5L6WL

Structure of the limk1-atpgammas-cfl1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
290
Chain Sequence
SMPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords LIM domain kinase 1
publication title Structure Of the LIMK1-ATPgammaS-CFL1 Complex
rcsb
source organism Homo sapiens
total genus 84
structure length 290
sequence length 306
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l6wL02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l6wL01
4XG3A 3PIXA 4UV0A 5A4LA 2WMBA 4JAIA 5ETIA 5I9XA 5HLPA 5CU3A 3TJDA 3UOJA 3E8EA 4K6ZA 4IC8A 3KULA 1XH7A 2WZJA 3IDCA 4I5CA 4D2VA 3BEAA 4N6ZA 2VGOA 2QO9A 1XH4A 2VU3A 3CJFA 4YPDA 3RALA 4BDDA 1A48A 1YKRA 1YOLA 3KXGA 4KRDA 5HKMA 4E6DA 2ZAZA 2YZAA 2PE0A 4EC8A 4DT9A 4W4YA 4AZTA 2VV9A 3LVPA 4MQ2A 1ZZ2A 3TNWA 4NL0A 3FI2A 5HTBA 2OFUA 3FDNA 4DN5A 4G3FA 3BWJA 3ZFMA 3MY0A 3EL8A 4MQ1A 1OKWA 1HOWA 2WTVA 4MXZA 3PY1A 4O0YA 3M11A 1ERKA 1GIIA 2W1HA 1GZKA 2YIRA 4KKGA 1H00A 3BZ3A 5CAQA 3WARA 2E2BA 5KE0A 4BKYA 5IEYA 1IRKA 4O7WA 1ZY5A 4W4WA 2XNBA 2QOBA 3WF6A 2PMNX 3NUUA 3ZHPC 4AA0A 3PJ8A 4FG9A 2XA4A 5HCXA 2RIOA 3PPJA 5GJGA 1APME 3BPRA 5F4NA 3SLSA 1YVJA 4CKJA 3Q4CA 1I09A 4X3FA 3ZLYA 5C1QB 3QRJA 2BRBA 4B0GA 2YM6A 5EHOA 3ORXA 2J50A 4IB3A 5E1SA 5GZ9A 4ZTHA 3F7ZA 3R7UA 2WQMA 4IVBA 4R3RA 1MRUA 3FYJX 3A7GA 3I5ZA 3PVBA 1KE8A 4JX7A 4M66A 4M14A 3VBVA 4QMTA 4YJSA 3LLAA 3IG7A 1H25A 2CCIA 3E62A 3ORKA 3DT1A 3CCNA 5EM6A 5AP0A 5FDXA 1B39A 3HMOA 2RFDA 4I0TA 4X2NA 4I23A 1CDKA 5HE3A 3ZO1A 4D9UA 4PL3A 3Q9XA 5CSVA 2RFEA 4OR5A 3R1QA 4IEBA 3TCPA 5EYDA 1ZYCA 4G3DA 4YLLA 4FKTA 4EK6A 4HOKA 5AP7A 4IAAA 1YI6A 4EOIA 1MUOA 2YIXA 4X3JA 3NEWA 4AE6A 3TL8A 5GZAA 3HX4A 4QYEA 3DBQA 1E9HA 4U42A 5KMJA 1CSNA 4EWHA 3TUCA 3UG1A 1ZOHA 3W16A 5AA8A 5J9LA 2C6OA 2PZRA 3V6SA 1WCCA 3U8WA 3BV3A 2WIHA 4E26A 1H0WA 3B2TA 2Y4PA 5HICA 3PJCA 4GU9A 1GJOA 3WILA 3EN5A 3R9NA 5AR7A 3QKKA 1IAJA 4HYSA 4U3ZA 3DZOA 3ORZA 4J98A 4E6AA 1YQJA 4AGDA 1URCA 4JJRA 3TZ7A 4D55A 4FKUA 4CSVA 1JQHA 5E8YA 4DYMA 3EKKA 3TIZA 3BHUA 4L6QA 4FSTA 4LL5A 3VS7A 5M07A 4L43A 1U4DA 4NM5A 3V5LA 3R30A 2A19B 2C5OA 4AX8A 2WEIA 3Q04A 2YAKA 4CKRA 3BQRA 2WMWA 3IW8A 5DPVA 5FP5A 3GFEA 1WBVA 3F2RA 2Y4IC 4W8DA 4WNOA 4RJ7A 1UU3A 2WO6A 4XV3A 4BF2A 1H1WA 4ORKA 5FUTA 3R00A 5B0XA 3QTUA 3R8PA 4XG9A 2W4KA 4F6SA 4F08A 4E5BA 4LGHA 1FQ1B 3UYSA 3F61A 4FTKA 4C61A 4QD6A 4EZ3A 5I3RA 3U6HA 4CCUA 4F4PA 3RAKA 4JG7A 4CFWA 4EK3A 2YM4A 3QTRA 4RX5A 4EOOA 5BUJA 4HPUE 3LMGA 2NO3A 1M2RA 3DBFA 3FZPA 3QU0A 4FV1A 3O50A 4ALUA 4DH8A 3OC1A 5CF8A 4XEYA 3R22A 3TJCA 4O0VA 3H9OA 3W33A 4RVMA 4UZDA 4GEOA 4I3ZA 3WZUA 4U80A 5A4CA 4EI4A 3A60A 4Y46A 1Y57A 2QOFA 3ORLA 4O82A 2QI8A 3D5VA 4Y8DA 2YERA 3ZS5A 3Q9YA 4FV7A 4CZUA 4DITA 4JBOA 4FMQA 3U55A 1U5QA 3LFEA 1YXVA 4FSNA 2CGXA 4K1BA 2PK9A 4LRMA 3V8TA 1TQIA 3TNPC 2PUIA 1IG1A 5CSXA 5I3OA 2Y0AA 4FSRA 4II5A 5JFWA 3QF9A 4B9DA 3N9XA 2ITYA 5DH3A 2PPQA 4B7TA 1U46A 4JXFA 2WMUA 1Z9XA 4YPSA 3RZFA 4PP7A 1ZYSA 1QCFA 4BDEA 4C37A 3SHEA 2JKMA 3QCSA 3VWAA 2EXCX 2UZVA 5CSWA 3I60A 5M56A 4I6HA 3C7QA 5CQUA 3IECA 1MRVA 4FZ7A 3ZEWA 4XNEA 1J91A 2PVYA 4QP1A 4TKSA 3CTQA 1SYKA 2LAVA 3PA4A 2W99B 4MAOA 2C69A 3UYTA 2XK8A 1AD5A 4G9CA 4GK4A 5CVHA 2O64A 4C4IA 4FKJA 1JKLA 1XR1A 2WTKB 4RIWB 2GDOA 4RT7A 3OMVA 4D2WA 3LW0A 3HGKA 1ZARA 3ZO2A 3OXIA 5A46A 3DS6A 4W4XA 5HE0A 4EC9A 2ITVA 4KBAA 3MTFA 1Q24A 3OY1A 4N4SA 3FMHA 3FSKA 3NW5A 4GG7A 5AUYA 5FTGA 4WBOA 2XUUA 3K54A 3E3BX 5EYKA 5C4LA 3EQHA 1YRPA 2ITQA 3T8OA 3EOCA 3AC2A 4XX9A 4CG8A 3VNTA 3R63A 5KKRC 2W1EA 3S3IA 3FZSA 4EQCA 1UV5A 3EYHA 4FSZA 1UWHA 5LMAA 4YZDA 2AC5A 2J0IA 1XHAA 4F7JA 1FBNA 2JFLA 3P79A 1PXOA 3SXFA 4BBFA 2OH4A 4YJNA 3MFTA 4AT4A 4O1OA 4BL1A 2YWVA 3VAPA 1UNGA 2VTOA 2VTJA 4G5PA 4IXPA 5BYLA 5CNNA 1H26A 4ZS4A 3DQWA 4DG0E 5IQBA 5IU2A 5HIBA 4EHVA 1F0QA 4HVHA 4O96A 1OBDA 2VZ6A 2OLCA 3RMFA 5CU2A 4PNKA 3F88A 4FKRA 4H58A 3C0IA 3EN6A 4AZFA 3OCBA 4LYNA 3PP1A 5CY3A 3CSVA 2XBAA 1OUKA 2QQ7A 3PRFA 2FSMX 4H3QA 4BI2A 1PYXA 4RVLA 3C51A 4TL0A 5CAOA 3HDNA 2XKFA 3LFSA 4QMOA 3TWJA 1VJYA 2QOOA 3OP5A 5HHWA 3N4TA 2XIXA 1BUHA 2EXEA 2W4OA 3LLTA 3VS6A 1FMKA 4ZSLA 5IQCA 4D0XA 4YLJA 2A4LA 3ORPA 4E5WA 2E9OA 4TYGA 5K9IA 4QMMA 2ZV2A 3FWQA 3DBEA 5FEQA 5KZ0A 3JY0A 3HV4A 4NJDA 4BBEA 3MGYA 4G1WA 2HZ0A 3QX2A 4O0XA 4RIYA 3GQIA 4BZNA 3UQFA 4Y85A 1PYEA 2QONA 3KCKA 3K5VA 3BGQA 2ZB1A 4G3CA 1LR4A 4V04A 3VUHA 3ODZX 2ITWA 3ZCLA 4C0TA 3IGGA 1RQQA 4MWIA 1S9JA 4E93A 3C5UA 2DWBA 4J52A 4GIHA 4RJ5A 3UOLA 3OF0A 3HAVA 2A2AA 4ZIMA 3HYHA 3A2CA 4C4HA 5AUUA 2QOLA 3EWHA 3H9FA 4WHZA 5CT0A 4OTPA 3DB8A 5IPJA 2OIBA 5HLNA 2BDFA 4ID7A 2WTDA 4HZRA 3DNDA 5KX8A 3FMKA 4AWIA 4GSBA 1ZY4A 4FODA 2Z60A 3MPTA 3R6XA 4K11A 4YZNA 2XCHA 3LJ1A 3QKLA 5D10A 3VULA 4DGLC 4HVGA 1JPAA 1JOWB 2WQEA 4GL9A 1H1SA 3P0MA 1PMEA 4QPSA 5I0BA 1WVXA 2F7EE 3PG3A 4TN6A 3VBWA 4AE9A 4DHFA 4FC0A 4DA5A 5HE2A 2VX0A 3ACKA 2QO7A 3CJGA 4ANSA 1ZAOA 5AV0A 4BGQA 4OTWA 3NWWA 3OUKA 2P33A 3CD3A 3LFAA 4ZSEA 2VTHA 1Q4LA 3HMIA 2ERKA 4Z3VA 2C0IA 3GC7A 4FZ6A 4I24A 4XOYA 2BRMA 4MK0A 1OI9A 2V7AA 5JKGA 2QURA 2YM3A 5CAVA 4ZY4A 3LM5A 4O7TA 1FVVA 4TYHB 2ZM4A 3GQLA 4N6YA 5E8UA 3GXLA 3VS3A 