA 5FRIA 2I0YA 4QMUA 3GVUA 4K33A 4IHPA 2ETRA 1SVEA 1UU8A 2YDKA 4IAIA 5IQIA 1GZNA 3ACJA 5ICPA 3KXNA 2XIYA 4FSWA 1ZAOA 5E91A 1P14A 3D7ZA 3SRVB 2JIVA 3PA4A 3LHJA 5EOBA 4EOLA 3LVPA 3MFTA 4LGHA 4FR4A 4QYYA 2O0UA 3PJ2A 3AGMA 1H26A 5EW3A 5F9EA 1U59A 2V7OA 2YCSA 3FV8A 4MYGA 3TNPC 1IA9A 3R9OA 4YJNA 2YIQA 3C0HA 2C6MA 3SHEA 3W18A 3AMYA 3NNWA 3ZO4A 2PZPA 4DFLA 3MV5A 5D12A 2CHLA 3CD3A 2OI4X 3QC9A 4CTCA 3PE2A 5CNNA 3VS1A 4CKIA 4Z55A 3ATSA 2OXXA 3KULA 3FI8A 2BVAA 2OZAA 1WFCA 1PYEA 4MXOA 4BCJA 5J5TA 5DR2A 3A4OX 3D4QA 2XH5A 3MPMA 4CG9A 2W5AA 3CPBA 1G5SA 2B9JA 4XV9A 3FAAA 4IB0A 3VUTA 4B99A 2PUUA 2WTKB 4AT3A 4I1ZA 1AQ1A 2F7EE 4GU9A 4EBWA 3VNTA 4BTFA 4FYNA 4YTFA 4RIYB 2RFEA 3BHHA 2Y6MA 3BZ3A 4EJNA 3R8UA 1T45A 1YHVA 2XKFA 5E1SA 3MDYA 4BBFA 3PY1A 4RIOA 3QD2B 3QA8A 4ITJA 3ZFMA 5M4CA 3PVGA 3DBEA 5FEQA 4RFYA 1URCA 5EYMA 1PKDA 3IQ7A 4EYMA 2BTSA 3U6JA 2P33A 4FA2A 4D2VA 3QZGA 4QTAA 2HZNA 4ENXA 5CEOA 1RW8A 2WQMA 2JLDA 4QTDA 1LR4A 4LUDA 3PJ3A 4QTBA 3RI1A 4IAZA 4DGLC 3QALE 3OOMA 4GT5A 3GGFA 4RX7A 5FTQA 1QPDA 2C3LA 5JKGA 4AXAA 2XRUA 4DGGA 3NUAA 3V8SA 4J52A 2W1HA 4FODA 4FVRA 4CLIA 2J0JA 3R63A 4D0XA 3CCNA 1R3CA 3AC4A 4O22A 2X2MA 1JLUE 4EH6A 3TDVA 3DV3A 4H1MA 3E8EA 3PG3A 4G3GA 4RVKA 2J0LA 5AR2A 5D11A 4DTBA 2QG5A 4FOBA 4GCJA 5F4NA 4DYMA 3RM7A 3QD0A 5AADA 2GQSA 5BMSA 3FMMA 4KNBA 1Y6BA 5EOLA 4WOVA 5EKOA 3DTWA 4QMZA 4CFVA 4EC8A 3HYHA 5E9EA 4OUCA 3A4PA 4C35A 2BMCA 5LWMA 3R7VA 5AJQA 4N57A 4MTAA 2YJSA 3RPSA 3KQ7A 4IX6A 4EK6A 4RSSA 2QOIA 3OZ6A 4CLJA 4FE2A 2XP2A 5KX8A 2UW3A 4RZWA 3KRJA 4IE9A 3GU6A 3C4EA 4H3BA 4E6QA 3I6WA 5HI2A 3BE2A 4K11A 2VWZA 3DKFA 4MVFA 1OBDA 4NYEA 1OKWA 5AR8A 5H9BA 1Q99A 4CKJA 3WYXA 3G2FA 4HYSA 3DKCA 2QD9A 3PSDA 4FV1A 4RX9A 3WI6A 4U80A 2VRXA 5CVHA 5DBXA 4IVCA 4L7SA 4JAIA 3LXKA 4TYIA 4APCA 4FICA 4XOZA 5M44A 4Y85A 3KVXA 3NNUA 2JDSA 3EYHA 5L2WA 3ZO2A 3MVLA 4EH8A 4TXCA 2H6DA 5E7RA 2C6LA 4G5PA 4D0WA 3LMGA 4HNIA 4LFIA 3JXWA 3DJ7A 4R7IA 2VX1A 2JFMA 4TYGA 1YOJA 4UB7A 1OMWA 4NTTA 3B8QA 3IONA 4EWQA 3BLQA 2XK6A 2GCDA 3F3VA 3CPCA 5HCZA 5C8NA 5HQ0A 2YM3A 3W1FA 4CCBA 1WBTA 2EU9A 4BDIA 3EQDA 1XBAA 1YKRA 2AC5A 4Y73A 5ANOA 2C6TA 3FJQE 4QMSA 2BDWA 5AX9A 4CV9A 5KKRC 5DIAA 4R5SA 3CQWA 3PG1A 4RLLA 4BCGA 2YLEA 4E7WA 4UMUA 5L2SA 1XKKA 1O6LA 4ANLA 4F6UA 4ITHA 3CQUA 5D7AA 5AWMA 3AC3A 2X2KA 3G0FA 4TPTA 3SOCA 4M69B 3ZU7A 3MWUA 4D1ZA 2XJ1A 4ASEA 1EH4A 2O3PA 3HL7A 2IVUA 4F09A 1GZ8A 2OGVA 2PY3A 3R7OA 5A4TA 2PZYA 4FOCA 1FGKA 4X7QA 3RPRA 3EN4A 3OUNB 4FUXA 2OXDA 4I5HA 3FI3A 4IAAA 3TZ8A 3SW7A 4IJ9A 2B4SB 4G3FA 5DH3A 4AA5A 5CEIA 2JKOA 4C4JA 3SAYA 4I94A 2UVXA 4ANNA 2EXMA 3ALOA 3FLQA 4D1XA 4UWCA 4IVAA 3CGOA 4IMYA 4WA9A 3OCGA 2YIWA 4AUAA 3M42A 5IQAA 2UZUE 3UNJA 4BI1A 4E4XA 4ZSJA 2CJMA 3RZFA 1B39A 3NCGA 5BVWA 4KIPA 5BUJA 3ORIA 5IDPA 4WUNA 2UZDA 1R1WA 1F5QA 2WEVA 2UW7A 2W1FA 3LJ1A 4IH8A 4XBRA 1ZLTA 2BFXA 4QPMA 3RGFA 4D9TA 2OXYA 4NH1A 4O84A 5IUGA 4LRJA 2WTJA 4E4NA 2J0KA 2UW0A 5CT7A 4FV9A 2PHKA 3PXKA 4JDHA 1P5EA 3R02A 3VF9A 1SNUA 4P2KA 4DBXA 2PVLA 4YHJA 4BCNA 3QQHA 5CSPA 4UBAA 1V1KA 4E5WA 4X6QC 3NGAA 4U43A 3IG7A 5DFPA 5HHWA 4C2VA 1WBWA 3TNHA 2YCQA 4WKQA 2FSMX 2QNJA 3F2RA 4L8MA 3ODYX 4BDFA 2B9HA 3N9XA 3UG2A 4S30A 4H58A 4AF3A 3TG1A 1VYZA 5D1JA 3GCPA 3A7FA 5HTCA 5IQBA 2Z02A 3QBNA 1H1WA 3D5WA 3VRYA 3F2AA 3VVHA 4MXXA 4CMOA 5LCJA 1ZZLA 2WXVA 2PE0A 3FYJX 4JDKA 2UZLA 4ITIA 3QUPA 4FTQA 2XIXA 4IZ5A 4WG5A 5HNBA 2J7TA 3BYUA 4LGGA 4XG2A 5TKDA 4ZTMA 3KEXA 4WSQA 1GIIA 2XS0A 1KOAA 3R71A 5IDNA 5DVRA 1BL6A 4PL5A 4B9DA 1DAYA 2ITYA 3DCVA 4PUZA 5E8YA 3LCOA 3QXPA 4X2NA 4JBVA 5AIKA 5C8MA 1GIHA 2C3KA 5LMAA 3RKBA 2YCRA 5IA2A 4C0TA 2VWXA 4X6RA 3D7TB 4O7VA 4HVDA 5K9IA 3K5UA 2R3HA 4I23A 4YBJA 3D94A 2BRHA 3ZLYA 4AOTA 2WEIA 2ETKA 2XCKA 3GU8A 3PJ1A 3FLNC 3E88A 3K3JA 4KAOA 4PTEA 1RDQE 4YLJA 3SLSA 3V8TA 5M4FA 4D4YA 5AV0A 3TT0A 5CAVA 4Y95A 4U41A 5BVFA 1OL5A 4AG8A 4XLVA 5CI7A 2VWWA 4FEXA 3F2NA 3H30A 5DEYA 4O2PA 2C6KA 3L8VA 5HTIA 2E9UA 4TRLA 3ODZX 2HELA 3ETAA 3L9MA 3F7ZA 3V5TA 3LFCA 3DQXA 4ZY4A 5I9VA 4LOPA 5LWNA 3EN5A 2HWOA 4HZSA 3DAEA 3UIXA 4ZAUA 5IQHA 4UX9A 1XH7A 5AV3A 1HOWA 2C0OA 2YN8A 4M3QA 3KFAA 4BICA 4E73A 5C03A 4FTCA 3Q9WA 3K54A 2G15A 4PMMA 1NXKA 4H1JA 4UXLA 5E8XA 1YWVA 3QGWA 4I5PA 4CFWA 3I5NA 4CZUA 3GXLA 