5L6WL

Structure of the limk1-atpgammas-cfl1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
290
Chain Sequence
SMPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIM domain kinase 1
publication title Structure Of the LIMK1-ATPgammaS-CFL1 Complex
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 290
sequence length 306
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l6wL02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l6wL01
5AP3A 2XRWA 1J1CA 4OTQA 3BE2A 5HBJA 4R7HA 4HVSA 3MJ1A 2F2CB 3U9NA 3IW6A 5FEDA 3MJ2A 3RZFA 4FV8A 5EI2A 4D2TA 3LOKA 3O8TA 2QI8A 2YJSA 5I9YA 3PWDA 5LVMA 3NCGA 3A60A 4JLCA 2O2UA 3R7IA 2QOHA 5BUIA 4O22A 2SRCA 1VJYA 2F7EE 4ZSJA 5FTOA 3T3VA 5HORA 3QGYA 2BRHA 2XEZA 3PY0A 3WZUA 4KIKB 5LCJA 4OBPA 3I5ZA 3PVUA 2OJIA 3RTPA 4AX8A 4Z55A 5JFWA 4DTKA 1SVGA 2J2IB 3BBWA 2XNPA 4ANBA 5BVNA 3FQHA 4PMMA 2YLFA 1ND4A 3ERKA 3U6HA 3UPZA 4II5A 4GU9A 3QCXA 4TWOA 5J7BA 3GBZA 4QYFA 3W10A 5GZ8A 5IISA 3OT8A 4QYYA 5AFVA 3QYWA 3HZTA 3R7GA 3RPYA 2W99B 3K54A 3ZU7A 4QMWA 1BLXA 3ODYX 4R7IA 5E92A 5K4JA 4ZIMA 5CF5A 3ETAA 4ASEA 2YWVA 2GNHA 2VZ6A 5CANA 4QPMA 3GQLA 5DT3A 5KMIA 4G6OA 3D4QA 4EYMA 3QTUA 4Y8DA 5AP6A 2OG8A 4DEAA 3Q9WA 3NZ0A 2UW7A 4KWPA 5KBQA 4BCHA 3FL4A 3LLTA 3O7LD 3TV7A 4D28A 4EQUA 5M53A 1I44A 5HCYA 4NJDA 4CFXA 3HMMA 3LFQA 4FIIA 2CNVA 5IH4A 2YACA 4G16A 4F9BA 3PUPA 2BR1A 4B6LA 4I92A 1CKJA 3MH0A 5HKMA 2O63A 3ZSHA 4GFOA 4ANLA 2RFDA 3GOKA 4UMTA 3RCDA 2WTCA 5EYMA 3TG1A 4UYAA 5D7AA 1NVSA 3BLQA 4TYEA 3WF8A 4E93A 4E26A 4YP8A 3ZHPC 4PQNA 3QD4A 2YZLA 1L8TA 3Q53A 2BVAA 4YSMA 3RHXA 3WF6A 2F7ZE 4CKRA 2W17A 2OIDA 4ZMFA 4P7EA 1NY3A 4ZTSA 5HVKA 3FI3A 5D12A 2GPHA 1O6YA 5BMSA 1U54B 2OF2A 3FMHA 3GQIA 2J0MB 2WMTA 3W2OA 4LFIA 4QPSA 3UO5A 4ASXA 3BYVA 1YWNA 3F5PA 