2WTIA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
286
Chain Sequence
SVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CHECKPOINT KINASE 2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 286
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtiA01
3ZC6A 1WVXA 3P7AA 5KBRA 4N0SA 3JPVA 3LJ0A 4IACA 4LM5A 4RJ5A 5M44A 4C4JA 2OH4A 2OF4A 1FVRA 1M7QA 4QP8A 4YJQA 4FEUA 1ZARA 4QTBA 4B8LA 1SNXA 4BBEA 4BI2A 4O7NA 2W9ZB 1M7NA 2BRNA 3N9XA 2QURA 5CVGA 3W2CA 3SX9A 1M17A 2GHGA 3HMIA 3R7GA 4GUBA 4KB8A 4KNBA 4X3FB 3ATTA 3RTPA 4OW8A 3DFAA 1OPLA 3QZHA 1YI6A 2Z7SA 3BHHA 3HNGA 4MQ2A 5AR7A 3HKOA 4AACA 1QL6A 2HZ0A 2XIYA 3P9JA 4X0MA 4D2VA 3HL7A 5D1JA 4E7WA 5LVPA 5CLPA 3VS5A 3VUDA 2BKKA 3MVHA 2BFXA 5GZ9A 4ERWA 2R3OA 4P90A 2JC6A 1OIUA 2X4FA 4XX9A 3WZUA 4IEBA 4BCMA 3AMAA 3FZPA 4EONA 2QOLA 3BLRA 2VV9A 4S30A 4IFGA 5AX9A 4EK8A 2RKUA 3NNVA 2YM5A 5JZNA 1PRYA 2E9UA 2GHLA 3NX8A 4NM0A 3D2IA 3NAYA 4Q2AA 5HIDA 3RVGA 4L44A 5AA9A 1ZOGA 1YXXA 2JAVA 3PWDA 4QMOA 2E9NA 3Q53A 2XA4A 4FV5A 3DLSA 4BCFA 2SRCA 1H1WA 4DBXA 3BYMA 3QKLA 3E5AA 3F3WA 4O2ZA 4O91A 4ZTNA 4FTMA 4DITA 3OOGA 4MF0A 2JDSA 4QOXA 4FYNA 2OWBA 1GNGA 3U6IA 2RIOA 2C5YA 5FTGA 4FC0A 3H30A 3NUAA 2R3KA 4OT5A 5M06A 1OIRA 3L9NA 3PIZA 1R1WA 4CRLA 4CV8A 4D4SA 5B2MA 4JBPA 3ELJA 4QP7A 2PUNA 2WMSA 2YIYA 4GW8A 1XO2B 1JBPE 4AGDA 2ZAZA 3QA0A 4F0GA 2R3NA 5EM7A 3IW8A 3FL4A 2XKCA 2C6TA 5EQPA 3O23A 1WBPA 4FSUA 2RG5A 5JQ8A 4DGMA 3GU5A 3EYHA 4C0TA 4L46A 3LVPA 3COIA 4HPTE 4YSJA 5LARA 4C34A 4EQUA 3Q9ZA 5IISA 4DTKA 4EOSA 4UB7A 5DBXA 2CN8A 3D15A 5A3XA 3V6SA 4F9YA 3BHTA 4IM2A 4HYSA 4FV4A 3MPMA 2XCKA 4RIXB 4Z9LA 4FKRA 4BWKA 5KMKA 2I6LA 3BKBA 2Y4IC 2OG8A 4FSMA 1PKDA 4U79A 1GZKA 1ZLTA 5IUGA 4W4XA 2J5EA 5C26A 3CPBA 3ORTA 2BZKB 3HLLA 4L7SA 5ACKA 4EKLA 4C4HA 5CEPA 3FYKX 4XV2A 3UNJA 4CQEA 4EK4A 4I5PA 2X9FA 4EJ7A 4RC4A 4AA0A 2PUIA 3V5TA 2WU7A 3D14A 4TWCA 4EBWA 2BHEA 1RJBA 5IA2A 2ZYBA 4W9WA 2JAMA 4KBCA 2XYUA 3Q9YA 4WSQA 4NSTA 5JFWA 3AMBA 4PL5A 1QMZA 4G3GA 3ZMMA 5BYZA 5EYMA 2YIRA 4G3CA 1Y8GA 4GU9A 3GOKA 1YHSA 5JGAA 5L8KA 2GCDA 4XJ0A 3QXPA 2Q0NA 3VBYA 3Q6WA 2OSCA 4D0XA 1GZ8A 1OIYA 1O6YA 1X8BA 2J0JA 1PMEA 4OAVB 3RGFA 4B0GA 1ATPE 2JDTA 3ZM9A 3O8PA 1WZYA 4GIIA 5A4CA 3FHIA 2PUUA 3R21A 4F7NA 5F9EA 2WMTA 4QMPA 2XM8A 1FINA 3NNWA 4AA5A 2W9FB 3OBJA 4O7RA 4W8DA 4FKWA 3LMHA 3LQ3A 3TDWA 4O22A 4RBLA 4QMSA 1NW1A 3KXZA 4K77A 4L8MA 3VUTA 1ERKA 2QLUA 2ZMCA 3E87A 4AE9A 1RE8A 4X2JA 2QKWB 2Z60A 2WOTA 3ENHA 4XG3A 3LCOA 4K11A 4AN2A 3NYXA 3FMMA 4AZWA 2I40A 3B8QA 3R1SA 2NRUA 1A9UA 4I5CA 4RMZA 4TYHA 4D9UA 3I4BA 5AJQA 1WBOA 3ZSHA 1WBTA 2X7GA 2HYYA 4C2VA 3R9RA 4CVAA 4G16A 2B9JA 2ZM4A 4ZSJA 3U4WA 4AAAA 4BGQA 2WXVA 4DH3A 5HKMA 4HCVA 4HZSA 4RLLA 1HCKA 3SW4A 1MRYA 2GNLA 2W1FA 3OXIA 3ZDUA 4A4LA 1GAGA 3VBTA 4WG4A 4K9YA 4ZS0A 2UZBA 5EI6A 2BTSA 5J1VA 4I6HA 2ZOQA 2YWVA 5EH0A 2GNFA 4DH8A 2W05A 3GT8A 4XP2A 1B39A 5GIPE 2G15A 3ORLA 2OF2A 3QTSA 4NZWB 4JRVA 5TO8A 3R9OA 2WNTA 4BYIA 2F2CB 5AMNA 1XQZA 3PJ2A 2ITOA 3W8LA 3G33A 4WUAA 1ZY4A 4FTCA 1FVTA 2WMXA 4GFGA 4ZTSA 3DU8A 3U8WA 2DQ7X 3R1YA 5CSXA 2UW3A 3D5WA 2PVJA 3QBNA 4S32A 3IDCA 3OCBA 2CLXA 4C2WA 2VO7A 4U97A 5CEMA 4O82A 4ZSLA 4UY9A 5F95A 4D4VA 1ZMWA 2V7OA 5E8UA 4U40A 3MB7A 4UYAA 2PMIA 4U44A 5F4NA 1P4FA 3MY0A 4M69B 3D9VA 5L4QA 4CT1A 3F66A 3ID6C 4DGOA 4O7SA 2QC6A 1K9AA 2IN6A 2WQOA 2WZJA 3E8NA 4AT4A 4YJPA 5FGKA 3BQRA 1NA7A 1CTPE 4DN5A 4PTEA 2F49A 4BL1A 3MFRA 3FPMA 2WQEA 3RZFA 3WILA 4C3PA 4YBJA 4AG8A 5ANKA 3LFSA 4R3PA 3RJCA 3TKHA 3KRXA 2ITWA 5HG9A 3KRRA 3GFEA 3NYVA 3CE3A 3QD3A 5CU3A 1DAWA 4FMQA 5A6NA 2VGOA 3UQFA 1UNLA 3LAUA 3SV0A 4BCIA 4QPMA 1DI8A 4DG3E 4Y5QA 3SAYA 2XM9A 3O96A 3CR0A 3BGQA 3W32A 2FSMX 5CI6A 3E3PA 4ALWA 4ANNA 4RIWB 4KWPA 3ZLSA 3QQJA 4FTLA 4BDKA 3QRKA 4AZSA 3U54A 5H8GA 3P1AA 2UVYA 5DPVA 2VTQA 5IQFA 2VZ6A 3NDMA 2NP8A 2IO6A 4IXPA 4YHFA 3GCPA 4J7BA 4TYEA 4ANQA 3SXRA 5BUJA 4CMUA 4Q5HA 1Q8YA 5C03A 4MWHA 4J97A 5AR5A 4MWIA 3H0YA 3ZOSA 4RFMA 4BKJA 3RCJA 3A61A 1EH4A 2UV2A 5CVHA 4AE6A 3S95A 1XR1A 3QWKA 2VWZA 3OD6X 4G9CA 5I5ZA 5HG7A 3LQ8A 5I9VA 3U9CA 3V8SA 4M0ZA 3F9NA 3QZIA 5A4QA 3OWJA 3EFJA 3TZMA 3IK3A 2FSLX 3F6XA 1ZMVA 4EL9A 2BIYA 3F61A 4GVJA 4CFWA 4QMZA 3THBA 4RX5A 5L2TA 5E8SA 4WOVA 4QQ5A 2EXCX 2BHHA 1XBCA 4X6QC 5DFPA 4ZXTA 1YXSA 3ALNA 5M07A 5BNJA 4CZTA 3NNUA 5CF4A 5AUTA 4W4WA 4FV0A 3KK9A 2WELA 4B99A 4YU2A 5FTOA 4JT3A 2AC5A 4MNFA 3O7LD 2PUPA 4Y73A 2XH5A 3GUBA 3E8CA 4IZYA 4TYIA 4ZIMA 5BX0A 4ACMA 2UW4A 3EN7A 1CSNA 4QMUA 4Y83A 5CF6A 3H9FA 3NW7A 2H9VA 3GVUA 3VBWA 4F65A 4HGLA 3DV3A 4OR5A 4V04A 5CXHA 4M68A 3UYSA 2UZVA 2GDOA 3DJ7A 3QTWA 4K33A 4G34A 5HHWA 4QTDA 4P5ZA 3ZFXA 4DA5A 4CTBA 5JQ5A 3EN6A 2X8DA 4YC6A 4HGSA 4KS7A 5CU2A 4F7JA 5I3RA 1SNUA 4ZTRA 5BVKA 3ET7A 4YTHA 4EOQA 4ANOA 3FY2A 2WAJA 3NNXA 4KS8A 1MRVA 2CGUA 4V01A 3ZONA 4ITHA 4CCUA 4E93A 1U5RA 1SVGA 3OXTA 5KZ0A 3ZO2A 5HVKA 3AC2A 4Z3VA 4MD9E 3T8OA 2WTIA 1IG1A 3R00A 2YIWA 2OK1A 4HCTA 3VJNA 1OL5A 2NO3A 5IA0A 2BZHB 5EI2A 2A2AA 4KAOA 2JKKA 4J95A 2E2BA 4LRMA 3TV6A 4FV2A 2EWAA 4GJ2A 3FXWA 3SD0A 4E6CA 1IR3A 3I0OA 3F3ZA 4APPA 2UZWE 3R8VA 4XG9A 