2WTIA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
286
Chain Sequence
b'SVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHECKPOINT KINASE 2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 286
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtiA01
3I0OA 5EOBA 4S34A 5L2WA 5EI2A 2PVJA 5FP5A 3QU0A 3BHVA 2VAGA 2OH4A 2XIKA 3QALE 3IO7A 2CGVA 2JITA 3NNWA 4RJ7A 2VZ6A 5B2MA 3KREA 5F95A 5DG5A 5LVPA 4I4EA 3F3TA 3H3CA 3HNGA 3W55A 1OZ1A 2C6KA 2I0YA 3TUBA 4EH3A 3QRKA 5B0XA 2G2FA 3IW7A 4U44A 3LLAA 4YMJA 4AZVA 5C8MA 2VTIA 3BYVA 4MWHA 3O71A 3QQHA 3PRIA 3M1SA 5IU2A 1VEBA 2ITWA 4U41A 3FI3A 4W4VA 5AX3A 4IM0A 3RAHA 1OVEA 1H01A 4MD9E 4M69B 4IBMA 4NJ3A 4QMUA 4D2SA 3FC2A 3P7BA 5AP2A 5CF4A 4FKQA 2YIRA 5A46A 2YM7A 3PDTA 3OXTA 5GJFA 4HVIA 2WFYA 4GFOA 3GBZA 4HGTA 5ITAA 4CG8A 3HLLA 3G6HA 2ERKA 1V1KA 5HLNA 3NW5A 3PXKA 3E62A 1I09A 1JSVA 4N70A 4U40A 4FA2A 4O7TA 2XJ2A 5EKOA 4DEDA 4KKEA 4CV8A 2ZM3A 3VQUA 2XK6A 4BIBA 3A7IA 1OL2A 3UOKA 2ERZE 3NYVA 2FA2A 2F49A 3FQSA 4JG7A 4FKTA 2HENA 3WE4A 5GINE 4K18A 4Y85A 3RINA 4TNBA 3TNIA 4NYEA 4EZ3A 4CNHA 2WMUA 3SC1A 5IA1A 4I41A 4DEGA 2C6TA 2ZM1A 3VUIA 3PJ2A 1PYEA 3WE8A 2IVTA 4FKVA 1PHKA 4UMUA 4DT8A 4RWLA 2F9GA 4AOTA 3R7GA 4WBBB 3D7ZA 5AM7A 3FMLA 3O7LB 5J5TA 3GQIA 3BHUA 2PUUA 2OFUA 4I6BA 4EKKA 3HV5A 4FT7A 4FL1A 2JLDA 4C34A 2GNJA 4PP7A 1CKPA 1DS5A 2WTKC 3DNEA 5BUIA 3D14A 1GOLA 4O91A 1ZXEA 4H05A 5AV1A 3CBLA 5FBNC 3BHTA 3OT8A 4YHFA 3ZM4A 4DGOA 4ZJJA 4JQ7A 3DKGA 1BKXA 3D5XA 5GZ8A 3DTCA 4CFXA 2WQOA 1KE7A 2PVMA 5CNOA 3OC1A 3RALA 3LOKA 4U97A 1JOWB 4ZAUA 4F63A 3CQUA 5HTIA 4AA5A 4QMZA 4C02A 5E91A 5HTCA 4O7RA 1BL6A 4CT2A 3TWJA 1OBDA 3MY5A 4OBOA 4ARKA 5E8TA 1ZZLA 3A4OX 4IW0A 3DJ7A 4FV2A 3F2RA 5HE1A 2BTRA 4NT4A 4QTBA 3EL8A 3RCDA 4I0RA 4JS8A 2OXYA 3RZBA 5ANGA 3LMIA 3UG2A 3JVSA 5ACKA 3HMMA 3AXWA 4RQVA 5CEQA 2W0JA 4U9AA 2WKMA 2W1IA 3I1AA 5KMMA 5AEPA 3KGAA 1ND4A 4HCTA 4RC3A 1E1XA 4GKHA 4YNOA 3RI1A 4L3LA 4LL5A 4W9WA 1U54A 3TJDA 4CQEA 5IQDA 1PF8A 2GHGA 4KINA 4L9IA 3Q04A 3OEZA 3QA8A 4CMOA 1GZOA 2PYWA 3I6UA 4KKGA 3FZPA 2HK5A 1MRUA 4RWJA 3ROYA 3PA4A 4FTTA 3SKCA 3NAYA 4IVAA 4A06A 4X3JA 1CM8A 4BTJA 5KMJA 2CJMA 4FYOA 4DN5A 3BQCA 3TI1A 4U8ZA 4FVQA 3RVGA 3VBYA 3QRTA 2JAMA 3UODA 3MS9A 3VO3A 1RJBA 3DTWA 1YVJA 5CAQA 3P79A 2BHHA 5HGIA 3PWDA 1QMZA 1U59A 1UNHA 2BZHB 4FI1A 4C2VA 3NDMA 1BLXA 3SW4A 5BVFA 1REKA 3FI2A 4G34A 4J1RA 5EH0A 2R3OA 3RK9A 1NT2A 1MRVA 4BL1A 2VTOA 4L3PA 4XG9A 5G6VA 4ORKA 4FICA 4DFYA 1ZYJA 1DAWA 2BPMA 1UU3A 4ZK5A 4IX6A 4APPA 4QMNA 4JI9A 4D1XA 5FP6A 4YHTA 5TT7A 2JKQA 3KULB 2ITPA 4G16A 3TNPC 3EFLA 3HZTA 4D2TA 1Q99A 4G5JA 3VUTA 2OIBA 4A4LA 4BCJA 2WOTA 3QKLA 5DI1A 3AD6A 3RTPA 2ONLC 2OXXA 3CY2A 4JIKA 3HDMA 4FSZA 4M15A 2B9IA 3GU6A 2QOIA 4MD8E 2C4GA 3TTJA 2XVDA 3VJNA 3LCDA 4JRNA 3SHEA 5AV4A 3TUDA 4R7BA 3QCSA 4FL3A 3EQPA 2CKOA 4GH2A 4QTCA 4KBKA 2W1DA 1STCE 3O23A 2LAVA 3MB6A 3PFQA 3NW6A 4MEDA 4GL9A 3ORXA 3U6IA 2RFDA 4ITHA 5L2QA 5AAFA 4NL0A 1IA8A 2CNUA 4TPTA 3FBVA 4IE9A 3ZH8A 2H8HA 4EQUA 3E8DA 3KRJA 4GVAA 4S2ZA 3TACA 5JRQA 4PMMA 2H96A 3G51A 4XLIA 3P5KA 4CCBA 2VWZA 4O7ZA 4I0TA 5TO8A 1JKTA 2UVZA 4FC0A 5AR5A 3NW7A 4BIEA 5HNGA 3O96A 5AUXA 1R1WA 4HVSA 1LPUA 2XRWA 3QD3A 5CEOA 5KMOA 2HAKA 4AGDA 3D15A 1U46A 3VS5A 3PY0A 1H1SA 2RF9A 4Z55A 5KUPA 4HPUE 2ZB1A 3OY1A 4HJOA 3IDBA 5D7AA 3W2QA 2R3KA 3MPAA 3DPKA 1Q3WA 3S2PA 4F4PA 4S33A 3ZEPA 4EK8A 1KE6A 4L52A 3DQWA 3DLSA 5C01A 3FL5A 2WB8A 4U81A 5F20A 3DLZA 4YO6A 3RHXA 4DH1A 2F7XE 4J99A 4AX8A 3FAAA 1MP8A 2XJ0A 2J50A 5D7VA 3MIYA 3P23A 5AV0A 1XH7A 4NCTC 3WBLA 3R2YA 2WZJA 3HUCA 1XR1A 5JN2A 2UVYA 5IMXA 5M08A 5J9LA 3WI6A 1XH9A 1REJA 3GI3A 3F3VA 4GIHA 4PRJA 3JYAA 4D2PA 2O5KA 2VWWA 2YM6A 1NY3A 5HBJA 4O82A 5HQ0A 1K2PA 3DU8A 2CNVA 1ZYLA 3HECA 2XNGA 2E9UA 4FZDB 4GFGA 4RLLA 3ZYAA 4YU2A 2FSOX 2OKRA 3K54A 3R28A 4FNYA 4S30A 5AR3A 4H3BA 2CHLA 3W10A 3ANRA 1JWHA 4BY9E 1GAGA 2WMAA 4ZTHA 5HNIX 2QC6A 2R3GA 3VUMA 4S31A 4ASXA 2W5BA 3IDCA 3FLQA 3IW5A 4GUBA 1VYZA 2WQEA 4J95A 4C0TA 5HBHA 2NRUA 1H25A 1OECA 3I7CA 3BWJA 1YHSA 4M97A 1H28A 4EK3A 2ZMDA 5A54A 1ZOHA 3B2WA 1Q8YA 2OI4X 4EK6A 2YDJA 3U9CA 1JKLA 1XQZA 2VTHA 4UZHA 5E8VA 5FM3A 5HVJA 4MX9A 1UU8A 5DHJA 3ZC5A 3ZBXA 4NTTA 4WNPA 3ZO4A 3SXSA 2W96B 5LARA 1L8TA 4GU6A 4HW7A 3ORPA 3IOKA 4FV3A 1YW2A 5DYJA 3II5A 2B55A 4K33A 4PNIA 4H58A 1YWNA 3CD8A 5HX6A 4D58A 2XIRA 4FV9A 4HVDA 4KUJA 4P90A 3PLAE 2ITZA 5CI6A 3QHWA 4I20A 3E8EA 3L9LA 2BR1A 2R4BA 1TQMA 3AC4A 4OTRA 5LVOA 3UMWA 2QU5A 4GT5A 2C0IA 2A19B 2E9OA 3UO6A 2PVLA 1QCFA 3MY0A 5AV3A 3EQBA 3CGOA 4MHAA 4I3ZA 4XHKB 4DYMA 4F64A 4FKWA 2WEIA 4KBAA 4O0VA 3RK5A 2WMRA 2HWPA 4BCNA 4XH6A 4C3RA 4EEVA 4OR5A 1O6KA 2O3PA 2NO3A 2Z7LA 4ITJA 3NUAA 3RM7A 1KE8A 5HHWA 4R6VA 3ZRMA 2Q0BA 2XM8A 3QX4A 4XYFA 2BAQA 3EMGA 3FZRA 3KXGA 1IG1A 2YJRA 4FIGA 3FHIA 4L8MA 4MXAA 1AGWA 2J0MB 3PUPA 1YWRA 3RMFA 3V5QA 4BCMA 2GQGA 2WIHA 2OJ9A 5IA4A 3EKNA 5IEXA 4RZWA 4PY1A 4RJ8A 3JY0A 2O2UA 3QGWA 4WOVA 5BMMA 1OI9A 5TF9A 4XOZA 5JZNA 2WMXA 2XKFA 5HU9A 2VTPA 1SVGA 4L46A 3D0EA 2GTNA 5AAEA 2JDTA 2UW0A 4UWBA 4AT3A 4JX7A 1QPEA 1NVQA 2R2PA 4BZNA 3H0ZA 