2CN5A 2OJ9A 4RX7A 3G0EA 5EM5A 3RGFA 4ZJVA 5AEPA 2GS2A 3PPZA 2OO8X 4U43A 3TV4A 4EOKA 5EKNA 2F4JA 4IM2A 1OL5A 1URWA 5ANGA 2X81A 3DU8A 5IA5A 4PPAA 4DEEA 2WMTA 3QA0A 5EDRA 4YP8A 5HEZA 4D5KA 1REJA 2FYSA 4LUDA 2W06A 1AGWA 2DYLA 2ZMDA 3HP5A 3G6GA 3V8SA 4CVAA 3DY7A 3L9MA 3NYNA 3PYYA 4AN2A 5L2QA 1UU9A 3DKFA 4DFYA 3MDYA 2FVDA 3CY2A 4NK9A 5KMOA 4AW5A 4LM5A 4XCUA 3IO7A 3ELJA 1CM8A 2WIPA 4QP4A 1UA2A 4XG4A 4EKLA 5J9ZA 3EJ1A 5ITAA 4L7FA 2ZM3A 4GT4A 5CXHA 1OIQA 4UMUA 5KHWA 2PL0A 2JIVA 2QU6A 3ROYA 5L2IA 4QMNA 4GFMA 2W5BA 3HV5A 4IZYA 3RM7A 2Z02A 3SOCA 2C4GA 1TKIA 1X8BA 2R3HA 3C0HA 4G3EA 4O27B 4OBQA 4YJOA 2VWUA 5TT7A 3RPRA 2PVJA 2O3PA 4YSMA 2BHEA 5HVKA 3NVMB 4IB5A 5J8IA 3LKMA 4PUZA 2V7OA 4BCGA 3V5WA 2PVMA 3FC2A 2G1TA 4FKOA 2JIUA 3NNXA 2B53A 2B1PA 3WYYA 3LFQA 3U6JA 1KOAA 3LXKA 3W32A 3WF7A 1M7QA 2OF2A 4YZCA 4FK3A 1OITA 5FP6A 2R0IA 3SRVB 3PG1A 4DTKA 1BL7A 1Q62A 2IWIA 4JX3A 3AG9A 1PXIA 3VUMA 4Z55A 2G2FA 2YCQA 3D0EA 3W2OA 1Q61A 4EH2A 5JQ8A 1OB3A 3EQFA 3F5UA 4RWIA 5CQWA 2X8EA 1IEPA 4RJ3A 1K9AA 1E1VA 1PXNA 3MA3A 4CFNA 3R7OA 4JL9A 3RCJA 3UO4A 3IW6A 4EZ5A 5AV2A 2UZOA 2XMYA 2YN8A 4S2ZA 4AGWA 3FUPA 4C35A 4IX3A 1NXKA 4BCOA 4ZZOA 1NVQA 2UVXA 2W5HA 3QQHA 4QPAA 3OT3A 4U81A 4AT3A 2JKKA 3PJ2A 3SKCA 2ZB0A 1H01A 2BTSA 3EHAA 1EH4A 2XK6A 2YIWA 5J9YA 5GINE 5B2KA 1XKKA 4LFIA 4I22A 3NX8A 5IA3A 4BKZA 4RWJA 4OAVB 3TM0A 4FTUA 3RPVA 4BDCA 4IFCA 4I6BA 2BDWA 2HZNA 3S95A 3LFDA 3OD6X 4AW0A 2ITNA 5AV4A 4ZOGA 4QNAA 4XBRA 5I9ZA 3BEGA 5FGKA 3R83A 3BGPA 2NNWB 2CSNA 1V1KA 3I4BA 1CKJA 4M69A 5DT4A 2YJRA 3KRXA 4BKJA 4L53A 4LG4A 3FJQE 3HV6A 4AZWA 3QTQA 5K4JA 3TT0A 2XZSA 3LXLA 5M08A 2FSTX 4XG8A 3F3UA 5IEXA 4R7BA 1FGIA 1W8CA 3F5PA 3GU4A 2QC6A 4H3PA 4JQ8A 1NVRA 5HZNA 5CVGA 3PE2A 1SVGA 3BBWA 2GNLA 2PZPA 3AGLA 4AZVA 5BPYA 3GC0A 3KCFA 3K3JA 5EH0A 4F63A 4FTLA 4YO4A 3HEGA 5M57A 1DM2A 5AR5A 2H96A 2GFSA 2VTIA 1IA8A 1R39A 3H30A 4MXAA 4I5MA 2YZLA 5LARA 4EHZA 4ANOA 3OVVA 2ZV9A 3GNIB 4GK2A 4MBIA 4B99A 5AUZA 2P3GX 3DAKA 3OOGA 4NIFB 4A9TA 1JKTA 2HY0A 4RSSA 4HVSA 4K0YA 1W84A 4D4YA 1H08A 1IAHA 3SD0A 3GCQA 4O0RA 4B8LA 3BX5A 4JBVA 4FV5A 4OTFA 3HZTA 4IE9A 3Q53A 3COMA 4H1MA 4U5JA 4X0MA 1WFCA 3MVMA 4DGMA 3EFJA 2H8HA 1XH5A 1PMUA 4F64A 4QMWA 3ZLXA 2XVDA 4RA5A 3Q4TA 1M14A 3L8VA 2IZRA 2C5VA 2ONLC 3MYGA 1P4OA 4G6NA 3UIUA 4F7LA 3C4FA 3PA3A 3ID6C 2OJGA 5E8ZA 4MNEA 4Q5EA 1F5QA 4FKSA 4L9IA 3BE9A 3FKNA 4ANNA 3FMLA 4ERWA 2RKUA 5J95A 3BWFA 3L9PA 2HZIA 4JIKA 4GK3A 2PMOX 4C3FA 4D4VA 2BPMA 3NIZA 2XIYA 5J1VA 3ZDIA 3AGMA 4FKGA 3TUDA 1MQBA 3ZMMA 4MF0A 4U97A 1OIUA 4YHTA 1YWVA 3BELA 3F6XA 3KULB 4ZTQA 2UZDA 2QOKA 2PZIA 3FLWA 2QR8A 3PXYA 1YDTE 4PPCA 3RZBA 3UZTA 1FINA 1LPUA 1YOJA 3G5DA 5LVLA 4CQGA 4FNXA 4D2TA 1QPDA 4DG3E 5BQ0A 2HIWA 4QMQA 5HIEA 2CNQA 4CZYB 2ITTA 4FA2A 4DBXA 4GFGA 4C7TA 4NSTA 3BI6A 2ZV7A 3MB7A 2VO7A 4FV8A 2I0HA 3V8WA 5DIAA 5JGBA 2WTIA 4PL5A 5CSHA 4KAOA 4QYYA 4GFOA 4KNBA 4KS7A 4RJ8A 4QT1A 3EB0A 1SNXA 5EI2A 3ORMA 2JD5A 3QLGA 4ACGA 4D4RA 4LRJA 1H8FA 4M15A 1RE8A 4RZVA 3LXNA 3A99A 2XIRA 5AX3A 4HPTE 3SG9A 3AD6A 4JQEA 2VNYA 3L9LA 4PMMA 5TF9A 4F70A 2XK4A 2GNHA 3UPZA 4X3FB 1F3MC 2YM5A 2X6DA 4ZJIA 5J7BA 4MCVA 5J5SA 3QBNA 3FMDA 1O6LA 4IDVA 4Q2AA 4YLKA 5HG7A 3GU6A 3CQEA 3LZBA 3U9CA 4NH1A 4E7WA 4IAZA 4AGCA 3GFWA 1H28A 3P23A 4FKLA 1BX6A 1ZYJA 3R1YA 4FV0A 3A7HA 4TW9A 2IN6A 4C3PA 4CFFA 5AUTA 4XP3A 3FY2A 4BDHA 4RZWA 4ANQA 4FVPA 2HZ4A 4JR3A 2X9FA 2XP2A 4AZSA 2QO2A 5A3XA 4QQTA 4IVDA 2JFMA 4FI1A 4GUBA 2WQBA 4KRCA 3C5IA 4BCKA 5ETFA 3FL4A 3PRIA 4FK6A 3HUBA 3UO5A 2XJ2A 5JH6A 2WU6A 3F5XA 3EFKA 5DE2A 1SMHA 2OIQA 2FGIA 4O81A 3IW7A 1MQ4A 3ENMA 3LXPA 3ZLWA 3LIJA 4TWOA 4BIBA 4IAYA 2RFSA 1J7IA 4TWCA 5EM7A 4NYEA 4RG0A 4ASEA 3MESA 2VN9A 3NUPA 2NPQA 4K18A 1DAYA 2HYYA 3KK8A 3R01A 1A06A 4C58A 4CFMA 2RF9A 3A61A 2GNJA 4AA5A 4AQCA 4EL9A 2X2KA 3GCPA 5ANIA 4ZTNA 5JT2A 5M06A 3BYOA 4OAUC 2JDOA 3FLNC 3GU7A 3W2QA 1CKIA 3PXRA 3DJ7A 3R28A 5DYJA 4J97A 5CX9A 2EB3A 1PXMA 2VX3A 4X6QC 4IJ9A 2ZV8A 3CTHA 3CLYA 4I0RA 1OKYA 4DAWA 4MWHA 2BUJA 4O0SA 4FNYA 1R3CA 2HY81 3EL7A 3GOKA 5I9UA 4FT3A 2AUHA 2G2HA 3OZ6A 3UJGA 5IEVA 2Q83A 2OXXA 2VTTA 3AT3A 5IF1A 4RWLA 4MXYA 4IHPA 3QD4A 3OWJA 4I93A 3BGZA 5FG8A 3ATTA 1FVTA 3F3VA 4MBJA 5IKWA 3GI3A 1NA7A 3SXSA 4C62A 3R8MA 2CKOA 5F95A 4NU1A 5AP4A 5HD7A 2R7BA 4FG7A 4E8AA 4FV6A 5IQGA 5A4EA 2IVSA 3PE1A 2RFNA 4CNHA 4ZZNA 1R0EA 2PVNA 2XNOA 2W17A 2C30A 2YACA 3PLSA 5EYMA 3D4QA 4EHEA 4YR8A 2OFVA 3DBDA 4UYAA 4A9YA 2DUVA 4ACCA 3EKNA 3SQQA 3QZGA 3EQCA 3LFCA 3UMXA 2Z7RA 1YHSA 3UC3A 4BCMA 4E4MA 3L8PA 4L44A 3DKCA 3P78A 4FIIA 4BZDA 5HO8A 3H0YA 4EH3A 2X7FA 2CHLA 1GZ8A 2A1AB 2UZBA 3KREA 5EQPA 3CPBA 3F66A 2XRWA 4A4XA 3BYMA 3P4KA 2OZAA 2GNGA 2OGVA 3CGOA 4Z9LA 2JBOA 3WOWA 4BCHA 2CNVA 4O7SA 4YU2A 3DDQA 2H6DA 4WG3A 4E4NA 1T46A 3ACJA 2F7XE 1BKXA 3CIKA 4K2RA 4V05A 3RK5A 3ALOA 4F65A 3QUPA 1G3NA 3DZQA 5HU9A 2XNNA 4G3GA 4CXAA 3CKXA 4E3CA 3VBYA 2WPAA 3FHRA 3FXXA 2R3IA 3KU2A 4C8BA 3EZVA 5A9UA 3OCTA 2C1AA 4DH3A 3B2WA 4OUCA 2QG7A 2YA9A 4GT5A 5AV3A 4XS2A 4FL3A 3TACA 2PU8A 2YHVA 4QP9A 4YNOA 1FVRA 4IW0A 3W18A 5H8GA 3WYXA 4E4XA 3F82A 3L8XA 3OTVA 3FZTA 4FSUA 4FV3A 3QX4A 4JG8A 