3OEFX 4R6VA 4AZEA 2B7AA 5EDPA 3ZS5A 3C13A 2XK7A 4BKZA 4WG3A 4ASDA 1BL7A 2B0QA 3H4JA 3UC4A 4FZAB 3LXNA 3HRFA 4FKUA 2ZV9A 3SDJA 2P2HA 3KK8A 3MVLA 2FUMA 1TVOA 3FMEA 4QMQA 2BRMA 4OTIA 4RLKA 4XG8A 2YM4A 3UOHA 5E1EA 2R3LA 2W7XA 2HCKA 4OBPA 4M3QA 3GP0A 4RX9A 5HO8A 3VC4A 2QONA 4JJRA 1FMKA 2B9FA 4F0FA 3FI3A 3ZXTA 5CAPA 5AR3A 4AGUA 3LMIA 3GC9A 5CNNA 3LCTA 3ZH8A 2QR7A 4F4PA 3WZEA 4TRLA 2HWOA 5IQBA 5CU0A 5K0XA 4R1VA 2VWVA 3TKUA 3L8SA 4FV3A 4USDA 5M56A 4I22A 2P3GX 2RG6A 3WZDA 3G6HA 1PMVA 2C4GA 3NS9A 4NIFB 1WAKA 4FKQA 4D2SA 1XHAA 1PKGA 4YO6A 3U6HA 1L8TA 4FEXA 3C0IA 5GIOE 3FC1X 3QTRA 1MUOA 4RVTA 1Q5KA 4FOBA 4HYUA 4XP3A 3KFAA 3V01A 4DFBA 3W1FA 3IW6A 3FSFA 3AQVA 3HGKA 3VS2A 2OBJA 3GENA 4GVAA 5BVDA 3C4FA 2XJ0A 3QF9A 4FVRA 4KA3A 3QCSA 3EKKA 4UWCA 3RM7A 4XCUA 2C3LA 4DH5A 3WF5A 4J1RA 3W10A 1YKRA 1XJDA 2C0IA 3Q04A 5I9ZA 3BBTB 3TXOA 3UDBA 3A4PA 3NGAA 3R73A 2OZAA 4DLJA 2VNYA 1Z9XA 5FEQA 2VTSA 1AGWA 3TTJA 1B38A 5HCZA 3WZJA 2NPQA 3OMVA 3P08A 2XKEA 4C37A 2CNQA 4FL1A 2QOQA 3K2LA 4QP1A 3C5UA 5AUXA 4XNEA 3SRVB 1YXVA 3OCSA 4ZY4A 4CD0A 1K2PA 2XNGA 3F3TA 4I6QA 4IMYA 5CQWA 4MVFA 2VWWA 4C59A 4BZOA 5EQYA 3UP2A 4EJNA 3OS3A 2VX3A 3COMA 2ZV7A 4GT3A 4YLLA 4DC2A 4WT6A 3KMUA 2DS1A 2XIZA 4FOCA 3O2MA 4XLIA 4CFXA 5CNOA 4N70A 4TYHB 4EH5A 1AQ1A 3K3IA 1O6KA 2I0EA 2JDRA 3F5GA 5JFSA 3FAAA 2PTKA 3FKLA 5AIRA 2W5AA 2ZVAA 3FLSA 3HMNA 1ZOHA 3BYOA 1NXKA 4OBOA 4JX3A 1H27A 2UW5A 2AC3A 4AT5A 4FEVA 5FQDC 1YI3A 2R3JA 3PLAE 4KRCA 2YFXA 4UV0A 3O71A 3QRJA 2ITZA 5EM8A 4E3CA 2OJIA 3PXQA 2X2KA 3IKAA 2C1AA 3PY1A 5EKNA 3MH1A 5A4LA 4XH6A 4RJ4A 3OWLA 3BI6A 5G1XA 4ZY5A 5IZFA 2O0UA 3PSCA 2UVXA 2UZDA 3F69A 3ORMA 5IEVA 4MKCA 5IKWA 5LXMA 5C8KA 4IW0A 5CF5A 5JFXA 3VO3A 5L6PA 4JS8A 3NCZA 4NTTA 4IVDA 3TDVA 5CXZA 1ZXEA 2IZUA 2QVSE 3VS6A 3D7ZA 1SVEA 3P7BA 3TCPA 2ZV2A 1J7IA 4KUJA 5ETCA 1OB3A 2V0DA 3I5ZA 4HOKA 2PVRA 5K5NA 5AX3A 4QQTA 2WMAA 4FV6A 5DE2A 1XH6A 2QQ7A 3FBVA 4AF3A 2J51A 2JIUA 2CGVA 4FNXA 1JSTA 2ITQA 4TYJA 4UBAA 4KBAA 4AGWA 2CCHA 4FYOA 2FSOX 5DLSA 4WNOA 2WB8A 4AZVA 4OAUC 3CKWA 3H9RA 1VEBA 4QP6A 3QC4A 4E20A 5C4LA 2XKDA 4BC6A 3UPZA 3OFMA 4E4NA 5AR8A 1YWNA 3NPCA 4I0RA 3V6RA 3C5IA 2XNEA 2BDWA 2ESMA 2VTRA 3EN5A 4ERKA 3CBLA 4AQCA 3NMUF 3TZ7A 3HVCA 2OJJA 4FGRA 4O83A 4PWNA 4D4RA 3TNIA 1Q3DA 2JKMA 1BX6A 4YC8A 4X3JA 4ZEGA 3UO4A 3VS0A 5L8LA 1TQMA 3IECA 1FGKA 3ZC5A 4NCTC 4DBNA 5KX8A 2E9VA 2YAKA 2VO6A 4L67A 4PL4A 4QNYA 1V0PA 3VBXA 5LVLA 3G9NA 3VUGA 2IG7A 4NM3A 5E1SA 4BHZA 5AV0A 3PP1A 5A54A 2Z7LA 5KMMA 5EQEA 3DJ5A 4DE4A 5I9XA 1DS5A 2H34A 3G15A 5CALA 1P2AA 3I1AA 3WF7A 4NT4A 4L00A 4JBQA 2XK9A 2JKOA 1ZYCA 3KXGA 5M4FA 5BYYA 4CLIA 4O0UA 1URCA 3ACKA 1P14A 3JUHA 3P86A 4X3FC 3RBWA 2VN9A 2C6DA 4ZSEA 4CFFA 4R3RA 3AT3A 3QA8A 3FLNC 4QYYA 5IA4A 4DG2E 5M4IA 5DIAA 5M53A 1JQHA 3G90X 3AGLA 1FBNA 5TR6A 2R9SA 5AEPA 3BELA 2QODA 4RA4A 1UVRA 3EQIA 3G0EA 3CQUA 4GCJA 4AU8A 4CXAA 5JZJA 3DAJA 4R7HA 4D28A 1W0XC 1QPJA 5KMJA 4ONAA 4IX5A 4PDYA 5FEDA 4IZAA 3VRZA 3QRIA 3HA8A 4KIQA 5D7VA 3CEKA 4HJOA 4UALA 5E8ZA 3HUCA 4HVGA 3WIGA 4WRGA 1I09A 1H08A 3EZRA 4NFNA 5HU9A 4O6EA 3ZCLA 1E1XA 4FG8A 2XP2A 5HU3A 4GKIA 4FIHA 2PK9A 4I6BA 1YXTA 3E8EA 3IONA 4QYFA 1BMKA 2GHMA 2VX0A 1PY5A 4RIYA 4YZ9A 5HIBA 2IW9A 4BICA 3PRFA 3KRJA 3FMDA 2PZ5A 3R30A 4RA5A 3WYXA 5BVNA 5CY3A 3TIZA 5JN2A 3EJ1A 5IA5A 3QZGA 5TT7A 2AYPA 2HOGA 1KSWA 5BUEA 3UE4A 3VBQA 2Z8CA 3NAXA 4OTDA 1YWVA 3SLSA 3AD5A 3EQDA 4U3ZA 3ZLWA 5J87A 2J0KA 4O86A 4F63A 2GQSA 2WTJA 3R28A 4FUXA 4AP7A 4O0TA 5E8TA 4YMJA 3P0MA 3R1QA 5EG3A 5ACBC 4DFZE 3GXLA 4USFA 3NVMB 4N57A 3JXWA 3BE9A 4A9UA 3GOPA 2VRXA 3MVJA 4FKGA 1UWHA 4ITIA 4J8MA 1J7LA 5EHLA 2X6EA 4TY1A 1PXOA 3GC8A 5EK7A 4JDHA 5AFVA 2Y9QA 4A9YA 2GNJA 4Z55A 3QD0A 2J0MB 4TTHB 1PYXA 4LG4A 5DWRA 3BWFA 1W7HA 5DVRA 1APME 4DYMA 2XIXA 4FTOA 3O7LB 1LR4A 1BI8A 4X2GA 5DG5A 2CMWA 4YBKA 3RKBA 2Y4PA 4GFMA 3N4TA 2R7BA 3KC3A 3E3BX 2PE0A 2PVYA 3F88A 4QQJA 2XBAA 3TACA 4JQ8A 3VQHA 4DT9A 3UZRA 4D1SA 2W06A 3UC3A 3RK5A 5CZHA 4I5HA 2OFVA 3KMWA 4RJ8A 4FIFA 5JRQA 3DBQA 5AADA 2A27A 3F2NA 2O64A 3DBDA 3PUPA 4FK3A 4EOMA 5IUHA 2C6EA 5CU4A 2W4KA 5AV3A 4BYJA 4DFXE 3W2QA 3R71A 2VUWA 5HBJA 5B2KA 3QCXA 3UBDA 4DEEA 3HECA 3PG3A 2CKPA 4FKTA 4FODA 4IADA 2BALA 3EH9A 3TNQB 3BHYA 2UW0A 2XIKA 4JL9A 1BYGA 2QOCA 5KKRB 1UU8A 4BR3A 3QGYA 2Y6OA 2BIKB 2VTHA 4YLKA 4EWQA 1FMOE 3UIUA 4UEUA 3C4EA 4LGDA 3E63A 3A7HA 2ONLA 3A62A 2WTKB 3A8XA 3RK9A 3MFSA 3SXFA 5M51A 1BUHA 5GNKA 3IW7A 3MFUA 2RFDA 4OBQA 2I0YA 2F7EE 4LV5A 3L8PA 4FL3A 2VU3A 5F94A 4YHTA 5JGDA 3A7FA 4PF4A 5E90A 3TI1A 4Y85A 3TUDA 4OTFA 4KSPA 4N4SA 3R1NA 2WQBA 3E93A 2QD9A 2BAQA 1S9IA 2IW6A 1UKHA 2YITA 3EWHA 3R7OA 3AC5A 3R9HA 2EU9A 3LE6A 3G6GA 4QD6A 4DHFA 2YACA 3DKOA 3D5UA 2C6OA 4FTTA 3UG1A 5HD4A 5IU2A 4QP4A 5CSWA 4IFCA 2HK5A 3FI4A 2WD1A 2BROA 3PDTA 4FTIA 4FNWA 5HE3A 4FV1A 2C1BA 5AUVA 3Q32A 3ORNA 4RSSA 4DTBA 3MVMA 3AMYA 4RFZA 3ZEPA 1R39A 3QYWA 3R8PA 2W96B 2VTOA 4ITJA 3PXFA 3W2PA 2VTTA 3H9OA 3R8ZA 4EKKA 4C57A 4FA2A 2P55A 3EQBA 4WSYA 1Y6AA 2W1IA 4GL9A 4ZMFA 3W8QA 4DEHA 1H1SA 4Z7HA 3ZEWA 4DGNA 5K3YA 4BCKA 4CG8A 2PVFA 2YZAA 4I6FA 4V0GA 