4EHGA 5J1VA 4MD7E 2QO2A 4MTAA 4UMRA 2VTMA 3A60A 3MDYA 2F7ZE 1OUKA 1WVYA 4I5HA 3Q9ZA 4IWDA 5M57A 4LRMA 4HCVA 3HL7A 2ITXA 3DAEA 3G5DA 3PVWA 2JIUA 2X4FA 4HGSA 4IADA 3WF7A 1OL6A 3DBCA 4PDOA 2FSMX 5BYYA 2IO6A 3KA0A 4IVCA 3LFEA 5CASA 2PMLX 4TYGA 5EQPA 2FSTX 3DNDA 1ZMUA 1GJOA 3D2IA 2VWVA 2VN9A 3FMJA 4L45A 5LXMA 3TCPA 4IWOA 4O86A 1B38A 2AC3A 4FKOA 4K11A 2Y9QA 4XG6A 1Z57A 3F3UA 4Y83A 3SAYA 4RJ6A 4QT1A 2VWYA 2VTLA 4EH6A 2GS6A 4IX4A 4CFVA 2QI8A 3HA8A 4NIFB 5TE0A 5CVGA 5CEPA 2X9FA 3KCKA 2QG7A 2C6DA 1EH4A 4KIQA 1P4FA 3VRZA 5FDXA 5CXZA 3TG1A 2OWBA 3H9FA 1OIUA 2HWOA 4IHPA 3P4KA 1PYXA 4UN0C 5DT4A 4H1JA 4NM5A 4RX8A 5D12A 5H8EA 4ZS4A 4Y73A 3S3IA 1H26A 4H39A 4YC8A 1FBNA 2DQ7X 3R83A 4RVMA 5DR6A 2ZOQA 3N51A 3PPKA 1PMUA 5FXSA 2WMBA 2Z7SA 4GVJA 3LJ1A 4E20A 5JFXA 1G8AA 3H30A 3ZDUA 2OBJA 5KBRA 1Q61A 3LFDA 3LXPA 3BE2A 1M7NA 2YCSA 3KXXA 4Q9ZA 3ZONA 3CSVA 2UW9A 4KA3A 4PPAA 3A8XA 1KSWA 3NVMB 4DFLA 5FD2A 3TN8A 4CQGA 5EW8A 3OXIA 4GU9A 5KMIA 2RIOA 2WAJA 3LXNA 4HYIA 2UZWE 2VWIA 4AS0A 2ZV2A 4DEAA 4OT6A 4FT0A 3ACKA 4LGGA 5ANDA 2RKUA 1PW2A 4FSTA 5KE0A 4BN1A 2ZAZA 3EOCA 4EKLA 4WHZA 2OJJA 5A4EA 2G01A 5M53A 4K77A 2I40A 4W4XA 3VHEA 2J7TA 4BGGA 3HKOA 4AA0A 2W1CA 1SMHA 1J7UA 2CCIA 4X2FA 2PVYA 3OY3A 4QTDA 4QMWA 2B7AA 3EYHA 2VGPA 3R1YA 2OGVA 2XIZA 3A99A 4N0SA 3EN6A 4Y8DA 4FIFA 3HRFA 3P7CA 3PJ3A 5EHLA 4IANA 4CFNA 3SXRA 2JIVA 3AC3A 3MB7A 3TNHA 2BRHA 2WELA 4UX9A 3WIGA 3GUBA 4H3QA 5AR2A 1MQBA 4GCJA 2I1MA 4F0GA 2C5YA 4DINA 2PUNA 4PP9A 3QTRA 3HA6A 3KF4A 2UVXA 4UXLA 5FTGA 5IQFA 4ZSGA 4ZLOA 2VD5A 3FSKA 4H3PA 4ZJIA 4PL5A 2IW9A 4BTKA 4JAJA 4GG5A 4BC6A 3COMA 3QRUA 3FUPA 3Q9YA 4XBUA 2HZ0A 3BKBA 3QCYA 4FTMA 5J7BA 3E5AA 4GIIA 4IIRA 3FZOA 3SRVA 4AZWA 3Q5ZA 5H9BA 3EYGA 3HP2A 3VUHA 5A6OA 4BTMA 5AA8A 5I5ZA 3LJ2A 2X6DA 2UZVA 3PSDA 3A7HA 3QLFA 1OB3A 5J95A 4J8NA 3ANQA 4JNWA 5CF5A 3VF9A 3RBWA 4O84A 1GZNA 3LPBA 4USEA 5IPJA 1X8BA 2X4ZA 3FE3A 2P33A 2QODA 3L1SA 4AU8A 1WBWA 4X3FC 3AOXA 3ATTA 3MFTA 3HDNA 5CS6A 4CGAA 3GEQA 1XO2B 4MAOA 3S95A 4E6CA 5CAOA 4EOKA 5CU3A 4O7SA 3Q4CA 1UA2A 4O7WA 4ZTQA 3EQGA 3BU5A 3LM5A 3MY1A 3OOGA 3KK9A 2ONLA 4GFMA 4RVLA 4EH7A 2ZV7A 1VYWA 4QMOA 5F4NA 5L2IA 4BR3A 3TIZA 4BWKA 3QTQA 3LAUA 3R1SA 4GYIA 4YC6A 3F69A 2GQRA 1CKIA 4MF0A 2PSQA 3DKCA 2X0GA 3NNUA 3R00A 5FLFA 2R3QA 4I5CA 3R9NA 4FEQA 4R77A 3NUPA 5F1ZA 5IDPA 3ZHPC 1RE8A 2PY3A 2VWBA 3GFWA 3F9NA 3N4VA 1KV1A 2R3HA 3MFSA 4C61A 3CTHA 4FMQA 2QG5A 4IDTA 4HNIA 2GFSA 4I6HA 2WOUA 4CD0A 1BMKA 1JKKA 3THBA 2BRNA 2GQSA 2KULA 3HEGA 4IFGA 1FINA 3ROCA 4BDCA 3KXMA 4TKSA 4D5KA 4MBJA 5IH6A 3QAME 3UG1A 2G2IA 4OAUC 4DTKA 5L3AA 2X81A 3H0YA 4RZVA 4W8EA 5CNNA 3L8PA 4QYYA 5CXHA 3R8LA 4EC8A 4NTSA 1IEPA 4PMTA 3NYXA 4FV8A 3AT4A 4ENXA 1PY5A 3UQFA 3NCGA 3H9OA 2PVKA 3D4QA 2BIKB 3MGYA 3QFVA 2CMWA 3G33A 4IVDA 4EQMA 5KHWA 3IONA 4IAFA 3A4PA 5EDQA 4DEBA 2IZSA 3G6GA 3HRBA 2F2UA 3D2KA 3QC9A 4R1VA 4F9YA 2BZJA 2BALA 4WUAA 3K3IA 2PMOX 3OW3A 3DA6A 3OVVA 1YOJA 2X8EA 2QOOA 4J96A 4NCTA 2W1ZA 3ZLYA 5DFPA 4EUTA 5J9YA 4DFUA 4QNYA 4EH5A 2QOKA 1XJDA 5L6PA 3RAKA 4EUUA 3SGCA 4YNEA 5AP6A 2XH5A 5KO1A 3QGYA 2YLEA 4XG7A 1WAKA 3ZUTA 5M09A 3ZC6A 5K0KA 4HVGA 3R02A 5CF6A 3U6JA 2O8YA 3L8VA 4YPDA 2JDSA 5E8SA 2IG7A 3ZEWA 4G3EA 5IUGA 5K0XA 3EN5A 2VGOA 3RNYA 4G6OA 4NW6A 5AV2A 2YISA 5LJJA 2OK1A 3QZHA 3ZU7A 1MQ4A 2IN6A 2IZUA 1OIYA 3UVPA 2YFXA 5JQ8A 3JR1A 2HYYA 3F66A 4FTNA 5ETIA 3EH9A 4XS2A 4ZEGA 1H1WA 1CMKE 3E64A 3EQHA 4V0GB 4ZZNA 5LMBA 3WZEA 4WA9A 5AP1A 2F4JA 4YZMA 2YCRA 5ANOA 3QUEA 4YSJA 3VBQA 4IVBA 3QCXA 1Q4LA 2EXCX 2R9SA 1SNXA 5JMSA 5ANKA 4EOOA 2ITNA 2OU7A 4FT5A 2YACA 4OTQA 4OTPA 2PMNX 5EI8A 4M7IA 4WG5A 5I3OA 5A6NA 2YIWA 4JOAA 3QYWA 3QTIA 2A2AA 2QHNA 5JGDA 4QQ5A 1Q8TA 5HX8A 1PXJA 1URCA 2ZM4A 4MQ1A 4OBQA 4BI0A 3F2AA 4ANMA 3ZBFA 4RIWA 4DGLC 3UJGA 2YIXA 4UBAA 3CS9A 1M2RA 2QKWB 3RPSA 5I9ZA 1JSTA 1LEZA 5E8WA 3DBEA 3PG1A 5FBOA 3Q3BA 4QPMA 2FUMA 3SX9A 2R5TA 3W8QA 1R78A 4QYEA 1HCKA 5HCZA 4BCOA 3TKIA 5FUTA 3EKKA 2V0DA 1FVTA 2QOLA 3H10A 2XP2A 1O9UA 4LFIA 3C5IA 3A7FA 4V0GA 5JKGA 5EK7A 2IZRA 4OW8A 3RZFA 2C30A 4I6QA 4JR7A 2C6OA 4ZY4A 5BPYA 3ID6C 3TZ8A 2XMYA 3TIYA 4IZ5A 5K9IA 3UC3A 3LHJA 3AC8A 4LMUA 2DUVA 3W2SA 2YZLA 4IXPA 1OBGA 2RG6A 1O6LA 1YXTA 2QOBA 4AE9A 1JAMA 3IDPA 1AD5A 3QWKA 1Q8UA 1YI6A 4II5A 4PDPA 3VBVA 4DLIA 5I9XA 5IA0A 2W05A 4DBXA 3VQHA 1JSUA 4E26A 1ZZ2A 4EZ7A 4BZDA 3G90X 2EXEA 3OUNB 4RJ5A 4A9RA 3RAIA 4QO9A 3V8TA 1BI8A 5EFQA 3QTWA 4RWIA 4KRDA 4CT1A 4M8TA 2C1BA 3TNQB 3CEKA 1ZRZA 3I5NA 4ID7A 4IAAA 4OLIA 1E9HA 3WF6A 2UUEA 3O8PA 2ETKA 2XNPA 4LUEA 3WZUA 4BI1A 2JAVA 5CVHA 3NAXA 1ZMVA 3E3BX 2WU7A 4QQJA 2UZUE 4DG2E 4EOSA 5HICA 5KCVA 2ZMCA 2XEYA 2PVNA 4N57A 4P7EA 5CEMA 3ZLSA 4AZTA 4BB4A 3C4WA 1WFCA 4Q5EA 4QMMA 5CSWA 2R3PA 4JQEA 2F2CB 3ALNA 3IS5A 2W4JA 4J52A 2YLFA 4KS7A 5E92A 3TT0A 3AD4A 2UZBA 3BQRA 2GNFA 5IQHA 4FKPA 1WVXA 4EH8A 2VU3A 3LCKA 4FV5A 3BYUA 2QURA 3Q6UA 4G2FA 5CAVA 3KVXA 3CXWA 5FRIA 4ANSA 5C1QB 2CN5A 2XNNA 4Q9SA 2HZNA 2UZEA 5FQDC 2P55A 4EOIA 2W1HA 1V0BA 4DEIA 3MV5A 5M4FA 2WMVA 1V0OA 4TNDA 1NA7A 3EZVA 4MWIA 4W4YA 5F94A 3QUDA 3VF8A 2PZ5A 2RG5A 1F3MC 4FUXA 