2C47A 4M84A 3S4QA 2WGJA 3FC1X 3FZ1A 1H27A 4K9YA 5AAEA 2WKMA 2IG7A 2ETMA 3MVJA 1U59A 2W4JA 3E88A 3V5PA 4RA4A 2OBJA 2GTMA 3D2KA 4G31A 4C36A 1WVWA 4D1SA 5BNJA 4O38A 3AC1A 2R3RA 3NPCA 5LCKA 5GNKA 5GJDA 1OKZA 4BTMA 4TNDA 2OKRA 3DAJA 4G34A 4ZS0A 3KN5A 4WKQA 4YNEA 2XM8A 2C5YA 4BB4A 4KS8A 4S34A 2CGWA 3I6WA 2OXYA 3RBWA 1PKDA 1XH6A 2XEYA 4UALA 4AGUA 4LI5A 3WZKA 1M52A 1RDQE 3QQKA 4APPA 4FEXA 3N51A 5EW3A 1UVRA 1SVHA 1PXLA 3HV7A 3R8VA 3ZBXA 1A9UA 3TXOA 5LXMA 1VYWA 4EH6A 4QYGA 4TT7A 2AYPA 2R7IA 3AC5A 4CTBA 4ZAUA 5LMBA 4EH9A 3UIXA 4NW6A 3WZDA 3BYUA 3EN7A 5KBQA 3RAWA 3TKHA 5BUIA 3O17A 1WBOA 4L45A 3NUNA 5JZJA 4HYUA 4F9CA 1Q3DA 5HD4A 4EOJA 4TTHB 2QR7A 4V01A 1JKKA 2XM9A 4NEUA 1YWRA 2IW8A 4W8EA 1PF8A 4MXXA 2AC3A 2YITA 5AIKA 4OTQA 4BDFA 5HBEA 3LHJA 3QQGA 4R7IA 3WIGA 3E8CA 3VF9A 1R78A 3JVSA 3DAEA 3UNZA 2OW3A 1YHVA 4CMUA 2VWZA 2E9UA 2HXLA 5HIDA 4FV9A 4IX6A 3KRWA 2OICA 4YJVA 3EFLA 1Q99A 4JBQA 3QZHA 3QALE 2JKQA 4NM3A 4RJ4A 1ZOEA 3FI4A 4BDAA 2BMCA 4C33A 4IZ5A 3AC4A 3NNWA 1M2PA 2G2IA 4RJ6A 3NVKI 3NUSA 5L8LA 3O0GA 5BVEA 4Z16A 3BKBA 2GHMA 5CT7A 4ANLA 2CMWA 4JRVA 4MTAA 2IW9A 3UVRA 3PA5A 3FLSA 2GFCA 4RIYB 4BTKA 5BVNA 1IR3A 2C6MA 2NRYA 4R6VA 2UZNA 4J53A 2WD1A 3D5WA 4N70A 4ZTLA 3TNQB 4CFVA 4O22A 4IVAA 4CRLA 4U7ZA 3QTZA 4ZTMA 5M4IA 3E7VA 2ETKA 3F3WA 5AX9A 4O7VA 4X7QA 4IACA 3Q2JA 4O7NA 3VUDA 1OL6A 3JXWA 2R5TA 2CKQA 1J1CA 4O21A 4B4LA 1BI7A 2ETRA 2XK7A 2WXVA 4BDKA 4HVDA 5L3AA 2UW9A 3QUDA 5FEDA 3UOHA 2BZIB 4FZFB 5HU3A 3LQ3A 4UBAA 5ACBC 4NZWB 4PY1A 4B8MA 3NMUF 4FUXA 4U9AA 4ZSGA 4D4SA 4R78A 3TTJA 2VWIA 4U40A 3E5AA 2LGCA 3E8DA 4F99A 3SG8A 3DQXA 3UG2A 1SZMA 4JR7A 2ITZA 2O8YA 2ZVAA 3PDTA 3NZ0A 5L2TA 4NCTC 4IB1A 2B0QA 4N57A 2O65A 5AP1A 4R3PA 3UIBA 3COHA 4W9WA 3RKBA 2R3FA 3WF8A 4RFZA 4GMYA 4IZAA 4UMRA 3KKVA 2XNMA 3I1AA 3H4JA 2XEZA 3LFNA 3ET7A 3GOPA 2WELA 4AF3A 3V5TA 4KKHA 4G9RA 5A54A 3PFQA 1UKIA 4JT3A 3I6UA 3JPVA 3WF5A 2G01A 4TYIA 4BDIA 1RW8A 4DEHA 4IVCA 3MPAA 5D11A 3PZHA 5L2SA 4TYEA 3E87A 1ZMWA 4EQUA 3PY3A 3LCKA 3Q5ZA 4DLJA 3HAMA 5C4KA 5IQEA 3C4CA 4CQEA 2ZDUA 5CSPA 2XKDA 5HX6A 1JVPP 3CBLA 4QRCA 5DA3A 2P2IA 2XRUA 4FZAB 1H0VA 1I44A 3RNIA 5L4QA 2P0CA 2RG5A 3TKUA 2VWBA 3D14A 3EQPA 3QD0A 4M97A 4XMOA 3N4VA 3MWUA 4O0TA 2VWVA 4FTQA 4BWPA 4YTFA 5CVFA 4RVTA 2OF4A 4O2PA 5EYCA 2P55A 4R77A 2PMLX 3GEQA 1ZWSA 5EI8A 2PUUA 4CYJA 2ITOA 5FBOA 2NRUA 2CGVA 3GC9A 4FTTA 2PUNA 3VW6A 3DNEA 1FOTA 4O2ZA 3R9DA 2RG6A 2FSOX 4PMTA 5HTIA 5D7VA 1DS5A 4NWMA 2Y4IB 2J0MB 2B54A 4MVFA 2IO6A 5HORA 3ZM9A 3QQLA 4QNYA 4Y95A 4ZSAA 5IMEA 1AQ1A 2GHGA 5T6KA 4F09A 4C34A 3IOKA 4YTHA 3TV6A 3ENHA 4LV8A 4EBWA 5LVNA 4FTNA 2Z7QA 2YCSA 4U41A 4Y83A 5HCYA 4BRXA 4BIDA 2JITA 2YLEA 4YTCA 5A6OA 4GYIA 4Y72A 4J1RA 4DTAA 5TR6A 4FV4A 3BU6A 4UY9A 4FEUA 3KY2A 1YI3A 4IAKA 1ZYDA 2W1DA 4NW5A 4CD0A 4EYJA 3MI9A 5IA2A 5IZFA 1J7UA 2YCFA 3LE6A 4WG5A 1PMNA 2JDTA 3KXHA 2XK9A 2HCKA 4LOQA 4EZ7A 1FMOE 1K3AA 3KMWA 4DEIA 1OBGA 3O51A 3OCSA 4I6QA 5IQIA 5ANEA 5HI2A 5HVJA 4BGGA 2VWXA 4O1PA 3EH9A 3AQVA 3G33A 3H3CA 3KL8A 4MXCA 5JFXA 4IJPA 2JIIA 2F2UA 3BQCA 3HV3A 3M2WA 1MP8A 4P4CA 4RBLA 4A9RA 2VO0A 3TDVA 3OFMA 1M17A 3ALNA 4PTEA 3VS0A 3P7CA 3BLQA 2JEDA 3QRTA 4O6EA 2PYWA 3BE2A 2WEVA 5JN2A 2HOGA 4NTSA 1ZMUA 3KEXA 2QU5A 2R3QA 4FL2A 2VO3A 5CEQA 3VRZA 3ZUTA 1PXKA 4GT3A 2XNEA 4C57A 5FTQA 3TDWA 2V55A 4O7YA 3PWDA 4X21A 1O6YA 3UZPA 3U4WA 2WOTA 4ZMEA 4G6OA 3B8QA 3QRKA 1XWSA 3V5JA 2XIZA 3CP9A 3K5UA 1J7LA 4ANBA 5IQDA 3MSSA 3W2RA 5IH4A 1Y6AA 2CN8A 1PXJA 1W0XC 3NLBA 4IANA 4IIRA 4KINA 2GQRA 3PWYA 1ZMVA 2KULA 4M69B 3RPYA 3HMMA 1Q8WA 2QOIA 3BHYA 4GCJA 4IFGA 3UODA 3BRBA 2BHHA 1J3HA 2JAVA 2BDJA 4BBMA 4CFUA 2J0LA 3MVHA 3ODYX 1XQZA 2ZDTA 1LEWA 4GVJA 3E64A 2B9HA 3ANRA 5H2UA 2JKOA 4A9SA 2R0UA 3FLYA 4FIGA 3NS9A 5AUWA 4WT6A 4F0GA 3CS9A 2C5XA 2GQGA 2R3KA 5KKRB 4KA3A 5E90A 3C4WA 1GY3A 1YW2A 4WNKA 5CEMA 5IG1A 5L8KA 4HCTA 3BHTA 5CLPA 5AR2A 3Q2MA 2X2MA 5E92A 4BI0A 3F9NA 4M13A 4ZTSA 1XBAA 4WNPA 3G6HA 3UGCA 3ZXZA 2QOHA 3NAYA 2OH0E 4V0GA 5ICPA 3QQJA 1OPLA 3D83A 2X4FA 3FI8A 4D2SA 2WMQA 3QCQA 2XNPA 2QHNA 3GU5A 4EOMA 2FO0A 4JOAA 4CMTA 2ERZE 4ZLOA 4EHGA 3KN6A 2FUMA 3GCSA 3PVUA 2EXMA 3FV8A 4O7LA 2BIYA 3VHKA 5DEWA 4EUUA 3FMJA 4MNEB 4RVKA 2UW0A 2BKKA 1YXUA 4BHZA 5KMNA 2ZOQA 1PRYA 2YIYA 1K2PA 5CS6A 5K5NA 2GHLA 3C4ZA 4FSWA 3QFVA 5DLSA 4BFMA 2A27A 3FKLA 3I0OA 5DR2A 3VS4A 2YCRA 3F3TA 4KWPA 4M7IA 2VGPA 3LMIA 4ZZMA 4E4LA 4XLIA 4JI9A 2C6KA 5D1JA 5I9YA 5D41A 4CTCA 5L6PA 4USEA 2BRHA 4IWOA 2PULA 2YWPA 4QQCA 3DXQA 2R3JA 4M0ZA 4O83A 3VS2A 4DINA 2B9JA 4L8MA 4IX4A 3JR1A 4AOJA 4NFMA 2UVZA 4CLIA 4EH7A 3MV5A 3R8LA 4J8MA 3OXZA 4CV9A 5J5TA 1DI8A 1OPKA 2IJMA 2X39A 2QOCA 4CG9A 2YM8A 5EQYA 3DTCA 4DGOA 3TZMA 4USFA 4K8AA 1JLUE 4RGJA 3AC8A 5KUPA 4YGAA 3ZXTA 1Z5MA 3G51A 3QUEA 3ZSGA 4YO6A 2FSLX 3RM6A 2CJMA 3BLRA 2OI4X 2OK1A 4IB0A 3L8SA 4ONAA 4ARKA 2OJFE 2GS7A 3F3ZA 3ORNA 4FNZA 3Q96A 3RCDA 4A9UA 4BGHA 4ZMFA 4UWBA 3O7LB 3O71A 5CI6A 3V6RA 4C38A 4EEVA 3PSBA 4L46A 3VVHA 1KE5A 4NM0A 4DEGA 4FTOA 4DE4A 4A4LA 3NNUA 4DC2A 1M7NA 2Y7JA 1O9UA 1OKVA 3RNYA 3PUPA 4FT0A 5EOLA 3V51A 4ZY5A 4J8NA 5KHXA 5JGDA 2Z2WA 2E9PA 4AFEA 5AA9A 1SM2A 2CPKE 