1JWHA 4II5A 4RFZA 4XG6A 2QOBA 3CY2A 2ITNA 4D28A 5ETCA 4PX6A 4RPVA 3TZ9A 4AN3A 4F08A 5KMKA 1Q24A 2W5HA 4JG8A 4M13A 4XG3A 4U7ZA 5D10A 4DLJA 4YO6A 5EI6A 2JFLA 3TKUA 4RIWA 3REPA 4K6ZA 4YP8A 3DBQA 4HCVA 3FMLA 1PJKA 3R9HA 1OL7A 4C4IA 3PRFA 3RAWA 3FLSA 3LFSA 4OGRA 1OPJA 2XK4A 4R1YA 4ZLYA 2RFNA 3UC4A 4ZEGA 3HV7A 2ZDTA 2YITA 3OWJA 2OIBA 3ZUTA 2VWUA 5IA5A 4XCUA 1H00A 3G90X 2C68A 4BCQA 3VIDA 3DDQA 4EK4A 1AD5A 2UW6A 4TNBA 3COMA 4YZCA 3NX8A 4FTRA 3WE8A 4O7SA 4IAFA 5HESA 4M84A 3SD0A 2OJGA 2JAVA 1GZKA 3C0GA 5DA3A 2VTMA 3EQBA 4I5CA 4U3YA 4QP8A 3W8LA 2W1ZA 4PP7A 5EQEA 3SC1A 3LXNA 3U51A 4FNZA 5DRBA 4EQUA 3PPZA 3E3BX 4DEDA 5CVGA 4ZTNA 1G8AA 4UMQA 4HJOA 4Q2AA 1KSWA 3T3UA 3FL5A 2ZB0A 4FIIA 2VAGA 4FKIA 3VS4A 5FBNC 1PKGA 3NS9A 4JT3A 3Q6WA 3NVMB 1XQZA 3R73A 5H8GA 4GG7A 3BV3A 2I0HA 1Q8WA 4O81A 1YDTE 2C69A 2C6IA 4KSPA 2QONA 4FVPA 4GU6A 3EMGA 4FSQA 5DEWA 2WMBA 5HD7A 5AAEA 4ZSGA 2HZIA 3UMWA 4BB4A 3PVUA 1XBCA 3RMFA 4E26A 4F6WA 2LGCA 5ITAA 1KV1A 1NVRA 5DMZA 3RAKA 4ZK5A 4X2JA 3QFVA 4KBKA 3R2BA 1R0EA 3OT3A 4IB5A 4KKEA 3L8SA 2R3MA 3DJ6A 3P1AA 1JKKA 4YLLA 3NZ0A 4TT7A 3ZLXA 4OT5A 4WT6A 3IW7A 2F4JA 5CTPA 3OMVA 2F7ZE 3ZFYA 2A27A 5FEDA 2QHMA 3CKWA 4QNAA 4QMVA 2ZV9A 4QMPA 5FTOA 5A4CA 1BUHA 2CSNA 2X7OA 5CS6A 2QO7A 1KE9A 3O71A 4F4PA 3ET7A 4QMLA 1H01A 4NL0A 4J8NA 3BGZA 4QYHA 2QU6A 2HY0A 4EHZA 3UC3A 5EW8A 3JPVA 3CS9A 1H25A 4B8LA 2HY81 3PP1A 5CAPA 5LJJA 3M2WA 5AV1A 3TKHA 4KBCA 5I0BA 4JQ8A 1IEPA 4Z3VA 4S33A 4O1PA 3TEIA 4BDJA 4EH9A 4BYIA 4EEVA 2C47A 1NW1A 2PVMA 5CEQA 3RZBA 2R0IA 3CQEA 4GEOA 2ZDUA 4ACHA 4K18A 5IQEA 4FKTA 2VTHA 3QTWA 2YM7A 4QP2A 5BYYA 1OKVA 4IDTA 4S2ZA 5IA0A 5LXMA 4O7YA 3D5VA 4ANOA 4FL3A 4Y83A 2Y4IB 5HVYA 5I9WA 2RFDA 4RA4A 5A6OA 3I81A 2XEZA 3PIZA 1M7NA 1FVVA 2UZTA 5KE0A 4QP9A 3QCXA 1H4LA 4L44A 3WIKA 4DG2E 1P4FA 4RWKA 4V0GB 3CKXA 2E9OA 4NUSA 4FKOA 4Q5EA 2ZM4A 1ZRZA 1R39A 5HG7A 3HMOA 2OJ9A 1PXLA 1ZOHA 3L8XA 4C33A 2A2AA 2WB8A 2WIPA 1R78A 3PLSA 2R3KA 4UY9A 4WNOA 3CIKA 5DT3A 3UMXA 3MIAA 2B1PA 4AP7A 4IWQA 4CRLA 4E4MA 3CTHA 1UVRA 4GMYA 1WBNA 3UIUA 4AFJA 2B54A 5G6VA 3OWKA 2WMRA 3IDCA 3IOKA 3DJ5A 4O0YA 4PRJA 1IR3A 4F1MA 3ZLSA 2DQ7X 4UMRA 3HV6A 5HIBA 3PLAE 3QGYA 3DLSA 3VC4A 4C34A 4PY1A 2YZLA 2CGVA 1M17A 2IVSA 3MYGA 4G16A 3UTOA 2J50A 5AM6A 4IW0A 4F0IA 3UDBA 2C0IA 2IJMA 4LRMA 3GCUA 3I60A 2HIWA 3AC8A 4CQGA 3ORPA 1BX6A 3O0GA 2GTNA 3QZFA 4UXQA 3UG1A 4TYJA 3W2RA 2NPQA 3DBFA 3PYYA 4QYFA 4C3RA 3G9NA 5C27A 3U9NA 4C58A 4XG9A 1FGIA 2QO2A 3MVMA 4HYHA 2VWIA 3F3UA 4C4GA 2GHLA 3SG9A 5K5NA 4ZIMA 1FOTA 4BDCA 1OPLA 3WF8A 4MQ2A 4BCHA 4LUEA 3BU5A 3PSCA 2Q0BA 1H08A 2WMXA 2BRGA 3VF8A 2UZWE 3DFAA 5I9XA 5ETFA 1M2RA 4O27B 3ID6C 1FQ1B 3P0MA 4G9RA 3ZMMA 2JBPA 4HGSA 5CAUA 5J1WA 4IJPA 1FVRA 3FUPA 3A61A 4I93A 5KUPA 1OPKA 3BQRA 3ENHA 5IA1A 3Q6UA 4CZYB 2XB7A 4M0YA 3RAHA 2V62A 3OBJA 4FNWA 4CG8A 4R3PA 5IQDA 2F7XE 5LVNA 2CLXA 5KHWA 4A4LA 2G9XA 4CRSA 3WF9A 4RJ8A 3SW4A 1Y6AA 4QMMA 2X7FA 5EDQA 2QLUA 1XJDA 4HNFA 2Q83A 3QTZA 5CLPA 3F3TA 3SOAA 2YA9A 4C38A 3VJNA 4FTLA 4WSYA 5A4LA 2XF0A 5L3AA 5BX0A 2FYSA 3P7CA 1TQMA 2NO3A 5CY3A 4FTUA 3U55A 5B7VA 4DITA 5IISA 3EQPA 4FUYA 5E8UA 1W84A 3ZO1A 5GIPE 4C59A 4U9AA 4I5MA 4GK2A 1L8TA 4WUAA 4DEEA 4RC3A 2VTRA 4FIEA 3HLLA 4M12A 1GNGA 2ZM1A 4G1WA 1GJOA 4G6LA 2YWVA 5HCXA 3UOLA 4BF2A 3I6UA 4AW1A 3R01A 3U4UA 5IZFA 1U54A 1YVJA 2BDJA 2C6DA 3ELJA 3LFDA 3NPCA 5BYZA 3EFLA 3ZRKA 3S00A 4R7BA 4I22A 4M8TA 3COHA 2BZHB 2W1DA 4G9CA 1OZ1A 3E5AA 5IA4A 4DEIA 3ULZA 2C3IB 4AZEA 4ACMA 5FM2A 5M57A 2WIHA 3I0OA 4PNKA 3QC4A 3R1QA 5E1EA 5CX9A 3UNZA 3R7GA 5CXZA 3HMIA 1OGUA 2OF2A 3PXYA 3DPKA 2VZ6A 2GDOA 1QCFA 3P7AA 3POOA 3QRJA 4HGLA 5TR6A 3VJOA 3FZPA 2VO7A 2ONLC 4PF4A 5AV4A 1MRVA 3CSVA 5FP6A 5HG9A 5EM8A 4RX5A 3AC2A 4XV1A 4BVUA 1IG1A 4X2FA 5EQYA 4FKSA 1YXXA 5HE0A 4OAUC 4F7LA 4W8EA 3NUSA 2PVHA 3ORMA 3VAPA 3F66A 4ALVA 2FO0A 3N51A 2YWPA 5DWRA 3UOKA 2QLQA 4MXYA 4XRLA 4FTAA 4NM0A 1YXSA 5JGAA 5KBRA 2HXQA 1OIYA 5T68A 4QPAA 4NW6A 2EXCX 4ZP5A 4FTIA 4FZDB 1ZMVA 4OTWA 2WKMA 3C4FA 2X2LA 2X4ZA 2XJ0A 3GP0A 1BI8A 5AUTA 4ACDA 5IUHA 4RVLA 1ZYLA 2FGIA 2CKEA 2P0CA 4D2TA 4YC8A 4FYOA 4A9YA 2J0IA 4WBBB 5IMEA 4HZRA 3E92A 4BCFA 5L6OA 3HZTA 3RPOA 1RE8A 4O38A 4R8QA 2PSQA 2OO8X 3NSZA 3RCJA 4EOMA 1UKHA 3QYWA 5EG3A 