4UWYA 4O81A 5AIRA 4XRJA 4QP4A 5DA3A 4A4OA 1FVVA 3C7QA 3NR9A 1CKJA 2ACXA 4DCAA 4BBEA 4ANQA 2RFSA 4TWCA 3BV2A 2HZIA 3KKVA 1U54B 4D1SA 1U5RA 3OHTA 3IW6A 4JLCA 3DQXA 4AW5A 4E73A 4F1MA 4OBPA 2IPXA 2RL5A 2BHEA 2G2HA 2UW7A 3G0FA 3Q2MA 2Y4IC 2F57A 2VX1A 4XEYA 3W33A 3VS1A 5JFVA 3GOKA 3FKOA 4JG8A 5CAUA 2PK9A 5EM7A 5J79A 4FTKA 3DXPA 3PIXA 3LQ3A 2P0CA 2PTKA 1XH6A 3FY0A 4BDAA 5KMNA 4H36A 4FSYA 4I24A 3SXFA 4CVAA 3KVWA 4D9UA 4RVTA 2J0JA 3QQUA 4UWCA 3FMMA 3QC4A 2WQMA 4RIOA 4O7YA 5CX9A 5D9HA 2GNLA 3VVHA 4CEGA 4DH7A 3UOJA 4X2NA 3OTUA 3LQ8A 5BYLA 3NLBA 1Y57A 2CSNA 3DKFA 5JFSA 3MSSA 3KFAA 3QCQA 2P4IA 3FZTA 3GU7A 4FK3A 3FWQA 3BHYA 2C69A 3FYJX 3NUUA 3CQWA 4FBXA 3MH3A 3N9XA 5CQUA 3BU6A 3BCEA 2I0HA 4TW9A 4YGAA 4DFBA 4L42A 4Y95A 4I5PA 4GW8A 4IH8A 4F7LA 3PY3A 5C26A 4FNZA 4IAYA 4RT7A 5CY3A 5EYCA 4YBJA 1Q8ZA 1MUOA 4J53A 4MBIA 4MXYA 4CKJA 1KUTA 2PUIA 1SVEA 4LL0A 4XG4A 2X1NA 4NU1A 3KXZA 2UV2A 4TXCA 5ETCA 3ORIA 5KKRC 5AUVA 1FMOE 1W98A 1YHWA 4G31A 3EFJA 2EUFB 2Y8OA 2XNOA 3AT2A 2YHVA 3AC1A 4YPSA 4XV2A 2NNWB 1FGIA 4RIXB 2JIIA 4WT6A 3Q9XA 4K1BA 1YI4A 3LCTA 2PZRA 3F5XA 3MPMA 4ZLZA 3TV4A 3IG7A 5LOHA 2WTIA 3A8WA 3HV6A 4GEOA 4I92A 3QBNA 3NUXA 4RJ4A 4L01A 2C5OA 3DFAA 3NIZA 2XIYA 3O51A 4X3FA 5DT0A 5IA2A 3FQEA 4IZYA 4BCFA 3NS9A 4BCIA 5IH4A 3QZGA 4JJRA 3EQIA 5EDRA 4F08A 4BHZA 4E5BA 5CLPA 3RHKA 5L2SA 5LMAA 3U55A 4ZY6A 4FSNA 4A4XA 2X9EA 1Q41A 1YRPA 4B8MA 1YOMA 3CQEA 2R7IA 3AG9A 3Q52A 5L6WL 4DGGA 1VR2A 2PWLA 2YA9A 3CC6A 4FKRA 2WHBA 4NM0A 3UMXA 5CSPA 3KN6A 4MXOA 1OUYA 2BKKA 4JRVA 3DB6A 5AUUA 5IEVA 3U6HA 5A4LA 4MBLA 3R73A 5A4QA 2ZYBA 3DK6A 3KRXA 1SZMA 2UZLA 3JPVA 5DLSA 2C3LA 4C62A 3O17A 3R21A 4DC2A 5J9ZA 4O7VA 2RFEA 3LZBA 5J1WA 3QZIA 1TKIA 3RK7A 4PF4A 3WIKA 1Y8YA 3Q4TA 1M7QA 4QMYA 4C4GA 1B39A 2WIPA 5A3XA 5AAGA 3JUHA 3MTFA 3IQ7A 3FZ1A 3PVGA 1ZAOA 3P9JA 3PXYA 4JT3A 4RIXA 4ZSLA 2PVRA 3ZTXA 3RGFA 1H1RA 3BE9A 3GFEA 1GIHA 2XCKA 1WCCA 3PYYA 4L7SA 2J0LA 3DDPA 2Y7JA 3VRYA 4EOQA 3R7OA 3GENA 2QR8A 3L8XA 5JEBA 3BYSA 1KWPA 3AMYA 3AD5A 4JDJA 1WMKA 4PL4A 3V5LA 2ZV8A 2QO9A 3FLSA 2OJIA 3T9TA 2BCJA 4JBVA 4RFZA 4RC2A 4DH3A 4EK4A 2YIQA 2BRMA 1YDRE 3ODYX 3ZO1A 3DFCB 4BDIA 4JX3A 4BWPA 5EYDA 3TDWA 3HMPA 4XNEA 5D10A 3ALOA 3M11A 3W2PA 3CIKA 1WBOA 4ZZOA 3LFSA 3TKHA 3FZSA 2G1TA 4DCEA 2YDKA 3NX8A 3ZS5A 5GNKA 4ACGA 5CT7A 2CLXA 2EXMA 4ERWA 3LM0A 3MPTA 4JDKA 4ALVA 1ZARA 3NRMA 4JIAA 4MNFA 4Z7HA 4LG4A 4ASZA 3L9MA 4JDHA 4WSQA 1JKSA 2I0EA 3PJCA 3FPQA 1OKYA 4E3CA 5FXRA 4L68A 4NH1A 2O63A 3R9OA 3RNIA 4FF8A 4FTAA 3NSZA 5K5NA 4B6LA 1YDTE 4BDFA 4BKZA 2VTNA 4CCUA 3SVVA 3SOCA 4M14A 2BAKA 4HCUA 4YJSA 3MH2A 4DITA 3MESA 5DOSA 4ERKA 4FEWA 4IZAA 1Y8GA 1YI3A 3QD0A 5HD4A 4XG2A 4BCHA 2JC6A 3V04A 4C57A 4IC8A 4EWQA 1HCLA 4K0YA 1P4OA 2VRXA 4O1OA 2C0TA 5FDPA 1W82A 4R7IA 4QP3A 1PMEA 2XKDA 4DLJA 3GCVA 3HMIA 4RG0A 3GOPA 1TQIA 2A0CX 3IECA 3C1XA 3KK8A 3S0OA 2QOQA 4BBFA 1VJYA 2XZSA 5HOAA 4YURA 4P5QA 2PMIA 2VTJA 3VS7A 1Y91A 2HY0A 4U79A 2QKRA 3QXPA 3KMMA 4OTGA 3MA6A 5KMLA 3CCNA 4KABA 4BHNA 4KIKA 1OKVA 4GSBA 4M68A 4D0XA 1ZWSA 3DJ6A 4FSUA 2OW3A 2W1EA 5HCYA 4HYHA 2FH9A 5FM2A 1H1PA 2CKQA 3PZEA 3JY9A 4TTHB 2VV9A 1S9IA 2B4SB 2B0QA 4O7NA 4AN2A 3UVQA 3TKUA 2PL0A 3BLRA 3BYOA 4CYJA 3NGAA 4BDGA 2JD5A 4CLJA 4F6SA 4R7HA 3KL8A 4BDDA 3MVMA 4DBNA 4ONAA 2XK8A 3F3ZA 2JDVA 4U45A 4YJTA 4C8BA 2W1GA 2PULA 3UE4A 2C6MA 2I0VA 1AQ1A 2IVUA 4KIOA 2HXLA 4ZJVA 2PHKA 5FTQA 3MVJA 4YZDA 5IG1A 3FEGA 4C7TA 4YJVA 2OH0E 4BCQA 2GS7A 2QU6A 2Z2WA 5CENA 3NUSA 4ACHA 3CD3A 4BDJA 4ZTLA 3FL4A 4IDVA 4JDIA 5CALA 4U42A 5IMEA 2Z7RA 5EQEA 3G0EA 4EOJA 5KMKA 5CQWA 1J7LA 2JBPA 2OO8X 3E8CA 2JDOA 5AMNA 2BZIB 4ITIA 4EH4A 4U3ZA 4O0WA 2EVAA 2UW8A 1LR4A 2WO6A 4OGRA 2PPQA 3V6SA 2IZTA 3DOGA 2ETRA 3IW4A 4E4XA 5JSMA 5C03A 4G3GA 3BIZA 5DR9A 2H34A 2YZAA 2ZDUA 3AT3A 2C1AA 3CE3A 5T6KA 3DDQA 3BLHA 3FQHA 5AM6A 3FPMA 5GHVA 2CNQA 5BUEA 3QUPA 3BGZA 4I23A 4TYJA 3KRLA 3PZHA 4QRCA 3MFUA 5J8IA 5IEYA 2O65A 4O7LA 2FB8A 4GRBA 5BVEA 2X6EA 3V51A 4BZOA 4DG0E 4CKRA 3ZSIA 4QP1A 5I9UA 2OG8A 2WTKB 1H27A 5DR2A 4ZTNA 5TOZA 4CKIA 4ZLYA 5JZJA 4L7FA 5DEYA 4BIDA 1OL1A 4PX6A 3R8UA 3I4BA 4KB8A 3OP5A 5G1XA 4FTUA 2BMCA 4WG3A 3COHA 5I9VA 1BX6A 4FZAB 4AFEA 4YZ9A 3CPBA 4FTQA 3HRCA 3I7BA 4XV3A 4MXXA 4CXAA 3SG9A 4BYIA 2ITTA 5IQCA 2BIYA 2W9ZB 3Q9WA 1Q62A 1YQJA 3FYKX 5HVYA 5C4LA 3DGKA 5HG8A 4TZRA 3BGPA 3MI9A 4ACMA 2C6IA 2GHMA 2CKPA 2QHMA 2B52A 3ZFMA 4C35A 4O0UA 3SW7A 4R8QA 3C50A 5E8XA 4CRLA 4JQ8A 5BVNA 5TR6A 3V5JA 3D5VA 2GNGA 4DFNA 2R3JA 1UNGA 3EN7A 3EQFA 3IPHA 3TZMA 4BFMA 2IW8A 2F7EE 4TYEA 5M55A 5E9EA 2VO7A 4ZY5A 3MN3A 5IKWA 4CV9A 4GJ3A 5HE2A 3TNWA 2DWBA 1G8SA 4IB5A 2Y4PA 1Y6BA 2Q83A 4FT3A 4GMYA 3VS4A 2VTAA 3C4CA 4XJ0A 5HZNA 3I0QA 4UYNA 4C36A 3NUYA 1DM2A 4QMVA 1H24A 3DV3A 3N4TA 2Y6MA 4EBWA 2C6EA 1WBPA 2GCDA 5HI2A 3VN9A 5DRBA 5ACBC 3MIAA 3F2NA 5EYMA 4AFJA 4ANOA 3GU4A 4FX3A 2HXQA 2VO6A 4U3YA 5IUHA 3D7TA 5CT0A 3EIDA 2YCFA 2OLCA 4O83A 1JBPE 3M42A 4CFMA 4TYHA 5HO6A 4NFNA 2OJGA 1IAHA 3PPJA 3LFQA 3GGFA 3Q2JA 3OF0A 3K2LA 3MJ1A 3ZLWA 3O2MA 5J7HA 2OZOA 3UIMA 1BUHA 2OZAB 5ETAA 4ZMEA 3SRVB 4J97A 3EFKA 3C4ZA 3E92A 