4ZZOA 3EFKA 3G90X 3AC2A 3EFWA 3VS4A 1BKXA 2PZIA 2RGPA 3N51A 2XCHA 3DAEA 3QRUA 4KSPA 3DV3A 3HECA 3FQEA 3FC1X 4M97A 3VS2A 4YJRA 4YBJA 3R1SA 1A9UA 3BHUA 4HCVA 4FEXA 1O9UA 3R30A 5CNNA 4BI2A 4O83A 4L68A 3LE6A 4OTPA 5CXHA 5AEPA 3MY5A 5AP2A 2YDJA 4C37A 1S9IA 4YHFA 3DJ6A 1PXLA 2V62A 4F08A 2WTDA 2CKOA 3LVPA 4BICA 3PFQA 4G31A 4ZSEA 2ESMA 5FBOA 2QO7A 3R9HA 2F4JA 3OCBA 4D2PA 5AV1A 2ITQA 4BC6A 3QTZA 4QMXA 2VWIA 4UMUA 1XJDA 2QOKA 3Q52A 4UXLA 3P86A 2GHMA 3UVPA 4BDCA 2JDVA 4I93A 3KN6A 2PL0A 3OCGA 4RQVA 4CSVA 4ZY5A 5KNJA 2JKQA 3FLSA 2X4FA 2OXYA 4RPVA 3DKCA 2JEDA 3ENMA 3WF5A 3H30A 3EYHA 2EU9A 2VO0A 3GU8A 1ZXEA 2HZ0A 3TV6A 3HV3A 1WZYA 3C4CA 4H1JA 3EQCA 3V6RA 5E90A 3F3VA 4GYIA 4YZBA 3N4VA 5J9ZA 1PMNA 2VWZA 3MY0A 4DTBA 4FKQA 2F57A 5EHLA 3R21A 3FLYA 4L3PA 1R0PA 3VC4A 4LV5A 1WAKA 4DH8A 4Y83A 4XLIA 4ASZA 5G6VA 3IQ7A 3RBWA 5T6KA 4BCIA 4RVLA 4RLLA 2YZAA 4DFUA 3MFTA 4G5JA 1PXOA 4UBAA 4CNHA 5CZHA 4ALWA 1BI7A 3LCTA 3FLNC 3EFLA 4DBXA 4D9UA 4RA5A 3VS0A 2VTSA 2VTIA 4GUBA 5EH0A 3VQHA 4K2RA 1NVQA 3CTQA 4KIOA 2CMWA 4FKRA 1OVEA 4I20A 5IA5A 3EN9A 2WTJA 4DA5A 1UNHA 1IASA 2R7BA 2HWOA 1ZLTA 3UVQA 5A4EA 5LWMA 4NCTC 4DEGA 3GXLA 2G2FA 2QVSE 4GT4A 4HNFA 4K0YA 5BVFA 2WOUA 4RT7A 4BZDA 1MP8A 3GENA 3PIZA 3ZLSA 4C3RA 3S4QA 2OW3A 2I6LA 1Q8TA 4DC2A 1XH4A 5CQWA 2QR7A 3RAHA 3BYOA 3FPMA 4PWNA 2W1ZA 4QMUA 5I3OA 5A6OA 2ZDUA 3M2WA 4XBUA 4ZJVA 2C6TA 5CU6A 3NDMA 2BAJA 2GDOA 4C57A 3EH9A 4FKLA 4R78A 3TDVA 5IQGA 3CD8A 3GB2A 4GFMA 3R7EA 4U5JA 2C6OA 2QO2A 2R3OA 3G9LX 4HVDA 5A4LA 3COKA 1LPUA 4EQCA 1Y6BA 5BUJA 4J98A 5LVNA 1GOLA 4V05A 3GUBA 4NW6A 3V5JA 1IEPA 5EKNA 3EMGA 1H00A 2XKFA 4O7ZA 2FH9A 3OP5A 1YI6A 3EYGA 3QQHA 2PUUA 3KK9A 5BYZA 2G2IA 5LVPA 5GNKA 4DEDA 5D11A 1JSVA 4X6QC 4N57A 2VWYA 4BY9E 2ITPA 1MQBA 2VTRA 3PJ1A 4QMZA 