4QMYA 4XV1A 4QMWA 3SW7A 3KGAA 3KXMA 3Q4CA 2XK4A 1FPUA 2NRYA 3LXPA 3DXQA 2R0UA 4I93A 4BDGA 2BAJA 3GI3A 3LM5A 4EHVA 3BYUA 3F7WA 3KRLA 2OKRA 2ITVA 5ANOA 4JDKA 3WOWA 4GG5A 4DINA 3IGOA 4D5KA 1HCLA 3A8WA 4FG7A 4DH7A 5JH6A 3UQGA 4IZ7A 5G6VA 3D94A 2ZV8A 5HX8A 3BQCA 3MY1A 5B0XA 3MYGA 3C50A 4PQNA 3ZLYA 4CFUA 3FC2A 4XG6A 4YP8A 2YZLA 1OM1A 3AC1A 4PPBA 4YURA 4O0SA 3TNPC 2OO8X 3V5LA 2VTIA 4FZ7A 2GNHA 2CN5A 2EUFB 3IW4A 4BHNA 1Q3WA 4RQKA 1SYKA 3QRTA 5J8IA 4E73A 1Q8ZA 4IDVA 3COKA 1OKVA 2OH0E 3IQ7A 3TKIA 3R2BA 1YOJA 4FBXA 4TW9A 5C1QB 2WO6A 1J3HA 3G2FA 4F9BA 1WCCA 3UNKA 3KY2A 2WPAA 1Q8WA 3ORZA 3ZYAA 4HNIA 4GYIA 4G31A 3TUCA 3O17A 4F6SA 3WYYA 4W9XA 1P5EA 3ZZWA 1XKKA 2X6DA 2GMXA 2VO3A 4EH9A 4RVLA 2XMYA 4H1JA 1TKIA 3UVPA 3QC9A 3V8WA 3FQEA 5IH4A 4UZHA 4AWIA 3OG7A 2ITXA 3M1SA 2XF0A 4A9RA 4AOIA 3CGOA 4ACDA 3QKMA 4Y95A 4M67A 5CWZA 3LFCA 3FE3A 4FL2A 3LKMA 4O6LA 3QUDA 4QPSA 1Y8YA 3LIJA 2GS6A 4ENYA 5K4JA 4EZ5A 3FWQA 5K5XA 3HRBA 3E92A 4J53A 3KULA 3PVBA 1U46A 4IC7A 4LFIA 3LLAA 3FKOA 3HEGA 4IB1A 3CS9A 3V5PA 5CT7A 5GJGA 2BZIB 1ZYJA 2W17A 3JY9A 4FNZA 1P4OA 2R4BA 2PYWA 4LMUA 4UN0C 1Q61A 4YJNA 2VWUA 2F7XE 1UV5A 4FZ6A 2HWPA 2X39A 4Y46A 3RAWA 3ZM4A 4IBMA 4M97A 4ZZOA 2GQGA 3OROA 1GZNA 4XBRA 4UZDA 4F99A 4J99A 5BPYA 5M08A 4NH1A 4I4FA 2VD5A 1M2PA 3FLQA 3CSVA 2PSQA 2E9PA 2WMQA 5CEQA 4KIKA 4S33A 3QLGA 3EL8A 3DNDA 1VZOA 4PUZA 5I9UA 5KZIA 4O27B 3ULIA 5JGBA 5CEOA 4RC3A 4CRSA 4FT0A 4YUQA 4ZK5A 1R78A 5C8MA 1PXKA 3LFBA 3MDYA 1DM2A 1UA2A 3R01A 1GOLA 2ZJWA 3DAKA 5FD2A 4E4MA 2B9IA 4G6NA 3Q52A 4MXYA 4EH6A 3IS5A 4AZFA 1W83A 4ZLZA 2B9HA 5ANEA 4J8NA 2X9EA 3M42A 4PL3A 4U5JA 4E4XA 3E88A 3VS4A 3OBGA 1PXJA 2ITPA 2QO9A 5J5TA 4R77A 4QYGA 4FIJA 2O5KA 3KL8A 2WU6A 4R5YA 4UMTA 4BGGA 5KE0A 4L53A 2R3QA 5CANA 1W82A 2YLFA 3NUNA 4CZUA 4NM5A 5AP4A 3TZ8A 3VQUA 3RCDA 1YWRA 3LFAA 3D2KA 2VTPA 4KSQA 4OLIA 4MXAA 1H0VA 3UMXA 4AX8A 4IIRA 5IG1A 5M4UA 4E8AA 2CCIA 4YJRA 4BCJA 4C38A 3N4VA 4RGJA 5HD7A 2C6MA 4U7ZA 4NJDA 4PMTA 3V04A 4XG4A 5DT4A 4G17A 2I0HA 3ZHPC 1KE9A 3R7EA 3FLZA 3L9PA 5HO7A 5FDPA 2V22A 4QMVA 1IEPA 4JG7A 1ZWSA 4F6WA 4GKHA 4ACGA 3BGPA 4D1XA 3LJ1A 3Q96A 4EK5A 5HGIA 4ACCA 3TJCA 4EOIA 2W1EA 3OEZA 3GC7A 4E5WA 2YDKA 4IC8A 4EOLA 4BCGA 2WGJA 4I5MA 1JWHA 4ANSA 2VWIA 1O9UA 2CGWA 5AM7A 3DKFA 1AD5A 3W55A 3C1XA 4OTHA 3CQEA 1U54A 4F7LA 1H0WA 3C7QA 3R2YA 3PVGA 3MIAA 3F3UA 5E8WA 4GIHA 2UW6A 2OU7A 3DTWA 2JKQA 4KBKA 3RPSA 2Y0AA 3SXSA 3VVHA 5HNIX 4MNEB 3MIYA 4Z16A 1H1RA 1GZOA 4AN3A 4QMLA 3N51A 1WVYA 1BKXA 3CD3A 1Q41A 4CCBA 1YHVA 3K3JA 2VTLA 4B8MA 2YCFA 3N4UA 4GT4A 2W1GA 4FEWA 4U0IA 3PFQA 2XJ1A 4O38A 4BIDA 3RWQA 5EHOA 2J90A 2C5XA 3OWKA 4TZRA 2V55A 3LFDA 4O0WA 4U43A 2QNJA 4CKRA 4FSYA 2YIQA 4CLJA 2CHLA 4G3DA 4O7TA 5IQHA 2KULA 2YAAA 4FIEA 4EH3A 4LRKA 4FT7A 4DCEA 4WG5A 4WNMA 4YGAA 4ZTQA 3QKKA 2BUJA 2YERA 3I79A 2H8HA 3IOPA 3H3CA 1A48A 4BBMA 3SG9A 4MXCA 4C4EA 5CENA 3SVVA 4ID7A 5DT3A 4JVGA 2P2IA 2EB3A 2QOIA 4BWPA 4YO4A 3QD2B 4DT8A 2E9OA 4HNFA 5IUIA 3ORXA 3C9WA 5GZAA 2JIIA 3QQKA 2OI4X 5M57A 2I7QA 5J9YA 2OIBA 4CFNA 4QP2A 5E9EA 2ITYA 3DQXA 4UMUA 3RPYA 4CMOA 2B54A 4ZLYA 3II5A 4C35A 2IZTA 5JEBA 4TL0A 1RDQE 3RWPA 3LQ5A 3GB2A 4EUTA 3F2AA 3LFEA 3SOAA 3GGFA 4F08A 3C4CA 4PMMA 3RPVA 4WA9A 4GJ3A 3LCSA 1YRPA 5E8VA 3LHJA 5F1ZA 3RINA 4GT5A 3VUIA 2CNUA 1SM2A 3ZBFA 4IH8A 5LMAA 5B2LA 3R8MA 1IA8A 5D7AA 4YPSA 5I0BA 1OKZA 2GTNA 2C5VA 5ITAA 1M14A 4AUAA 3A7GA 2H6DA 1UU7A 2B4SB 3Q4ZA 4C61A 3QHWA 5J95A 2G01A 1L3RE 2ERZE 2QOKA 2QR8A 3A99A 2GS2A 2QKRA 3KN5A 3QD4A 5AP1A 1LPUA 5I4NA 3JVSA 4MX9A 2CNVA 3VIDA 3NZ0A 3ODYX 4I4EA 4PNIA 4B6LA 4NCTA 4XG2A 2IW8A 3QALE 4IVBA 2BDJA 3C51A 2HIWA 5H3QA 4C8BA 3BBWA 4FVQA 2WHBA 3GEQA 1PMUA 4BTJA 4ENXA 1PXNA 4FV7A 5IQGA 4ASZA 4OTRA 2BPMA 2OJGA 3NUSA 3D5VA 3PSDA 5HOAA 2ETRA 3FY0A 3QQHA 5KCVA 2JGZA 2WQNA 3EFKA 3DBEA 3GC0A 5KO1A 3VJOA 3DKCA 1OPKA 2GPHA 2YJRA 3EOCA 5FP6A 4M0YA 5AAFA 3U87A 5IEYA 4BIBA 4UMQA 5JKGA 5CF8A 5IH5A 4EOOA 1PYEA 5FM3A 4X3FA 5ICPA 3WIKA 5LOHA 2JD5A 4EOJA 3FPQA 5IQIA 4UXLA 2F4JA 3SQQA 4LI5A 4FSWA 5CSVA 5H8BA 4AS0A 4EQMA 5HICA 4UYNA 4JXFA 3ZU7A 3OW3A 2QU6A 4AFJA 4O2PA 1WBWA 4MBLA 4D0WA 4FICA 2J7TA 3VW8A 2W0JA 4U9AA 4GH2A 4JDIA 4M12A 2R3FA 4PDPA 2ETMA 4Y72A 1VYWA 2VX1A 4MF1A 3GCUA 5CU6A 4YTIA 3QX2A 4A4OA 2GFSA 2HZ4A 3DAEA 2C3JA 4LUEA 5AA8A 2UZLA 5JRSA 2QOHA 4O21A 1FQ1B 4A4XA 4OTQA 3RK7A 2OIDA 2AUHA 5HORA 1YDRE 3EB0A 3P79A 2W4OA 4G1WA 3R7VA 2DYLA 4HYIA 4PV0A 3TUBA 1VJYA 3OZ6A 5EKOA 2H96A 4MYGA 3VUKA 2I0VA 4KABA 4QMMA 5IQDA 4IAFA 1J7UA 2YISA 3FZRA 2X1NA 3DZOA 1CKIA 3FI8A 1GIHA 2X81A 4Z7GA 5FP5A 2IVVA 5DGZA 1ND4A 3LOKA 2OXXA 4BB4A 3GCSA 3UPXA 5IQAA 2XEYA 3FMHA 3E7VA 3SG8A 2EB2A 2XJ2A 4XBUA 4JR3A 3ZFMA 4MK0A 4AA4A 3CY2A 5ANGA 3OC1A 4XP0A 2R3GA 3BRBA 3HA6A 4A07A 3R83A 4DFLA 3V5JA 2CKEA 3MA6A 4RJ6A 2EVAA 4YJOA 4E5AX 2Z02A 3ALOA 4MD8E 4O0YA 3KU2A 3V5WA 3WZKA 4FSZA 4RIXA 3MH3A 4NU1A 1CKJA 3I6UA 2EXMA 3OXZA 3W2RA 3C0HA 2C5NA 3F7ZA 2GS7A 3NIEA 4G3FA 4MBJA 3R63A 4MH7A 4TNDA 3KULB 2Z7RA 3LM0A 5K4IA 2IPXA 4I24A 4P5QA 2C3IB 2YLEA 4V05A 4NW5A 3CJFA 4CKJA 2PHKA 3BU6A 3ZFYA 4ANMA 2QCSA 