1SNXA 3ZS5A 1G3NA 3BU6A 5HO8A 2QO9A 5BVNA 3IKAA 5DT0A 2OIQA 4LL0A 3QZIA 5IKWA 4YZBA 1YXUA 2W99B 1ND4A 3GU7A 5GZ8A 4QQJA 4AT4A 4FV3A 3S95A 2WPAA 3OCTA 3PP0A 4AA0A 2F2CB 3DK6A 4BHNA 3MY0A 2R3GA 1CTPE 3BHYA 3KF7A 4CQEA 3A8XA 4DT8A 4R3RA 5AP3A 5ETIA 3DS6A 2Z8CA 5M53A 2CN5A 1XO2B 4DEBA 4YSMA 3TL8A 3EIDA 4YPSA 5B2MA 2R64A 3F7WA 4O0TA 3RINA 1PXKA 3GCVA 3VBTA 2OFUA 4G6NA 1G8SA 4FT3A 4JR3A 2FSOX 3D2IA 5CSHA 3R8MA 3PPKA 3I4BA 3R6XA 2JDOA 2RGPA 3PFQA 2W1CA 3FMNA 4PQNA 4Q9ZA 2LAVA 3S2PA 3THBA 4QQ5A 3ANQA 3AMBA 3C5UA 4CFFA 4CMTA 4Z7GA 3G33A 4I21A 3ZSHA 3C1XA 2ONLA 2HZ0A 3QHRA 2G2IA 3IGGA 4I6QA 3Q9YA 4W4VA 4YHFA 4O1OA 1M52A 2J6MA 2QKRA 3DNDA 3MFSA 2ESMA 2VTAA 4G17A 4I6BA 5HEZA 4ZZMA 3ANRA 3KXHA 3PA3A 3NAXA 3UIBA 3ZO3A 4CD0A 2ZOQA 5I3RA 3B8RA 3H4JA 4OBOA 5DRDA 4E8AA 3DDPA 3VULA 3LJ0A 3NMUF 2YM4A 2YAKA 4FV2A 5EFQA 3W8QA 1ZY5A 3FLYA 4F9BA 3EQIA 5HE1A 3RK9A 3HAMA 2VO6A 2XJ2A 2WZJA 3E63A 3O8TA 3OFMA 2X8DA 3BEAA 4FZ7A 5B0XA 3TWJA 5IEXA 1PF8A 3RM6A 3FYKX 4IXPA 4W4XA 3OEFX 3TJCA 1ZMUA 2JDRA 2BTRA 4ZS0A 4JLCA 2C6OA 2AC3A 1U5RA 2XYUA 4J98A 5L6WL 1KE7A 2WQEA 4YTHA 4AZVA 4E5AX 4XS2A 2BFYA 3V8WA 4DF3A 4EUUA 5KMLA 3MJ2A 4ZSLA 1ZXEA 3QX4A 3P7BA 4YTIA 2PVYA 4QOXA 5H2UA 2C0TA 2J51A 2OFVA 1UWHA 1MQ4A 2XM9A 4FTNA 2XBAA 4JR7A 4O91A 5DG5A 1XH5A 4PDSA 4E1ZA 5JK3A 2QR7A 3GC7A 5AM7A 4BTMA 2GQGA 4MK0A 5DE2A 1MQBA 3HGKA 3I5ZA 4AWIA 5FXQA 3FXXA 5EM7A 3V3VA 4IAKA 4TWNA 1UNLA 5EM6A 4YO4A 3R8VA 4MNEA 5F1ZA 4UYNA 1J1CA 4RA5A 3C0IA 3MA6A 1W83A 3Q9XA 3R00A 4MBIA 4F7SA 2PUIA 2R7IA 5BPYA 5EYCA 1B38A 3DAKA 3SXRA 1YDSE 2J90A 3PRIA 4LOOA 4M7IA 5FUTA 4FVQA 3C9WA 3R30A 1W8CA 2QQ7A 3UIMA 4TYEA 3QCQA 4XP3A 4FTMA 3RPVA 5KKRB 3N4TA 4QT1A 2QR8A 3MSSA 2GNIA 4ID7A 4I92A 4PDYA 4J7BA 1OIRA 3EKNA 3QF9A 4LRKA 3UODA 1JQHA 4ZLOA 2UZVA 4FSMA 2ZB1A 5JSMA 3SA0A 3QYZA 4G3DA 1E1VA 4XHKB 4O6LA 3LMIA 4NTSA 4OAVB 4C37A 4DH3A 2XNMA 5DT4A 2R3IA 4RGJA 2X9FA 2VO0A 3AD4A 3MA3A 4RZVA 5FWKK 3CR0A 1K2PA 3MBLA 4L9IA 4DT9A 5KNJA 4EJ7A 3H9RA 1VJYA 3HMNA 2YM5A 2QCSA 2I6LA 4NSTA 3OUKA 5HLPA 3JS2A 3AC5A 4W9XA 3P4KA 2JEDA 3QTSA 1JKLA 3UPXA 4DFNA 1SZMA 3PXFA 5LQFA 5E8VA 4HPTE 5TO8A 3MESA 3DXNA 3P86A 2IZRA 3ZZWA 5DPVA 4XMOA 2CKOA 2E2BA 4ALUA 2NP8A 4ZJVA 2B7AA 3UYSA 3BGQA 4JIKA 2W5BA 2QC6A 3JY0A 3GQIA 5A46A 4XP0A 3W2OA 4ZTHA 4H3QA 3BBWA 4NWMA 3O2MA 2GNFA 5DN3A 4FZ6A 5ANDA 3PVWA 5M4IA 4GUBA 3DU8A 4BKZA 5TF9A 5AP2A 1PXIA 1NY3A 2QODA 2WTCA 3NDMA 4E5BA 2PMOX 4FIHA 4Z9LA 4ANBA 4X3JA 4NJ3A 5I4NA 2IZSA 3GI3A 1ZOGA 4A9RA 3KMUA 4RIWB 4I6HA 3WZJA 1Q4LA 5IPJA 3FBVA 5GHVA 2QKWB 4S31A 5ETAA 5CQUA 5CF5A 4IIRA 5FD2A 3FMHA 4I4FA 1JKTA 1W82A 1ZWSA 5IG1A 2PK9A 3BYOA 2XUUA 3D9VA 4L3LA 4WNMA 1R0PA 1O6YA 3NIEA 2VTQA 2CNQA 1ZOEA 3JYAA 4UMTA 3NYVA 3QCSA 3BKBA 3LAUA 4FTTA 4GYIA 4H36A 3AQVA 1UU9A 3TV4A 3C4CA 2WTVA 3SRVA 3JVSA 3TACA 4D2SA 4X3FC 2BAKA 1XH9A 3K3IA 2OW3A 4BKYA 3RNIA 4BI0A 4Y46A 5HD4A 1WBSA 4EKLA 2CNVA 2J4ZA 2Y6OA 1W0XC 3HDNA 4IX3A 4OTFA 2VO3A 2XNNA 3QXOA 4FTJA 2NNWB 4ZY5A 2BALA 4APPA 2JIIA 3PTGA 4TY1A 2ZV8A 4XG4A 4E6AA 4Z7HA 3Q9ZA 3IW5A 4LV8A 4P5QA 4XV3A 5HX8A 3R1NA 4F99A 2W96B 3OVVA 3SGCA 5EI2A 1OKYA 3I0QA 4EOPA 4U81A 4FIGA 4YC6A 2V5QA 5AP1A 4YURA 3A7GA 2WTWA 5A9UA 3NYOA 2WELA 1VR2A 2YFXA 4Y72A 4QMTA 4GH2A 5HORA 2ITPA 4H05A 2KULA 3Q53A 3VS3A 4QP1A 2B52A 5AX3A 2HAKA 2R3JA 3HA6A 4QQCA 3FZOA 5J95A 3KN6A 3VBVA 2FVDA 3WZUA 4A4OA 4EZ7A 5L6PA 4I20A 4AFEA 4O7LA 3AD5A 4DH5A 2JDTA 5CU3A 2W06A 4CT1A 3TZMA 4HGTA 2ZM3A 4B4LA 2V0DA 2UW8A 4RQVA 2YIYA 5BUIA 4YU2A 5JEBA 5M08A 4RMZA 3PIYA 4WD5A 2B9FA 3FI4A 2VV9A 3RPYA 4EH5A 4YZDA 1XHAA 2A19B 4AACA 1F0QA 4QNYA 4GK3A 2UVZA 5L8KA 2VWYA 3MH2A 4JRVA 3HV3A 3QQLA 4RJ3A 3PIXA 5F94A 2QOOA 3QX2A 3V04A 2XKEA 5BQ0A 3LLAA 2ETMA 4OBPA 3MPAA 3D2KA 2W1GA 3NCZA 3WOWA 4RWIA 3NUNA 4BL1A 3LXPA 4EOKA 3HRBA 4FV7A 1PMVA 4P4CA 3FZSA 5K3YA 3V01A 4JRNA 4L52A 2UZNA 4DFBA 5A6NA 3PWDA 4QMOA 4CZTA 3HMPA 5IH4A 1V0BA 4MHAA 3ZRLA 3QA0A 4EK8A 2C4GA 1Q61A 4RG0A 5EHOA 4HVHA 3LFFA 4AE6A 3IECA 2PMLX 5CT0A 4JI9A 4LV5A 5EYKA 4C4EA 3K5VA 4HYUA 4X3FA 5FDXA 3NYXA 4XH6A 4PL3A 4EHGA 4BTJA 2OICA 2ERKA 3F5PA 2ZYBA 5L2TA 1KE6A 3QD4A 4NFNA 4MWHA 1SVGA 4LG4A 2WGJA 4U5JA 3CP9A 1KE8A 4AGCA 2WMWA 4E4LA 1I09A 4UMPA 4G31A 4FKRA 2REIA 