4O38A 4PV0A 5KKRB 3SOAA 4Y5QA 3TXOA 2QLUA 4BDEA 4C59A 3FMDA 2YWVA 2QLQA 2PE0A 3QQKA 1F0QA 2C5VA 3BBTB 4IZ7A 4RMZA 4I93A 3MVHA 4AT4A 4IM3A 1LUFA 2JDRA 4ZSAA 3FKLA 3RP9A 2WQNA 4YJOA 3UQCA 4O0SA 4WNOA 5DBXA 5M07A 4G6NA 1RW8A 5E8YA 4V05A 2BDWA 2XKCA 4AA4A 2IW6A 3EQRA 4EK5A 4I22A 3OWLA 2CGWA 2UZDA 5BX0A 4NKAA 2J5EA 3VHKA 4E4NA 3R9DA 2HW7A 3E7VA 4NM3A 5F9EA 3W18A 2X2LA 5ANIA 4D4VA 4LV5A 4D2VA 3PXRA 4G9CA 3TV7A 4E6AA 3GU5A 3RCJA 2XA4A 4M0ZA 5T3QA 3W16A 4NSTA 2J51A 2OZAA 2VNYA 3KF7A 4BTFA 3OEFX 3HAVA 3TM0A 1NXKA 2X2MA 5L8LA 1PXOA 4PTEA 4Q2AA 2A1AB 4RLKA 5B2LA 5KX8A 2VX3A 3NIEA 5A4TA 3ZUUA 1PXLA 2X8IA 3PRFA 4X0MA 3C51A 3I60A 2QNJA 3RAWA 4NJDA 3PTGA 4FTLA 3R9HA 3RWQA 1DAYA 5EW3A 4O1PA 2XF0A 4I4FA 5B2KA 3V8WA 3HMNA 2BROA 2GS2A 4AW2A 3GCPA 4RIYA 3TDVA 5E90A 4L53A 2QOHA 2A27A 2DYLA 2UW5A 2QOCA 2XBAA 5CEIA 5HTBA 4EBVA 1PXKA 1YXSA 5IQEA 1Z9XA 3RWPA 3GCUA 3U51A 5GJGA 2X7FA 5CI7A 2WMQA 4U43A 4CZUA 3UNJA 2J5FA 3FY2A 3OMVA 4PTGA 4QMXA 2YIYA 4FODA 1ZY4A 4N6ZA 1G3NA 3OWPA 2V62A 3QZFA 3ORLA 5HIBA 4UY9A 3PSCA 4WG4A 4PPCA 2IVSA 4JBPA 3E88A 3OZ6A 4YLJA 4EYMA 3D5UA 3DXQA 5IQIA 1YKRA 4YHJA 2HY81 4QYGA 3OOMA 2VTRA 3OCBA 4DTBA 1R3CA 2V55A 2ZJWA 3ET7A 3K5VA 3PVUA 1M2QA 3HX4A 5TKDA 4AUAA 4X6RA 2I6LA 1LP4A 2VUWA 3R01A 5LCKA 1IAJA 5FG8A 5AJQA 4FZ7A 2C6LA 3LFFA 2J0IA 3OS3A 3V5PA 5BYZA 3RPVA 1QPJA 3CJFA 3UBDA 3OWKA 4O21A 1UKHA 4D55A 5DIAA 3VIDA 4FGRA 3WARA 4BCGA 3O8UA 3BU3A 1H4LA 3U4WA 3Q96A 4HOKA 4JG6A 4KD1A 3PSBA 4BGHA 3WOWA 3MVLA 4DEEA 5M4IA 2PVHA 4YJNA 2GPHA 2XJ1A 2XUUA 4O96A 5AP5A 3I79A 3ZOSA 4O6EA 4BF2A 4D4YA 2EU9A 5D11A 3F6XA 4IB3A 4AZSA 3R71A 2PZPA 4DGMA 4F99A 3AC2A 5E1SA 4U6RA 3EQDA 3E7OA 4E1ZA 4USFA 1FGKA 4C4HA 1V0PA 4IWQA 1ZOEA 4BICA 2BAJA 2DS1A 2ESMA 3PIYA 5H3QA 4BKYA 2A4LA 5CVFA 4L67A 3U4UA 1S9JA 5ANJA 3VW6A 4BDKA 2YERA 1YDSE 4EH9A 3HMOA 2YABA 3CGFA 3R30A 4U5JA 3PXFA 2ITUA 3SLSA 2VNWA 2BRBA 4RX7A 2Z60A 5EM8A 5AUZA 1MRYA 3R7IA 3SQQA 4RIWB 4LQMA 4CRSA 1H07A 3ORTA 4IJ9A 4GK4A 3T9IA 2UW3A 2WQBA 3UP2A 2BVAA 4ZZMA 5CU0A 1W84A 5DEWA 5EDPA 3HAMA 4UV0A 4FUYA 2E9VA 3VAPA 3AGMA 2OICA 5CU2A 4DFZE 5C9CA 4QP6A 2B9HA 4XMOA 3B8RA 2ZB0A 3D94A 4EHZA 2BRGA 1I44A 4G6LA 4WSYA 1XH4A 5T68A 4BCKA 4F09A 5LCJA 4IMYA 4ANLA 4F9BA 1BI7A 4ZIMA 4MCVA 5IUIA 2C3JA 2XNBA 4FV4A 1ZY5A 3FV8A 3UPZA 4FEVA 2RGPA 3HV7A 5EHOA 2FO0A 5CZIA 2HOGA 2GFCA 3JXWA 1XBCA 2XIXA 5JRSA 4FSRA 3V3VA 1IA9A 2C3IB 4DHFA 2OFVA 2BZKB 3AQVA 3LFAA 4R5YA 4FIJA 3FI4A 1R0EA 2YM5A 1XKKA 2YITA 4HZSA 4CZYB 5IQAA 3MA3A 4F7JA 4G3CA 1OKZA 3C0HA 4AG8A 4GS6A 2VTTA 1JQHA 1U5QA 4R5SA 3I5ZA 1A06A 1JVPP 5FXQA 4BKJA 3A7JA 4W8DA 3UOHA 3R7EA 3ORZA 1PXPA 2WTCA 4U7ZA 4DTAA 5EI6A 4FTOA 3QL8A 4E5AX 1WBNA 1URWA 2YAAA 4CYIA 4J71A 3O8TA 3LCOA 4MQ2A 3TL8A 2BDJA 5BQ0A 3H9RA 3DXNA 4IAZA 2GMXA 4TWPA 3UIXA 3AC5A 3VBTA 2QR7A 4UXQA 3FHRA 2GTMA 4YTIA 2EB2A 5AUYA 3POOA 4IM2A 2I7QA 2R0IA 3KCFA 3C13A 2E9NA 4G9RA 2FGIA 4CFWA 4CSVA 5IQGA 4FZFB 4QQCA 2R3LA 4AGUA 1SYKA 5AFVA 1PKGA 1M2PA 2WMWA 5HE0A 4PDYA 4GK2A 4LRJA 4RA5A 5FEQA 5HD7A 4IAIA 2PZYA 2UZNA 3I81A 1GY3A 5DVRA 3DK7A 4NW5A 4AACA 4IWPA 3C9WA 4BI2A 4O0RA 5HE3A 3G9NA 3UNZA 1XBBA 2P2IA 5DWRA 3C4XA 4PMSA 1XBAA 1DI9A 1OPLA 3QTSA 3E87A 4N4SA 4JL9A 4CTBA 5GIPE 2JKMA 3PWYA 4F1TA 4X6QC 2CGXA 2CDZA 3ULIA 4MNEA 1GNGA 1YXUA 4Y5HA 1UV5A 3ZO3A 5LQFA 5EM6A 1LEWA 3HYHA 4RJ3A 2W5HA 1Q97A 1QL6A 3COKA 3GU8A 3PJ8A 3TZ9A 3ATSA 3BPRA 4AW0A 3LFBA 4AOIA 4F65A 2X7OA 3QA0A 1OIQA 2WTDA 4H1MA 3CKXA 4DG3E 4PWNA 4EI4A 2O64A 2QO7A 4QD6A 3GC8A 3KN5A 3CPCA 3WF9A 2BFXA 4G1WA 4DH5A 4ASDA 3QTXA 1SM2A 3P0MA 3MYGA 4HGLA 4RA4A 4XOYA 4QTAA 5E7RA 2J90A 4FIHA 3QKMA 3F82A 3DBDA 5KBQA 1J3HA 5EQYA 5GZAA 4I94A 1XH8A 2HCKA 3KEXA 3VUDA 3HV3A 3WF8A 3QX2A 5M44A 3VWAA 3PLSA 5DMZA 4QNAA 4F6WA 5AP7A 1JNKA 1OM1A 3C5UA 4E8AA 1UVRA 5AUWA 4X2JA 1H08A 3HP5A 2R3MA 3OG7A 2VWXA 3PIZA 1KV2A 2EB3A 3IGOA 3S4QA 4CG9A 4J8MA 3LE6A 4QPAA 3V6RA 4CFUA 3VUKA 4ENYA 5EYKA 4F9AA 4UMTA 1ZYSA 4ALWA 4C37A 1SNUA 1Y6AA 3O0GA 4M69A 4RRVA 3O7LD 3ZO2A 2BUJA 4F0IA 1KE5A 2QQ7A 4BDBA 4D2WA 4JVGA 2YM8A 4E4LA 1OKWA 2YN8A 5HLPA 1Q3DA 4NZWB 3LKMA 3PA3A 4O0XA 3VS2A 4F70A 4QP9A 4XRLA 5CYIA 3NCZA 2JKKA 4LGDA 4MK0A 4R3RA 3QQLA 5M4CA 3UYSA 5JGBA 2VX0A 3DT1A 4ANBA 4XV9A 3MW1A 3PE2A 5C27A 4MKCA 1QPDA 3MH1A 2UW6A 4UYAA 5A9UA 4B8LA 2ETMA 3WF5A 4WO5A 2W99B 5KNJA 4FNXA 3CR0A 3IK3A 1IR3A 3VNTA 3ZM9A 4RPVA 4M13A 2Z8CA 3CTJA 3DS6A 1XWSA 4X3FB 3ODZX 2XK9A 2CLQA 2HW6A 4IFCA 2REIA 2XK4A 2R0UA 1FOTA 4EONA 2XB7A 5I9WA 4D9TA 3MJ2A 1PRYA 4WRSA 4Z7GA 4V04A 3DBQA 1F5QA 4JAIA 3E63A 5ETFA 4WKQA 4C4FA 5IZFA 3DAJA 3VW8A 2ITOA 4A9TA 4FV7A 2YAKA 4C38A 5C4KA 4IB0A 5HCXA 4I21A 2X2KA 3R8VA 4TL0A 5M51A 3Q53A 4ZS0A 4BYJA 4O22A 4OUCA 3W2RA 4OTDA 4AT5A 4C58A 3ZFXA 4EHVA 4ALUA 3MBLA 3ZZEA 2P2HA 4BBMA 3UTOA 3E93A 4LUDA 3VBWA 5JFWA 3LW0A 4EH2A 2WMTA 2JFMA 3UP7A 3OTVA 2V7AA 3Q60A 3BHHA 3RPRA 4FK6A 3QYZA 4XV1A 5AIKA 4AE6A 1UKIA 1WBSA 2ITYA 5L4QA 3UZRA 3IGGA 1KOBA 1KOAA 2FVDA 3KU2A 2J6MA 4A7CA 4HYUA 5EW9A 4OTWA 2QONA 4EYJA 4RVKA 5HEZA 3UVRA 1DI8A 4RC4A 1W0XC 1XHAA 2YM3A 2X39A 5I9YA 1OL7A 