2W9ZB 4OTHA 4NCTA 5AR4A 4FTCA 5CF4A 3QQUA 5DBXA 4OTGA 4FIEA 3UBDA 4C2WA 4FV2A 4DGNA 2C6IA 3HL7A 5DEYA 3VHEA 2PVLA 1OVEA 2BZJA 5M55A 1KOBA 3A7IA 1UU7A 3ZRLA 4BICA 3DK7A 4U8ZA 3RINA 4EOPA 4CFXA 1Y6BA 5ETAA 4PTCA 2G15A 5FTOA 2CKPA 3SOAA 4YURA 4I4FA 5DR9A 4ASXA 3OBJA 2IVVA 3DLZA 2C6EA 4P7EA 3ZZWA 4R1VA 4CRSA 4I1ZA 5M4CA 3TKIA 2WQNA 2VWYA 5AUXA 3ORTA 2GNFA 4KBCA 4E6CA 5KBRA 4ACDA 4XP2A 2Z8CA 3ZTXA 3UNKA 1XBCA 2WMXA 1GIHA 3W2PA 2ZMCA 1Q5KA 2X4ZA 3NDMA 4JDJA 5CASA 2C6DA 1JNKA 3MH0A 3NUAA 1J1BA 5FLFA 4F6UA 4L00A 3BHHA 4XH6A 4BIEA 4HCVA 5M4FA 4E6QA 4LL0A 1OPJA 1XH9A 1Q97A 4QQ5A 3RJCA 4ANMA 5E91A 4F9WA 4BC6A 3O8TA 1LP4A 2UW4A 4JBPA 3MFSA 4OBOA 4MHAA 1Q8YA 5G6VA 4F1MA 3D7TA 2XJ0A 3BHVA 3LJ2A 3SW7A 1ZXEA 2WAJA 2UW5A 3PSCA 5FXQA 4AN3A 4YC6A 2JDRA 3ZC5A 4OTDA 4ZY6A 5GJFA 5K4IA 4ASDA 5C01A 2CDZA 5J1WA 2PZYA 3OWLA 3PXQA 1STCE 5AM6A 3CPCA 4LGGA 1Y8GA 4DFNA 5IA0A 4UWYA 4GUEA 5LCJA 1H4LA 3GT8A 1JSUA 3H10A 3KRJA 1R0PA 4F7NA 4AU8A 3II5A 4D5HA 3G9LX 3ZM4A 4DH7A 4AN9A 5J87A 3U51A 1RJBA 4U45A 2QNJA 3A8WA 4EORA 4S30A 3W1FA 3R8UA 2PVRA 4GJ3A 4EQMA 2XF0A 3KK9A 4KIQA 5DT0A 3TZ8A 2C0OA 5B7VA 2QKWB 3VRYA 2Y9QA 5F94A 2FH9A 3F5GA 3A8XA 5DGZA 3TI1A 5TE0A 5CU6A 4G16A 4OT5A 4PMSA 4UMQA 5ANJA 1LEZA 4BR3A 3FQEA 2YIQA 3SV0A 4FTAA 2I40A 2XJ1A 3LFFA 3DFCB 3DPKA 4U0IA 5AM7A 5A4QA 4FL1A 2OZAB 4X2FA 4NJ3A 5D9HA 3ZFYA 3QD2B 2GS6A 2R4BA 2C3LA 3WE4A 5H8EA 5HX8A 4PDOA 4D28A 5H9BA 1DI9A 3U87A 5LJJA 1L8TA 1T45A 5LOHA 2YLFA 3OXTA 4DFUA 5I9VA 2JAMA 2VTNA 5IDNA 4CV8A 3PIZA 3RAHA 5E4HA 4L3PA 4PDYA 2GQSA 3TV7A 3A4OX 4EONA 5JRSA 4EK5A 4QMPA 1V0OA 3AC3A 2PVKA 4KIKA 5IQFA 2QG5A 3ZSIA 3KF7A 3KRRA 5EDQA 4JVGA 1W7HA 2FA2A 3S00A 4BI1A 3IW4A 4HYIA 4QQJA 5C9CA 2WTCA 4D9TA 3E93A 4L67A 4J99A 1LUFA 3G9NA 4IX5A 3I7CA 4QTEA 3GUBA 3UO6A 4I21A 3MTLA 4AS0A 2PMIA 4WIHA 4FTIA 5JQ5A 4UYNA 5HGIA 5I5ZA 3EQBA 2F57A 1VYZA 2CGUA 2W0JA 5HNGA 3ZUUA 2O5KA 3W8QA 2BIKB 4WUNA 3RP9A 4CKIA 3RK9A 4Q5HA 5HCZA 5GZ8A 2WNTA 3PZEA 3RK7A 5EQEA 4FNWA 3HA6A 2VNWA 4TWNA 4WA9A 4ITJA 2VX1A 3LJ0A 4QMVA 4CT1A 4X2KA 4EOQA 2QCSA 5JMSA 3MA6A 3VBXA 1CTPE 2R3NA 3OUNB 3R9OA 4C59A 3KC3A 4R7HA 5JGAA 5IMXA 5T3QA 3OWPA 4MEDA 5LQFA 4UX9A 3E63A 4MF1A 3O96A 5KMLA 4DH5A 4WOVA 5CU0A 3PLAE 4L52A 5T68A 1WAKA 4OBPA 3U6IA 3UZRA 4EBVA 5F20A 4AA4A 5IH6A 2XYNA 4FEQA 1XBBA 5BUEA 3TZ9A 3UP7A 3ANQA 1YWNA 1OL1A 4D0WA 2B52A 4XHKB 3ULZA 3R73A 2QKRA 1GOLA 3F2AA 3VC4A 5L2WA 4ACHA 4EOSA 1FGKA 5A6NA 4Y5QA 4I41A 4H1JA 2I1MA 3FKOA 2J90A 4FIHA 5E8WA 4H3BA 5EDPA 3FE3A 4M0YA 3NSZA 3O8PA 4BZOA 1NW1A 4FIFA 4FZDB 4HGTA 3LMHA 4P2KA 4BCPA 3THBA 2HK5A 3TN8A 1Q3WA 2XK3A 2PY3A 4KIOA 3I0QA 3QC9A 3KF4A 3HVCA 4LMNA 4YZMA 4DCEA 3CE3A 3Q4ZA 2OU7A 3PIYA 4YC8A 1GZOA 2EWAA 5C27A 4A06A 5KMMA 1UWJA 4QTBA 4FOBA 4NTTA 3W2CA 3GENA 3R02A 4ZXTA 4FSQA 2EUFB 2PUPA 2PWLA 2WMRA 3GB2A 3JS2A 3PP0A 4YZ9A 4BDBA 4JNWA 5ACKA 5E9EA 2REIA 2Y6OA 5EK7A 3JUHA 2W96B 5EI6A 4CEGA 5J79A 3P7BA 2UZUE 4ZTRA 3V5QA 2GNIA 4IBMA 3IQ7A 1QPCA 2HWOA 3VBTA 3ZO4A 1KUTA 4ALVA 2OJJA 4RLLA 3R2YA 2GCDA 1TVOA 3NYXA 4L01A 4YJPA 3KA0A 2HW6A 4EUTA 3D2IA 2X2LA 5AMNA 1CMKE 4G5JA 1OIYA 3U54A 3A7FA 4PTGA 5EW8A 1U54A 5ANKA 3UTOA 4XG2A 2VAGA 3ORIA 4C4FA 3QXPA 5K0XA 5BMMA 1NY3A 4QP6A 4EH8A 2GSFA 4QP3A 2WTWA 3DJ6A 3LQ5A 4RPVA 3COIA 5HESA 3FMNA 5CZHA 3QA8A 5CYIA 4O91A 5KCVA 2XCKA 4IWQA 5FEEA 5M4UA 3EZRA 3LPBA 2BRGA 2UV2A 4AOIA 4P5QA 3ZU7A 2BILB 5BVWA 1BI8A 1PKGA 4EK8A 5D12A 4HJOA 2C6TA 2Y6MA 3PJ3A 4FIJA 3Q6UA 4BCJA 1Q8ZA 4IZ7A 4JS8A 3FI3A 5BYYA 3IGOA 4LOPA 3EN9A 4GRBA 5L8JA 2BFXA 4TPTA 2UZTA 3BYVA 3TG1A 3UVPA 4I0SA 3HMPA 3I7BA 2J4ZA 3FBVA 4WD5A 4XG7A 2C5NA 3E3PA 4BCFA 4DFXE 3LCSA 2WOUA 4Z7HA 2JGZA 3MH1A 1W83A 5CXZA 3FMEA 3DTWA 3OEFX 4ZSJA 4QPMA 2W05A 5AP5A 3LQ8A 3G2FA 3GCVA 1HCKA 3A4PA 4BYJA 2RGPA 5G1XA 3Q60A 2QODA 5F9EA 2GTNA 4R5YA 2QLUA 2F7ZE 2YEXA 4LMUA 2YFXA 3FAAA 4C4GA 3SC1A 2DQ7X 3QC4A 4JLCA 4QP8A 1JBPE 3D9VA 3REPA 2J0JA 3KFAA 5EHYA 5CANA 4FE2A 3IDPA 3KXMA 3MFRA 3NGAA 3EQIA 4O84A 1JSTA 4MH7A 4O0UA 2ITXA 4IQ6A 5FRIA 4WUAA 2C3KA 4FT9A 3D5UA 4H36A 3TIYA 5HG8A 2WTKC 4TYJA 3ZH8A 2ONLA 1ZLTA 2J6MA 3NYVA 4M67A 3DKGA 3EYGA 1M2QA 2DS1A 4YBJA 3U9NA 3MVLA 4QTDA 3VUTA 2BKZA 4W9XA 2EB2A 2PE1A 2VTMA 4WRGA 4DLIA 1H1RA 1OZ1A 3MPMA 3R04A 4PF4A 5KNJA 3HA8A 3JVRA 2I7QA 5K0KA 4QMSA 4AOTA 4DEBA 3EN4A 3OS3A 4QO9A 5CALA 4FX3A 4XRLA 2JDVA 4HGSA 2UVYA 2ZM1A 3RI1A 2YABA 1V0PA 5HBJA 5JEBA 4A7CA 5KMIA 5L6OA 2I0YA 3E7OA 5IQHA 1S9IA 4QYFA 5IQAA 3M42A 4FR4A 4LRKA 2IZTA 1H07A 3SAYA 3G15A 4UB7A 4JQ7A 4WO5A 2VTSA 1HCLA 3R0TA 1U5RA 4WG4A 5CF5A 4QP7A 3R7IA 3D7ZA 3UOKA 2VD5A 3FZRA 3FZOA 4IWDA 3I5NA 3PTGA 2H34A 4DH1A 5AP2A 5CEOA 3DK6A 1PXPA 3HUCA 3R71A 1W98A 2R3GA 2O0UA 2VUWA 3QZIA 4FICA 2IZSA 5AJQA 3EIDA 4DEDA 5AV1A 5HLWA 3S0OA 2C3JA 4FKQA 4X2GA 4UMTA 2C6LA 3IS5A 3P1AA 4Q9ZA 1P14A 2GPHA 2YAAA 4A07A 5BMSA 1YXTA 5LVPA 4I20A 4FTMA 4UXLA 4O7ZA 5DHJA 1YHWA 3FSFA 4GYGA 4F9YA 4KABA 4QYHA 1H1PA 3RPSA 4IDTA 4IADA 4MD7E 2HXQA 4K77A 3ITZA 4ZLZA 1Q41A 3FXWA 4B6LA 4R1YA 3VUGA 3GVUA 4BWKA 2I0EA 3RWPA 2BZKB 5M44A 2YJSA 4KSQA 3UNJA 5M53A 5AWMA 4P90A 3F69A 3D94A 4EH4A 1OL2A 4E20A 