3NUXA 1M2PA 4MF1A 3QQFA 4WG3A 5AUVA 3PY0A 5FP5A 4X2GA 2EWAA 4CNHA 2CNUA 4IX5A 3VUDA 1ZYCA 3EL7A 3FKLA 3POZA 5HOAA 3AXWA 1OL2A 2OG8A 2X8EA 5JH6A 3HKOA 3AG9A 5J9YA 3N4UA 4BWKA 5KBQA 2WOTA 3HV4A 2IPXA 4IZ7A 5AFVA 5JFSA 5KMMA 2H96A 2P4IA 2Z60A 3GUBA 4NM3A 3ZUUA 3VS2A 4AN9A 2I1MA 2B9IA 4NCTC 3CBLA 3MB6A 4JX3A 4BIDA 1P4OA 4QMNA 1BLXA 3E8CA 4L45A 3MVJA 4YGAA 4L3JA 4CFNA 4FIFA 4EOJA 2CGXA 3LCDA 4Q9SA 2EB3A 3JY9A 5HO6A 3E7VA 4NKAA 5CI6A 4JJRA 1Y91A 4TN6A 4FT7A 3I1AA 2Z2WA 4MH7A 5K4JA 4YNEA 3E87A 3GFWA 4YSJA 4ZTSA 4C36A 5AP5A 2A1AB 3CTJA 4NM5A 3V5PA 5AIRA 2QHNA 4DGMA 2F9GA 3FQEA 3LE6A 4YJOA 4LMUA 3W2CA 2BZJA 4EKKA 3HP5A 2GU8A 1H8FA 3LQ8A 4FV0A 3EZVA 3MH3A 2C5YA 4AS0A 2BCJA 3BE9A 3OWLA 2BRBA 1ZMWA 4JG7A 4DH1A 3NNXA 4CFMA 3P79A 3LQ5A 4DHFA 4A07A 3FY0A 5HBHA 4NZWB 1CKIA 4BKJA 2XZSA 4EK5A 5HCYA 5HG5A 1PYXA 3QRKA 4K0YA 1IA8A 4S34A 2C5NA 5EHLA 2BILB 5B2LA 3GU5A 4BR3A 2VGPA 1NVQA 4KS8A 4O0RA 5I3OA 5IA3A 2XCHA 3FQHA 4GG5A 2C6EA 4N6ZA 4U40A 5M06A 4NIFA 1WVWA 3R0TA 5DGZA 3W2QA 3W55A 4FL2A 2E9NA 3IGOA 3PJ8A 4BI2A 3VHKA 1ZY4A 4JG6A 4XNEA 3OBGA 4RWJA 1L3RE 4FSNA 3OXTA 5LVMA 3TXOA 4YR8A 1H28A 2UVYA 3GCSA 3EQGA 2GPHA 1Y8YA 2PZRA 1TQIA 3DTCA 2OWBA 2BR1A 2QOQA 4DCAA 2WQOA 5BMMA 4L01A 2C5VA 2GNLA 1LUFA 2Z7QA 2R3RA 3DBDA 2XKCA 5LVPA 4O0WA 2Y8OA 4GJ2A 4DN5A 1YOMA 1VZOA 2VTIA 2OJIA 3R7IA 3IOPA 4RC2A 4L6QA 3TV6A 4C8BA 1Q3DA 3TUCA 1PW2A 3H9OA 3FLWA 4EZ5A 4DGOA 2RIOA 2PVKA 4IWPA 3R7YA 4MXCA 2QOFA 3F5UA 3ORKA 3FDNA 2BKZA 4U8ZA 4OTIA 4FKJA 1HCLA 2XIKA 5IQGA 5KMNA 3O23A 3QZHA 4I6FA 4KIOA 4NEUA 4QO9A 1Y57A 3FEGA 5H3QA 3KXXA 5E8SA 3QUDA 3QAME 3BWFA 1QL6A 4FK3A 3RJCA 4C2WA 3TM0A 4BZNA 4FZAB 4EORA 4IDVA 5ACKA 4XX9A 4BDBA 3TTIA 3MTLA 2CN8A 3O8UA 3BYSA 3PJCA 4RIXA 4KD1A 2GS2A 4U0IA 4YJSA 3TZ7A 3WZDA 4C02A 2WTIA 2YHVA 4BBEA 4AOIA 1PRYA 4I3ZA 4D2WA 3BHUA 3LMHA 2R4BA 5HG8A 2XK3A 1Z9XA 2R3PA 3ZLWA 3Q5ZA 4ANMA 4HCTA 3LQ3A 2O63A 4IX4A 4BIBA 3KRRA 4QP7A 5CAOA 2IVTA 5A14A 2B55A 3N4VA 4KB8A 4ZLZA 3E62A 3EN7A 3A8WA 4O0SA 5AP0A 5M55A 1SVHA 2XNOA 3IW4A 3D7TA 2OLCA 2YZAA 2GHMA 1IASA 4EL9A 1OUKA 3OD6X 4YJTA 5C1QB 4BCIA 3FSFA 4GJ3A 4AW5A 5KMJA 4XOYA 5GZ9A 4O7ZA 4CTBA 2JKQA 3H10A 4USFA 1T46A 4C61A 3RWQA 4JX7A 3MY5A 3QRUA 4PDOA 4YZ9A 2CCIA 4OTDA 4EQMA 1WVXA 4CYIA 3OF0A 4PPCA 3EFJA 4O7WA 5JMSA 4FSRA 4TWPA 5IEVA 5J7HA 4F1TA 4PL4A 4X21A 3ZM9A 4QTEA 4KKGA 2PU8A 4IAYA 2UZOA 3IW6A 3QQUA 3QHWA 3BLHA 4WNPA 1XR1A 1PXOA 4MKCA 3HVCA 5JFWA 4DFUA 2HWPA 5L8JA 2PUPA 2C1AA 5AEPA 4BGGA 1BYGA 3H0ZA 5AR7A 3ORTA 3AT2A 4L7FA 5T3QA 3DXQA 4D55A 2Z7LA 5HU3A 3DXPA 3QKMA 3UP7A 4UEUA 2WAJA 2XIRA 4DFXE 3O51A 4L43A 3DK7A 4DG3E 1ZARA 3OTVA 5KMIA 2C5OA 5JQ8A 4NU1A 3QTXA 3UGCA 4DCEA 3UPZA 4O96A 5EQPA 2OJFE 4KABA 3D14A 4JNWA 4RJ7A 3GCQA 2OIDA 4ZSEA 3OP5A 1U46A 4YLKA 4F65A 4PTCA 5DR9A 2HYYA 1Q3WA 5KCVA 4O82A 3HAVA 2JITA 2UV2A 4IM0A 5EDPA 3LCKA 5GIOE 3TKIA 3LCTA 1J7IA 4YUQA 5CEKA 5K0XA 2FUMA 4BZDA 2PTKA 4RFMA 2W1IA 4AN2A 3IPHA 4D4VA 4DLIA 4UN0C 5JZJA 3B2WA 4FTOA 4JXFA 3LM0A 4IWDA 3C7QA 2OJJA 3KULB 3MFUA 2Y4IC 3Q60A 3R8LA 4D5KA 4EOIA 2OZAB 2F2UA 2JKKA 2R0UA 3E8NA 2P3GX 4FTKA 5JN2A 5LVOA 4AZWA 3BELA 2XKDA 3LW0A 4BDDA 4EZ3A 1UKIA 3O7LB 4R78A 3ENMA 4PV0A 3FMJA 2VWVA 3QKKA 3LPBA 3CD8A 4TYHA 1YWNA 3D15A 3S4QA 3OY3A 5EDRA 3LFAA 4F7JA 4JS8A 4A9TA 2X0GA 4LYNA 4WNKA 4FSUA 2VGOA 3HRFA 3PPJA 2C30A 2RFSA 3PY3A 4PMSA 4W4YA 1URWA 4ENYA 3QLFA 4PMPA 4J71A 4F9CA 2H34A 4O21A 4FSZA 3BYMA 2CGWA 4IEBA 4IQ6A 4MEDA 3U87A 2W9ZB 4L67A 3ULIA 5DYJA 3HA8A 3U4WA 2XM8A 5L2IA 2XVDA 4BCMA 4YJRA 1DAWA 3TN8A 4F9WA 5HICA 1J7UA 1PXMA 2YAAA 3NR9A 4KBAA 4C4FA 3JR1A 4GSBA 3LOKA 3PXQA 2C3JA 3QU0A 3VS7A 4CFXA 2IZTA 4RLKA 5EHYA 5I9YA 4GIIA 4BGHA 3CLYA 4V04A 5D41A 3CTQA 4ZZOA 3BBTB 3QQGA 3ZEWA 4TZRA 3BYVA 3LFNA 5M07A 3TIZA 3V6SA 5JFVA 3F69A 5CF4A 4ACGA 5KMOA 5A3XA 3UBDA 3O96A 4DEGA 2NRYA 1QPEA 4GYGA 1OM1A 1UA2A 3TUBA 1YHSA 3FMDA 3EHAA 2I7QA 5I5ZA 2CPKE 3NWWA 4D58A 5AAGA 2XK7A 3BGPA 3EB0A 4UV0A 3DA6A 3R2YA 3UZPA 3F82A 5AUYA 3WF7A 4ANQA 1BMKA 2YM6A 2WOUA 3KY2A 4IVBA 4PP9A 3DY7A 3FXWA 3L9NA 4LM5A 2O2UA 2DS1A 2GFSA 3SXFA 4EH3A 1J3HA 4OTQA 3PDTA 4ZSAA 4K9YA 1P2AA 2G2HA 3NAYA 4BDGA 3P23A 4D4RA 4AOJA 3FPQA 2OSCA 3CJFA 2X6DA 2HXLA 4XG8A 4RT7A 3CY3A 3IK3A 