4K9YA 3PE1A 4AP7A 3T3VA 4DT9A 1J91A 4KRCA 3U54A 2YDIA 4PQNA 1WVWA 4IX5A 4O2ZA 5EHYA 3FLZA 3PXZA 4JBOA 5J5SA 4F9WA 3OCTA 4L00A 4AAAA 4R1YA 2CKEA 3KRRA 3V5TA 4HNFA 3OWJA 1FPUA 2ITVA 2XCHA 4B7TA 1H1QA 5M06A 2W17A 4QMLA 5I3RA 4BGQA 4TY1A 3NVKI 4A07A 4LV8A 3FKNA 1YHVA 5C8NA 2RSVA 4B9DA 4G5PA 4EOLA 2GDOA 5E4HA 3R7UA 1VZOA 2RFNA 4ZTMA 1ZYCA 3QTUA 1JPAA 3WYXA 5EM5A 2Z02A 4QP8A 3R1NA 4Y46A 4RWKA 2C5NA 4S32A 3JVRA 3F61A 4W4WA 4GK3A 3IKAA 4QP7A 2JEDA 4AZEA 3ZLXA 4QMTA 1NW1A 2BTSA 4D28A 3ORNA 3VS6A 3RM6A 2X7GA 4EQCA 2PE1A 4PUZA 3UPXA 4ANNA 4MXZA 4YP8A 2PE2A 4E7WA 2FSLX 3OD6X 3BEGA 3MTLA 3Q5IA 4W9XA 3D5WA 5GJDA 3T8OA 4FTRA 3R63A 3NZ0A 3OBGA 5FEEA 4YLLA 4ASEA 1U4DA 4G17A 3FLNC 4KKHA 3M2WA 4RSSA 3W2OA 5AR4A 1HOWA 1TVOA 2IJMA 3BYMA 4M84A 1KE9A 3KULA 5CTPA 4DH8A 4KIKB 2C0OA 4ZXTA 3QXOA 4PL3A 2R3NA 4XP3A 4E6QA 4M3QA 5BVOA 3LLTA 4TYIA 3ZUVA 1NVRA 3A61A 3GCSA 4JBQA 4FL2A 4NFMA 3ZRLA 5A4CA 3QLGA 3LMGA 4FV1A 2ITQA 1ERKA 2XM9A 4HPTE 4O27B 2UZOA 3MFRA 3OUKA 4Z3VA 4GT4A 5KHXA 5AWMA 1FVRA 3CP9A 4LOOA 3NUNA 3GCQA 3TJCA 3UIBA 4F7NA 2BKZA 2GU8A 4FKIA 5HIDA 3ITZA 1WZYA 2OF2A 3LFNA 3UO5A 2GHLA 2R3RA 2C3KA 4BRXA 5AUTA 5HG7A 3DKOA 4F7SA 5JH6A 3NMUF 3EZRA 1YXXA 1Q5KA 1R0PA 1Q8WA 4RX5A 4NKSA 4YUQA 3P86A 1B6CB 4XG8A 4DF3A 4AZFA 4TRLA 3UQGA 3ULZA 4FKGA 1P5EA 2B9FA 5L8KA 4FV0A 5BVDA 4M0YA 4YSMA 4ACCA 2PZIA 3GT8A 3QQGA 3UDBA 4GJ2A 2XRUA 4C33A 4FIEA 3HGKA 3VJOA 5DN3A 2HZ4A 3NEWA 5K5XA 2B1PA 4FEXA 4LGHA 5KZIA 1BYGA 3KY2A 4E6DA 3TZ7A 3BX5A 4EHEA 5LMKC 3QKKA 2Y0AA 1GIIA 3A2CA 3BV3A 4HVHA 2CGUA 4WD5A 3ZZWA 3OT3A 2H9VA 2H6DA 3R7YA 5AP0A 2WGJA 4Q5HA 5AR7A 4QQTA 4AGWA 4EJNA 3F88A 4KWPA 2C68A 3UIUA 5AADA 5JQ5A 2CPKE 3TUCA 4AN3A 1W83A 3O50A 2NPQA 3TV6A 5M56A 3VULA 4XX9A 2VTSA 5K4JA 2OF4A 3F5UA 2C47A 3BI6A 3BGQA 3PVBA 3GB2A 2JBOA 3C0GA 2R7BA 4NUSA 3KB7A 4NM7A 1GZKA 1YWVA 2CCHA 3QRIA 2XBJA 3GNIB 5HIEA 4FEUA 3LQ5A 3KXNA 4OTFA 5CWZA 4UALA 5IQBA 2Z7QA 2Y6OA 2W06A 3DZQA 3FSFA 3FXWA 4O6LA 4RBLA 4QMQA 2KTYA 5DGZA 3ETAA 3SA0A 4V01A 2WPAA 3F5PA 1UWJA 2UZTA 4CMTA 3R2BA 2W1FA 1ZYDA 3V8SA 3EQCA 5BVKA 4XCUA 1G5SA 3F3WA 4LRKA 4GKIA 4Z16A 1K9AA 4LI5A 5I4NA 5LVNA 1E1VA 5EOLA 3SV0A 4JXFA 5CEKA 3RJCA 3NYNA 3OW4A 4AOJA 2JFLA 4F9CA 3NNVA 1APME 1ATPE 3FLWA 3EHAA 4FVRA 3RKBA 2C5XA 2YJSA 3FXXA 1ZOGA 4UB7A 4TWNA 3UGCA 3WZJA 4A9SA 2J9MA 5ANEA 4C4JA 1CSNA 5J87A 4B0GA 2VO0A 3R8ZA 4IEBA 4YR8A 5JT2A 4OAVB 4YBKA 2IWIA 4UZDA 2EWAA 2WXVA 3TTIA 4QPSA 4BCPA 3ZSGA 5HO7A 3A7GA 3UOLA 1PXIA 4XP2A 5E8UA 3W8LA 5L6OA 3ZFYA 4I6FA 4X2KA 4ZSJA 2XNMA 3ORKA 4DAWA 3BBWA 2WMSA 3GC9A 2QCSA 5HBEA 3D7TB 4E5WA 4NEUA 1WBTA 4C4EA 1Q24A 4TYHB 3KC3A 5AX9A 4CTCA 5EKNA 2NP8A 1J1BA 2YWPA 4FGBA 3VC4A 4D0WA 4D4RA 3G15A 2Y4IB 3PY1A 4QOXA 5DH3A 2W4OA 2VO3A 3GC7A 4D5HA 1YXVA 5IF1A 3ZCLA 3OROA 4DEHA 4AWIA 5IA5A 1RQQA 4PPBA 1OITA 2BFYA 5KZ0A 1OMWA 5BUJA 5H2UA 3PPZA 4GUEA 4YLKA 4DGNA 4L43A 4WUNA 1TQPA 2ZDTA 2YM4A 4LYNA 4OTHA 1IRKA 5CSHA 4FYNA 4M66A 4M67A 2V22A 3E8NA 5HORA 5CU6A 4AN9A 4GT3A 3DY7A 2WEVA 3FMKA 3LFCA 2B54A 3AMBA 3L9PA 3R04A 4KNBA 4O2PA 4KAOA 5CU4A 3DB8A 2PUPA 3D83A 3HV4A 4X2GA 4FTJA 4M12A 4K2RA 3WZDA 3H4JA 4EL9A 5CSXA 4A9UA 2FYSA 1RDQE 4TT7A 2BDFA 3PP1A 2J0KA 4XBRA 4PTCA 1A9UA 3KMWA 4P4CA 5CF8A 2ZV9A 3R9RA 4IX3A 5DPVA 2NRYA 5E1EA 3EWHA 4FTIA 2P3GX 3BRBA 4MXCA 4RQKA 3R6XA 4EZ5A 4WRGA 3PA5A 5BVWA 2GNIA 3COIA 3Q4ZA 2W5AA 1M14A 2XYUA 3QQFA 4GG7A 3REPA 3S00A 5FGKA 3KRWA 3SDJA 4ZMFA 5HG9A 3QF9A 1FQ1B 1PMVA 2BILB 4RX9A 2UW4A 3EL7A 4Y72A 4K8AA 3U8WA 1H8FA 4YJPA 5K4IA 3DK3A 3L9NA 3ZRKA 3R1QA 4L6QA 1H00A 4ACDA 4APCA 3UC4A 2ZVAA 3BEAA 3GP0A 5DRDA 3LMHA 1GZ8A 2QOFA 4UMPA 3S1HA 2SRCA 3KMUA 4BWXA 3R8PA 3MWUA 3WYYA 4QYFA 4YJUA 4XP0A 1OIRA 4X21A 4ZTRA 3RPOA 4RFYA 2GSFA 4RIYB 5A14A 2OJFE 3GQLA 3FMNA 3POZA 4FKUA 4O0YA 3KQ7A 3R0TA 4MH7A 4ZP5A 5IH5A 3KXHA 3B2TA 4FSMA 4D2RA 3PG3A 3FXZA 4R3PA 2AC5A 3W1FA 3LXLA 3QTZA 4E4MA 4NIFA 2HIWA 4NWMA 4P5ZA 1T46A 2OSCA 4YTHA 2OIQA 5DNRA 1OGUA 1L3RE 3E3PA 4FKJA 4ZTSA 1WBVA 2XNEA 5CZHA 3IOPA 2W7XA 1OPJA 4YZCA 3DCVA 4F6UA 3P7AA 4IB1A 5GIOE 5HESA 1UWHA 1K3AA 1XH5A 3FMEA 3P78A 4FTCA 5HKMA 3R7VA 3AMAA 5D41A 3Q6WA 5HLWA 3C0IA 4B4LA 5L2TA 3UNKA 4FT9A 4FKSA 3HUBA 5FWKK 3UYTA 2B53A 2JKOA 4QP2A 4XLVA 1Z5MA 1UU9A 5D1JA 1P2AA 4PDSA 5BNJA 3C4FA 1FMKA 4TWOA 4EJ7A 1P14A 3QD2B 4DE4A 3VBXA 2XK7A 3FC1X 4L44A 4MYGA 4A9YA 5ICPA 3EB0A 2OXDA 4EOPA 5EG3A 4OT5A 3NWWA 4BVUA 3JS2A 5CANA 3BELA 4PMPA 3A62A 2V5QA 1QPCA 3CJGA 3WZKA 4WBOA 4FZ6A 4FV6A 4NK9A 3EFWA 3ZXTA 4HGEA 1H0WA 3F5GA 3W32A 3C4EA 3TEIA 4CLIA 5H8GA 3GXLA 3K3JA 4IACA 4WNMA 4TN6A 5AP4A 2YCQA 3PJ1A 2JGZA 3DJ5A 1R39A 5AP3A 2LGCA 4ZSEA 4C3PA 4FSWA 4YTCA 3W2CA 4D1ZA 1JLUE 2CN8A 2E2BA 4FIIA 1A48A 4QMSA 5IDNA 1PXMA 4FSQA 4FOCA 3GVUA 4I1ZA 4L3JA 2R3FA 4C2WA 4X7QA 3AGLA 3QRJA 2WD1A 5HG5A 5M4UA 2J4ZA 3LXKA 3K5UA 5AA9A 3NYOA 3UZPA 3OFMA 4CFFA 2R64A 5CAPA 4EC9A 3ENHA 1YOLA 3F7WA 3VS0A 5K3YA 2AYPA 3D9VA 4WNKA 5HVKA 1M17A 3N4UA 4F0FA 3SD0A 3ACJA 5L8JA 3ORMA 4FVPA 4I0SA 3SG8A 5LWNA 3DBFA 4FG9A 1ZMWA 2V7OA 3DAKA 3GC0A 4FOBA 4J98A 4WIHA 4E93A 1IASA 1OPKA 