4D0XA 4B7TA 4PV0A 4O7NA 3GFEA 3NNUA 5J87A 2CGWA 3DBFA 3FMLA 4HCTA 4IZAA 4JIKA 5AP0A 4BL1A 4L3JA 5ANGA 3SVVA 5CYIA 4FG7A 3P1AA 3N4UA 2YEXA 5HG9A 4MXCA 3MIYA 4O38A 4V0GA 5J9LA 3VHEA 3EQDA 3PP1A 4QP1A 5M56A 3P0MA 4F6WA 1YVJA 1OBGA 4CFFA 4QTCA 5CXZA 2BCJA 5IF1A 3JUHA 4UB7A 5HHWA 4DT8A 4ANSA 1M7QA 4WIHA 3ZH8A 3Q3BA 1H08A 3PIYA 4GKHA 3ENHA 2QG7A 4FNZA 1IRKA 3KXZA 4XG8A 1NT2A 5DH3A 1BX6A 4NCTA 4BGHA 3RCJA 3I7CA 2V5QA 2XUUA 2IG7A 1XH9A 5CT0A 3WOWA 2WZJA 3CD3A 4I22A 4D4SA 2OZOA 2PMNX 3NAXA 4EWHA 3DNDA 3AD6A 3BEGA 4RLKA 3OOMA 3IW8A 1TVOA 3IKAA 5L2IA 1DS5A 5BVEA 1H27A 3KXGA 4FKIA 1ZYJA 3B8RA 4AFEA 4E4XA 3FC2A 1OL1A 4YSJA 5CSWA 1UKHA 5L3AA 2RG6A 1XH8A 3PG1A 3Q5ZA 5BQ0A 4WSYA 2R3FA 4L67A 5F20A 4R7BA 4ZS4A 4RQKA 4CZUA 1Y8YA 2HY0A 2Z8CA 3AT2A 4WBOA 1AQ1A 3Q5IA 1UV5A 5IU2A 3I79A 4X6RA 4J52A 4TYHB 4PPCA 3O7LB 4FTIA 4B9DA 1CMKE 3NW7A 2Z7SA 5DT4A 4GVAA 2C6IA 2IN6A 4WOVA 1YI3A 3U4UA 1G8AA 4EOLA 2VWBA 3DK6A 5FLFA 1WBPA 1OM1A 5EHOA 4AT3A 2Y4IB 3SX9A 3R7YA 3UZPA 4JDKA 1PMEA 5E4HA 4XV3A 3FKOA 3EQFA 2W5BA 3E7OA 3L8SA 2C69A 3OD6X 5AUVA 1QPDA 1AGWA 3QF9A 4W9XA 2WEIA 3E64A 3FZRA 3QBNA 2HELA 2V55A 5A14A 3P7BA 3QYZA 5JGDA 4YURA 5EI6A 5C1QB 4LOPA 5D10A 2J0LA 3FE3A 2RFSA 4HVHA 5IUIA 4MVFA 1RJBA 3MDYA 2YIWA 4FTAA 3POZA 3FLQA 4DG2E 4I5PA 2P3GX 5CASA 2CNUA 1YWRA 3QTXA 1QPJA 2QU5A 4I0RA 3NUYA 2WD1A 2GFSA 4IFCA 3AD5A 2YFXA 3VW6A 4O7SA 2J5EA 4YC6A 4EI4A 3QUPA 3R8MA 4EC8A 3FI8A 4KBCA 2WQOA 3MVHA 1J7IA 5A4QA 2RKUA 4AP7A 5KHWA 2VD5A 3ZMMA 4ZXTA 1K9AA 2CDZA 2V22A 3KRRA 3R8ZA 2C30A 5CAOA 2WO6A 3FZSA 4H1MA 3KRWA 1JWHA 4O0RA 5C8MA 5HCXA 2GSFA 3RAIA 3M42A 4AG8A 4ERWA 4MXOA 5AR3A 3D2KA 3RM7A 5D7VA 4U6RA 1JQHA 4JBVA 4EKLA 4O7LA 2X0GA 3LM0A 2W05A 5DPVA 3WARA 4MF1A 5J1WA 3Q9YA 3BU5A 4DCAA 4FTKA 5AA8A 5CU4A 