3L9LA 4YJVA 5D9HA 5TT7A 1OL1A 3TIYA 3OCSA 3U8WA 2ZVAA 3BPRA 1ZYDA 4IADA 4QP3A 3F6XA 1CSNA 4WIHA 1J7LA 4FEQA 2A4LA 3TJDA 5HVKA 4FV6A 4I0RA 4OLIA 5I9ZA 3A7JA 4MWIA 2BKKA 1WBPA 2ITVA 1ATPE 4OT6A 4BCOA 4L68A 4ZMFA 4O7TA 4V0GA 3ROYA 2IVVA 1FMKA 1KWPA 4ONAA 4PPAA 1SMHA 3ZFXA 4DFYA 2R7BA 2VTPA 4FT5A 2QU5A 5IF1A 5TE0A 3LM5A 2F49A 4MQ1A 4BRXA 5JGDA 3QLGA 3WYYA 3II5A 1CDKA 4CV8A 2ITWA 2YM8A 4XV2A 3AGLA 3FLZA 4Y8DA 3MH0A 5AR5A 5BNJA 3COKA 3C5IA 4QP6A 4FNXA 3LJ2A 3PUPA 2XK9A 4FKUA 2ITUA 2J5FA 4J1RA 1JNKA 4CEGA 4BDKA 2RG5A 3BQCA 3QQKA 4W9WA 3TI1A 1KOBA 4HGEA 4NFMA 2WMTA 1FVTA 4YZNA 3PVBA 4X2KA 3RK7A 4TWOA 1BKXA 5FM3A 4FT0A 3Q3BA 1OVEA 2IO6A 3EFKA 3GFEA 4RX8A 4CYJA 1Q41A 3OTUA 3OT8A 4FMQA 4FV4A 4LI5A 4E20A 5C26A 5CALA 4CFUA 2XEYA 5CENA 2RF9A 3KL8A 3SQQA 3SXSA 3DGKA 3FHRA 3Q96A 4ASDA 4J99A 4R5YA 3E64A 2XK8A 4FF8A 5HBJA 1A9UA 4P5ZA 3I79A 3ZH8A 4J95A 5IEYA 3NUYA 4V01A 2UW4A 3UJGA 1H1RA 3KK9A 2X39A 2HENA 1LP4A 3NW7A 1Y8GA 1YXTA 3L8PA 3KA0A 3NNVA 5EW9A 4AU8A 4M66A 5CF8A 4O83A 4PPBA 1REKA 4AZSA 3SVVA 4W4WA 1XH6A 3D83A 3MN3A 3F88A 5BVKA 2CKPA 4MXAA 3LFBA 1H07A 5AAFA 4Z16A 4UWYA 2I40A 4HW7A 1J91A 1FINA 2UW5A 2P2HA 2PE2A 4QYEA 4I41A 3GU4A 3NW5A 5BYLA 2BZIB 2YJRA 3WIGA 2O5KA 3ZDUA 5CZIA 5GJGA 1JBPE 4A9UA 5DOSA 4BDEA 1YW2A 3CC6A 3T3VA 4EWHA 1MRYA 4NT4A 4XUFA 1GY3A 3H3CA 3NEWA 3ALNA 2PPQA 4S32A 2CMWA 1JAMA 2YEXA 4UZDA 1UU7A 2H8HA 4GL9A 4KKHA 4KRDA 3TTJA 4EI4A 5DNRA 5EH0A 3FY2A 3KXZA 4G5JA 2X81A 2VNWA 1WBVA 1PHKA 2BIYA 3NUPA 4GRBA 5HE3A 3R21A 4AW0A 3R7EA 3OROA 1OKZA 2ITXA 2VTTA 4EH2A 1WCCA 3EQRA 5LMKC 3W2PA 4M14A 3TNIA 5E8ZA 3KGAA 2WU6A 4QP4A 3V5JA 3O17A 5AUUA 5CQWA 3WE4A 2O65A 4G6OA 3OY1A 4YZMA 4BGQA 5HZNA 4O7NA 3OEZA 3QRIA 4M15A 3JVRA 2FH9A 3ZBXA 4D2RA 3FI2A 4Y5QA 4LQMA 4DBNA 2G1TA 3RBWA 3EQHA 2QI8A 1M7QA 4ZZNA 1MRUA 3M11A 4RJ5A 4N0SA 4FV8A 3DKGA 2XRWA 4F1OA 5F95A 3Q32A 2JKMA 1SM2A 3TCPA 3PZEA 4BHZA 5J9ZA 2XIZA 3P5KA 3IO7A 1CM8A 1PY5A 1MUOA 4IC8A 5J79A 2B0QA 5E90A 4AX8A 4H3PA 4B6LA 2YERA 4YNOA 3BHTA 4AGUA 3Q2MA 1UNHA 2O8YA 2RG6A 4TNDA 1GAGA 3QD3A 5EKNA 3BEGA 1O6KA 1J1BA 4MBLA 4G2FA 3E7OA 3QL8A 4FZFB 3O7LD 4QRCA 5HU9A 5HNIX 3UOJA 4X3FB 4YTCA 5CNOA 4F63A 1UWJA 2GFCA 5ANKA 5KZIA 1YI4A 3FQSA 4AQCA 3NYNA 2G01A 5AUWA 2NRUA 3MTFA 3UVPA 4EOOA 3HNGA 4RBLA 2WTKC 5HLNA 4MD9E 4GT4A 4AGDA 4G3CA 4EUTA 5IU2A 1PXJA 4QMWA 3KN5A 5ANIA 3TNWA 5CU0A 4EBVA 2YIRA 1JPAA 4MD8E 4C3PA 2W7XA 3QWKA 3E3PA 3V6RA 1H1PA 3OG7A 1JOWB 4FG7A 5CU2A 1OUYA 5K4IA 3VW6A 2PVNA 2V55A 3OW3A 4YBKA 3MI9A 1YWRA 1B6CB 3A7HA 4FSYA 2I0VA 3F5XA 3D0EA 4DTAA 5J5SA 3EQCA 3OWPA 3R9DA 3ZTXA 3U6HA 2WMSA 2QG7A 4I0TA 4LMNA 5HO7A 4FIJA 5KZ0A 2HW6A 3CEKA 2BUJA 2CLQA 2WMVA 4O6EA 2W05A 4TL0A 3ORLA 3G0EA 5E92A 2PVFA 3FMKA 1IRKA 3AT4A 4OBQA 4QMXA 2P55A 4A4XA 2FSTX 2IN6A 4KIKA 5CVFA 1V0OA 5E8TA 3FPMA 1YQJA 3RK5A 5LMKA 3OHTA 3GC8A 3G6GA 3A7IA 2Z7SA 3L1SA 3MVHA 4FGBA 2GNJA 3RWPA 3LLTA 1WMKA 2UZEA 4DFZE 4IC7A 4L3PA 4USDA 5IQCA 1M2QA 2BROA 3HMMA 3S0OA 3GOPA 4JBQA 5FLFA 5D7VA 1DM2A 5J7BA 4FBXA 2ITZA 4PNIA
chains in the Genus database with same CATH superfamily
4FSTA 3UVQA 4UALA 3DB8A 2IG7A 3L9PA 4JOAA 2C5XA 3FZTA 4MF0A 3EYGA 1BI7A 2I0EA 1QPJA 3HV5A 3RALA 3ZSGA 4M0ZA 3RNYA 3ZZEA 3Q4UA 4DTKA 4U44A 5LARA 2Y0AA 1A06A 2PMNX 3OOGA 5AUXA 4R77A 4FV5A 4O0UA 3VUKA 5JRQA 4EC9A 4BY9E 2WQNA 3ZXZA 4TKSA 4LGDA 4ZS4A 3TDWA 4WO5A 3A60A 3LZBA 4TWCA 3EQFA 3FC1X 3I7CA 4NIFB 3W2SA 1O9UA 3KB7A 2WMAA 2OH4A 3DOGA 3PZHA 2IW8A 4CMUA 3KCFA 5HTBA 1Z5MA 3FZRA 3MY1A 4U6RA 4LL5A 5E8WA 3R1YA 2J9MA 5AR4A 3A62A 4GK4A 5AUZA 3WF6A 3R22A 4CKRA 5HIEA 1Q8UA 5M51A 1IAHA 3W0MA 4DINA 1FBNA 3RAIA 4RIYA 2QURA 4IZYA 5JGBA 3MGYA 5AV2A 3R8ZA 3VW8A 3KMMA 4ZY6A 1VEBA 1IAJA 5ANGA 3ROCA 4M67A 4YMJA 5C4KA 5AP4A 3GT8A 4FC0A 4FEVA 5CXHA 3ORXA 2BHHA 4AA4A 3VUGA 3ZOSA 4AT5A 4MCVA 4IFGA 4L00A 4RQKA 4I4EA 1ZZ2A 5GZAA 4MBJA 4D4SA 1TQPA 2OKRA 3R9NA 4FKVA 5FGKA 1UV5A 2X9EA 4P7EA 4EHVA 2GS7A 5L2QA 5AA9A 5FDPA 4L53A 3S3IA 5J8IA 4BC6A 2YIXA 2YCFA 2IWIA 1Q8YA 4R6VA 4WRGA 5DI1A 3DZOA 2GQRA 2YACA 4QMYA 3QKLA 2PYWA 3Q4ZA 4LOQA 3EL8A 3DK3A 3FKNA 3VS0A 1ZYJA 3TV7A 4H39A 4KSQA 4E6DA 4CCUA 3UDTA 1KV2A 3GC9A 4IFCA 3TUDA 4YPDA 1REJA 2CDZA 4RIXB 4AAAA 1PMNA 2VX3A 4BFMA 4CXAA 1Z57A 