2WTJA 4FG7A 5I0BA 3G9LX 2B9JA 3RPYA 4B99A 4K6ZA 2X8DA 4KBCA 3NNXA 2O0UA 3FMHA 4YZNA 3OBJA 3ELJA 3BWFA 4R78A 1OL5A 2HELA 2PVFA 4C3FA 4QYHA 4HYSA 4CMUA 3UZTA 4IAKA 3LJ0A 2WTWA 2WU6A 2G15A 3CTQA 4CZTA 4GYGA 2YEXA 3LCSA 2QD9A 3OCSA 4UEUA 3DZOA 4KS8A 3V5WA 4EORA 5B7VA 3P08A 5FTOA 4F1OA 4QTEA 2W9FB 5IA3A 4AGCA 2W4KA 4Z9LA 1BL7A 3IW8A 4J7BA 4ZOGA 1CTPE 3BLQA 3B8QA 1GIJA 1H0VA 3P1AA 3Q4UA 2IVVA 4YO4A 2GNHA 3HVCA 4PNKA 4G3FA 2VWUA 3MH0A 1W8CA 5H8BA 2XK3A 3U87A 3VUGA 4D4SA 1PXNA 2XEZA 5JK3A 3PP0A 4C4IA 5HO8A 3OCGA 1UU7A 3QHRA 4YC3A 1M52A 4UMQA 2E9PA 5FEDA 4N6YA 4LOQA 4I5MA 4U0IA 1UNLA 3V01A 4R3CA 1J1CA 4AW1A 5LVMA 2J2IB 4FG8A 4KIPA 4AF3A 3NPCA 5C8KA 1PKDA 3T3UA 2WNTA 1T45A 3G2FA 4LOPA 4KSPA 3R8MA 4FNWA 3VS3A 4LM5A 4OTIA 4DA5A 3ZMMA 4HZRA 4G3DA 1CDKA 5CSVA 2Q0NA 2VTQA 3OXZA 3F7ZA 1NVSA 5LMKA 3ZSHA 4BDHA 5E8ZA 4YTFA 3PXQA 4MF1A 5DE2A 4IQ6A 3LIJA 4USDA 1ZLTA 4AQCA 1SVHA 3ZDIA 3FLYA 1O6YA 2WTVA 2XKEA 5DT3A 4IC7A 1PJKA 2QVSE 3CLYA 3WILA 3FDNA 3ERKA 5BMSA 4IJPA 4RFMA 2OIDA 3QWJA 3CY3A 4GV1A 4MVFA 4P2KA 2PU8A 3R22A 3EJ1A 2G9XA 3BZ3A 4EWHA 5JGAA 1PMNA 4O0TA 3ZXZA 4AXAA 3FJQE 3QD4A 4FR4A 1J7IA 4YZBA 4YJQA 3ENMA 3LVPA 5GZ9A 4DFXE 4FKLA 3EN4A 3FI8A 3U9NA 4MNEB 4FE2A 3CKWA 4KSQA 4XUFA 2AUHA 3L8SA 2XS0A 3EN9A 3I6WA 3UO4A 2R3IA 2XYNA 4LMNA 4QMPA 5IISA 3QQJA 4EOMA 4YJRA 1W7HA 4RGJA 5LVLA 5HNBA 3Q32A 5HU3A 4JR3A 4U80A 4XG3A 5AR8A 5LWMA
chains in the Genus database with same CATH superfamily
3I0OA 5EOBA 4S34A 5L2WA 5EI2A 2PVJA 5FP5A 3QU0A 3BHVA 2VAGA 2OH4A 2XIKA 3QALE 3IO7A 2CGVA 2JITA 3NNWA 4RJ7A 2VZ6A 5B2MA 3KREA 5F95A 5DG5A 5LVPA 4I4EA 3F3TA 3H3CA 3HNGA 3W55A 1ST0A 1OZ1A 2C6KA 2I0YA 3TUBA 4EH3A 3QRKA 5B0XA 2G2FA 3IW7A 4U44A 3LLAA 4YMJA 4AZVA 5C8MA 2VTIA 3BYVA 4MWHA 3O71A 3QQHA 3PRIA 4DHZA 3M1SA 5IU2A 1VEBA 2ITWA 4U41A 3FI3A 4W4VA 5AX3A 4IM0A 3RAHA 1OVEA 1H01A 4JMQA 4MD9E 4M69B 4IBMA 4NJ3A 4QMUA 4D2SA 3FC2A 3P7BA 5AP2A 5CF4A 4FKQA 2YIRA 5A46A 2YM7A 3PDTA 3OXTA 5GJFA 4HVIA 2WFYA 4GFOA 3GBZA 4HGTA 5ITAA 4CG8A 3HLLA 3G6HA 2ERKA 1V1KA 5HLNA 3NW5A 3PXKA 3E62A 1I09A 1JSVA 4N70A 4U40A 4FA2A 4O7TA 4BJJA 2XJ2A 5EKOA 4DEDA 4KKEA 4CV8A 2ZM3A 3VQUA 2XK6A 4BIBA 3A7IA 1OL2A 3UOKA 2ERZE 3NYVA 2FA2A 2F49A 3FQSA 4JG7A 4FKTA 2HENA 3WE4A 5GINE 4K18A 4Y85A 3RINA 4TNBA 3TNIA 4NYEA 4EZ3A 4CNHA 2WMUA 3SC1A 5IA1A 4I41A 4DEGA 2C6TA 2ZM1A 3VUIA 3PJ2A 3PFYA 1PYEA 3WE8A 3BL9A 2IVTA 4FKVA 1PHKA 4UMUA 4DT8A 4RWLA 2F9GA 4AOTA 3R7GA 4WBBB 3D7ZA 5AM7A 3FMLA 3O7LB 5J5TA 3GQIA 3BHUA 2PUUA 2OFUA 4I6BA 4EKKA 3HV5A 4FT7A 4FL1A 2JLDA 4C34A 2GNJA 4PP7A 1CKPA 1DS5A 2WTKC 3DNEA 5BUIA 3D14A 1GOLA 4O91A 1ZXEA 4H05A 5AV1A 2XARA 3CBLA 5FBNC 3BHTA 3OT8A 4YHFA 3ZM4A 4DGOA 4ZJJA 4JQ7A 3DKGA 1BKXA 3D5XA 5GZ8A 4DDIA 3DTCA 4CFXA 2WQOA 1KE7A 2PVMA 5CNOA 3OC1A 4LDTA 3RALA 2X0PA 3LOKA 4U97A 1JOWB 4ZAUA 4F63A 3CQUA 5HTIA 4AA5A 4QMZA 4C02A 5E91A 5HTCA 4O7RA 1BL6A 4CT2A 3TWJA 1OBDA 3MY5A 4OBOA 4ARKA 5E8TA 1ZZLA 3A4OX 4IW0A 3DJ7A 4FV2A 3F2RA 5HE1A 2BTRA 4NT4A 4QTBA 3EL8A 3RCDA 4I0RA 4JS8A 2OXYA 3RZBA 5ANGA 3LMIA 4LV7A 3UG2A 3JVSA 5ACKA 3HMMA 3AXWA 4RQVA 5CEQA 2W0JA 4U9AA 2WKMA 2W1IA 3I1AA 5KMMA 5AEPA 3KGAA 1ND4A 4HCTA 4RC3A 1E1XA 4GKHA 4YNOA 3RI1A 4L3LA 4LL5A 4W9WA 1U54A 3TJDA 4CQEA 5IQDA 1PF8A 2GHGA 4KINA 4L9IA 3Q04A 3OEZA 3QA8A 4CMOA 1GZOA 2PYWA 3UDTA 3I6UA 4KKGA 3FZPA 2HK5A 1MRUA 4RWJA 3ROYA 3PA4A 4FTTA 3SKCA 3NAYA 4IVAA 4A06A 4X3JA 1CM8A 4BTJA 5KMJA 2CJMA 4FYOA 4DN5A 3BQCA 3TI1A 4U8ZA 4FVQA 3RVGA 3VBYA 3QRTA 2JAMA 3UODA 3MS9A 3VO3A 1RJBA 3DTWA 1YVJA 5CAQA 3P79A 2BHHA 5HGIA 3PWDA 1QMZA 1U59A 1UNHA 2BZHB 4FI1A 4C2VA 3NDMA 1BLXA 3SW4A 5BVFA 1REKA 3FI2A 4G34A 4J1RA 5EH0A 2R3OA 3RK9A 1NT2A 1MRVA 4BL1A 2VTOA 4L3PA 4XG9A 5G6VA 4ORKA 4FICA 4DFYA 1ZYJA 1DAWA 2BPMA 1UU3A 4ZK5A 4IX6A 4APPA 4QMNA 4JI9A 4D1XA 5FP6A 4YHTA 5TT7A 2JKQA 3KULB 2ITPA 4G16A 3TNPC 3EFLA 3HZTA 4D2TA 1Q99A 4G5JA 3VUTA 2OIBA 4A4LA 4BCJA 2WOTA 3QKLA 5DI1A 3AD6A 3RTPA 2ONLC 2OXXA 3CY2A 4JIKA 3HDMA 4FSZA 4M15A 1G8KA 2B9IA 3GU6A 2QOIA 4MD8E 2C4GA 3TTJA 2XVDA 3VJNA 3LCDA 4JRNA 3SHEA 5AV4A 3TUDA 4R7BA 3QCSA 4FL3A 3EQPA 2CKOA 4GH2A 4QTCA 4KBKA 2W1DA 1STCE 3O23A 2LAVA 3MB6A 3PFQA 3NW6A 4MEDA 4GL9A 3ORXA 3U6IA 2RFDA 4ITHA 5L2QA 5AAFA 4NL0A 4QEBA 1IA8A 2CNUA 4TPTA 3FBVA 4IE9A 3ZH8A 2H8HA 4EQUA 3E8DA 3KRJA 4GVAA 4S2ZA 3TACA 5JRQA 4PMMA 2H96A 3G51A 4XLIA 3P5KA 4CCBA 2VWZA 4O7ZA 4I0TA 5TO8A 1JKTA 2UVZA 4FC0A 5AR5A 3NW7A 4BIEA 5HNGA 3O96A 5AUXA 1R1WA 4HVSA 1LPUA 2XRWA 3QD3A 5CEOA 5KMOA 2HAKA 4AGDA 3D15A 1U46A 3VS5A 3PY0A 1H1SA 2RF9A 4Z55A 5KUPA 4HPUE 2ZB1A 3OY1A 4HJOA 3IDBA 5D7AA 3W2QA 2R3KA 3MPAA 3DPKA 1Q3WA 3S2PA 4F4PA 4S33A 3ZEPA 4EK8A 1KE6A 4L52A 3DQWA 3DLSA 5C01A 3FL5A 2WB8A 4U81A 5F20A 3DLZA 4YO6A 3RHXA 4DH1A 2F7XE 4J99A 4AX8A 3FAAA 1MP8A 4O4CA 4O4BB 2XJ0A 2J50A 5D7VA 3MIYA 3P23A 5AV0A 1XH7A 4NCTC 3WBLA 3R2YA 2WZJA 3HUCA 1XR1A 5JN2A 2UVYA 5IMXA 5M08A 5J9LA 3WI6A 1XH9A 1REJA 3GI3A 3F3VA 4GIHA 4PRJA 3JYAA 4D2PA 2O5KA 2VWWA 2YM6A 1NY3A 5HBJA 4O82A 5HQ0A 1K2PA 3DU8A 2CNVA 1ZYLA 3HECA 2XNGA 2E9UA 4FZDB 4GFGA 4RLLA 3ZYAA 4YU2A 