4TPTA 3BEAA 3GU4A 2XK9A 4EL9A 4IM3A 3QD2B 3PJ3A 4I3ZA 2R3MA 4GSBA 5BVOA 1PYEA 4GEOA 1M2QA 2WMBA 4CLIA 3LJ2A 4GCJA 2UW3A 1G5SA 5AX9A 3AMAA 5H3QA 3MTLA 3R7OA 3WE8A 2QURA 5M09A 1NA7A 2PVYA 4MAOA 4Q5HA 4UZHA 5D9HA 5CEPA 1YXSA 3VJOA 3Q04A 4BDKA 2JIIA 3TM0A 3TNQB 3C1XA 3OXZA 3HRFA 4D58A 3CCNA 3A4OX 3U55A 5BYLA 1IAHA 4G3CA 4CXAA 2W5AA 2XM9A 2PTKA 2JITA 4X2GA 2YA9A 5HNGA 5E1SA 2FGIA 5GZ9A 2BIYA 1NVRA 2HXQA 4XP0A 4EK3A 4NK9A 3MN3A 4ACGA 4E6QA 5B2MA 3F3UA 1SYKA 4NH1A 3F2RA 3ZFMA 2XRUA 3A99A 3IPHA 3QHWA 4JQ8A 4QP7A 2HCKA 4GYGA 4DFXE 3DXPA 2XH5A 3W8QA 3KK8A 4IX6A 5DR6A 2R3IA 3UG2A 5K5NA 3L9PA 4JBPA 4CT2A 3EKKA 1WVXA 4YJSA 4ZJIA 4OR5A 2FUMA 4JDJA 2ZB0A 3ZC6A 3ZUTA 4YJOA 5KUPA 3B2WA 4ITHA 3L9NA 1XH5A 2XNEA 4NIFA 4RMZA 3RPOA 2PVHA 3PSCA 5JZNA 3WBLA 3GCVA 1L3RE 3GI3A 1ATPE 4EBVA 2X39A 3NWWA 4QT1A 2QLUA 4FV4A 4BI1A 4FV9A 4I6QA 3E8EA 4YNOA 3NR9A 2UV2A 4M69A 3SA0A 1JKSA 4QNAA 3H0YA 4KS8A 5ETAA 4IANA 2V7AA 4R6VA 2PK9A 3QCQA 2PZ5A 3D94A 3QCYA 3NUNA 4CZTA 5AR5A 1STCE 3KRJA 3QC4A 1IA8A 3F5GA 1KOBA 4FMQA 3A61A 1R3CA 3NUXA 4ONAA 2Y0AA 4YHTA 2QOIA 3ZOSA 4E1ZA 3D5XA 4XOZA 4LI5A 4GKIA 1UNLA 2XIYA 3Q2JA 3VQUA 5E8TA 1PMVA 3ZM4A 3DQWA 1SVHA 3KVWA 4M0ZA 4RWJA 5TE0A 4DYMA 1OIRA 3OMVA 4KNBA 4FIJA 4DH3A 5JN2A 1PXMA 5H8GA 2HYYA 1PJKA 4DG0E 4LRJA 4EH2A 4LL0A 4DEBA 3ZUUA 4N6ZA 4YMJA 5EK7A 5DR9A 5E8WA 1UVRA 5L6WL 2YLEA 3NPCA 2GNJA 4FKPA 1HCLA 3UZRA 4K18A 3ZUVA 4K9YA 4XNEA 5GZAA 3ZONA 4CTBA 5FEEA 2ERZE 3TCPA 2QOQA 2XJ1A 4D2RA 4RC2A 4IB3A 1YHWA 4BZOA 2XNGA 4F1TA 1H25A 2IO6A 2R64A 3CPCA 3O2MA 4OT5A 3UMXA 4NYEA 5DYJA 3G6GA 2B53A 5AA9A 4DLJA 2Q83A 4IM0A 5IUGA 1JLUE 4LGDA 2XK6A 4NM3A 2YISA 4WKQA 3BZ3A 2Y6MA 4N4SA 3OTUA 1P4FA 4MK0A 5AWMA 4EHZA 3FDNA 5F1ZA 4IVAA 4J71A 2CJMA 4Y95A 5TF9A 4DFNA 4F9CA 4AN2A 