5EYDA 4ERKA 2OU7A 3OW4A 3MB7A 2V7AA 1KUTA 4JL9A 3ZRMA 3PXRA 3OCBA 4QD6A 3GNIB 3NW6A 4FI1A 1ERKA 2BPMA 4X0MA 4GVJA 5ANJA 4EONA 1OBGA 4A7CA 3W0NA 5CAQA 3DNEA 1PXNA 4E6CA 4FG8A 4L46A 2V22A 2PVJA 1XMMA 3R8PA 2X7GA 3UO5A 3EOCA 4HOKA 3IS5A 3ZDIA 2XMYA 3HX4A 4NM7A 5K5XA 4F70A 3BRBA 1WAKA 3HUCA 3MPTA 5C9CA 3VS5A 1ZYSA 5FQDC 2H9VA 3UVRA 4DG0E 2XNEA 1H1SA 4JQ7A 3ZBFA 4E93A 1VYWA 4BBMA 3WF5A 4WHZA 5BVOA 2X0QA 3QWJA 4K1BA 1RQQA 1XBBA 1XH8A 3E93A 2KTYA 3P9JA 4ZTQA 3RCDA 4ERWA 4XYFA 2XALA 3NLBA 5FEEA 3QRTA 3AT3A 3KU2A 3ZEPA 5HBEA 1FPUA 3WZEA 4ASXA 3SDJA 4FEUA 1W7HA 4OW8A 5CU6A 1W2CA 2JAMA 2PE1A 4YJPA 3OS3A 2JDVA 2XYNA 2UW9A 2J0MB 4B8MA 4A06A 1K9AA 1V0PA 3ACKA 3FHIA 4Q5HA 2XBJA 4KS7A 3AC1A 3CJGA 3KF4A 2OF4A 4IWOA 5CWZA 5JZNA 4F0FA 4QYGA 3ERKA 4BWXA 2PL0A 3FC2A 2UUEA 1H1QA 3B2TA 3GC0A 4FJVA 5DHJA 2W4KA 3HRCA 3E8DA 1Q8TA 4B7TA 4E3CA 2OH0E 3BLAA 3EFWA 1FMOE 5FG8A 5BUEA 3SG8A 3DLZA 5C01A 4FEWA 3V51A 2BZKB 3G5DA 3IW8A 3V5WA 3IDPA 4F7NA 3FKOA 1JSVA 2ACXA 3KVWA 4NW5A 4HVSA 1Q5KA 2WTDA 3HDMA 4O2ZA 3VUIA 1SYKA 2CGUA 4XP2A 5L4QA 2BAJA 4OR5A 4DGNA 3AMAA 4ZJIA 3C4ZA 2EVAA 5H8BA 4YC3A 4M69A 4NK9A 4YHTA 3QUEA 4N70A 4OTPA 4U42A 3VWAA 3KREA 1LEWA 5AR3A 4IANA 2QOHA 2YLFA 4IBMA 4BWPA 1GIJA 3UNKA 3F3WA 3LIJA 3Q4CA 4YJQA 4U45A 4C3FA 4JQEA 2PUNA 3R04A 4D9UA 3KCKA 4G3EA 4PMTA 5EM5A 5G1XA 1OITA 1OIUA 3DAJA 4P90A 4D2PA 2GSFA 3MJ1A 4ZMEA 2IZUA 3CGFA 5T6KA 3VBXA 2EXEA 4J97A 4BDAA 2C1BA 3G51A 3WZKA 3BHVA 3DB6A 5I9UA 4EOSA 2JC6A 4TYHB 3DQWA 2ITQA 4ZTLA 3EWHA 2PMIA 2R9SA 4KINA 2HW7A 3MIYA 4EOQA 3LFEA 4JBPA 1XWSA 5K0KA 3ZXTA 4F64A 4AZTA 3KRLA 3GEQA 4TTHB 1H24A 4C4HA 4GIHA 1U54B 3LKMA 1OB3A 5CU4A 3Q2JA 2J2IB 1UNGA 5TOZA 2P2IA 2VTOA 3T9TA 3V5QA 4EH4A 5JRSA 5HVJA 2Y4PA 5A4EA 5AP6A 1YDRE 1PMUA 3QTQA 3VQHA 1W98A 1M14A 4R7HA 3EH9A 4USEA 5H8EA 1DI8A 3ZUVA 2B53A 1OL6A 1GOLA 3QQJA 2XNGA 5HLWA 2JBOA 2ZAZA 2ZJWA 1K3AA 4L42A 5LMBA 3C50A 3FXZA 5AA8A 5AMNA 2R2PA 2Y9QA 5ANEA 2HOGA 3AOXA 3UZRA 4NCTA 4D1SA 3PSBA 4FGRA 2VD5A 3MH1A 3ZM4A 2X1NA 3VRZA 4AW2A 4ACCA 4DA5A 2QOKA 2AEGA 4XG7A 4EQCA 2GHGA 2VN9A 2W0JA 4GFOA 4ARKA 2W4JA 3VO3A 1E9HA 4GT3A 5JFXA 4D5HA 1LEZA 4DH8A 3EN6A 3VUMA 1XH4A 2JD5A 4KRCA 1KE5A 5CZHA 4N6YA 4C62A 5IH6A 3WARA 2ITTA 2YISA 3HP2A 3M1SA 3Q52A 5HGIA 3UQGA 5M09A 1H0VA 4CGAA 3UOHA 4F9AA 3BI6A 4NKSA 2EUFB 3R1SA 4RWLA 4XLIA 3FSKA 3COIA 4HCUA 4UYAA 4C57A 1S9JA 5HX6A 1Q97A 5FXSA 4FG9A 4BCPA 3AD6A 4AGWA 3MS9A 3RHKA 2Q0NA 5GNKA 3FZ1A 5LVLA 5HKMA 3KK8A 5KHXA 3VUHA 3KRXA 1YOLA 5CANA 1A48A 1NT2A 3VBWA 1PXPA 5CYIA 1WVYA 3H9FA 3LXLA 5IH5A 4RJ6A 2Z7RA 3BLRA 4AZFA 1WBOA 4HPUE 4B0GA 5IMXA 2BRNA 2AYPA 3Q4TA 3KC3A 3RTPA 3HEGA 3V5LA 4R1VA 1PMEA 3BX5A 3OC1A 3D5XA 5CSWA 4C7TA 5LCKA 4F0GA 4MX9A 2DYLA 4WBOA 4U79A 2GTMA 4FKPA 3QTUA 3U54A 4HYIA 1NVSA 2VU3A 3NRMA 2GNHA 1I44A 2A0CX 4RVTA 1GZOA 1JSTA 3SV0A 3UYTA 5EI8A 3DFCB 4FX3A 3ZHPC 4WRSA 3PUFC 5FTGA 4DE4A 3GQLA 3Q04A 3FWQA 3JUHA 3U9CA 4PTGA 2ZFYA 1STCE 2RL5A 4U3ZA 1YI6A 3R28A 4ZJJA 1HCKA 2FA2A 3PXZA 3F3ZA 2WQBA 2YABA 2VUWA 1H0WA 2QOLA 2VTJA 2J5EA 4ORKA 1OECA 3QCYA 3I7BA 5EK7A 3BV2A 4FKQA 2DWBA 2RSVA 4PDPA 5GJDA 1JKSA 3T9IA 2WMQA 3C4XA 2R3NA 4QQTA 3UQCA 3BU3A 4BCKA 1YRPA 2PZIA 1JSUA 2SRCA 5HIDA 4O7RA 2HK5A 2QOCA 4UZHA 3FL4A 1OI9A 2VWBA 3A2CA 3C4WA 2XNBA 3GBZA 2EB2A 5HNGA 3G15A 5AP7A 2ZMDA 2PZ5A 3O50A 2ITOA 4YJUA 2O64A 1WZYA 4CVAA 3W32A 3MW1A 4ZTRA 3LCSA 1APME 2JGZA 3GENA 2ZMCA 4ZXTA 2VTSA 1YI3A 4R3CA 2HCKA 2X8IA 1W2FA 4OTGA 4XBUA 4ANSA 4GKHA 4I24A 2JIUA 4M68A 2PVRA 2FSLX 4NJDA 3RHXA 3P78A 2DUVA 2WO6A 3GOKA 4W8DA 5GINE 5C8KA 2R5TA 4MAOA 2BHEA 5CASA 3WBLA 3R9RA 4O86A 5IUIA 4QMQA 4BIEA 3KMWA 4ASZA 1CMKE 2PULA 3KXMA 4IB3A 3R83A 2OBJA 2YDJA 3O8PA 4CT2A 1Q8ZA 4IM3A 3ZCLA 4BZOA 4RVMA 1U5QA 4ALWA 4F9YA 4Y5HA 4EH7A 4RC4A 4UWBA 5FXRA 3GB2A 4KIQA 5BVDA 1DI9A 2AUHA 3ZSIA 3EKKA 3UQFA 3QTIA 3DZQA 4JBOA 1JVPP 2WMUA 5CF6A 2XA4A 5M4UA 2FB8A 3PWYA 3VBQA 5LOHA 2IW6A 1LPUA 2BIKB 3EN9A 2ZV2A 3FE3A 1X8BA 4JIAA 4WG4A 5F20A 3C13A 1Q62A 2F57A 4K77A 4AE9A 1OIQA 2BDFA 3EJ1A 3UP2A 5CSXA 3IDBA 1F3MC 3VN9A 2E9PA 1TKIA 2VTNA 2W4OA 3S1HA 5L8LA 3VBYA 3HECA 3ZONA 5JT2A 3A99A 4IACA 4OTRA 3BIZA 3T8OA 2OZOA 3CE3A 3R7UA 3VS6A 5J87A 4BYJA 3Q5IA 4IM2A 4KA3A 4GW8A 4MNFA 