2FSOX 2OKRA 3K54A 3R28A 4FNYA 4S30A 5AR3A 4H3BA 2CHLA 3W10A 3ANRA 1JWHA 4BY9E 1GAGA 2WMAA 4ZTHA 5HNIX 2QC6A 2R3GA 3VUMA 4S31A 4ASXA 2W5BA 3IDCA 3FLQA 3IW5A 4GUBA 1VYZA 2WQEA 4J95A 4C0TA 5HBHA 2NRUA 1H25A 1OECA 3I7CA 3BWJA 1YHSA 4M97A 1H28A 4EK3A 2ZMDA 5A54A 1ZOHA 3B2WA 1Q8YA 2OI4X 4EK6A 2YDJA 3U9CA 1JKLA 1XQZA 2VTHA 4UZHA 5E8VA 5FM3A 5HVJA 4MX9A 1UU8A 5DHJA 3ZC5A 3ZBXA 4NTTA 4WNPA 3ZO4A 3SXSA 2W96B 5LARA 1L8TA 4GU6A 4HW7A 3ORPA 3IOKA 4FV3A 1YW2A 5DYJA 3II5A 2B55A 4K33A 4PNIA 4H58A 1YWNA 3CD8A 5HX6A 4D58A 2XIRA 4FV9A 4HVDA 4KUJA 4P90A 3PLAE 2ITZA 5CI6A 3QHWA 4I20A 3E8EA 3L9LA 2BR1A 2R4BA 1TQMA 3AC4A 4OTRA 5LVOA 3UMWA 2QU5A 4GT5A 2C0IA 2A19B 2E9OA 3UO6A 2PVLA 1QCFA 3MY0A 5AV3A 3EQBA 3CGOA 4MHAA 4I3ZA 4XHKB 4DYMA 4F64A 4FKWA 2WEIA 4KBAA 4O0VA 3RK5A 2WMRA 2HWPA 4BCNA 4XH6A 4C3RA 4EEVA 4OR5A 1O6KA 2O3PA 2NO3A 2Z7LA 4ITJA 3NUAA 3RM7A 1KE8A 5HHWA 4R6VA 3ZRMA 2Q0BA 2XM8A 3QX4A 4XYFA 2BAQA 3EMGA 3FZRA 3KXGA 1IG1A 2YJRA 4FIGA 3FHIA 4L8MA 4MXAA 1AGWA 2J0MB 3PUPA 1YWRA 3RMFA 3V5QA 4BCMA 2GQGA 2WIHA 2OJ9A 5IA4A 3EKNA 5IEXA 4RZWA 4PY1A 4RJ8A 3JY0A 2O2UA 3QGWA 4WOVA 5BMMA 1OI9A 5TF9A 4XOZA 5JZNA 2WMXA 2XKFA 5HU9A 2VTPA 1SVGA 4L46A 3D0EA 2GTNA 5AAEA 2JDTA 2UW0A 2X0OA 4UWBA 4AT3A 4JX7A 1QPEA 1NVQA 2R2PA 4BZNA 3H0ZA 4EHGA 5J1VA 4MD7E 2QO2A 4MTAA 4UMRA 2VTMA 3A60A 3MDYA 2F7ZE 1OUKA 1WVYA 4I5HA 3P5JC 3Q9ZA 4IWDA 5M57A 4LRMA 4HCVA 3HL7A 2ITXA 3DAEA 3G5DA 3PVWA 2JIUA 2X4FA 4HGSA 4IADA 3WF7A 1OL6A 3DBCA 4PDOA 2FSMX 5BYYA 2IO6A 3KA0A 4IVCA 3LFEA 5CASA 2PMLX 4TYGA 5EQPA 2FSTX 3DNDA 1ZMUA 1GJOA 3D2IA 2VWVA 2VN9A 3FMJA 4L45A 5LXMA 3TCPA 4IWOA 5BV3A 4O86A 1B38A 2AC3A 4FKOA 4K11A 2Y9QA 4XG6A 1Z57A 3F3UA 4Y83A 3SAYA 4RJ6A 4QT1A 2VWYA 2VTLA 4EH6A 2GS6A 4IX4A 4CFVA 2QI8A 3HA8A 4NIFB 5TE0A 5CVGA 5CEPA 2X9FA 3KCKA 2QG7A 2C6DA 1EH4A 4KIQA 1P4FA 3VRZA 5FDXA 4AXCA 5CXZA 3TG1A 3VONA 2OWBA 3H9FA 1OIUA 2HWOA 4IHPA 3P4KA 1PYXA 4UN0C 5DT4A 4H1JA 4NM5A 4RX8A 5D12A 5H8EA 4ZS4A 4Y73A 3S3IA 1H26A 4H39A 4YC8A 1FBNA 2DQ7X 3R83A 4RVMA 5DR6A 2ZOQA 3N51A 3PPKA 1PMUA 5FXSA 2WMBA 2Z7SA 4GVJA 3LJ1A 4E20A 5JFXA 1G8AA 3H30A 3ZDUA 2OBJA 5KBRA 1Q61A 3LFDA 3LXPA 3BE2A 1M7NA 2YCSA 3KXXA 4FRFA 3ZONA 4Q9ZA 2XANA 3CSVA 2UW9A 4KA3A 4PPAA 3A8XA 1KSWA 3NVMB 4DFLA 5FD2A 3TN8A 4CQGA 5EW8A 3OXIA 4GU9A 5KMIA 2RIOA 2WAJA 3LXNA 4HYIA 2UZWE 2VWIA 4AS0A 2ZV2A 4DEAA 4OT6A 4FT0A 3ACKA 4LGGA 5ANDA 2RKUA 1PW2A 4FSTA 5KE0A 4BN1A 2ZAZA 3EOCA 4EKLA 4WHZA 2OJJA 5A4EA 2G01A 5M53A 4K77A 2I40A 4W4XA 3VHEA 2J7TA 4BGGA 3HKOA 4AA0A 2W1CA 1SMHA 1J7UA 2CCIA 4X2FA 2PVYA 3OY3A 4QTDA 4QMWA 2B7AA 3EYHA 2VGPA 3R1YA 2OGVA 2XIZA 3A99A 4N0SA 3EN6A 4Y8DA 4FIFA 3HRFA 3P7CA 3PJ3A 5EHLA 4IANA 4CFNA 3SXRA 2JIVA 3AC3A 3MB7A 3TNHA 2BRHA 2WELA 4UX9A 3WIGA 3GUBA 4H3QA 5AR2A 1MQBA 4GCJA 2I1MA 4F0GA 2C5YA 4DINA 2PUNA 4PP9A 3QTRA 3HA6A 3KF4A 2UVXA 4UXLA 5FTGA 5IQFA 4ZSGA 4ZLOA 2VD5A 3FSKA 4H3PA 4ZJIA 4PL5A 2IW9A 4BTKA 4JAJA 4GG5A 4BC6A 3COMA 3QRUA 3FUPA 3Q9YA 4XBUA 2HZ0A 3BKBA 3QCYA 4FTMA 5J7BA 3E5AA 4GIIA 4IIRA 3FZOA 3SRVA 4AZWA 3Q5ZA 5H9BA 3EYGA 3HP2A 3VUHA 5A6OA 4BTMA 5AA8A 5I5ZA 3LJ2A 2X6DA 2UZVA 3PSDA 3A7HA 3QLFA 1OB3A 5J95A 4J8NA 3ANQA 4JNWA 5CF5A 3VF9A 3RBWA 4O84A 1GZNA 3LPBA 4USEA 5IPJA 1X8BA 2X4ZA 3FE3A 2P33A 2QODA 3L1SA 4AU8A 1WBWA 4X3FC 3AOXA 3ATTA 2A98A 3HDNA 3MFTA 5CS6A 4CGAA 3GEQA 1XO2B 4MAOA 3S95A 4E6CA 5CAOA 2IF8A 4EOKA 5CU3A 4O7SA 3Q4CA 1UA2A 4O7WA 4ZTQA 3EQGA 3BU5A 3LM5A 3MY1A 3OOGA 3KK9A 2ONLA 4GFMA 4RVLA 4EH7A 2ZV7A 1VYWA 4QMOA 5F4NA 5L2IA 4BR3A 3TIZA 4BWKA 3QTQA 3LAUA 3R1SA 4GYIA 4YC6A 3F69A 2GQRA 1CKIA 4MF0A 2PSQA 3DKCA 2X0GA 3NNUA 3TYKA 3R00A 5FLFA 2R3QA 4I5CA 3R9NA 4FEQA 4R77A 3NUPA 5F1ZA 5IDPA 3ZHPC 1RE8A 2PY3A 2VWBA 3GFWA 3F9NA 3N4VA 1KV1A 2R3HA 3MFSA 4C61A 3CTHA 4FMQA 2QG5A 4IDTA 4HNIA 2GFSA 4I6HA 2WOUA 4CD0A 1BMKA 1JKKA 3THBA 2BRNA 2GQSA 2KULA 3HEGA 4IFGA 1FINA 3ROCA 4BDCA 3KXMA 4TKSA 4D5KA 4MBJA 3BLAA 5IH6A 3QAME 3UG1A 2G2IA 4OAUC 4DTKA 5L3AA 2X81A 3H0YA 4RZVA 4W8EA 5CNNA 3L8PA 4QYYA 5CXHA 3R8LA 4EC8A 4NTSA 1IEPA 4PMTA 3NYXA 4FV8A 3AT4A 4ENXA 1PY5A 3UQFA 3NCGA 3H9OA 2PVKA 3D4QA 2BIKB 3MGYA 3QFVA 2CMWA 3G33A 4IVDA 4EQMA 5KHWA 3IONA 4IAFA 3A4PA 5EDQA 4DEBA 2IZSA 3G6GA 3HRBA 2F2UA 3D2KA 3QC9A 4R1VA 4F9YA 2BZJA 2BALA 4WUAA 3K3IA 2PMOX 3OW3A 3DA6A 3OVVA 1YOJA 2X8EA 2QOOA 4J96A 4NCTA 2W1ZA 3ZLYA 5DFPA 4EUTA 5J9YA 4DFUA 4QNYA 4EH5A 2QOKA 1XJDA 5L6PA 3RAKA 4EUUA 3SGCA 4YNEA 5AP6A 2XH5A 5KO1A 3QGYA 2YLEA 4XG7A 1WAKA 3ZUTA 5M09A 3ZC6A 5K0KA 4HVGA 3R02A 5CF6A 3U6JA 2O8YA 3L8VA 4YPDA 2JDSA 5E8SA 2IG7A 3ZEWA 4G3EA 3PUFC 5IUGA 5K0XA 3EN5A 2VGOA 3RNYA 4G6OA 4NW6A 5AV2A 2YISA 5LJJA 2OK1A 3QZHA 3ZU7A 1MQ4A 2IN6A 2IZUA 1OIYA 3UVPA 2YFXA 5JQ8A 3JR1A 2HYYA 3F66A 4FTNA 5ETIA 3EH9A 4XS2A 4ZEGA 1H1WA 1CMKE 3E64A 4FJVA 3EQHA 4V0GB 4ZZNA 5LMBA 3WZEA 4WA9A 5AP1A 2F4JA 4YZMA 2YCRA 5ANOA 3QUEA 4YSJA 3VBQA 4IVBA 3QCXA 1Q4LA 2EXCX 2R9SA 1SNXA 5JMSA 5ANKA 4EOOA 2ITNA 2OU7A 4FT5A 2YACA 4OTQA 4OTPA 2PMNX 5EI8A 4M7IA 4AXFA 4WG5A 5I3OA 5A6NA 2YIWA 4JOAA 3QYWA 3QTIA 2A2AA 2QHNA 5JGDA 4QQ5A 1Q8TA 5HX8A 1PXJA 