1W98A 3FV8A 1ZZLA 5DT0A 4C3FA 3OUNB 5EDRA 2HY81 4ZSGA 4NJ3A 2X7OA 2RF9A 2F7ZE 2R7IA 2WEIA 2OICA 3M11A 1PXLA 3Q5ZA 3FZ1A 4LUDA 5EHYA 3VULA 3Q4UA 1H01A 3FMNA 2WOUA 4YPDA 3R0TA 3OUKA 3FMJA 4I94A 4XEYA 4TKSA 1BLXA 5KMLA 3MH0A 4LGGA 5IEXA 5HG5A 4IAIA 4EH2A 1H8FA 2BR1A 3E8DA 3PZEA 3RAHA 3IGGA 3HV7A 3JS2A 1Z5MA 3QUPA 4JAJA 3HP2A 3NUYA 3CP9A 5DH3A 1G3NA 3DTCA 4F0IA 5J1WA 4O7ZA 1OKWA 3G51A 4JQEA 1YOMA 3MS9A 3EQHA 1SZMA 3NW6A 3BE2A 3HV4A 4EHEA 1IAHA 2B1PA 2ZB1A 2C69A 4W8EA 2C30A 4TN6A 3R9DA 3PLSA 3Q4TA 4U42A 4I23A 3JY0A 4YJSA 3FYJX 3HUBA 3K5VA 5HVYA 2IVTA 3PY3A 5D12A 3PIYA 5CS6A 3OTVA 3QXOA 2UW9A 2UUEA 2QG7A 3QQUA 3CY3A 3ORPA 4X2FA 4LRJA 3UIMA 2WMBA 4GK3A 4OTWA 3GU8A 3R04A 4QPAA 5DI1A 2ZM3A 3R8LA 4G6LA 2PZPA 4BDBA 4NKSA 4PMSA 4AOJA 5EW8A 4D58A 3GCVA 3NCGA 1H00A 5DEWA 4MBIA 5EYKA 3KRWA 4YZBA 5AUWA 2Y6MA 4YSMA 1OUKA 3KMMA 1NVRA 4IWPA 4RWKA 4YZNA 3RI1A 4A9TA 3DCVA 3O51A 3I0QA 3PY0A 4H3BA 4O84A 3KXNA 4BCNA 5A46A 4M14A 4RT7A 3MH2A 4EOKA 3DK6A 3KB7A 3QCQA 3VS3A 1KV2A 3TZ9A 2JEDA 3A7JA 3PG1A 3ACJA 5F20A 3I7BA 3MW1A 2R3MA 1W84A 5KKRC 3BEAA 3F5PA 5IA3A 1NVSA 2XUUA 3PRIA 3DNEA 4G3EA 2VO0A 2DUVA 3MB6A 4IM0A 2QHMA 1OKYA 4ZMEA 3KCKA 4HVSA 3R8UA 4M69A 3UIXA 4L3PA 2WTKC 3ZTXA 1Q62A 4A7CA 4BCPA 3VS7A 4XV3A 2XK8A 4JOAA 3TWJA 4EWHA 4ZJVA 4AW5A 3MPTA 5TKDA 4PNKA 4QYEA 1OL2A 4C62A 4FTRA 2A19B 2UZOA 2PZIA 3Q9WA 4K18A 5HG8A 1F0QA 4KKGA 3WE8A 4K0YA 4BBFA 1FGIA 3Q2MA 5BYLA 1KE8A 2HZNA 1R0PA 4HYHA 4YNOA 2WIHA 3ZRMA 1PXPA 5ETAA 3LFQA 5AV1A 5C8NA 2ITUA 3WF6A 4WKQA 4EH8A 3BHUA 1CMKE 3ZUVA 2W1HA 5TF9A 3PVWA 2UW8A 5JT2A 4DF3A 1IAJA 4WD5A 5HNBA 5EOLA 4DEDA 4QMTA 5DN3A 5HE1A 3NUPA 4XV9A 3ZXZA 1SMHA 1VR2A 5IPJA 3ATSA 2WTDA 2FVDA 2P0CA 2X8IA 4J71A 4RIWA 5HCXA 5LMKC 1F3MC 2HY0A 4QP3A 4RWLA 5AUZA 3S4QA 1JKTA 4B7TA 1ZYLA 3MESA 4PDOA 3EHAA 5FBOA 2JFLA 4RIOA 1PHKA 5DNRA 2JBPA 2PE1A 5H9BA 3ENMA 3FZSA 3R7YA 2WTVA 2W4JA 4F9AA 4CFVA 4HVHA 4LL0A 5FDXA 3B8RA 4OGRA 4WO5A 5ETFA 4L9IA 3RHKA 4EOPA 3MTFA 5AP3A 2VAGA 3PJ1A 4O0VA 4CZYB 4E6AA 3PXKA 5KBQA 4APCA 4F09A 1IASA 1BI7A 1OUYA 4IANA 4FK6A 1H24A 4TYGA 4WHZA 3QTUA 4GU6A 5EFQA 4PDSA 2R3RA 3DDPA 5KHWA 4GMYA 4HZRA 4EH4A 3KXXA 3U55A 4FZFB 4QT1A 2UZUE 1ZOEA 4R7IA 1SVHA 4BI1A 4FV9A 5L8JA 2V62A 3TV4A 4J98A 4CV9A 1JSUA 2W1CA 3H0ZA 5IMXA 4FKPA 4FF8A 3DDQA 3NRMA 5DRBA 3ROCA 2OFUA 4W4YA 5CAVA 1JAMA 3U9NA 4C4GA 2VTJA 3P5KA 4EHZA 2O8YA 2J0IA 3BV3A 4NUSA 3UODA 3DFCB 3DOGA 2YM3A 4FKLA 5M09A 3PSBA 1Q99A 4FT9A 4JI9A 3FXXA 2GFCA 2FH9A 3BEGA 3U6JA 3VUHA 2XK6A 2BDFA 3I7CA 2F2UA 1R0EA 2HXLA 4R78A 4N6ZA 5GJFA 2XCHA 1S9JA 2FO0A 1QCFA 2EXEA 2KTYA 4WBBB 4BRXA 3COHA 4L01A 5T68A 5TOZA 3BLQA 3FQSA 1OVEA 4Q9SA 5DRDA 5AUUA 4NL0A 4NWMA 3EQCA 3OOMA 3NUUA 1F5QA 4MQ1A 4YZCA 4U6RA 2YEXA 3QQGA 2YCRA 4FV8A 4M84A 4ORKA 2PWLA 3ORKA 1ZAOA 2VWXA 2JDOA 3DXPA 5JFVA 4O81A 2I1MA 1CKPA 3DLZA 2W1ZA 4LOQA 3PA5A 4PPAA 4RX8A 3KVXA 1NVQA 3FSKA 3HAMA 3EQPA 4MXXA 4CYJA 4MTAA 2OJFE 2XVDA 4FTJA 3NYOA 1Y6BA 4OUCA 4FGBA 2OZOA 2RL5A 5LWNA 4XRLA 3TEIA 3T9IA 4EH7A 3LCDA 4ANLA 5HLPA 3L9LA 4I92A 2P4IA 2OZAB 5EW3A 4MEDA 3LMGA 4KINA 5AR2A 4BDEA 3CIKA 3LFFA 3ORIA 4CYIA 4F1TA 2GSFA 3QUEA 4AW1A 2HW6A 2RFNA 3DGKA 3DJ6A 1OL1A 3OCGA 3QU0A 3OF0A 3S2PA 5LVNA 4PY1A 5C27A 4MD7E 2PVNA 1GY3A 1FVVA 3I5NA 2W5BA 4GUEA 4KIOA 2PE2A 4ZTLA 4D2TA 3AT2A 2GQRA 4U81A 1LEWA 1V1KA 4JBVA 4D9TA 1G5SA 5BQ0A 1OECA 5C4KA 1T46A 4OTGA 1LP4A 3NEWA 4FKVA 5FTQA 4F70A 2QHNA 4K1BA 5AP0A 5J79A 4QP9A 5CSHA 5I9WA 4ALVA 1YQJA 4I21A 1TQIA 3AD4A 4BY9E 1R3CA 3NUXA 2B52A 3SA0A 4BDIA 1B6CB 2QO2A 2VGPA 1J91A 2XK3A 3FQHA 3CQWA 2PVHA 3HYHA 3LJ2A 3QCYA 3MA3A 3R02A 4I1ZA 4M13A 4TPTA 3SHEA 3UOLA 2C6IA 4DFNA 4CG9A 2O2UA 4DCAA 5GHVA 5DR2A 5BMSA 4NIFA 3CTHA 3NYNA 4FTAA 4FT3A 3POOA 4O7LA 1RW8A 3QZFA 2CPKE 3ANRA 2XBJA 5DEYA 4EYMA 5CAQA 4BDJA 3AT4A 3OP5A 4YR8A 2F57A 3QWJA 5EYCA 3S3IA 1OBGA 5I9YA 4DLIA 5LJJA 4RFYA 4BCQA 3OCTA 4Y5HA 3BYVA 2CGXA 2GNIA 5ANJA 1M52A 3PJ8A 4IJPA 5CSPA 5E4HA 3KKVA 3ANQA 4K8AA 2JLDA 4QTCA 3UJGA 1JLUE 1MRUA 3VF8A 2ZM1A 3QLFA 4EBVA 4ZZMA 1YXUA 1DI9A 3WARA 4EI4A 3VN9A 4PP7A 3OTUA 2CKOA 1KOBA 1PF8A 2GTMA 4E6DA 3LW0A 4H39A 4DGGA 4RZVA 3ZDIA 3HV6A 5FG8A 2FSTX 3IDPA 4L3JA 4FUYA 5M55A 3TNHA 4CMTA 4NYEA 2PL0A 3F5XA 5HI2A 2O63A 4D1ZA 3WF9A 3E7OA 1DAYA 4E26A 2BAKA 3P23A 3GFWA 2R2PA 4MXOA 3T9TA 2Z7QA 5CT0A 3PPKA 1ZYDA 2VNWA 3QQLA 4P4CA 4ZY6A 3B2WA 3SRVA 4L42A 1TQPA 3RAIA 4C4FA 3S0OA 3S1HA 4M66A 3OY1A 2WQMA 3IDBA 4IAYA 4S2ZA 3R22A 4Y8DA 3FMLA 2YM6A 3IO7A 4JG8A 3CTJA 3FMKA 4X2NA 3H10A 4FZDB 3WI6A 5B7VA 1UKIA 2WTWA 4WNKA 5HX6A 5FXSA 3VWAA 4RX7A 5KMIA 2J6MA 5L2WA 3FXZA 3NLBA 4U8ZA 3L1SA 2ZMDA 4S34A 3AG9A 1I44A 1Y57A 4JBOA 5HE2A 2PY3A 2OXDA 5I3OA 4U45A 1OI9A 5DR6A 3R7IA 4C7TA 3Q3BA 2J0LA 3DY7A 4TXCA 3MTLA 3PVUA 1MP8A 2G2HA 4GEOA 4IJ9A 3TTIA 5CVFA 1KUTA 1WFCA 3ZLXA 5EDQA 2XNBA 3ULZA 3UGCA 5J9ZA 5D10A 4KD1A 4JIKA 4I41A 4BTFA 3PJCA 4CKIA 4CSVA 5FEEA 1YHWA 4MAOA 5GZ8A 4YJTA 3CTQA 3GBZA 5FWKK 1OL6A 3QGWA 3BZ3A 2WEVA 1H4LA 1OIQA 2HXQA 5FBNC 4C02A 5DMZA 2J2IB 4BI0A 3WF8A 2BRHA 1MQBA 3UTOA 4UMRA 4BDAA 4NW6A 5BVOA 4IB3A 