4DEHA 1YXVA 4U97A 1QMZA 3UO4A 4BN1A 2YDIA 4EYJA 4HVGA 3SKCA 4JDJA 4J53A 3QTRA 3SX9A 2X4FA 2WNTA 4FL1A 1AGWA 1BL7A 4XRJA 2GS6A 3K2LA 2R3QA 4F6SA 1QPCA 4JAJA 4MNEB 4EK3A 5E4HA 3BCEA 3ORZA 2BAQA 4G34A 3H0YA 5C4LA 1RJBA 4K2RA 4TW9A 1G8JA 3RVGA 3DT1A 4GV1A 4ZOGA 3RP9A 4DEAA 4O0XA 4IZAA 4O0VA 2X6EA 1H27A 4GFGA 2BRMA 5M56A 1NA7A 2IW9A 4QTCA 3F9NA 2XNPA 1U4DA 3UO6A 4EHEA 5CEMA 4XJ0A 2W9FB 2OK1A 5FBOA 3BWJA 4J96A 2W17A 3CXWA 2R3LA 4FNYA 3G9LX 1TVOA 3UE4A 5J1VA 5J9LA 5B2KA 3TNQB 3TMOA 4A9SA 3PA5A 1MP8A 3DBCA 4JDIA 1DS5A 3AKLA 3KKVA 3D5UA 3FMEA 5A54A 1UU3A 5GJFA 3EZRA 3P08A 4BTKA 2ZV7A 2ERZE 2WU7A 5CSVA 3ZC6A 3ZC5A 2CKQA 2RKUA 4V05A 5DLSA 3W10A 3VQUA 3ZYAA 2E9VA 4GKIA 4PWNA 3UDZA 3UZTA 4GFMA 5A4QA 1CKJA 3DKOA 4QPSA 4RJ4A 2VNYA 3LFQA 3W16A 3U6IA 2UZBA 4GVAA 4M97A 2Y7JA 5BVEA 4CSVA 2W1EA 4J8MA 4DH7A 2WFYA 1S9IA 3PE1A 4K8AA 3WILA 2G2FA 2CCHA 4JVGA 1E1XA 4FKWA 3OXZA 2HZ4A 4DC2A 2PWLA 3ITZA 3OXIA 4N4SA 4GS6A 3F61A 5DR6A 3ATTA 4IB1A 2QVSE 5KO1A 5ACBC 4MXZA 4BDHA 2WHBA 5JQ5A 3W33A 4GUEA 5CEPA 4AXDA 3MFRA 4FT9A 4FKGA 4MD7E 3G6HA 3HUBA 2R3FA 3KXGA 2VTLA 2VX0A 3KRWA 4FKLA 4IVDA 4FK6A 3NVKI 1YHWA 2GNGA 1CKPA 5IQFA 3NUUA 4DAWA 4I0SA 4KUJA 3ORNA 4HVIA 3VHEA 4OTHA 2R3OA 2WD1A 4KIKB 3F5GA 3C51A 2GMXA 4RRVA 5HE2A 3NIZA 4XEYA 4KWPA 5FRIA 2I0YA 4QMUA 3P5JC 3GVUA 4K33A 4IHPA 2ETRA 1SVEA 1UU8A 2YDKA 4IAIA 5IQIA 1GZNA 3ACJA 5ICPA 3KXNA 2XIYA 4FSWA 1ZAOA 5E91A 1P14A 3D7ZA 3SRVB 2JIVA 3PA4A 3LHJA 5EOBA 4EOLA 3LVPA 3MFTA 4LGHA 4FR4A 4QYYA 2O0UA 3PJ2A 3AGMA 1H26A 5EW3A 5F9EA 1U59A 2V7OA 2YCSA 3FV8A 4MYGA 3TNPC 1IA9A 3R9OA 4YJNA 2YIQA 3C0HA 2C6MA 3SHEA 3W18A 3AMYA 3NNWA 3ZO4A 2PZPA 4DFLA 3MV5A 5D12A 2CHLA 3CD3A 2OI4X 3QC9A 4CTCA 3PE2A 5CNNA 3VS1A 4CKIA 4Z55A 3ATSA 2OXXA 3KULA 3FI8A 2BVAA 2OZAA 1WFCA 1PYEA 4MXOA 4BCJA 5J5TA 5DR2A 3A4OX 3D4QA 2XH5A 3MPMA 4CG9A 2W5AA 3CPBA 1G5SA 2B9JA 4XV9A 3FAAA 4IB0A 3VUTA 4B99A 2PUUA 2WTKB 4AT3A 4I1ZA 1AQ1A 2F7EE 4GU9A 4EBWA 3VNTA 4BTFA 4FYNA 4YTFA 4RIYB 2RFEA 3BHHA 2Y6MA 3BZ3A 3AKJA 4EJNA 3R8UA 1T45A 1YHVA 2XKFA 5E1SA 3MDYA 4BBFA 3PY1A 4RIOA 3QD2B 3QA8A 4ITJA 3ZFMA 5M4CA 3PVGA 3DBEA 5FEQA 4RFYA 1URCA 5EYMA 1PKDA 3IQ7A 4EYMA 2BTSA 3U6JA 2P33A 4FA2A 4D2VA 3QZGA 4QTAA 2HZNA 4ENXA 5CEOA 1RW8A 2WQMA 2JLDA 4QTDA 1LR4A 4LUDA 3PJ3A 4QTBA 3RI1A 4IAZA 4DGLC 3QALE 3OOMA 4GT5A 3GGFA 4RX7A 5FTQA 1QPDA 2C3LA 5JKGA 4AXAA 2XRUA 3W0SA 4DGGA 3NUAA 3V8SA 4J52A 2W1HA 4FODA 4FVRA 4CLIA 2J0JA 3R63A 4D0XA 3CCNA 1R3CA 3AC4A 4O22A 2X2MA 1JLUE 4EH6A 3TDVA 3DV3A 4H1MA 3E8EA 3PG3A 4G3GA 4RVKA 2J0LA 5AR2A 5D11A 4DTBA 2QG5A 4FOBA 4GCJA 5F4NA 4DYMA 2X0OA 3RM7A 3QD0A 5AADA 2GQSA 5BMSA 3FMMA 4KNBA 1Y6BA 5EOLA 4WOVA 5EKOA 3DTWA 4QMZA 4CFVA 4EC8A 3HYHA 5E9EA 4OUCA 3A4PA 4C35A 2BMCA 5LWMA 3R7VA 5AJQA 4N57A 4MTAA 2YJSA 3RPSA 3KQ7A 4IX6A 4EK6A 4RSSA 2QOIA 3OZ6A 4CLJA 2NYAA 4FE2A 2XP2A 5KX8A 2UW3A 4RZWA 3KRJA 4IE9A 3GU6A 3C4EA 4H3BA 4E6QA 3I6WA 5HI2A 3BE2A 4K11A 2VWZA 3DKFA 4MVFA 1OBDA 2AQXA 4NYEA 1OKWA 5AR8A 5H9BA 1Q99A 4CKJA 3WYXA 3G2FA 4HYSA 3DKCA 2QD9A 3PSDA 4FV1A 4RX9A 3WI6A 2XANA 4U80A 2VRXA 5CVHA 5DBXA 4IVCA 4L7SA 4JAIA 3LXKA 4TYIA 4APCA 4FICA 4XOZA 5M44A 4Y85A 3KVXA 3NNUA 2JDSA 3EYHA 5L2WA 3ZO2A 3MVLA 4EH8A 4TXCA 2H6DA 5E7RA 2C6LA 4G5PA 4D0WA 3LMGA 3BL7A 4HNIA 4LFIA 3JXWA 3DJ7A 4R7IA 2VX1A 2JFMA 4TYGA 1YOJA 4UB7A 1OMWA 4NTTA 3B8QA 3IONA 4EWQA 3BLQA 2XK6A 2GCDA 3F3VA 3CPCA 5HCZA 5C8NA 5HQ0A 2YM3A 3W1FA 4CCBA 1WBTA 2EU9A 4BDIA 3EQDA 1XBAA 1YKRA 2AC5A 4Y73A 5ANOA 2C6TA 3FJQE 4QMSA 2BDWA 5AX9A 4CV9A 5KKRC 5DIAA 4R5SA 3CQWA 3PG1A 4RLLA 4BCGA 2YLEA 4E7WA 4UMUA 5L2SA 3W0PA 1XKKA 1O6LA 4ANLA 4F6UA 4ITHA 3CQUA 5D7AA 5AWMA 3AC3A 2X2KA 3G0FA 4TPTA 3SOCA 4M69B 3ZU7A 3MWUA 4D1ZA 2XJ1A 4ASEA 1EH4A 2O3PA 3HL7A 2IVUA 4F09A 1GZ8A 2OGVA 2PY3A 3R7OA 5A4TA 2PZYA 4FOCA 1FGKA 4X7QA 3RPRA 3EN4A 3OUNB 4FUXA 2OXDA 4I5HA 3FI3A 4IAAA 3TZ8A 3SW7A 4IJ9A 2B4SB 4G3FA 5DH3A 4AA5A 5CEIA 2JKOA 4C4JA 1G8KA 3SAYA 4I94A 2UVXA 4ANNA 2EXMA 3ALOA 3FLQA 4D1XA 4UWCA 4IVAA 3CGOA 4IMYA 4WA9A 3OCGA 2YIWA 4AUAA 3M42A 5IQAA 2UZUE 3UNJA 4BI1A 4E4XA 4ZSJA 2CJMA 3RZFA 1B39A 3NCGA 5BVWA 4KIPA 5BUJA 3ORIA 5IDPA 4O4DA 2UZDA 1R1WA 1F5QA 2WEVA 2UW7A 4WUNA 2W1FA 3LJ1A 4IH8A 4XBRA 1ZLTA 2BFXA 4QPMA 