4F7SA 2CKEA 1G8SA 4D58A 3TNHA 4Y73A 4LOOA 2OG8A 3CR0A 3PXZA 4L3JA 5H8BA 2HENA 3Q3BA 3HECA 5FM3A 3G0FA 3QD3A 5E8VA 1TQPA 3ZUVA 3OWKA 3DDPA 4N0SA 5HNBA 2VWWA 3T9IA 2IVTA 4JIAA 5E1EA 2QOQA 2WU7A 3CQWA 3VW8A 3ZRKA 2ITUA 2P2HA 4ERKA 4GKHA 3AMAA 5HQ0A 3MY1A 1WZYA 4IAIA 4R8QA 5FBNC 3R7EA 2IVUA 2WMSA 3DBCA 4XYFA 4Y5HA 4CT2A 5HTCA 5EHLA 3RVGA 1OL7A 1GZNA 2HAKA 2J51A 4BCQA 5CI7A 3RHXA 2VTAA 4HCUA 3QCXA 4HNIA 3R7GA 3IW5A 3L1SA 1WVYA 2VTPA 3C0GA 4XBUA 2W1ZA 5FWKK 3WIKA 5CNOA 3PVGA 1KWPA 2HELA 3NR9A 2CLQA 2JDSA 3KXNA 5CEIA 3HP2A 4FG8A 3ZO3A 3CC6A 3ZYAA 3W8LA 3W55A 3M1SA 4LV5A 4HW7A 2WHBA 4F0IA 4V0GB 3NRMA 4PDSA 4RIXB 4Z7GA 3DB6A 2RL5A 3NYOA 4TY1A 4XG6A 2UZWE 3O23A 2F9GA 3ZLSA 4O0WA 4BDJA 4H39A 1GIJA 3UC4A 1L3RE 1V0BA 1YXXA 4BTFA 4I5HA 5HNIX 3K3IA 2OIDA 4FKIA 3HLLA 3PY0A 4OGRA 4YJRA 3RAIA 1OM1A 2ZJWA 3R7VA 3GC8A 5BYZA 2PE2A 1KV2A 3Q52A 3QQFA 3RWQA 2P4IA 4NUSA 5IDPA 5LVOA 4G17A 4RQVA 5HVYA 3LM0A 3QXOA 4FKVA 3VF8A 5DFPA 3ZFXA 4DBNA 2OSCA 4MXOA 4WNMA 4L42A 5DI1A 4CCBA 2XKCA 4QMLA 3BV2A 4D2RA 5CEPA 3QKMA 1UNLA 2QD9A 5AUVA 2VTQA 1OUYA 5AP6A 3KRLA 2XB7A 5E8SA 3HRFA 2R3PA 3UVQA 3W2SA 4CMOA 3SVVA 4K33A 4FEVA 1SNUA 3DV3A 4KUJA 2X7OA 4YBKA 2VO6A 3VO3A 2X9EA 4ITIA 5ANDA 4RC4A 2J5EA 4JDIA 4XOZA 3WZEA 1YI4A 5K3YA 3VIDA 3FMMA 2R2PA 1WBWA 2JBPA 3QRIA 3AMBA 3OCGA 3ZC6A 3FY0A 4GG5A 4FEWA 4FBXA 1IA9A 3UPXA 4HGEA 3O7LD 3CD8A 3TUBA 3H0ZA 2B55A 3E8NA 4HZSA 3NW6A 3MS9A 4QMXA 3WZJA 2V0DA 1JWHA 2XIKA 2CNUA 3NCGA 4QOXA 5CWZA 4YC3A 1PW2A 3ZSHA 3FL5A 4CYIA 1TQMA 5C26A 4GW8A 4BTJA 3FEGA 3I79A 4KIPA 4FT5A 4YHFA 3MIYA 3VS5A 5DN3A 4UN0C 2F49A 5D7AA 4AP7A 3IK3A 2PSQA 3C4EA 2OJIA 2ZYBA 3AXWA 3H9RA 5DR6A 5C8KA 5GHVA 4XJ0A 2J9MA 1SVEA 4PL4A 4QP2A 3WBLA 3ATSA 5CENA 4AFJA 4GKIA 2YDJA 3QWKA 3PXKA 5IUHA 3SW4A 5CAUA 3GCUA 2BFYA 3LAUA 3R8ZA 3TEIA 3V04A 4EH5A 4EKKA 3ULIA 3C13A 3WE8A 5CEKA 4PNIA 5CTPA 3QTSA 5FQDC 5BVKA 4H05A 3AMYA 1QPJA 3V01A 4FGBA 4IM0A 4HVIA 2E9VA 3NUYA 4BWXA 2W1CA 4G2FA 3BIZA 3G90X 3R9RA 4GH2A 5GIOE 1YXSA 2C3IB 2X8IA 3KQ7A 3QTIA 2GU8A 4I94A 3NCZA 1O6KA 5EW9A 4F0FA 1DAWA 1YDRE 2V22A 4AT5A 5EFQA 5M09A 4AW2A 3NNVA 3AT2A 4ENXA 2BVAA 3ZZEA 3D15A 5DRDA 3SX9A 4F9AA 4OTRA 4DEAA 4AZEA 3R9HA 3FLQA 1JKSA 3QGWA 4AG8A 3R2BA 4YSJA 4FKWA 5KMKA 2BALA 2W1GA 2GMXA 1Y91A 4C4EA 3N4UA 1WBSA 2BAQA 1REKA 4U6RA 3COKA 4FF8A 4JDHA 4QTCA 3DXPA 1OIRA 3CTJA 3VJNA 4EOLA 2UW3A 4RIWA 1Y8YA 4R5SA 4RIXA 3KXXA 3LCOA 3R21A 2J0KA 1Z57A 4RRVA 4DFBA 3D7TB 5DT3A 4TXCA 2X8DA 3Q9WA 3DOGA 4WSQA 3ZONA 5M51A 4XLVA 4RIOA 2PHKA 1UNHA 2YISA 4I92A 1P4FA 3O8UA 1NVSA 5ETCA 3TTIA 2BTRA 2OZOA 3QCYA 3UDBA 3UQCA 3OW3A 3RPOA 3WI6A 5FD2A 5C8NA 2BROA 2OWBA 5HBHA 5K5XA 3SGCA 4L68A 5H3QA 3P9JA 3VN9A 5IUIA 4F1OA 2SRCA 3P86A 5AIRA 5I4NA 3LOKA 5HG5A 3EQDA 4A4OA 4LQMA 2V5QA 3NW7A 5BX0A 5LMKC 4XV1A 1WBNA 3RHKA 2CLXA 2X1NA 4FOCA 5ANOA 4PX6A 1Q8UA 4FKPA 4C2VA 2BAJA 4BHNA 5HO7A 4GV1A 3QRUA 4EK4A 4O7RA 3ERKA 3IOPA 3HRBA 3KVXA 3HRCA 5LVMA 3HDMA 3IPHA 3ETAA 4YHJA 3IDBA 2W9FB 4G6LA 4ZJJA 3EQGA 5AR3A 4NT4A 2YDKA 4BN1A 3C4XA 2BCJA 5AAFA 3MJ1A 4YMJA 5HG9A 3MW1A 3FXZA 2O2UA 3MBLA 1ND4A 2Z7SA 5KZIA 4EWQA 2IPXA 2EU9A 3EFWA 3LCTA 4C02A 3QLFA 5E8TA 5B2LA 3F7WA 4D1XA 3AD4A 4PRJA 3VUIA 2C0TA 4FYOA 3R1NA 5F1ZA 2I0VA 2JC6A 4X2JA 3VQUA 3ZOSA 2CCHA 2R9SA 3DGKA 3C9WA 4M8TA 5FXSA 2YDIA 4QMUA 1PY5A 3T9TA 4TRLA 3QYWA 4ASZA 3DJ5A 4AW1A 4ZK5A 3QL8A 4S31A 4AAAA 3ZDUA 4RFYA 5AADA 4C3RA 1PHKA 3MJ2A 2BRNA 4KIKB 4MX9A 1H1QA 2R3OA 5TO8A 4QMYA 1VZOA 2E9NA 3OT8A 4ACMA 2UUEA 1OGUA 2B9IA 4RX9A 3NIEA 2WB8A 3OW4A 1ZOGA 3QTXA 3OY3A 2Y8OA 5HO6A 3UMWA 3VBQA 3DFAA 2XBJA 4PWNA 3NUXA 2H9VA 2EVAA 4F6WA 3QWJA 3R7YA 4M3QA 3T3VA 1KE6A 4LUEA 2HWPA 4DFLA 3MB6A 3AT4A 3QZFA 2PTKA 4PP9A 4IAFA 4X6RA 2BAKA 3MH3A 4O6LA 5JK3A 4EYMA 4PMPA 1R1WA 3IONA 1JSVA 3GU8A 3POZA 3EMGA 4FT7A 4MKCA 4NM7A 4I5PA 4X3FC 3K2LA 4GS6A 4ZP5A 2F2CB 1Q8TA 3PJ1A 5KO1A 1KV1A 5A14A 1PMVA 3KB7A 4YJUA 3S2PA 2B7AA 3QGYA 1CKPA 5EG3A 4DT8A 2X7GA 2XYUA 4J95A 4U3YA 3QHRA 4UZHA 1BYGA 1H24A 3A62A 5DNRA 4BVUA 2R64A 3WF9A 3I81A 2X0GA 4NFNA 4DTBA 1OECA 5JSMA 3QTWA 1FPUA 3ZBFA 4F1TA 3VS1A 3BCEA 4TYHA 5EKOA 5DWRA 3DLSA 2QHMA 2HW7A 4FVRA 4J7BA 1P2AA 5DRBA 2R3MA 3HNGA 4UXQA 5J7HA 4BCIA 2G9XA 1W82A 4RMZA 3FHIA 2Q0NA 4ENYA 4YUQA 4KSPA 2O63A 3C1XA 3NAXA 2Q0BA 3D5XA 4MBLA 3OTUA 3BU5A 5JFSA 3Q9ZA 3DA6A 4DCAA 4CGAA 2W1IA 5BVFA 3CY3A 4MYGA 4I6FA 3ROCA 1KE9A 3P5KA 4FTJA 2XH5A 3FPQA 3E92A 1XJDA 3P7AA 4E1ZA 3A7JA 5AAGA 1PJKA 4KD1A 5E8XA 4P5ZA 1BLXA 1JAMA 4FSYA 4HYHA 2XNGA 1WMKA 3AOXA 3KGAA 4RLKA 5LWMA 2UW7A 3PPKA 3MFUA 2ITPA 3R1SA 2IW6A 4I4EA 4IWPA 4BY9E 4D2PA 3PVWA 3DK3A 3KVWA 3OHTA 2UZLA 3FLZA 4YTIA 3FQHA 3U4UA 2YM7A 5TOZA 1KE7A 1YDSE 2UW8A 3CXWA 4RWKA 4XRJA 1G5SA 4GU6A 1E1XA 1B6CB 3EQRA 1NT2A 2WFYA 4U79A 5L6WL 5IH5A 5JRQA 4S32A 4ITHA 4KKEA 5HE1A 2A0CX 2OXDA 5AFVA 3QAME 4OW8A 4FTRA 5B2MA 2W7XA 5CZIA 4GVAA 1GNGA 4MD9E 4E5AX 4FVQA 4WRSA 3SDJA 1U54B 1YOMA 2Z7LA 3CKWA 4KB8A 4USDA 4L3LA 4YZBA 3TNIA 4E73A 4XP0A 5CAPA 3B8RA 4XV9A 4RC3A 4BDGA 5AR8A 5JFVA 3SA0A 5IA4A 1UU8A 2VTLA 3LCDA 3MY5A 5BVDA 4DF3A 3UIMA 5C8MA 3SRVA 5DG5A 3P08A 4QTAA 4JAJA 