5J5SA 2IVSA 4F6UA 3NSZA 4MHAA 3EFLA 3GU6A 4ARKA 1PXMA 4A06A 4F64A 3TT0A 4YZDA 4W4VA 2F9GA 2FGIA 4X2KA 3QX4A 5FXQA 3VHKA 3HDNA 5IDPA 2QOFA 3FI2A 4CEGA 2ONLC 2XYNA 4QMXA 1H1QA 2UW7A 2OIQA 3FDNA 4G5PA 4XOZA 3RALA 4YTCA 1KWPA 3A2CA 1Y91A 2QOOA 1XBBA 4D5HA 2BMCA 3ZZEA 4EZ7A 5AR4A 2C68A 4JDJA 4ASXA 2OW3A 4KIPA 5CEIA 2VWBA 3HZTA 4L6QA 4DG0E 4FSRA 4FTNA 2Y4IB 2WMWA 4NEUA 1WVWA 2R0IA 1WBSA 2WTCA 3PP0A 4ANBA 4TNBA 3QL8A 5HE0A 2BRBA 2PVLA 2Y8OA 4RZWA 4FKJA 4XG7A 4DGLC 2UZNA 3K5UA 4IX3A 5A4TA 1YW2A 2CLQA 1WBNA 4FT5A 4RIYB 4X6RA 3ZUUA 4YJUA 5CAUA 2A4LA 4TWNA 1U59A 3QQFA 4AXAA 4F7SA 4BCHA 1ZYSA 3ZO3A 4DTAA 4RWJA 3POZA 1CDKA 4R1YA 4FIIA 2VTMA 3HRCA 3A60A 1XBAA 2HAKA 1XWSA 2R3PA 4FSTA 4JAIA 4XYFA 5HO6A 4FEQA 5J7HA 4XHKB 1U4DA 3PJ3A 4ZTHA 5L2SA 2XNOA 3VNTA 4O7YA 4ACHA 5JSMA 3PYYA 2X0GA 2R64A 4IDTA 3SGCA 3C4WA 4BTKA 2IVUA 3S00A 5AAGA 2QO7A 3BGZA 1UWJA 3HMMA 3ETAA 1PW2A 3JVRA 4IZ5A 2HZIA 4R5SA 4RJ7A 5DR9A 4PRJA 3DPKA 2PMOX 3UIBA 4ZTMA 3O50A 3TNWA 3UO6A 5CQUA 4NK9A 3AC4A 5D11A 4ZAUA 4OT6A 2XNMA 4EC9A 3FLWA 3MI9A 3BLHA 4M7IA 2XRUA 2QI8A 2R3HA 5E8YA 2RGPA 3Q6UA 3RPOA 4Q9ZA 4AW0A 3TJDA 2UZTA 4QRCA 3ZSGA 3CGFA 3D7TA 3ITZA 2G1TA 1PMNA 4IHPA 3DS6A 4Q5EA 4XS2A 1VYZA 2BTRA 3CLYA 3CXWA 5FM2A 2RSVA 2O3PA 2X8EA 1PJKA 5A6OA 4FSQA 4FKOA 5AP6A 3FKNA 5T3QA 1LEZA 4CNHA 4UMPA 5HTIA 1YDSE 3V3VA 5AV4A 2FA2A 2WMVA 3EQFA 4IAZA 3V51A 4NTSA 5GINE 3FZTA 3LXLA 4H36A 1G8SA 3EQRA 3NIZA 2PPQA 4F9WA 4HVIA 5KNJA 5IH6A 4LL5A 2A1AB 2ITTA 1QPEA 1YOLA 5E92A 4IQ6A 4LV8A 5HESA 2W5HA 3EZVA 2XZSA 4FE2A 5H8EA 3BWJA 3OVVA 4BGHA 3KREA 2FB8A 4EZ3A 4FSNA 3R6XA 2YCQA 4FKIA 1JKKA 4ZOGA 2CKQA 2IZSA 2J9MA 3GU7A 3I60A 3EQGA 4NFMA 3FL5A 1V0OA 2XIRA 1JSVA 4RRVA 4TT7A 3KVWA 3QYZA 4IB5A 3OWPA 4RVKA 4UWYA 3AXWA 4DEBA 3HDMA 3D5XA 1WBVA 4FKSA 4HCUA 4QO9A 5CX9A 3PWYA 1KE6A 3LFNA 3GCQA 4FIGA 3AC3A 3Q60A 2CDZA 4RC2A 4AOTA 3DK3A 4IAAA 3AGMA 1JOWB 5A9UA 2IWIA 5L6WL 3UYTA 4CTCA 1STCE 3P4KA 5KMNA 4F1OA 3L8XA 4L45A 3KF7A 5JK3A 4RJ3A 4WBOA 1BL6A 1UU9A 3NWWA 5J9LA 1M2RA 4FNYA 2V5QA 2QU5A 5HTBA 4RWIA 1Z57A 1OBDA 4RVMA 4ZSAA 5HZNA 2ITNA 4CT2A 2C5OA 3EKNA 4R3CA 5EW9A 3RHXA 4BDDA 5KHXA 4HPUE 3VF9A 4GRBA 3JR1A 5EYDA 3V8TA 2YCSA 4EYJA 3E62A 4XLVA 4HGEA 4BN1A 5LCJA 5E8XA 2XNNA 3AD6A 4QTEA 4S31A 2J50A 3EL7A 4G9RA 2YHVA 3LCKA 4AT3A 3CC6A 5HLWA 5KUPA 3K54A 2W99B 3HV5A 4I0SA 1XH7A 3F5UA 3SOCA 2PU8A 1KE5A 3EFWA 3LZBA 1OL7A 2X7FA 3UG2A 1MQ4A 5EI8A 4D55A 3P78A 3BU5A 4EEVA 4PMPA 1H28A 1OPJA 4LMNA 3Q9XA 4GYGA 5LMBA 3UQCA 4RQVA 3P7CA 3W2OA 2X2LA 3DB8A 3NR9A 1UNHA 4JX7A 4NM7A 5DHJA 3ERKA 4FG9A 1OITA 3A4OX 1Q24A 1M2QA 4JQ7A 4GG7A 4V0GB 5K9IA 5HCYA 4QYHA 2NNWB 4L3LA 2WFYA 5LWMA 3BYSA 3BHVA 3MFTA 3CKXA 2B53A 3V5QA 4IM3A 4D4YA 4E5BA 4XMOA 2ZDUA 3U4UA 3BV2A 4WRSA 1UU3A 2JBOA 2CSNA 4KKHA 1GIIA 4BCOA 4G6OA 3D0EA 3RPRA 1J1BA 3HP5A 3ZO4A 5EOBA 3W16A 5HEZA 1URWA 4CQGA 2VTAA 4EK6A 3DZQA 5DYJA 4ASEA 2ZDTA 5DOSA 1H26A 3AC8A 3ZRKA 2Q83A 4YLJA 2G2IA 4IX6A 3DKGA 4C36A 3VAPA 3A7IA 3UOJA 2REIA 4O1PA 2PVKA 4AW2A 5AV2A 2UVZA 4UXQA 1CM8A 4I3ZA 2PULA 3IG7A 2LAVA 3GQIA 5HQ0A 5EM6A 4ZS4A 1IA9A 1FOTA 4LQMA 5LVMA 1H1PA 3Q5IA 3VHEA 3G0FA 1XH9A 2Z2WA 3DT1A 4BWXA 4BTMA 5D41A 1GJOA 1XH5A 3RZBA 3T3UA 2R5TA 3T3VA 2PMLX 4ZZNA 4HW7A 5L6OA 2YJSA 3UNZA 4N6YA 1REKA 3EIDA 3FZOA 3MWUA 4H3PA 3SC1A 3IOKA 3W33A 4EC8A 1JKLA 3F82A 3OW4A 4O0XA 5LMKA 3BU3A 3MV5A 3VBVA 4XRJA 3KXHA 3MY5A 4BFMA 4B9DA 4LOPA 2O65A 2PZYA 3PE1A 4GK4A 3TL8A 5L3AA 3DXNA 2JITA 4BDFA 3VRYA 3UMWA 5AIKA 2LGCA 4PPCA 4OTPA 4O7VA 2C6KA 4X7QA 1KOAA 5AUYA 1KV1A 4PTCA 5EM5A 4G5JA 3O0GA 4FX3A 5LCKA 3BPRA 4B4LA 4DH1A 5KMOA 3VS1A 4E6QA 5IQCA 3PA4A 1QPDA 2FYSA 3QTXA 3ODZX 3MPAA 1Q4LA 4G2FA 4F9CA 3PIXA 4RG0A 5FUTA 3QRUA 4L52A 3TG1A 5L2IA 5ANDA 4IVCA 1A06A 3F3VA 3KF4A 2BRGA 2ACXA 2W1DA 2Y7JA 3M2WA 2B55A 2JIVA 3WBLA 4DAWA 3RM6A 3QTZA 3F2RA 2C47A 4IE9A 2HW7A 3CD8A 4YNEA 5BVEA 1HOWA 3ZBXA 4WNPA 1YI4A 1GIJA 2ERKA 2WMRA 3R9NA 3DA6A 4AGCA 3D83A 4GS6A 3PTGA 2HENA 2BVAA 4DEGA 3GQLA 3U51A 3MBLA 4EK3A 3GNIB 3HV3A 1XH4A 4ZJIA 5E91A 3CJGA 3ZSIA 4UX9A 3E64A 4KIKB 2BKZA 2J5FA 3HAVA 5LQFA 3MSSA 4YJVA 1IRKA 4ZP5A 2P33A 1OGUA 3MJ1A 5IQEA 1Q97A 3RMFA 4H1MA 4WUNA 1NY3A 2J4ZA 3KQ7A 4AFEA 4QMNA 3PZHA 2X2MA 4R7BA 4BZDA 5IMEA 1G8AA 2OGVA 3BCEA 4E1ZA 3PPJA 4BVUA 2RFSA 1ZRZA 2CJMA 3PXRA 4K6ZA 4TWPA 3LXKA 4F1MA 3G9LX 5CASA 4QQCA 5BVFA 1Q8TA 5M4CA 1K3AA 3KEXA 3KA0A 4DEAA 4J52A 4L68A 3C4XA 4FTKA 4PX6A 2GNGA 1E9HA 5HIEA 5HTCA 5IDNA 4FVPA 5C9CA 3CPCA 1JPAA 3LLTA 4KKEA 4HGTA 5IA1A 3FEGA 4IX4A 3EN4A 2X4ZA 2WMUA 3DBCA 3C0GA 4CFMA 4LYNA 4DFYA 3G5DA 4U41A 4EORA 5LVOA 5HVJA 5BMMA 2RFEA 3PPZA 3L8VA 1ZZ2A 1OMWA 2IJMA 3MN3A 3QFVA 4GFOA 4I20A 3UO5A 3QAME 2HELA 4FR4A 2YN8A 4AZTA 2YM8A 4BIEA 1RQQA 4M15A 4TWOA 2BCJA 3TIYA 3ZUTA 3DK7A 4QTAA 2YA9A 2QLQA 5CEKA 4QNAA 3ROYA 4YHJA 5AM6A 4H05A 1XH8A 3TM0A 1J1CA 3PE2A 4IAKA 4IVAA 3B2TA 4O96A 4A9SA 3AOXA 2XB7A 5C01A 4IB0A 2V7AA 4R8QA 4ZLOA 4XOYA 1JVPP 1ZY5A 3EMGA 3PXZA 4KRDA 4L7FA 4JRNA 5BUIA 1OZ1A 1YDTE 2OLCA 3FUPA 4H58A 1REJA 1ZMUA 2XRWA 1U54B 3LPBA 3QTQA 4DEIA 5CTPA 4C3RA 3FLYA 