1WBVA 2UZLA 3ZTXA 4A9TA 3PE2A 4OT6A 4QQCA 1U59A 4IWPA 4ZLYA 4C0TA 4D1XA 2Z60A 4XV9A 4IC8A 4Y46A 4ZMEA 2JDSA 2V7OA 2QNJA 2PMLX 3CP9A 2WAJA 4BBMA 2Q0BA 4KS7A 3OF0A 4AZTA 2R3HA 5FM3A 4EZ5A 1F5QA 5HU3A 4CFUA 2W9ZB 4ZEGA 1TKIA 4RFZA 4YGAA 3UBDA 3PSBA 2WMUA 5EKOA 3F66A 4ZZNA 4YC3A 2ITNA 4I41A 2R0UA 3DY7A 3VVHA 5KE0A 2GMXA 5DRBA 4MH7A 4UYNA 4YJUA 3VIDA 3TIZA 1Y91A 4FTJA 2FYSA 2J6MA 3PPZA 3VBXA 4C4GA 4DF3A 1H26A 1SM2A 4CV8A 3RI1A 3VRZA 4C4IA 4F09A 4Z7GA 4D1SA 4EOMA 2J0IA 5IH6A 4NZWB 1OZ1A 3DB8A 4FV5A 4O7RA 2ETRA 5TR6A 5HTBA 2UZTA 4RIWB 2W1IA 2WMSA 5HE1A 3SG8A 2BRGA 3EN6A 5FEQA 3ZSGA 5D1JA 5AP5A 2W1DA 4OTIA 4I1ZA 4QRCA 2VNWA 2C6DA 2X2LA 5CS6A 5CVFA 5DHJA 2BIKB 4K11A 4PDYA 4Y85A 3RHKA 3AMYA 3GNIB 5IQDA 5AV2A 4O91A 4S2ZA 3WIGA 4AN3A 2F2UA 2XYNA 4ZZMA 4DHFA 4EH5A 3ZM9A 3ACJA 3AT3A 1Q61A 2PZYA 4PRJA 3E3BX 4PPAA 4FTQA 4YO6A 4J8NA 3QKLA 3U6IA 3W2RA 5AUYA 4LL5A 3BWFA 4BZNA 1Z57A 5IG1A 2PSQA 4AA0A 3CSVA 1E1VA 4J97A 4PTCA 3S3IA 5KX8A 3UP7A 4I5CA 5CAPA 3O51A 4AE9A 4CRLA 4I21A 4FNWA 5LCKA 4FTLA 4DEIA 4FK6A 4FGBA 4RWLA 3KY2A 1QMZA 1BMKA 4YTIA 5M06A 1DAWA 3QXPA 4RA4A 2G9XA 4IVBA 3SRVB 1MRYA 3F7WA 2HW6A 4L01A 5AR8A 2UW4A 3CGOA 4NU1A 4YTHA 2JKKA 4RJ8A 2PMIA 3FJQE 4RX8A 4S31A 5DWRA 2XMYA 4RWKA 4S30A 3HDMA 3HMIA 3OROA 2QONA 4QP9A 2WQNA 5CZIA 4CCUA 3D9VA 4JR3A 4A9YA 1MQ4A 4PTEA 2X2KA 2NP8A 2PUIA 3PPKA 3R73A 1KOAA 4LOOA 3F61A 4OUCA 4CCBA 3PA4A 2C5OA 2DYLA 4ZJJA 4DGMA 5LXMA 3TXOA 5FQDC 2GQSA 2WTVA 4D4RA 1CTPE 3C13A 3HLLA 3LW0A 3OCTA 3SXRA 5E8XA 4BWKA 2ZM4A 1Q3WA 3LFEA 1M14A 4PDSA 1SNUA 3W1FA 3K2LA 3SXSA 4E4LA 2CKPA 5IZFA 3MB6A 5JK3A 4TXCA 3NMUF 4G3GA 1PF8A 2CPKE 1UWJA 2VV9A 2F49A 1W84A 2BALA 2HAKA 2OZAA 4D1ZA 4O0UA 3ZBFA 4NM7A 3FZOA 3A7JA 3DB6A 3OCSA 3OXIA 3FEGA 5IMEA 5DIAA 4E6DA 4AW5A 