3MN3A 2FB8A 4YJQA 1ZZLA 4DGGA 2C68A 1BMKA 2PVFA 1BL6A 2WTJA 4FYNA 4UMPA 3DCVA 1G8AA 3OEZA 2B4SB 2NP8A 4OLIA 4EJNA 1B38A 4U44A 2QVSE 4WSYA 3DXNA 1QMZA 4TWPA 3BU3A 2C1BA 3MH2A 4C4JA 4D1ZA 3Q6WA 2WMVA 4IM3A 4M12A 4DG2E 2BZHB 4S33A 2J7TA 1QL6A 4ZEGA 2JLDA 3QYZA 4RX8A 2ACXA 3MIAA 3PXFA 4PPBA 1GAGA 2R3LA 3RTPA 4FGRA 5DVRA 1XH8A 4Q9SA 4AUAA 5GIPE 2B9FA 4RQKA 4XV2A 4CZTA 3OBGA 4JG6A 4GJ2A 5DOSA 4PQNA 3BBTB 4ZLYA 3CGFA 3V3VA 3T3UA 2WMAA 4DFZE 1IASA 4OT6A 2UZEA 2PZ5A 1MRYA 4JDKA 3ZEPA 4KBKA 4TNBA 1KSWA 4WBBB 2IZUA 3PSDA 1OMWA 4YJTA 2WQOA 4MD8E 5IUGA 4HNFA 1WBTA 2X6EA 3VUKA 1ZRZA 5HOAA 1UKHA 2XKEA 3KMUA 4IMYA 4M68A 4FUYA 3ZRMA 4CLJA 5I9WA 4AXAA 1WBPA 4NKAA 4IH8A 3W10A 5A4TA 5LWNA 4TZRA 3FPMA 4RFMA 4W4VA 2I6LA 2BR1A 3POOA 4HGLA 3DKOA 4F9BA 4BYIA 3KMMA 5C03A 3SXRA 3Q4UA 4RC2A 2RSVA 3Q32A 4MNFA 4AACA 1ZYLA 4BCNA 5FDPA 3HMNA 3VJOA 4LGDA 5BVOA 3GBZA 3AD5A 2VTRA 3F2NA 5LMKA 2KTYA 4O86A 3GP0A 3S1HA 5FM2A 5TKDA 3GGFA 2J5FA 3L9NA 5DMZA 3HKOA 3CEKA 4J96A 4R3CA 2W1FA 4NIFA 4OTIA 4JRNA 1ATPE 2UW6A 3O2MA 2PVHA 3QHWA 4IC7A 5FXRA 5CU4A 5AP3A 3IKAA 1VR2A 3OOMA 2V62A 3UE4A 4PDPA 4PV0A 1P5EA 4UWCA 3JYAA 2VRXA 3Q5IA 4QMZA 4L7SA 5IISA 5E7RA 4GIIA 4J71A 5CF6A 4UEUA 3CQUA 4XUFA 3OG7A 3BYSA 5EM8A 1VEBA 3LFBA 4ALWA 1XO2B 4APCA 4NKSA 3UQGA 3BLHA 2ESMA 4FSMA 5EOBA 3C50A 3UP2A 3JY9A 4EJ7A 2J2IB 2QLQA 3VQHA 3FQSA 2XS0A 3OROA 3KXZA 1QPEA 5JZNA 3FYKX 5IA1A 2W5AA
chains in the Genus database with same CATH superfamily
4XG3A 3PIXA 4UV0A 5A4LA 2WMBA 4JAIA 5ETIA 5I9XA 5HLPA 5CU3A 3TJDA 3UOJA 3E8EA 4K6ZA 4IC8A 3KULA 1XH7A 2WZJA 3IDCA 4I5CA 4D2VA 3BEAA 4N6ZA 2VGOA 2QO9A 1XH4A 2VU3A 3CJFA 4YPDA 3RALA 4BDDA 1A48A 1YKRA 1YOLA 3KXGA 4KRDA 5HKMA 4E6DA 2XALA 2ZAZA 2YZAA 2PE0A 4EC8A 4DT9A 4W4YA 4AZTA 2VV9A 3LVPA 4MQ2A 1ZZ2A 3TNWA 2XANA 3FI2A 5HTBA 2OFUA 4NL0A 3FDNA 4DN5A 4G3FA 3BWJA 3ZFMA 3MY0A 3EL8A 4MQ1A 1OKWA 1HOWA 2WTVA 4MXZA 3PY1A 4O0YA 3M11A 1ERKA 1GIIA 2W1HA 1GZKA 2YIRA 4KKGA 1H00A 3BZ3A 5CAQA 3WARA 2E2BA 5KE0A 4BKYA 5IEYA 1IRKA 4O7WA 1ZY5A 4W4WA 2XNBA 2QOBA 3WF6A 2PMNX 3NUUA 3ZHPC 4AA0A 3PJ8A 4FG9A 2XA4A 5HCXA 2RIOA 3PPJA 5GJGA 1APME 3BPRA 5F4NA 3SLSA 1YVJA 4CKJA 3Q4CA 1I09A 4X3FA 3ZLYA 5C1QB 3QRJA 2BRBA 4B0GA 2YM6A 5EHOA 3ORXA 2J50A 4IB3A 5E1SA 5GZ9A 4ZTHA 3F7ZA 3R7UA 2WQMA 4IVBA 4R3RA 1MRUA 3FYJX 3A7GA 3I5ZA 3PVBA 1KE8A 4JX7A 4M66A 4M14A 3VBVA 4QMTA 4YJSA 3LLAA 3IG7A 1H25A 2CCIA 2IF8A 3E62A 3ORKA 3DT1A 3CCNA 5EM6A 5AP0A 5FDXA 1B39A 3HMOA 2RFDA 4I0TA 4X2NA 4I23A 1CDKA 5HE3A 3ZO1A 4D9UA 4PL3A 3Q9XA 5CSVA 2RFEA 4OR5A 3R1QA 4IEBA 3TCPA 5EYDA 1ZYCA 4G3DA 4YLLA 4FKTA 4EK6A 4HOKA 5AP7A 4IAAA 1YI6A 4EOIA 1MUOA 2YIXA 4X3JA 3NEWA 4AE6A 3TL8A 5GZAA 3HX4A 4QYEA 2X0PA 3DBQA 1E9HA 4U42A 5KMJA 1CSNA 4EWHA 3TUCA 3UG1A 1ZOHA 3W16A 5AA8A 5J9LA 2C6OA 2PZRA 3V6SA 1WCCA 3U8WA 3BV3A 2WIHA 3ML1A 4E26A 1H0WA 3B2TA 2Y4PA 5HICA 3PJCA 4GU9A 1GJOA 3WILA 3EN5A 3R9NA 5AR7A 3QKKA 1IAJA 4HYSA 4U3ZA 3DZOA 3ORZA 4J98A 4E6AA 1YQJA 4AGDA 1URCA 4JJRA 3TZ7A 4D55A 4FKUA 4CSVA 1JQHA 5E8YA 4DYMA 3EKKA 3TIZA 3BHUA 4L6QA 4FSTA 4LL5A 3VS7A 5M07A 4L43A 3P5JC 1U4DA 4NM5A 3V5LA 3R30A 2A19B 2C5OA 4AX8A 2WEIA 3Q04A 2YAKA 4CKRA 3BQRA 2WMWA 3IW8A 5DPVA 5FP5A 3GFEA 1WBVA 3F2RA 2Y4IC 4W8DA 4WNOA 4RJ7A 1UU3A 2WO6A 4XV3A 4BF2A 1H1WA 4ORKA 5FUTA 3R00A 5B0XA 3QTUA 3R8PA 4XG9A 2W4KA 4F6SA 4F08A 4E5BA 4LGHA 1FQ1B 3UYSA 3F61A 4FTKA 4C61A 4QD6A 4EZ3A 5I3RA 3U6HA 4CCUA 4F4PA 3RAKA 4JG7A 4CFWA 4EK3A 2YM4A 3QTRA 4RX5A 4EOOA 5BUJA 4HPUE 3LMGA 2NO3A 1M2RA 3DBFA 3FZPA 3QU0A 4FV1A 3O50A 4ALUA 4DH8A 3OC1A 5CF8A 4XEYA 3R22A 3TJCA 4O0VA 3H9OA 3W33A 4RVMA 4UZDA 4GEOA 4I3ZA 3WZUA 4U80A 5A4CA 4EI4A 3A60A 4Y46A 1Y57A 2QOFA 3ORLA 4O82A 2QI8A 3D5VA 4Y8DA 2YERA 3ZS5A 3Q9YA 4FV7A 4CZUA 4DITA 4JBOA 4FMQA 3U55A 1U5QA 3LFEA 1YXVA 4FSNA 2CGXA 4K1BA 2PK9A 4LRMA 3V8TA 1TQIA 3TNPC 2AQXA 2PUIA 1IG1A 5CSXA 5I3OA 2Y0AA 4FSRA 3UDZA 4QDVA 4II5A 5JFWA 3QF9A 4B9DA 3N9XA 2ITYA 5DH3A 2PPQA 4B7TA 1U46A 4JXFA 2WMUA 1Z9XA 4YPSA 3RZFA 4PP7A 1ZYSA 1QCFA 4BDEA 4C37A 3SHEA 2JKMA 3QCSA 3VWAA 2EXCX 2UZVA 5CSWA 3I60A 5M56A 4I6HA 3C7QA 5CQUA 3IECA 1MRVA 4FZ7A 3ZEWA 4XNEA 1J91A 2PVYA 4QP1A 4TKSA 3CTQA 1SYKA 2LAVA 3PA4A 2W99B 4MAOA 2C69A 3UYTA 2XK8A 1AD5A 4G9CA 4GK4A 5CVHA 2O64A 4C4IA 4FKJA 1JKLA 1XR1A 2WTKB 4RIWB 2GDOA 4RT7A 3OMVA 4D2WA 3LW0A 3HGKA 1ZARA 3ZO2A 3OXIA 5A46A 3DS6A 4W4XA 5HE0A 4EC9A 2ITVA 4KBAA 3MTFA 1Q24A 3OY1A 4N4SA 3FMHA 3FSKA 3NW5A 4GG7A 5AUYA 5FTGA 4WBOA 2XUUA 3K54A 3E3BX 5EYKA 5C4LA 3EQHA 1YRPA 2ITQA 3T8OA 3EOCA 3AC2A 4XX9A 4CG8A 3VNTA 3R63A 5KKRC 2W1EA 3S3IA 3FZSA 4EQCA 1UV5A 3EYHA 4FSZA 1UWHA 5LMAA 4YZDA 2AC5A 2J0IA 1XHAA 4F7JA 1FBNA 2JFLA 3P79A 1PXOA 3SXFA 4BBFA 2OH4A 4YJNA 3MFTA 4AT4A 4O1OA 4BL1A 2YWVA 3VAPA 1UNGA 2VTOA 2VTJA 4G5PA 4IXPA 5BYLA 5CNNA 1H26A 4ZS4A 3DQWA 4DG0E 4I6LA 5IQBA 5IU2A 5HIBA 4EHVA 1F0QA 4HVHA 4O96A 1OBDA 4QEBA 2VZ6A 2OLCA 3RMFA 5CU2A 4PNKA 3F88A 4FKRA 4H58A 3C0IA 3EN6A 4AZFA 3OCBA 4LYNA 3PP1A 5CY3A 3CSVA 2XBAA 1OUKA 2QQ7A 3PRFA 2FSMX 4H3QA 4BI2A 1PYXA 4RVLA 3C51A 4TL0A 5CAOA 3HDNA 2XKFA 3LFSA 4QMOA 3TWJA 1VJYA 2QOOA 3OP5A 5HHWA 3N4TA 