3C4ZA 4II5A 2PMNX 3DQWA 4JG6A 1JNKA 5ANIA 2A0CX 2OXYA 4USEA 3SKCA 4I0TA 5E7RA 4CGAA 3QHRA 5DA3A 3DBFA 3W2SA 4EQCA 2VWYA 1W8CA 4IWOA 3O8TA 3EYGA 5HLNA 3UVQA 3NVKI 5CZIA 3MJ2A 5HBEA 3I6WA 2YDIA 3TV7A 4D2PA 3D7TB 4RPVA 3UOKA 2YM7A 5AWMA 3WE4A 2PVMA 1V0BA 2YIXA 3PA3A 3HMOA 2BILB 5K0KA 5D9HA 2C6LA 5FRIA 1O6LA 3GU4A 4U80A 5FLFA 5HBHA 2JDVA 4PP9A 3TN8A 4X21A 1Q8UA 3OT8A 3CCNA 3UP7A 4UWBA 4YTFA 5CAOA 2WIPA 3HMPA 4U3YA 3UZPA 4K2RA 2QOBA 5A4EA 5L2QA 3EN9A 4O0RA 5J7BA 4JIAA 2IZRA 4JR7A 4M8TA 2VTNA 5JMSA 1H07A 2XEZA 4IWDA 3OT3A 2GU8A 2ZB0A 3DB6A 4BKYA 3BX5A 3KCFA 3UVRA 3RNIA 4E4LA 2XKFA 2YDJA 2JFMA 5CYIA 4C58A 1WMKA 4FI1A 4FTUA 1T45A 2C0OA 3QTIA 3UZTA 2ETKA 4MCVA 4IWQA 3HX4A 1JKSA 1E1VA 4PTGA 2G9XA 3JYAA 3R7UA 5T6KA 4BDCA 1LUFA 4HVDA 2PZRA 3MGYA 5IF1A 3OHTA 1QPCA 4P7EA 3ZO1A 1PXIA 1KE7A 2OJ9A 1H25A 3NW5A 2UZEA 2WKMA 3BIZA 2XNPA 4GK2A 4D2WA 3L9MA 4AN9A 2G2FA 3FHRA 5GJDA 3PXYA 2R3IA 4BZNA 4EHGA 3I81A 2BFYA 2XS0A 5HNGA 2C0TA 4P2KA 4C4IA 3Q2JA 2C3KA 4WIHA 3RAKA 4DFUA 2BZJA 4GSBA 4L43A 4O1OA 4BF2A 3D4QA 5BVWA 3IPHA 4O7WA 2YABA 4BDHA 4YC3A 3REPA 4ALUA 4EUUA 4J96A 4JNWA 3ZRLA 5AAEA 5ETIA 3IW5A 3VUMA 1UNGA 4YZMA 4FTQA 4NKAA 3W18A 1NT2A 3OY3A 4LGHA 4C33A 5AP5A 5AP7A 2QG5A 3O8UA 3KN6A 4LOOA 4ZJJA 3RNYA 5FXRA 4MNEA 3FJQE 1U5QA 5AP2A 5H2UA 5A14A 4GV1A 2YWPA 4MXZA 1YVJA 3VW6A 4H3QA 2DWBA 4XUFA 5TE0A 5CI7A 4D2RA 2Q0BA 3RP9A 4JLCA
chains in the Genus database with same CATH superfamily
3ZC6A 1WVXA 3P7AA 5KBRA 4N0SA 3JPVA 3LJ0A 4IACA 4LM5A 4RJ5A 5M44A 4C4JA 2OH4A 2OF4A 1FVRA 1M7QA 4QP8A 4YJQA 4FEUA 1ZARA 4QTBA 4B8LA 1SNXA 1TZDA 4BBEA 4BI2A 4O7NA 4I6LA 2W9ZB 1M7NA 2BRNA 3N9XA 2QURA 5CVGA 3W2CA 3SX9A 1M17A 2GHGA 3HMIA 3R7GA 4GUBA 4KB8A 4KNBA 4X3FB 3ATTA 3RTPA 4OW8A 3DFAA 1OPLA 3QZHA 1YI6A 2Z7SA 3BHHA 3HNGA 4MQ2A 5AR7A 3HKOA 4AACA 1QL6A 2HZ0A 2XIYA 3P9JA 4X0MA 4D2VA 3HL7A 5D1JA 4E7WA 5LVPA 5CLPA 3VS5A 3VUDA 2BKKA 3MVHA 2BFXA 5GZ9A 4ERWA 2R3OA 4P90A 2JC6A 1OIUA 2X4FA 4XX9A 3WZUA 4IEBA 4BCMA 3AMAA 3FZPA 4EONA 2QOLA 3BLRA 2VV9A 4S30A 4IFGA 5AX9A 4EK8A 2RKUA 3NNVA 2YM5A 5JZNA 1PRYA 2E9UA 2GHLA 3NX8A 4NM0A 3D2IA 3NAYA 4Q2AA 5HIDA 3RVGA 4L44A 5AA9A 1ZOGA 1YXXA 2JAVA 3PWDA 4QMOA 2E9NA 3Q53A 2XA4A 4FV5A 3DLSA 4BCFA 2SRCA 1H1WA 4DBXA 3BYMA 3QKLA 3E5AA 3F3WA 4O2ZA 4O91A 4ZTNA 4FTMA 4DITA 3OOGA 4MF0A 2JDSA 4QOXA 4FYNA 2OWBA 1GNGA 3U6IA 2RIOA 2C5YA 5FTGA 4FC0A 3H30A 3NUAA 2R3KA 4OT5A 5M06A 1OIRA 3L9NA 3PIZA 1R1WA 4CRLA 4CV8A 4D4SA 5B2MA 4JBPA 3ELJA 4QP7A 2PUNA 2WMSA 2YIYA 4GW8A 1XO2B 1JBPE 4AGDA 2ZAZA 3QA0A 4F0GA 3PFYA 2R3NA 5EM7A 3IW8A 3FL4A 2XKCA 2C6TA 5EQPA 3O23A 1WBPA 4FSUA 2RG5A 5JQ8A 4DGMA 3GU5A 3EYHA 4C0TA 4L46A 3LVPA 3COIA 4HPTE 4YSJA 5LARA 4C34A 4EQUA 3Q9ZA 5IISA 4DTKA 4EOSA 4UB7A 5DBXA 2CN8A 3D15A 5A3XA 3V6SA 4F9YA 3BHTA 4IM2A 4HYSA 4FV4A 3MPMA 2XCKA 4RIXB 4Z9LA 4FKRA 4BWKA 5KMKA 2I6LA 3BKBA 2Y4IC 2OG8A 4FSMA 1PKDA 4U79A 1GZKA 1ZLTA 5IUGA 4W4XA 2J5EA 5C26A 3CPBA 3ORTA 2BZKB 3HLLA 4L7SA 5ACKA 4EKLA 4C4HA 5CEPA 3FYKX 4XV2A 3UNJA 4CQEA 4EK4A 4I5PA 2X9FA 4EJ7A 4RC4A 4AA0A 2PUIA 3V5TA 2WU7A 3D14A 4TWCA 4EBWA 4FJVA 2BHEA 1RJBA 5IA2A 2ZYBA 4W9WA 2X0OA 2JAMA 4KBCA 2XYUA 3Q9YA 4WSQA 4NSTA 5JFWA 3AMBA 4PL5A 1QMZA 4G3GA 3ZMMA 5BYZA 5EYMA 2YIRA 4G3CA 1Y8GA 4GU9A 3GOKA 1YHSA 5JGAA 5L8KA 2GCDA 4XJ0A 3QXPA 2Q0NA 3VBYA 3Q6WA 2OSCA 4D0XA 4FRFA 1GZ8A 1OIYA 1O6YA 1X8BA 2J0JA 1PMEA 4OAVB 3RGFA 4B0GA 1ATPE 2JDTA 3ZM9A 3O8PA 1WZYA 4GIIA 5A4CA 3FHIA 2PUUA 3R21A 4F7NA 5F9EA 2WMTA 4QMPA 2XM8A 1FINA 3NNWA 4AA5A 2W9FB 3OBJA 4O7RA 4W8DA 4FKWA 3LMHA 3LQ3A 3TDWA 4O22A 4RBLA 4QMSA 1NW1A 3KXZA 4K77A 4L8MA 3VUTA 1ERKA 2QLUA 2ZMCA 3E87A 4AE9A 1RE8A 4X2JA 2QKWB 2Z60A 2WOTA 3ENHA 4XG3A 3LCOA 4K11A 4AN2A 3NYXA 3FMMA 4AZWA 2I40A 3B8QA 3R1SA 2NRUA 1A9UA 4I5CA 4RMZA 4TYHA 4D9UA 3I4BA 5AJQA 1WBOA 3ZSHA 1WBTA 2X7GA 2HYYA 4C2VA 3R9RA 4CVAA 4G16A 2B9JA 2ZM4A 4ZSJA 3U4WA 4AAAA 4BGQA 2WXVA 4DH3A 5HKMA 4HCVA 4HZSA 4RLLA 1HCKA 3SW4A 1MRYA 2GNLA 2W1FA 3OXIA 3ZDUA 4A4LA 1GAGA 3VBTA 4WG4A 4K9YA 4ZS0A 2UZBA 5EI6A 2BTSA 5J1VA 4I6HA 2ZOQA 2YWVA 5EH0A 2GNFA 4DH8A 2W05A 3GT8A 4XP2A 1B39A 5GIPE 2G15A 3ORLA 2OF2A 3QTSA 4NZWB 4JRVA 5TO8A 3R9OA 2WNTA 4BYIA 2F2CB 5AMNA 1XQZA 3PJ2A 2ITOA 3W8LA 3G33A 4WUAA 1ZY4A 4FTCA 1FVTA 2WMXA 4GFGA 4ZTSA 3DU8A 3U8WA 3O5AA 2DQ7X 3R1YA 5CSXA 2UW3A 3D5WA 2PVJA 3QBNA 4S32A 3IDCA 3OCBA 2CLXA 4C2WA 2VO7A 4U97A 5CEMA 4O82A 4ZSLA 4UY9A 5F95A 4D4VA 1ZMWA 2V7OA 5E8UA 4U40A 3MB7A 2AQXA 2PMIA 4UYAA 4U44A 5F4NA 1P4FA 3MY0A 4M69B 3D9VA 5L4QA 4CT1A 3F66A 3ID6C 4DGOA 4O7SA 2QC6A 1K9AA 2IN6A 2WQOA 2WZJA 3E8NA 4AT4A 4YJPA 5FGKA 3BQRA 1NA7A 1CTPE 4DN5A 4PTEA 2F49A 4BL1A 3MFRA 3FPMA 2WQEA 3RZFA 4O4FA 3WILA 4C3PA 4YBJA 4AG8A 5ANKA 3LFSA 4R3PA 3RJCA 3TKHA 3KRXA 2ITWA 5HG9A 3KRRA 3GFEA 3NYVA 3CE3A 3QD3A 5CU3A 1DAWA 4FMQA 5A6NA 2VGOA 3UQFA 1UNLA 3LAUA 3SV0A 4BCIA 4QPMA 1DI8A 4DG3E 4Y5QA 3SAYA 2XM9A 3O96A 3CR0A 3BGQA 3W32A 2FSMX 5CI6A 3E3PA 4ALWA 4ANNA 4RIWB 4KWPA 3ZLSA 3QQJA 4FTLA 4BDKA 3QRKA 4AZSA 3U54A 5H8GA 3P1AA 3W0OA 2UVYA 3TMOA 5DPVA 2VTQA 5IQFA 2VZ6A 3NDMA 2NP8A 