3RGFA 4D9TA 2OXYA 4NH1A 4O84A 5IUGA 4LRJA 2WTJA 4E4NA 2J0KA 2UW0A 5CT7A 4FV9A 2PHKA 3PXKA 4JDHA 1P5EA 3R02A 3VF9A 3KIOC 1SNUA 4P2KA 4DBXA 2PVLA 4YHJA 4BCNA 3QQHA 5CSPA 4UBAA 1V1KA 4E5WA 4X6QC 3NGAA 4U43A 3IG7A 5DFPA 5HHWA 4C2VA 1WBWA 3TNHA 2YCQA 4WKQA 2FSMX 2QNJA 3F2RA 4L8MA 3ODYX 4BDFA 2B9HA 3N9XA 3UG2A 4S30A 4H58A 4AF3A 3TG1A 1VYZA 5D1JA 3GCPA 3A7FA 5HTCA 5IQBA 2Z02A 3QBNA 1H1WA 3D5WA 3VRYA 3F2AA 1ST0A 3VVHA 4MXXA 4CMOA 3BL9A 5LCJA 1ZZLA 2WXVA 2PE0A 3FYJX 4JDKA 2UZLA 4ITIA 3QUPA 4FTQA 2XIXA 4IZ5A 4WG5A 5HNBA 2J7TA 3BYUA 4LGGA 4XG2A 5TKDA 4ZTMA 3KEXA 4WSQA 1GIIA 2XS0A 1KOAA 4QDEA 4AXCA 3R71A 5IDNA 5DVRA 1BL6A 4PL5A 4B9DA 1DAYA 2ITYA 3DCVA 4PUZA 5E8YA 3LCOA 3QXPA 4X2NA 4JBVA 5AIKA 5C8MA 1GIHA 2C3KA 5LMAA 3RKBA 2YCRA 5IA2A 4C0TA 2VWXA 4X6RA 3D7TB 4O7VA 4HVDA 5K9IA 3K5UA 2R3HA 4I23A 4YBJA 3D94A 2BRHA 3ZLYA 4AOTA 2WEIA 2ETKA 2XCKA 3GU8A 3PJ1A 3FLNC 3E88A 3K3JA 4KAOA 4PTEA 1RDQE 4YLJA 3SLSA 3V8TA 5M4FA 4D4YA 5AV0A 3TT0A 5CAVA 4Y95A 4U41A 5BVFA 1XMLA 1OL5A 4AG8A 4XLVA 5CI7A 2VWWA 4FEXA 3F2NA 3H30A 5DEYA 4O2PA 2C6KA 3L8VA 5HTIA 2E9UA 4TRLA 3ODZX 2HELA 3ETAA 3L9MA 3F7ZA 3V5TA 3LFCA 3DQXA 4ZY4A 5I9VA 4LOPA 5LWNA 3EN5A 2HWOA 4HZSA 3DAEA 3UIXA 4ZAUA 5IQHA 4UX9A 1XH7A 5AV3A 1HOWA 2C0OA 2YN8A 4M3QA 3KFAA 4BICA 4E73A 5C03A 4BJJB 4FTCA 3Q9WA 3K54A 2G15A 4PMMA 1NXKA 4H1JA 4UXLA 5E8XA 1YWVA 3QGWA 4I5PA 4CFWA 3I5NA 4CZUA 3GXLA 1JWHA 4II5A 4RFZA 4XG6A 2QOBA 3CY2A 2ITNA 4D28A 5ETCA 4PX6A 4RPVA 3TZ9A 4AN3A 4F08A 5KMKA 1Q24A 2W5HA 4JG8A 4M13A 4XG3A 4U7ZA 5D10A 4DLJA 4YO6A 5EI6A 2JFLA 3TKUA 4RIWA 3REPA 4K6ZA 4YP8A 3DBQA 4HCVA 3FMLA 1PJKA 3R9HA 1OL7A 4C4IA 3PRFA 3RAWA 3FLSA 3LFSA 4OGRA 1OPJA 2XK4A 4R1YA 4ZLYA 2RFNA 3UC4A 4ZEGA 3HV7A 2ZDTA 2YITA 3OWJA 2OIBA 3ZUTA 2VWUA 5IA5A 4XCUA 1H00A 3G90X 2C68A 4BCQA 3VIDA 3DDQA 4EK4A 1AD5A 2UW6A 4TNBA 3COMA 4YZCA 3NX8A 4FTRA 3WE8A 4I6LA 4O7SA 4IAFA 5HESA 4M84A 3SD0A 2OJGA 2JAVA 1GZKA 3C0GA 5DA3A 2VTMA 3EQBA 4I5CA 4U3YA 4QP8A 3W8LA 2W1ZA 4PP7A 5EQEA 3SC1A 3LXNA 3U51A 4FNZA 5DRBA 4EQUA 3PPZA 3E3BX 4DEDA 5CVGA 4ZTNA 1G8AA 4UMQA 4HJOA 4Q2AA 1KSWA 3T3UA 3FL5A 2ZB0A 3UDSA 4FIIA 2VAGA 4FKIA 3VS4A 5FBNC 1PKGA 3NS9A 4JT3A 3Q6WA 3NVMB 1XQZA 3R73A 5H8GA 4GG7A 3BV3A 2I0HA 1Q8WA 4O81A 1YDTE 2C69A 2C6IA 4KSPA 2QONA 4FVPA 4GU6A 3EMGA 4FSQA 5DEWA 2WMBA 5HD7A 5AAEA 4ZSGA 2HZIA 3UMWA 4BB4A 3PVUA 1XBCA 3RMFA 4E26A 4F6WA 2LGCA 5ITAA 1KV1A 1NVRA 5DMZA 3RAKA 4ZK5A 4X2JA 3QFVA 4KBKA 3R2BA 1R0EA 3OT3A 4IB5A 4KKEA 3L8SA 2R3MA 3DJ6A 3P1AA 1JKKA 4YLLA 3NZ0A 4TT7A 3ZLXA 4OT5A 4WT6A 3IW7A 2F4JA 5CTPA 3OMVA 2F7ZE 3ZFYA 2A27A 5FEDA 2QHMA 3CKWA 4QNAA 4QMVA 2ZV9A 4QMPA 5FTOA 5A4CA 1BUHA 2CSNA 2X7OA 5CS6A 2QO7A 1KE9A 3O71A 4F4PA 3ET7A 4QMLA 1H01A 4NL0A 4J8NA 3BGZA 4QYHA 2QU6A 2HY0A 4AXEA 4EHZA 3UC3A 5EW8A 3JPVA 3CS9A 1H25A 4B8LA 2HY81 3PP1A 5CAPA 5LJJA 3M2WA 5AV1A 3TKHA 4KBCA 5I0BA 4JQ8A 1IEPA 4Z3VA 4S33A 4O1PA 3TEIA 4BDJA 4EH9A 4BYIA 4EEVA 2C47A 1NW1A 2PVMA 5CEQA 3RZBA 2R0IA 3CQEA 4GEOA 2ZDUA 4ACHA 4K18A 5IQEA 4FKTA 2VTHA 3QTWA 2YM7A 4QP2A 5BYYA 1OKVA 4IDTA 4S2ZA 5IA0A 5LXMA 4O7YA 3D5VA 4ANOA 4FL3A 4Y83A 2Y4IB 5HVYA 5I9WA 2RFDA 4RA4A 5A6OA 3I81A 2XEZA 3PIZA 1M7NA 1FVVA 2UZTA 5KE0A 4QP9A 3QCXA 1H4LA 4L44A 3WIKA 4DG2E 1P4FA 4RWKA 4V0GB 3CKXA 2E9OA 4NUSA 4FKOA 4Q5EA 2ZM4A 1ZRZA 1R39A 5HG7A 3ML1A 3HMOA 2OJ9A 1PXLA 1ZOHA 3L8XA 4C33A 2A2AA 2WB8A 2WIPA 1R78A 3PLSA 2R3KA 4UY9A 4WNOA 3CIKA 5DT3A 3UMXA 3MIAA 2B1PA 4AP7A 4IWQA 4CRLA 4E4MA 3CTHA 1UVRA 4GMYA 1WBNA 3UIUA 4AFJA 2B54A 5G6VA 3OWKA 2WMRA 3IDCA 3IOKA 3DJ5A 4O0YA 4PRJA 1IR3A 4F1MA 3ZLSA 2DQ7X 4UMRA 3HV6A 5HIBA 3PLAE 3QGYA 3DLSA 3VC4A 4C34A 4PY1A 2YZLA 2CGVA 1M17A 2IVSA 3MYGA 4G16A 3UTOA 2J50A 5AM6A 4IW0A 4F0IA 3UDBA 2C0IA 2IJMA 4LRMA 3GCUA 3I60A 2HIWA 3AC8A 4CQGA 3ORPA 1BX6A 3O0GA 2GTNA 3QZFA 4UXQA 3UG1A 4TYJA 3W2RA 2NPQA 3DBFA 3PYYA 4QYFA 4C3RA 3G9NA 5C27A 3U9NA 4C58A 4XG9A 1FGIA 2QO2A 3MVMA 4HYHA 2VWIA 3F3UA 4C4GA 3TYKA 2GHLA 3SG9A 2IEWA 5K5NA 4ZIMA 1FOTA 4BDCA 1OPLA 3WF8A 4MQ2A 5BV3A 4BCHA 4LUEA 3BU5A 3PSCA 2Q0BA 1H08A 2WMXA 2BRGA 3VF8A 2UZWE 3DFAA 5I9XA 5ETFA 1M2RA 4O27B 3ID6C 1FQ1B 3P0MA 4G9RA 3ZMMA 2JBPA 4HGSA 5CAUA 5J1WA 4IJPA 1FVRA 3FUPA 3A61A 4I93A 5KUPA 1OPKA 3BQRA 3ENHA