4YJTA 3VWAA 5FG8A 5GJFA 4U3ZA 3TZ7A 4ZTRA 2JFMA 4ZOGA 3GGFA 1BI8A 1K3AA 3BHVA 4EOKA 3TNHA 5AV0A 3CY2A 4IMYA 2BZIB 5LOHA 4IE9A 3EOCA 4KIQA 4DAWA 4X3JA 3E63A 5FBNC 3TNWA 3Q9XA 4O6LA 4YZDA 3HRBA 3LFSA 1UKIA 5HD7A 2H9VA 4UMPA 3M11A 5JRQA 2H96A 3GCSA 3U9CA 3BHYA 4H3BA 4TYGA 3ORXA 3ORMA 3BHHA 1H1SA 3TJCA 2EXCX 2VTPA 1IAJA 4ZTMA 4R5SA 3W55A 3UE4A 3FHRA 2B55A 3FYJX 4I24A 5JH6A 3FHIA 3QUEA 3BELA 1O6LA 2AYPA 2QOOA 3KC3A 5J5TA 4Z3VA 2XBJA 2B52A 3I6UA 5G1XA 3L1SA 4AOTA 5L6OA 2FSLX 1CM8A 3PJ8A 2B54A 2X8IA 4UV0A 1PRYA 4YLJA 5A46A 3TUBA 4G6NA 4EUUA 3CTHA 5C01A 4YHJA 3D7ZA 1W8CA 4L00A 4O0TA 3CJFA 4WNKA 2PY3A 4CYJA 3FUPA 2F7XE 4GJ2A 4OTRA 3UTOA 1K2PA 2E2BA 2P33A 2XNBA 4RJ4A 5HO8A 3ZO2A 3C0HA 5FM2A 3NYVA 3RKBA 3UJGA 4U43A 4TRLA 3AOXA 5CF4A 2B9JA 4RG0A 1GZOA 4I6HA 4IAFA 5FRIA 3NUAA 3HKOA 2YM8A 1YI4A 4AGDA 4FGRA 4RVMA 4J1RA 3F3WA 1M17A 3KMMA 4NTSA 4PMSA 3MFUA 1PXJA 3MA6A 2C4GA 3HV7A 2ETKA 4BTMA 3BQCA 2OJ9A 3KEXA 2EXEA 2W1CA 2P2IA 3KRLA 3P7CA 2WMAA 3KXXA 2GS6A 1YRPA 4XP2A 5I3RA 2WTWA 5ETCA 3DXQA 2VN9A 3A8WA 4U45A 3NW6A 4FSRA 2IZSA 2YCSA 1SVEA 5TKDA 3PXYA 4EOPA 2WTKC 4FV6A 1A48A 2VTHA 2UVZA 2E9VA 4AOIA 4I4FA 4RFMA 2ZV7A 2CGVA 3I0QA 5E9EA 4NKAA 3PRFA 4I0SA 2IPXA 4OAUC 1W83A 2J90A 2CGUA 4JI9A 3LMHA 2QKWB 1OUKA 3KMWA 4IEBA 3VN9A 5IA1A 3VS5A 3FBVA 5HVJA 3RALA 4FT0A 1PMUA 4X0MA 1VR2A 1XO2B 4AACA 3MVMA 2X9FA 3U54A 1KE7A 2RF9A 2C3LA 2OXXA 4LUDA 4CMOA 3H0ZA 2BILB 3KF7A 4BDEA 3F5XA 4FSZA 5EG3A 5ANJA 4FKSA 4U97A 3L8PA 4OTGA 5L8LA 4DBNA 3IDBA 4BCGA 1TQMA 4NJ3A 3CE3A 3E87A 4AZWA 4D4VA 3ZEWA 2ZOQA 3LPBA 3FPQA 3C51A 3RGFA 3M1SA 2WQEA 2XM8A 4JR7A 5IEYA 1W7HA 3JY9A 3SW7A 3HP2A 4QYGA 4FYOA 2R4BA 4AWIA 3P5KA 3A7HA 3E5AA 3NAYA 4C02A 4PL4A 3THBA 4BDDA 5IMXA 4L53A 2ZMDA 3MESA 1FMOE 2WNTA 3UP2A 3E93A 