2IO6A 4IXPA 4YHFA 3GCPA 4J7BA 4TYEA 4ANQA 3SXRA 5BUJA 4CMUA 4Q5HA 1Q8YA 5C03A 4MWHA 4J97A 5AR5A 4MWIA 3H0YA 3ZOSA 4RFMA 4BKJA 3RCJA 3A61A 1EH4A 2UV2A 5CVHA 4AE6A 3S95A 1XR1A 3QWKA 2VWZA 3OD6X 4G9CA 5I5ZA 5HG7A 3LQ8A 5I9VA 3U9CA 3V8SA 4M0ZA 3F9NA 3QZIA 5A4QA 3OWJA 2XANA 3EFJA 3TZMA 3IK3A 2FSLX 3F6XA 1ZMVA 4EL9A 2BIYA 3F61A 4GVJA 4CFWA 4QMZA 3THBA 4RX5A 5L2TA 5E8SA 4WOVA 4QQ5A 2EXCX 2BHHA 1XBCA 4X6QC 5DFPA 4ZXTA 1YXSA 3ALNA 5M07A 5BNJA 4CZTA 3NNUA 3NFFB 5CF4A 5AUTA 4W4WA 4FV0A 3KK9A 2WELA 4B99A 4YU2A 5FTOA 4JT3A 2AC5A 4MNFA 3O7LD 2PUPA 4Y73A 2XH5A 3GUBA 3E8CA 4IZYA 4TYIA 4ZIMA 5BX0A 4ACMA 2UW4A 3EN7A 1CSNA 4QMUA 4Y83A 5CF6A 3H9FA 3NW7A 2H9VA 3GVUA 3VBWA 4F65A 4HGLA 3DV3A 4OR5A 4V04A 5CXHA 4M68A 3UYSA 2UZVA 2GDOA 3DJ7A 3QTWA 4K33A 4G34A 5HHWA 4QTDA 4P5ZA 3ZFXA 4DA5A 4CTBA 5JQ5A 3EN6A 2X8DA 4YC6A 4HGSA 4KS7A 5CU2A 4F7JA 5I3RA 1SNUA 4ZTRA 5BVKA 3ET7A 4YTHA 4EOQA 4ANOA 3FY2A 2WAJA 3NNXA 4KS8A 1MRVA 2CGUA 4V01A 3ZONA 4ITHA 4CCUA 4E93A 1U5RA 1SVGA 3OXTA 5KZ0A 3ZO2A 5HVKA 3AC2A 4Z3VA 4MD9E 3T8OA 2WTIA 1IG1A 3R00A 2YIWA 2OK1A 4HCTA 3VJNA 1OL5A 2NO3A 5IA0A 2BZHB 5EI2A 2A2AA 4KAOA 2JKKA 4J95A 2E2BA 4LRMA 1ST4A 3TV6A 4FV2A 2EWAA 4GJ2A 3FXWA 3SD0A 4E6CA 1IR3A 3I0OA 3F3ZA 4APPA 2UZWE 3R8VA 4XG9A 3OEFX 4R6VA 4AZEA 2B7AA 5EDPA 3ZS5A 3C13A 2XK7A 4BKZA 4WG3A 4ASDA 1BL7A 2B0QA 3H4JA 3UC4A 4DDGA 4FZAB 3LXNA 3HRFA 4FKUA 2ZV9A 3SDJA 2P2HA 3KK8A 3MVLA 2FUMA 1TVOA 3FMEA 4QMQA 2BRMA 4OTIA 4RLKA 4XG8A 2YM4A 3UOHA 5E1EA 2R3LA 2W7XA 2HCKA 4OBPA 4M3QA 3GP0A 4RX9A 5HO8A 3VC4A 2QONA 4JJRA 1FMKA 2B9FA 4F0FA 3FI3A 3ZXTA 5CAPA 5AR3A 4AGUA 3LMIA 3GC9A 5CNNA 3LCTA 3ZH8A 2QR7A 4F4PA 3WZEA 4TRLA 2HWOA 5IQBA 5CU0A 5K0XA 4R1VA 2VWVA 3TKUA 3L8SA 4FV3A 4USDA 5M56A 4I22A 2P3GX 2RG6A 3WZDA 3G6HA 1PMVA 2C4GA 3NS9A 4NIFB 1WAKA 4FKQA 4D2SA 1XHAA 1PKGA 4YO6A 3U6HA 1L8TA 1VLRA 3C0IA 4FEXA 3FC1X 5GIOE 3QTRA 1MUOA 4RVTA 1Q5KA 4FOBA 4HYUA 4XP3A 3KFAA 3V01A 2X0QA 4DFBA 3W1FA 3IW6A 3FSFA 3AQVA 3HGKA 3VS2A 2OBJA 3GENA 4GVAA 5BVDA 3C4FA 2XJ0A 3QF9A 4FVRA 4KA3A 3QCSA 3EKKA 4UWCA 3RM7A 4XCUA 2C3LA 4DH5A 3WF5A 4J1RA 3W10A 1YKRA 1XJDA 2C0IA 3Q04A 5I9ZA 3BBTB 3TXOA 3UDBA 3A4PA 3NGAA 3R73A 2OZAA 4DLJA 2VNYA 1Z9XA 5FEQA 2VTSA 1AGWA 3TTJA 1B38A 5HCZA 3WZJA 2NPQA 3OMVA 3P08A 2XKEA 4C37A 2CNQA 4FL1A 2QOQA 3K2LA 4QP1A 3C5UA 5AUXA 4XNEA 3SRVB 1YXVA 3OCSA 4ZY4A 4CD0A 1K2PA 2XNGA 3F3TA 4I6QA 4IMYA 5CQWA 4MVFA 2VWWA 4C59A 4BZOA 5EQYA 3UP2A 4EJNA 3OS3A 2VX3A 3COMA 2ZV7A 4GT3A 4YLLA 4DC2A 4WT6A 3KMUA 2DS1A 2XIZA 4FOCA 3O2MA 4XLIA 4CFXA 5CNOA 4N70A 4TYHB 4EH5A 1AQ1A 3K3IA 1O6KA 2I0EA 2JDRA 3F5GA 5JFSA 3FAAA 2PTKA 3FKLA 5AIRA 2W5AA 2ZVAA 3FLSA 3HMNA 1ZOHA 3BYOA 1NXKA 4OBOA 4JX3A 1H27A 2UW5A 4AAYA 2AC3A 4AT5A 4FEVA 5FQDC 1YI3A 2R3JA 3PLAE 4KRCA 2YFXA 4UV0A 3O71A 3QRJA 2ITZA 5EM8A 4E3CA 2OJIA 3PXQA 2X2KA 3IKAA 2C1AA 3PY1A 5EKNA 3MH1A 5A4LA 4XH6A 3NFGB 4RJ4A 3OWLA 3BI6A 5G1XA 4ZY5A 5IZFA 2O0UA 3PSCA 2UVXA 2UZDA 3F69A 3ORMA 5IEVA 4MKCA 5IKWA 5LXMA 5C8KA 4IW0A 5CF5A 5JFXA 3VO3A 5L6PA 4JS8A 3NCZA 4NTTA 4IVDA 3TDVA 5CXZA 1ZXEA 2IZUA 2QVSE 3VS6A 3D7ZA 1SVEA 3P7BA 3TCPA 2ZV2A 1J7IA 4KUJA 5ETCA 1OB3A 2V0DA 3I5ZA 4HOKA 2PVRA 5K5NA 5AX3A 4QQTA 2WMAA 4FV6A 5DE2A 1XH6A 2QQ7A 3FBVA 4AF3A 2J51A 2JIUA 2CGVA 4FNXA 1JSTA 2ITQA 4TYJA 4UBAA 4KBAA 4AGWA 2CCHA 4FYOA 2FSOX 5DLSA 4WNOA 2WB8A 4AZVA 4OAUC 3CKWA 3H9RA 1VEBA 4QP6A 3QC4A 4E20A 5C4LA 2XKDA 4BC6A 3UPZA 3OFMA 4E4NA 5AR8A 1YWNA 3NPCA 4I0RA 3V6RA 3C5IA 2XNEA 2BDWA 2ESMA 2VTRA 3EN5A 4ERKA 3CBLA 4AQCA 3NMUF 3TZ7A 3HVCA 2OJJA 4FGRA 4O83A 4PWNA 4D4RA 3TNIA 1Q3DA 2JKMA 1BX6A 4YC8A 4X3JA 4ZEGA 3UO4A 3VS0A 5L8LA 1TQMA 3IECA 1FGKA 3ZC5A 4NCTC 4DBNA 5KX8A 2AEGA 2E9VA 2YAKA 2VO6A 4L67A 4PL4A 4QNYA 1V0PA 3VBXA 5LVLA 3G9NA 3VUGA 2IG7A 4NM3A 5E1SA 4BHZA 5AV0A 3PP1A 5A54A 2Z7LA 5KMMA 5EQEA 3DJ5A 4DE4A 5I9XA 1DS5A 2H34A 3G15A 5CALA 1P2AA 3I1AA 3WF7A 4NT4A 2NYAA 4L00A 4JBQA 2XK9A 2JKOA 1ZYCA 3KXGA 5M4FA 5BYYA 4CLIA 4O0UA 1URCA 3ACKA 1P14A 3JUHA 3P86A 4X3FC 3RBWA 2VN9A 2C6DA 4ZSEA 4CFFA 4R3RA 3AT3A 3QA8A 3FLNC 4QYYA 5IA4A 4DG2E 5M4IA 5DIAA 5M53A 1JQHA 3G90X 3AGLA 1FBNA 5TR6A 2R9SA 5AEPA 3BELA 2QODA 4RA4A 1UVRA 3EQIA 3G0EA 3CQUA 4GCJA 4AU8A 4CXAA 5JZJA 3DAJA 4R7HA 4D28A 1W0XC 1QPJA 5KMJA 4ONAA 4IX5A 4PDYA 5FEDA 4IZAA 3VRZA 3QRIA 3HA8A 4KIQA 5D7VA 3CEKA 4HJOA 4UALA 5E8ZA 3HUCA 4HVGA 3WIGA 4WRGA 1I09A 1H08A 3EZRA 4NFNA 5HU9A 4O6EA 3ZCLA 1E1XA 4FG8A 2XP2A 5HU3A 4GKIA 4FIHA 2PK9A 4I6BA 1YXTA 3E8EA 3IONA 4QYFA 1BMKA 2GHMA 2VX0A 1PY5A 4RIYA 4YZ9A 5HIBA 2IW9A 4BICA 3PRFA 3KRJA 3FMDA 2PZ5A 3R30A 4RA5A 3WYXA 5BVNA 5CY3A 3TIZA 5JN2A 4BJJA 3EJ1A 5IA5A 3QZGA 5TT7A 2AYPA 2HOGA 1KSWA 5BUEA 3UE4A 3VBQA 2Z8CA 3NAXA 4OTDA 1YWVA 3SLSA 3AD5A 3EQDA 4U3ZA 3ZLWA 5J87A 2J0KA 4O86A 4F63A 2GQSA 2WTJA 3R28A 4FUXA 4AP7A 4O0TA 5E8TA 4YMJA 3P0MA 3R1QA 5EG3A 5ACBC 4DFZE 3GXLA 4USFA 3NVMB 4N57A 3JXWA 3BE9A 4A9UA 3GOPA 2VRXA 3MVJA 4FKGA 1UWHA 4ITIA 4J8MA 1J7LA 5EHLA 2X6EA 4TY1A 1PXOA 3GC8A 5EK7A 4JDHA 5AFVA 2Y9QA 4A9YA 2GNJA 4Z55A 3QD0A 2J0MB 4TTHB 1PYXA 4LG4A 5DWRA 3BWFA 1W7HA 5DVRA 