2XIXA 1BUHA 2EXEA 2W4OA 3LLTA 3VS6A 1FMKA 4ZSLA 5IQCA 4D0XA 4YLJA 2A4LA 3ORPA 4E5WA 2E9OA 4TYGA 5K9IA 4QMMA 2ZV2A 3FWQA 3DBEA 5FEQA 5KZ0A 3JY0A 3HV4A 4NJDA 4BBEA 3MGYA 4G1WA 2HZ0A 3QX2A 4O0XA 4RIYA 3GQIA 4BZNA 3UQFA 4Y85A 1PYEA 2QONA 3KCKA 3K5VA 3BGQA 2ZB1A 4G3CA 1LR4A 4V04A 3VUHA 3ODZX 2ITWA 3ZCLA 4C0TA 3IGGA 1RQQA 4MWIA 1S9JA 1OGYA 4E93A 3C5UA 2DWBA 4J52A 4GIHA 4RJ5A 3UOLA 3OF0A 3HAVA 2A2AA 4ZIMA 3HYHA 3A2CA 4C4HA 5AUUA 2QOLA 3EWHA 3H9FA 4WHZA 5CT0A 4OTPA 3DB8A 5IPJA 2OIBA 5HLNA 2BDFA 4ID7A 2WTDA 4HZRA 3DNDA 5KX8A 3FMKA 4AWIA 4GSBA 1ZY4A 4FODA 2Z60A 3MPTA 3R6XA 4K11A 4YZNA 2XCHA 3LJ1A 3QKLA 5D10A 3VULA 4DGLC 4HVGA 1JPAA 1JOWB 2WQEA 4GL9A 3W0PA 1H1SA 3P0MA 1PMEA 4QPSA 5I0BA 1WVXA 2F7EE 3PG3A 4TN6A 3VBWA 4AE9A 4DHFA 4FC0A 1TFFA 4DA5A 5HE2A 2VX0A 3ACKA 2QO7A 3CJGA 4ANSA 1ZAOA 5AV0A 4BGQA 4OTWA 3NWWA 3OUKA 2P33A 3CD3A 3LFAA 4ZSEA 2VTHA 1Q4LA 3HMIA 2ERKA 4Z3VA 2C0IA 2X0QA 3GC7A 4FZ6A 4I24A 4XOYA 2BRMA 4MK0A 1OI9A 2V7AA 5JKGA 2QURA 2YM3A 5CAVA 4ZY4A 3LM5A 4O7TA 1FVVA 4TYHB 2ZM4A 3GQLA 4N6YA 5E8UA 3GXLA 3VS3A 2CN5A 2OJ9A 4RX7A 3G0EA 5EM5A 3RGFA 4ZJVA 5AEPA 2GS2A 3PPZA 2OO8X 4U43A 3TV4A 4EOKA 5EKNA 2F4JA 4IM2A 1OL5A 1URWA 5ANGA 2X81A 3DU8A 5IA5A 4PPAA 4DEEA 2WMTA 3QA0A 5EDRA 4FRFA 4YP8A 5HEZA 4D5KA 1REJA 2FYSA 4MUQA 4LUDA 2W06A 1AGWA 2DYLA 2ZMDA 3HP5A 3G6GA 3V8SA 4CVAA 3DY7A 3L9MA 3NYNA 3PYYA 4AN2A 5L2QA 1UU9A 3DKFA 4DFYA 3MDYA 2FVDA 3CY2A 4NK9A 5KMOA 4AW5A 4LM5A 4XCUA 3IO7A 3ELJA 1CM8A 2WIPA 4QP4A 1UA2A 4XG4A 4EKLA 5J9ZA 3EJ1A 5ITAA 4L7FA 2ZM3A 4GT4A 5CXHA 1OIQA 4UMUA 5KHWA 2PL0A 1W2DA 2JIVA 2QU6A 3ROYA 5L2IA 4QMNA 4GFMA 2W5BA 3HV5A 4IZYA 3RM7A 2Z02A 3SOCA 2C4GA 1TKIA 1X8BA 2R3HA 3C0HA 4G3EA 4O27B 4OBQA 4YJOA 2VWUA 5TT7A 3RPRA 2PVJA 2O3PA 4YSMA 2BHEA 5HVKA 3NVMB 4IB5A 5J8IA 3LKMA 4PUZA 2V7OA 4BCGA 3V5WA 2PVMA 3FC2A 2G1TA 4FKOA 2JIUA 3NNXA 2B53A 2B1PA 3WYYA 3LFQA 3U6JA 1KOAA 3LXKA 3W32A 3WF7A 1M7QA 2OF2A 4YZCA 4FK3A 1OITA 5FP6A 2R0IA 3SRVB 3PG1A 4DTKA 1BL7A 1Q62A 2IWIA 4JX3A 3AG9A 1PXIA 3VUMA 4Z55A 3AKKA 2G2FA 2YCQA 3D0EA 3W2OA 1Q61A 4EH2A 5JQ8A 1OB3A 3EQFA 3F5UA 4RWIA 5CQWA 2X8EA 1IEPA 4RJ3A 1K9AA 1E1VA 1PXNA 3MA3A 4CFNA 3R7OA 1G8KA 4JL9A 3RCJA 3UO4A 3IW6A 4EZ5A 5AV2A 2UZOA 2XMYA 2YN8A 4S2ZA 4AGWA 3FUPA 4C35A 4IX3A 1NXKA 4BCOA 4ZZOA 1NVQA 2UVXA 2W5HA 3QQHA 4QPAA 3OT3A 4U81A 4AT3A 2JKKA 3PJ2A 3SKCA 2ZB0A 1H01A 2BTSA 3EHAA 1EH4A 2XK6A 2YIWA 5J9YA 5GINE 5B2KA 1XKKA 4LFIA 4I22A 3NX8A 5IA3A 4BKZA 4RWJA 4OAVB 3TM0A 4FTUA 3RPVA 4BDCA 4IFCA 4I6BA 2BDWA 2HZNA 3S95A 3LFDA 3OD6X 4AW0A 2ITNA 5AV4A 4ZOGA 4QNAA 4XBRA 5I9ZA 3BEGA 5FGKA 3R83A 3BGPA 2NNWB 2CSNA 1V1KA 3I4BA 1CKJA 4M69A 5DT4A 2YJRA 3KRXA 4BKJA 4L53A 4LG4A 3FJQE 3HV6A 4AZWA 3QTQA 5K4JA 3TT0A 2XZSA 3LXLA 5M08A 2FSTX 4XG8A 3F3UA 5IEXA 4R7BA 1FGIA 1W8CA 3F5PA 3GU4A 2QC6A 4H3PA 4JQ8A 1NVRA 5HZNA 5CVGA 3PE2A 1SVGA 3BBWA 2GNLA 2PZPA 3AGLA 4AZVA 5BPYA 3GC0A 3KCFA 3K3JA 5EH0A 4F63A 4FTLA 4YO4A 3HEGA 5M57A 1DM2A 5AR5A 2H96A 2GFSA 2VTIA 1IA8A 1R39A 3H30A 4MXAA 4I5MA 2YZLA 5LARA 4EHZA 4ANOA 3OVVA 2ZV9A 3GNIB 4GK2A 4MBIA 4B99A 5AUZA 2P3GX 3DAKA 3OOGA 4NIFB 4A9TA 1JKTA 2HY0A 4RSSA 4HVSA 4K0YA 1W84A 4D4YA 1H08A 1IAHA 3SD0A 3GCQA 4O0RA 4B8LA 3BX5A 4JBVA 4FV5A 4OTFA 3HZTA 4IE9A 3Q53A 3COMA 4H1MA 4U5JA 4X0MA 1WFCA 3MVMA 4DGMA 3EFJA 2H8HA 1XH5A 1PMUA 4F64A 4QMWA 3ZLXA 2XVDA 4RA5A 3Q4TA 1M14A 3L8VA 2IZRA 2C5VA 2ONLC 3MYGA 1P4OA 4G6NA 3UIUA 4F7LA 3C4FA 3PA3A 3ID6C 2OJGA 5E8ZA 4MNEA 4Q5EA 1F5QA 4FKSA 4L9IA 3BE9A 3FKNA 4ANNA 3FMLA 4ERWA 2RKUA 5J95A 3BWFA 3L9PA 2HZIA 4JIKA 4GK3A 2PMOX 4C3FA 4D4VA 2BPMA 3NIZA 2XIYA 5J1VA 3ZDIA 3AGMA 4FKGA 3TUDA 1MQBA 3ZMMA 4MF0A 4U97A 1OIUA 4YHTA 1YWVA 3BELA 3F6XA 3KULB 4ZTQA 2UZDA 2QOKA 2PZIA 3FLWA 2QR8A 3PXYA 1YDTE 4PPCA 3RZBA 3UZTA 1FINA 1LPUA 1YOJA 3G5DA 5LVLA 4CQGA 4FNXA 4D2TA 1QPDA 4DG3E 5BQ0A 2HIWA 4QMQA 5HIEA 2CNQA 4CZYB 2ITTA 4FA2A 4DBXA 4GFGA 4C7TA 4NSTA 3BI6A 2ZV7A 3MB7A 2VO7A 4FV8A 2I0HA 3V8WA 5DIAA 5JGBA 2WTIA 4PL5A 5CSHA 4KAOA 4QYYA 4GFOA 4KNBA 4KS7A 4RJ8A 4QT1A 3EB0A 1SNXA 5EI2A 3ORMA 2JD5A 3QLGA 4ACGA 4D4RA 4LRJA 1H8FA 4M15A 1RE8A 4RZVA 3LXNA 3A99A 2XIRA 5AX3A 4HPTE 3SG9A 3AD6A 4JQEA 2VNYA 3L9LA 4PMMA 5TF9A 4F70A 2XK4A 2GNHA 3UPZA 4X3FB 1VLRA 1F3MC 2YM5A 2X6DA 4ZJIA 5J7BA 4MCVA 3UDTA 5J5SA 3QBNA 3FMDA 1O6LA 4IDVA 4Q2AA 4YLKA 5HG7A 3GU6A 3CQEA 3LZBA 3U9CA 3BLAA 4NH1A 4E7WA 4IAZA 4AGCA 3GFWA 1H28A 3P23A 4FKLA 1BX6A 1ZYJA 3R1YA 4FV0A 3A7HA 4TW9A 2IN6A 4C3PA 4CFFA 5AUTA 4XP3A 3FY2A 4BDHA 4RZWA 4ANQA 4FVPA 2HZ4A 4JR3A 2X9FA 2XP2A 4AZSA 2QO2A 5A3XA 4QQTA 4IVDA 2JFMA 4FI1A 4GUBA 2WQBA 4KRCA 3C5IA 4BCKA 5ETFA 3FL4A 3PRIA 4FK6A 3HUBA 3UO5A 2XJ2A 5JH6A 2WU6A 3F5XA 3EFKA 5DE2A 1SMHA 2OIQA 2FGIA 4O81A 3IW7A 1MQ4A 3ENMA 3LXPA 3ZLWA 3LIJA 4TWOA 4BIBA 4IAYA 2RFSA 1J7IA 4TWCA 5EM7A 4NYEA 4RG0A 4ASEA 3MESA 2VN9A 3NUPA 2NPQA 4K18A 1DAYA 2HYYA 3KK8A 3R01A 1A06A 4C58A 4CFMA 2RF9A 3A61A 2GNJA 4AA5A 4AQCA 4EL9A 2X2KA 1XMMA 3GCPA 5ANIA 4ZTNA 5JT2A 5M06A 3BYOA 4OAUC 2JDOA 3FLNC 3GU7A 3W2QA 1CKIA 3PXRA 3DJ7A 3R28A 5DYJA 4J97A 5CX9A 2EB3A 1PXMA 2VX3A 4X6QC 4IJ9A 2ZV8A 3CTHA 3CLYA 4I0RA 