1URCA 2ZM4A 4MQ1A 4OBQA 4BI0A 3F2AA 4ANMA 3ZBFA 4RIWA 4DGLC 3UJGA 2YIXA 4UBAA 3CS9A 1M2RA 2QKWB 3RPSA 5I9ZA 1JSTA 1LEZA 5E8WA 3DBEA 3PG1A 5FBOA 3Q3BA 4QPMA 2FUMA 3SX9A 2R5TA 3W8QA 1R78A 4QYEA 1HCKA 5HCZA 4BCOA 3TKIA 5FUTA 3EKKA 2V0DA 4BJJB 1FVTA 2QOLA 3H10A 2XP2A 1O9UA 4LFIA 3C5IA 3A7FA 4V0GA 5JKGA 5EK7A 2IZRA 4OW8A 3RZFA 2C30A 4I6QA 4JR7A 2C6OA 4ZY4A 5BPYA 3ID6C 3TZ8A 2XMYA 3TIYA 4IZ5A 5K9IA 1G8JA 3UC3A 3LHJA 3AC8A 4LMUA 2DUVA 3W2SA 2YZLA 4IXPA 1OBGA 2RG6A 1O6LA 1YXTA 2QOBA 4AE9A 1JAMA 3IDPA 1AD5A 3QWKA 1Q8UA 1YI6A 4II5A 4PDPA 3VBVA 4DLIA 5I9XA 5IA0A 2W05A 4DBXA 3VQHA 1JSUA 4E26A 1ZZ2A 4EZ7A 4BZDA 3G90X 2EXEA 3OUNB 4RJ5A 4A9RA 3RAIA 4QO9A 3V8TA 1BI8A 5EFQA 3QTWA 4RWIA 4KRDA 4CT1A 4M8TA 2C1BA 3TNQB 3CEKA 1ZRZA 3I5NA 4ID7A 4IAAA 4OLIA 1E9HA 3WF6A 2UUEA 3O8PA 2ETKA 2XNPA 4LUEA 3WZUA 4BI1A 2JAVA 5CVHA 3NAXA 1ZMVA 3E3BX 2WU7A 4QQJA 2UZUE 4DG2E 4EOSA 2ZFYA 5HICA 5KCVA 2ZMCA 2XEYA 2PVNA 4N57A 4P7EA 5CEMA 3ZLSA 4AZTA 4BB4A 3C4WA 1WFCA 4Q5EA 4QMMA 5CSWA 2IEWA 2R3PA 4JQEA 2F2CB 3ALNA 3IS5A 2W4JA 4J52A 1W2FA 2YLFA 4KS7A 5E92A 3AD4A 2UZBA 3BQRA 2GNFA 3O5AA 5IQHA 4FKPA 1WVXA 4EH8A 2VU3A 3LCKA 4FV5A 2XALA 3BYUA 2QURA 3Q6UA 4G2FA 5CAVA 3KVXA 3CXWA 5FRIA 4ANSA 5C1QB 2CN5A 2XNNA 4Q9SA 2HZNA 2UZEA 5FQDC 2P55A 4EOIA 2W1HA 1V0BA 4DEIA 3MV5A 5M4FA 2WMVA 1V0OA 4TNDA 1NA7A 3EZVA 4MWIA 4W4YA 5F94A 3QUDA 3VF8A 2PZ5A 2RG5A 1F3MC 4FUXA 4UWYA 4O81A 5AIRA 4XRJA 4QP4A 5DA3A 4A4OA 1FVVA 3C7QA 3NR9A 1CKJA 2ACXA 4DCAA 4BBEA 4ANQA 2RFSA 4TWCA 3BV2A 2HZIA 3KKVA 1U54B 4D1SA 1U5RA 3OHTA 3IW6A 4JLCA 3DQXA 4AW5A 4E73A 4F1MA 4OBPA 2IPXA 2RL5A 2BHEA 2G2HA 2UW7A 3G0FA 3Q2MA 2Y4IC 2F57A 2VX1A 4XEYA 3W33A 3VS1A 5JFVA 3GOKA 3FKOA 4JG8A 5CAUA 2PK9A 5EM7A 5J79A 4FTKA 3DXPA 3PIXA 3LQ3A 2P0CA 2PTKA 1XH6A 3FY0A 4BDAA 5KMNA 4H36A 4FSYA 4I24A 3SXFA 4CVAA 3KVWA 4D9UA 4RVTA 2J0JA 3QQUA 4UWCA 3FMMA 3QC4A 2WQMA 4RIOA 4O7YA 5CX9A 5D9HA 2GNLA 3VVHA 4CEGA 4DH7A 3UOJA 4X2NA 3OTUA 3LQ8A 5BYLA 3NLBA 1Y57A 2CSNA 3DKFA 5JFSA 3MSSA 3KFAA 3QCQA 2P4IA 3FZTA 3GU7A 4FK3A 3FWQA 3BHYA 2C69A 3FYJX 3NUUA 3CQWA 4FBXA 3MH3A 3N9XA 5CQUA 3BU6A 3BCEA 2I0HA 4TW9A 4YGAA 4DFBA 4L42A 4Y95A 4I5PA 4GW8A 4IH8A 4F7LA 3PY3A 5C26A 4FNZA 4IAYA 4RT7A 5CY3A 5EYCA 4YBJA 1Q8ZA 1MUOA 4J53A 4MBIA 4MXYA 4CKJA 1KUTA 2PUIA 1SVEA 4LL0A 4XG4A 2X1NA 4NU1A 3KXZA 2UV2A 4TXCA 5ETCA 3ORIA 5KKRC 5AUVA 1FMOE 1W98A 1YHWA 4G31A 3EFJA 2EUFB 2Y8OA 2XNOA 3AT2A 2YHVA 3AC1A 4YPSA 4XV2A 2NNWB 1FGIA 4RIXB 2JIIA 4WT6A 3Q9XA 4K1BA 1YI4A 3LCTA 2PZRA 3F5XA 3MPMA 4ZLZA 3TV4A 3IG7A 5LOHA 2WTIA 3A8WA 3HV6A 4GEOA 4I92A 3QBNA 3NUXA 4RJ4A 4L01A 2C5OA 3DFAA 3NIZA 2XIYA 3O51A 4X3FA 5DT0A 5IA2A 3FQEA 4IZYA 4BCFA 3NS9A 4BCIA 5IH4A 3QZGA 4JJRA 3EQIA 5EDRA 4F08A 4BHZA 4E5BA 5CLPA 3RHKA 5L2SA 5LMAA 3U55A 4ZY6A 4FSNA 4A4XA 2X9EA 1Q41A 1YRPA 4B8MA 1YOMA 2R7IA 3AG9A 3CQEA 3Q52A 5L6WL 4DGGA 1VR2A 2PWLA 2YA9A 3CC6A 4FKRA 2WHBA 4NM0A 3UMXA 5CSPA 3KN6A 4MXOA 1OUYA 2BKKA 4JRVA 3DB6A 5AUUA 5IEVA 3U6HA 5A4LA 4MBLA 3R73A 5A4QA 2ZYBA 3DK6A 3KRXA 1SZMA 2UZLA 3JPVA 5DLSA 2C3LA 4C62A 3O17A 3R21A 4DC2A 5J9ZA 4O7VA 4DHIB 2RFEA 3LZBA 5J1WA 3QZIA 1TKIA 3RK7A 4PF4A 3WIKA 1Y8YA 3Q4TA 1M7QA 4QMYA 4C4GA 1B39A 2WIPA 5A3XA 5AAGA 3JUHA 3MTFA 3IQ7A 3FZ1A 3PVGA 1ZAOA 3P9JA 3PXYA 4JT3A 4RIXA 4ZSLA 2PVRA 3ZTXA 3RGFA 1H1RA 3BE9A 3GFEA 1GIHA 2XCKA 1WCCA 3PYYA 4L7SA 2J0LA 3DDPA 2Y7JA 3VRYA 4EOQA 3R7OA 3GENA 2QR8A 3L8XA 5JEBA 3BYSA 1KWPA 3AMYA 3AD5A 4JDJA 1WMKA 4PL4A 3V5LA 2ZV8A 2QO9A 3FLSA 2OJIA 3T9TA 2BCJA 4JBVA 4RFZA 4RC2A 4DH3A 4EK4A 2YIQA 2BRMA 1YDRE 3ODYX 3ZO1A 3DFCB 4BDIA 4JX3A 4BWPA 5EYDA 3TDWA 3HMPA 4XNEA 5D10A 3ALOA 3M11A 3W2PA 3CIKA 1WBOA 4ZZOA 3LFSA 3TKHA 3FZSA 2G1TA 4DCEA 2YDKA 3NX8A 3ZS5A 5GNKA 4ACGA 5CT7A 2CLXA 2EXMA 4ERWA 4F78A 3LM0A 3MPTA 4JDKA 4ALVA 1ZARA 3NRMA 4JIAA 4MNFA 4Z7HA 4LG4A 4ASZA 3L9MA 4JDHA 4WSQA 1JKSA 2I0EA 3PJCA 3FPQA 1OKYA 4E3CA 5FXRA 4L68A 4NH1A 2O63A 2X0QA 3R9OA 3RNIA 4FF8A 4FTAA 3NSZA 5K5NA 4B6LA 1YDTE 4BDFA 4BKZA 2VTNA 4CCUA 3SVVA 3SOCA 4M14A 2BAKA 4HCUA 4YJSA 3MH2A 4DITA 3MESA 5DOSA 4ERKA 4FEWA 4IZAA 1Y8GA 1YI3A 3QD0A 5HD4A 4XG2A 4BCHA 2JC6A 3V04A 4C57A 4IC8A 4EWQA 1HCLA 4K0YA 1P4OA 2VRXA 4O1OA 2C0TA 5FDPA 1W82A 4R7IA 4QP3A 1PMEA 2XKDA 4DLJA 3GCVA 3HMIA 4RG0A 3GOPA 1TQIA 2A0CX 3IECA 3C1XA 3KK8A 3S0OA 2QOQA 4BBFA 1VJYA 2XZSA 5HOAA 4YURA 4P5QA 2PMIA 2VTJA 3VS7A 1Y91A 2HY0A 4U79A 3UDSA 2QKRA 3QXPA 3KMMA 4OTGA 3MA6A 5KMLA 3CCNA 4KABA 4BHNA 4KIKA 1OKVA 4GSBA 4M68A 4D0XA 1ZWSA 3DJ6A 4FSUA 2OW3A 2W1EA 5HCYA 4HYHA 2FH9A 5FM2A 1H1PA 2CKQA 3PZEA 4AAYA 3JY9A 4TTHB 2VV9A 1S9IA 2B4SB 2B0QA 4O7NA 4AN2A 3UVQA 3TKUA 2PL0A 3BLRA 3BYOA 4CYJA 3NGAA 4BDGA 2JD5A 4CLJA 4F6SA 4R7HA 3KL8A 4BDDA 3MVMA 4DBNA 4ONAA 2XK8A 3F3ZA 2JDVA 4U45A 4YJTA 4C8BA 2W1GA 2PULA 3UE4A 2C6MA 2I0VA 1AQ1A 2IVUA 4KIOA 2HXLA 4ZJVA 2PHKA 5FTQA 3MVJA 4YZDA 5IG1A 3FEGA 4C7TA 4YJVA 2OH0E 4BCQA 2GS7A 2QU6A 2Z2WA 5CENA 3NUSA 4ACHA 3CD3A 4BDJA 4ZTLA 3FL4A 4IDVA 4JDIA 5CALA 4U42A 5IMEA 2Z7RA 5EQEA 3G0EA 4EOJA 5KMKA 5CQWA 1J7LA 2JBPA 2OO8X 3E8CA 2JDOA 5AMNA 2BZIB 4ITIA 4EH4A