1APME 4DYMA 2XIXA 4FTOA 3O7LB 1LR4A 1BI8A 4X2GA 5DG5A 2CMWA 4YBKA 3RKBA 2Y4PA 4GFMA 3N4TA 2R7BA 3KC3A 3E3BX 2PE0A 2PVYA 3F88A 4QQJA 2XBAA 3TACA 4JQ8A 3VQHA 4DT9A 3UZRA 4D1SA 2W06A 3UC3A 3RK5A 5CZHA 4I5HA 2OFVA 3KMWA 4RJ8A 4FIFA 5JRQA 3DBQA 5AADA 2A27A 3F2NA 2O64A 3DBDA 3PUPA 4FK3A 4EOMA 5IUHA 2C6EA 5CU4A 5I4NA 2W4KA 5AV3A 4BYJA 4DFXE 3W2QA 3R71A 2VUWA 5HBJA 5B2KA 3QCXA 3UBDA 4DEEA 3HECA 3PG3A 2CKPA 4FKTA 4FODA 4IADA 2BALA 3EH9A 3TNQB 3BHYA 2UW0A 2XIKA 4JL9A 1BYGA 2QOCA 5KKRB 1UU8A 4BR3A 3QGYA 2Y6OA 2BIKB 2VTHA 4YLKA 4EWQA 1FMOE 3UIUA 4UEUA 4LV7A 3C4EA 4LGDA 3E63A 3A7HA 2ONLA 3A62A 2WTKB 3A8XA 3RK9A 3MFSA 3SXFA 5M51A 1BUHA 5GNKA 3IW7A 3MFUA 2RFDA 4OBQA 2I0YA 2F7EE 4LV5A 3L8PA 4FL3A 2VU3A 5F94A 4YHTA 5JGDA 3A7FA 4PF4A 5E90A 3TI1A 4Y85A 3TUDA 4OTFA 4KSPA 4QDEA 4N4SA 3R1NA 2WQBA 3E93A 2QD9A 2BAQA 1S9IA 2IW6A 1UKHA 2YITA 3EWHA 3R7OA 3AC5A 3R9HA 2EU9A 3LE6A 3G6GA 4QD6A 4DHFA 2YACA 3DKOA 3D5UA 2C6OA 4FTTA 3UG1A 5HD4A 5IU2A 4QP4A 5CSWA 4IFCA 2HK5A 3FI4A 2WD1A 2BROA 3PDTA 4FTIA 4FNWA 5HE3A 4FV1A 2C1BA 5AUVA 3Q32A 3ORNA 4RSSA 4DTBA 3MVMA 3AMYA 4RFZA 3ZEPA 1R39A 3QYWA 3PUFC 3R8PA 2W96B 2VTOA 4ITJA 3PXFA 3W2PA 2VTTA 3H9OA 3R8ZA 4EKKA 4C57A 4FA2A 2P55A 3EQBA 4WSYA 1Y6AA 2W1IA 4GL9A 4ZMFA 3W8QA 4DEHA 1H1SA 4Z7HA 3ZEWA 4DGNA 5K3YA 4BCKA 4CG8A 2PVFA 2YZAA 4I6FA 4V0GA 4QMYA 4XV1A 4QMWA 3SW7A 3KGAA 3UDZA 3KXMA 3Q4CA 2XK4A 1FPUA 2NRYA 3LXPA 3DXQA 2R0UA 4I93A 4BDGA 2BAJA 3GI3A 3LM5A 4EHVA 3BYUA 3F7WA 3KRLA 2OKRA 2ITVA 5ANOA 4JDKA 3WOWA 4GG5A 4DINA 3IGOA 4D5KA 1HCLA 3A8WA 4FG7A 4DH7A 5JH6A 3UQGA 4IZ7A 5G6VA 3D94A 2ZV8A 5HX8A 3BQCA 3MY1A 5B0XA 3MYGA 3C50A 4PQNA 3ZLYA 4CFUA 3FC2A 4XG6A 4YP8A 2YZLA 1OM1A 3AC1A 4PPBA 4YURA 4O0SA 3TNPC 2OO8X 3V5LA 2VTIA 4FZ7A 2GNHA 2CN5A 2EUFB 3IW4A 4BHNA 1Q3WA 4RQKA 1SYKA 3QRTA 5J8IA 4E73A 1Q8ZA 4IDVA 3COKA 1OKVA 2X0PA 2OH0E 3IQ7A 3BLAA 3TKIA 3R2BA 1YOJA 4FBXA 4TW9A 5C1QB 2WO6A 1J3HA 3G2FA 4F9BA 1WCCA 3UNKA 3KY2A 2WPAA 1Q8WA 3ORZA 3ZYAA 4HNIA 4GYIA 4G31A 3TUCA 3O17A 4F6SA 3WYYA 4W9XA 1P5EA 3ZZWA 4O4CA 1XKKA 2X6DA 2GMXA 2VO3A 4EH9A 4RVLA 2XMYA 4H1JA 1TKIA 3UVPA 3QC9A 3V8WA 3FQEA 5IH4A 4UZHA 4AWIA 3OG7A 2ITXA 3M1SA 2XF0A 4A9RA 4AOIA 3CGOA 4ACDA 3QKMA 4Y95A 4M67A 5CWZA 3LFCA 3FE3A 4FL2A 3LKMA 4O6LA 3QUDA 4QPSA 1Y8YA 3LIJA 2GS6A 4ENYA 5K4JA 4EZ5A 3FWQA 5K5XA 3HRBA 3E92A 4J53A 3KULA 3PVBA 1U46A 4IC7A 4LFIA 4DHJA 3LLAA 3FKOA 3HEGA 4IB1A 3CS9A 3V5PA 5CT7A 5GJGA 2BZIB 1G8KA 2ZFYA 1ZYJA 2W17A 3JY9A 4FNZA 1P4OA 2R4BA 2PYWA 4LMUA 4UN0C 1Q61A 4YJNA 2VWUA 2F7XE 1UV5A 4FZ6A 2HWPA 2X39A 4Y46A 3RAWA 3ZM4A 4IBMA 4M97A 4ZZOA 2GQGA 3OROA 1GZNA 4XBRA 4UZDA 4F99A 4J99A 5BPYA 5M08A 4NH1A 4I4FA 2VD5A 1M2PA 3FLQA 3CSVA 2PSQA 2E9PA 2WMQA 5CEQA 4KIKA 4S33A 3QLGA 3EL8A 3DNDA 1VZOA 4PUZA 5I9UA 5KZIA 4O27B 3ULIA 5JGBA 5CEOA 4RC3A 4CRSA 4FT0A 4YUQA 4ZK5A 1R78A 5C8MA 1PXKA 3LFBA 3MDYA 1DM2A 1UA2A 4O4BB 3R01A 1GOLA 2ZJWA 3DAKA 5FD2A 4E4MA 2B9IA 4G6NA 3Q52A 4MXYA 4EH6A 3IS5A 4AZFA 1W83A 4ZLZA 4QEBA 2B9HA 5ANEA 4J8NA 2X9EA 3M42A 2XARA 4PL3A 4U5JA 4E4XA 3E88A 3VS4A 3OBGA 1PXJA 2ITPA 2QO9A 5J5TA 4R77A 4QYGA 4FIJA 2O5KA 3KL8A 2WU6A 4R5YA 4UMTA 4BGGA 5KE0A 4L53A 2R3QA 5CANA 1W82A 2YLFA 3NUNA 4CZUA 4NM5A 5AP4A 3TZ8A 3VQUA 3RCDA 1YWRA 3LFAA 3D2KA 2VTPA 4KSQA 4OLIA 4MXAA 1H0VA 3UMXA 4AX8A 4IIRA 5IG1A 5M4UA 4E8AA 2CCIA 4YJRA 4BCJA 4C38A 3N4VA 4RGJA 5HD7A 2C6MA 4U7ZA 4NJDA 4PMTA 3V04A 4XG4A 5DT4A 4G17A 2I0HA 3ZHPC 1KE9A 3R7EA 3FLZA 3L9PA 5HO7A 5FDPA 2V22A 4QMVA 1IEPA 4JG7A 1ZWSA 4F6WA 4GKHA 4ACGA 3BGPA 4D1XA 3LJ1A 3Q96A 4EK5A 5HGIA 4ACCA 3TJCA 4EOIA 2W1EA 3OEZA 3GC7A 4E5WA 2YDKA 4IC8A 4EOLA 4BCGA 2WGJA 4I5MA 1JWHA 4ANSA 2VWIA 1O9UA 2CGWA 5AM7A 3DKFA 1AD5A 3W55A 3C1XA 4OTHA 3CQEA 1U54A 4AQKA 4F7LA 1H0WA 3C7QA 3R2YA 4QDVA 3PVGA 5BV3A 3MIAA 3F3UA 5E8WA 4GIHA 2UW6A 2OU7A 3DTWA 2JKQA 4KBKA 3RPSA 2Y0AA 3SXSA 3VVHA 5HNIX 4MNEB 3MIYA 4Z16A 1H1RA 1GZOA 4AN3A 4QMLA 3N51A 1WVYA 1BKXA 3CD3A 1Q41A 4CCBA 1YHVA 3K3JA 2VTLA 4B8MA 2YCFA 3N4UA 4GT4A 2W1GA 4FEWA 4U0IA 3PFQA 2XJ1A 4O38A 4BIDA 3RWQA 5EHOA 2J90A 2C5XA 3OWKA 4TZRA 2V55A 3LFDA 4O0WA 4U43A 2QNJA 4CKRA 4FSYA 2YIQA 4CLJA 2CHLA 4G3DA 3W0QA 4O7TA 5IQHA 2KULA 2YAAA 4FIEA 4EH3A 4LRKA 4FT7A 4DCEA 4WG5A 4WNMA 4YGAA 4ZTQA 3QKKA 2BUJA 2YERA 3I79A 2H8HA 3IOPA 3H3CA 1A48A 4BBMA 3SG9A 4MXCA 4C4EA 5CENA 3SVVA 4ID7A 5DT3A 4JVGA 2P2IA 2EB3A 2QOIA 4BWPA 4YO4A 3QD2B 4DT8A 2E9OA 4HNFA 5IUIA 3ORXA 3C9WA 5GZAA 2JIIA 3QQKA 2OI4X 5M57A 2I7QA 5J9YA 2OIBA 4CFNA 4QP2A 5E9EA 2ITYA 3DQXA 4UMUA 3RPYA 4CMOA 2B54A 4ZLYA 3II5A 4C35A 2IZTA 5JEBA 4TL0A 1RDQE 3RWPA 3LQ5A 3GB2A 4EUTA 3F2AA 3LFEA 3SOAA 3GGFA 4F08A 3C4CA 4PMMA 3RPVA 4WA9A 4GJ3A 3LCSA 1YRPA 5E8VA 3LHJA 5F1ZA 3RINA 4GT5A 3VUIA 2CNUA 1SM2A 3ZBFA 4IH8A 5LMAA 5B2LA 3R8MA 1IA8A 5D7AA 4YPSA 5I0BA 1OKZA 2GTNA 2C5VA 5ITAA 1M14A 4AUAA 3A7GA 2H6DA 1UU7A 2B4SB 3Q4ZA 4C61A 3QHWA 5J95A 2G01A 1L3RE 2ERZE 2QOKA 2QR8A 3A99A 2GS2A 2QKRA 3KN5A 2IEWA 3QD4A 1LPUA 5AP1A 3JVSA 4MX9A 2CNVA 3VIDA 3NZ0A 1TFFA 3ODYX 4I4EA 4PNIA 4B6LA 4NCTA 4XG2A 2IW8A 3QALE 4IVBA 2BDJA 3C51A 2HIWA