1OKYA 4DAWA 4MWHA 2BUJA 4O0SA 4FNYA 1R3CA 2HY81 3EL7A 3GOKA 5I9UA 4FT3A 2AUHA 2G2HA 3OZ6A 3UJGA 5IEVA 2Q83A 3TMOA 2OXXA 2VTTA 3AT3A 5IF1A 4RWLA 4MXYA 2XARA 4IHPA 3QD4A 3OWJA 4I93A 3BGZA 5FG8A 3ATTA 1FVTA 3F3VA 4MBJA 5IKWA 3GI3A 1NA7A 3SXSA 4C62A 3R8MA 2CKOA 5F95A 4NU1A 5AP4A 5HD7A 2R7BA 4FG7A 4E8AA 4FV6A 5IQGA 5A4EA 2IVSA 3PE1A 2RFNA 4CNHA 4ZZNA 1R0EA 2PVNA 2XNOA 2W17A 2C30A 2YACA 3PLSA 5EYMA 3D4QA 4EHEA 4YR8A 4FJVA 2OFVA 3DBDA 4UYAA 4A9YA 2DUVA 4ACCA 3EKNA 3SQQA 3QZGA 3EQCA 3LFCA 3UMXA 2Z7RA 1YHSA 3UC3A 4BCMA 4E4MA 3L8PA 4L44A 3DKCA 3P78A 4FIIA 4BZDA 5HO8A 3H0YA 4EH3A 2X7FA 2CHLA 1GZ8A 2A1AB 2UZBA 3KREA 5EQPA 3CPBA 3F66A 2XRWA 4A4XA 3BYMA 3P4KA 2OZAA 2GNGA 2OGVA 3CGOA 4Z9LA 2JBOA 3WOWA 4BCHA 2CNVA 4O7SA 4YU2A 3DDQA 2H6DA 4WG3A 4E4NA 1T46A 3ACJA 2F7XE 1BKXA 3CIKA 4K2RA 4V05A 3RK5A 3ALOA 4F65A 3QUPA 1G3NA 3DZQA 5HU9A 2XNNA 4G3GA 4CXAA 3CKXA 4E3CA 3VBYA 2WPAA 3FHRA 3FXXA 2R3IA 3KU2A 4C8BA 3EZVA 5A9UA 3OCTA 3TYKA 2C1AA 4DH3A 3B2WA 4OUCA 2QG7A 2YA9A 4GT5A 5AV3A 4XS2A 4AAYA 4FL3A 3TACA 2PU8A 2YHVA 4QP9A 4YNOA 1FVRA 4IW0A 3W18A 5H8GA 3WYXA 4E4XA 4BJJA 3F82A 3L8XA 3OTVA 3FZTA 4FSUA 4FV3A 3QX4A 4JG8A 2C47A 4M84A 3S4QA 2WGJA 3FC1X 3FZ1A 1H27A 4K9YA 5AAEA 2WKMA 2IG7A 2ETMA 3MVJA 1U59A 2W4JA 3E88A 3V5PA 4RA4A 2OBJA 2GTMA 3D2KA 4G31A 4C36A 1WVWA 4D1SA 5BNJA 4O38A 3AC1A 2R3RA 3NPCA 5LCKA 5GNKA 5GJDA 1OKZA 4BTMA 4TNDA 2OKRA 3DAJA 4G34A 4ZS0A 3KN5A 4WKQA 4YNEA 2XM8A 2C5YA 4BB4A 4KS8A 4S34A 2CGWA 3I6WA 2OXYA 3RBWA 1PKDA 1XH6A 2XEYA 4UALA 4AGUA 4LI5A 3WZKA 1M52A 1RDQE 3QQKA 4APPA 4FEXA 3N51A 5EW3A 1UVRA 1SVHA 1PXLA 3HV7A 3R8VA 3ZBXA 1A9UA 3TXOA 5LXMA 1VYWA 4EH6A 4QYGA 4TT7A 2AYPA 2R7IA 3AC5A 4CTBA 4ZAUA 5LMBA 4EH9A 3UIXA 4NW6A 3WZDA 3BYUA 3EN7A 5KBQA 3RAWA 3TKHA 5BUIA 3O17A 1WBOA 4L45A 3NUNA 5JZJA 4HYUA 4F9CA 1Q3DA 5HD4A 4EOJA 4TTHB 2QR7A 4V01A 1JKKA 2XM9A 4NEUA 1YWRA 2IW8A 4W8EA 1PF8A 4MXXA 2AC3A 2YITA 5AIKA 4OTQA 4BDFA 5HBEA 3LHJA 1G8JA 3QQGA 4R7IA 3WIGA 3E8CA 3VF9A 1R78A 3JVSA 3DAEA 3UNZA 2OW3A 1YHVA 4CMUA 2VWZA 2E9UA 2HXLA 5HIDA 4FV9A 4IX6A 3KRWA 2OICA 4YJVA 3EFLA 1Q99A 2XAMA 4JBQA 3QZHA 3QALE 2JKQA 4NM3A 4RJ4A 1ZOEA 3FI4A 4BDAA 2BMCA 4C33A 4IZ5A 3AC4A 3NNWA 1M2PA 2G2IA 4RJ6A 3NVKI 3NUSA 5L8LA 3O0GA 5BVEA 4Z16A 3BKBA 2GHMA 5CT7A 4ANLA 2CMWA 4JRVA 4MTAA 4QDEA 2IW9A 3UVRA 3PA5A 3FLSA 2GFCA 4RIYB 4BTKA 5BVNA 1IR3A 2C6MA 2NRYA 4R6VA 2UZNA 4J53A 2WD1A 3D5WA 4N70A 4ZTLA 3TNQB 4CFVA 4O22A 4IVAA 4CRLA 4U7ZA 3QTZA 4ZTMA 5M4IA 3E7VA 2ETKA 3F3WA 5AX9A 4O7VA 4X7QA 4IACA 3Q2JA 4O7NA 3VUDA 1OL6A 3JXWA 2R5TA 2CKQA 1J1CA 4O21A 4B4LA 1BI7A 2ETRA 2XK7A 2WXVA 4BDKA 4HVDA 5L3AA 2UW9A 3AKLA 3QUDA 5FEDA 3UOHA 2BZIB 4FZFB 5HU3A 3LQ3A 4AQKA 4UBAA 5ACBC 4NZWB 4PY1A 4B8MA 3NMUF 4FUXA 4U9AA 4ZSGA 4D4SA 4R78A 3TTJA 2VWIA 4U40A 3E5AA 2LGCA 3E8DA 4F99A 3SG8A 3DQXA 3UG2A 1SZMA 4JR7A 2ITZA 2O8YA 2ZVAA 3PDTA 3NZ0A 5L2TA 4NCTC 4IB1A 2B0QA 4N57A 2O65A 5AP1A 4R3PA 3UIBA 3COHA 4W9WA 3RKBA 2R3FA 3WF8A 4RFZA 4GMYA 4IZAA 4UMRA 3KKVA 2XNMA 3I1AA 3H4JA 2XEZA 3LFNA 3ET7A 3GOPA 2WELA 4AF3A 4DHJA 3V5TA 4KKHA 4G9RA 5A54A 3PFQA 1UKIA 4JT3A 3I6UA 3JPVA 3WF5A 2G01A 4TYIA 4BDIA 1RW8A 4DEHA 4IVCA 3MPAA 5D11A 3PZHA 5L2SA 4TYEA 3E87A 1ZMWA 4EQUA 3PY3A 3LCKA 3Q5ZA 4DLJA 3HAMA 5C4KA 5IQEA 3C4CA 4CQEA 2ZDUA 5CSPA 2XKDA 5HX6A 1JVPP 3CBLA 4QRCA 5DA3A 2P2IA 2XRUA 4FZAB 1H0VA 1I44A 3RNIA 5L4QA 2P0CA 2RG5A 3TKUA 2VWBA 3D14A 3EQPA 3QD0A 4M97A 4XMOA 3N4VA 3MWUA 4O0TA 2VWVA 4FTQA 4BWPA 4YTFA 5CVFA 3W0NA 4RVTA 2OF4A 4O2PA 5EYCA 2P55A 4R77A 2PMLX 3GEQA 1ZWSA 5EI8A 2PUUA 4CYJA 2ITOA 5FBOA 2NRUA 2CGVA 3GC9A 4FTTA 2PUNA 3VW6A 3DNEA 1FOTA 4O2ZA 3R9DA 2RG6A 2FSOX 4PMTA 5HTIA 5D7VA 1DS5A 4NWMA 2Y4IB 2J0MB 2B54A 4MVFA 2IO6A 5HORA 3ZM9A 3QQLA 4QNYA 4Y95A 4ZSAA 5IMEA 1AQ1A 2GHGA 5T6KA 4F09A 4C34A 3IOKA 4YTHA 3TV6A 3ENHA 4LV8A 4EBWA 5LVNA 4FTNA 2Z7QA 2YCSA 4U41A 4Y83A 5HCYA 4BRXA 4BIDA 2JITA 2YLEA 4YTCA 5A6OA 4GYIA 4Y72A 4J1RA 4DTAA 5TR6A 2X0OA 3BU6A 4FV4A 4UY9A 4FEUA 3KY2A 1YI3A 4IAKA 1ZYDA 2W1DA 4NW5A 4CD0A 4EYJA 3MI9A 5IA2A 5IZFA 1J7UA 2YCFA 3LE6A 4WG5A 1PMNA 2JDTA 3KXHA 2XK9A 2HCKA 4LOQA 4EZ7A 1FMOE 1K3AA 3KMWA 4DEIA 1OBGA 3O51A 3OCSA 4I6QA 5IQIA 5ANEA 5HI2A 5HVJA 4BGGA 2VWXA 4O1PA 3EH9A 3AQVA 3G33A 3H3CA 3KL8A 4MXCA 5JFXA 4IJPA 2JIIA 2F2UA 3BQCA 3HV3A 3M2WA 1MP8A 4P4CA 4RBLA 4A9RA 2VO0A 3TDVA 3OFMA 1M17A 3ALNA 4PTEA 3VS0A 4DDGA 3P7CA 3BLQA 2JEDA 3QRTA 4O6EA 2PYWA 3BE2A 2WEVA 5JN2A 2HOGA 4NTSA 1ZMUA 3KEXA 2QU5A 2R3QA 4FL2A 2VO3A 5CEQA 3VRZA 3ZUTA 1PXKA 4GT3A 2XNEA 4C57A 5FTQA 3TDWA 2V55A 4O7YA 5BV3A 3PWDA 4X21A 1O6YA 3UZPA 3U4WA 2WOTA 4ZMEA 4G6OA 3B8QA 3QRKA 1XWSA 3V5JA 2XIZA 3CP9A 3K5UA 1J7LA 4ANBA 5IQDA 3MSSA 3W2RA 3W0SA 5IH4A 1Y6AA 2CN8A 1PXJA 1W0XC 3NLBA 4IANA 4IIRA 4KINA 2GQRA 3PWYA 1ZMVA 2KULA 4M69B 3RPYA 3HMMA 1Q8WA 2QOIA 3BHYA 4GCJA 4IFGA 3UODA 3BRBA 2BHHA 1J3HA 2JAVA 2BDJA 4BBMA 4CFUA 2J0LA 3MVHA 3ODYX 1XQZA 2ZDTA 1LEWA 4GVJA 3E64A 2B9HA 3ANRA 5H2UA 2JKOA 4A9SA 2R0UA 3FLYA 4FIGA 3NS9A 5AUWA 4WT6A 4F0GA 2C5XA 3CS9A 2GQGA 4AXCA 2R3KA 5KKRB 4KA3A 5E90A 3C4WA 1GY3A 1YW2A 4WNKA 5CEMA 5IG1A 5L8KA 4HCTA 3BHTA