3W33A 4C36A 1JNKA 4FKVA 4IAZA 5L2QA 2XKCA 4BGQA 3PLAE 4X3FB 4O84A 4KABA 2G1TA 3SGCA 2ACXA 3SAYA 3FMEA 4BFMA 2WOTA 4H3QA 3ANQA 3QTSA 1M52A 4I0TA 3FZ1A 3FSKA 3FZTA 3QTWA 4MBIA 4O0WA 4PDOA 5J95A 5K3YA 3TN8A 3E8NA 3UVRA 3C5UA 4O6EA 5DGZA 4Z7HA 1ZZLA 2GS7A 4IJ9A 4IB5A 1JKTA 3HMPA 5HE0A 2BTSA 4EYJA 3MB7A 4KINA 4L3LA 4PP9A 3C4XA 4IDTA 5CI7A 4BTKA 4BIDA 1YOLA 3E8CA 4YZMA 4C35A 5AUUA 2PPQA 3QTIA 3UG1A 5EQEA 1URCA 2WGJA 3OVVA 4FT7A 4QP6A 3UC4A 4M8TA 2QD9A 4XS2A 5DT0A 4CEGA 4ZP5A 3TNPC 4S33A 2FSMX 4FVRA 2XJ2A 5DA3A 4GJ3A 5KHXA 2O5KA 2OKRA 3PY1A 4GG7A 5GJGA 2JGZA 3E88A 1PHKA 3QFVA 5EI8A 4C38A 4MXYA 3ZXZA 3VUDA 3PYYA 1OL7A 4TW9A 3BYSA 5HBEA 1FINA 2A1AB 2VTNA 3BIZA 4BYIA 1Z5MA 5BUEA 2JBOA 2QLQA 2UVXA 4X2FA 3I60A 3VULA 3D2IA 4J7BA 4APPA 2VTJA 2WIPA 4IAYA 4WHZA 1H1PA 5FWKK 2IW8A 3PTGA 4WT6A 3V8WA 5J1VA 4K77A 4ERKA 3NGAA 3UDBA 2H6DA 3UOJA 3Q32A 4I6FA 2X6EA 5EDPA 5AP1A 4EQMA 5B7VA 2VUWA 3WF9A 3VS7A 1FPUA 4L52A 2XIZA 3GU5A 3HP5A 4AZSA 1KE9A 3II5A 2B9IA 4R77A 2PMOX 1Q5KA 4UWCA 4FTOA 4AGCA 3FKLA 3AC5A 4JRNA 4I23A 5B2KA 2KULA 4MCVA 3KREA 4J95A 4GMYA 5HI2A 3TZ8A 3ATTA 3H3CA 5K9IA 3QXOA 3U8WA 2EVAA 3TZ9A 1TQPA 3VUIA 4FOBA 2YM6A 4F7NA 1KV2A 4AN9A 5AR7A 4TL0A 3CPBA 4H36A 4XYFA 4E4MA 3ORZA 2NNWB 4C59A 4YJQA 4C58A 2GNGA 4DFBA 5AX3A 3MPMA 2CKQA 2HZ4A 3DLSA 4FV3A 5FDPA 1T46A 4LUEA 3QCSA 2WPAA 1WBNA 2FVDA 3U87A 3QUDA 5A3XA 2OFUA 3EZVA 2O8YA 3KU2A 5ACKA 1EH4A 3O8PA 1OPJA 3OFMA 3W2SA 5LMAA 1NXKA 4MD7E 3BWJA 1XWSA 3NNVA 5CU0A 5K0XA 1ZYCA 2C1AA 4P90A 4BTFA 2HZNA 4YPDA 2O0UA 4EZ7A 4JAIA 4PX6A 3R0TA 5AAGA 4BF2A 4FK3A 3HMOA 3A7GA 4E3CA 3QQKA 4OTHA 2W4OA 2IWIA 3EQRA 3V5LA 4D0WA 2QHMA 2WMQA 3QD0A 5CEKA 1YXTA 3VO3A 4DEHA 3MH3A 4GIHA 5KKRC 3KXMA 4FG9A 4U40A 5HU9A 2Z7LA 5CENA 5L6PA 3DFCB 5AUXA 5JMSA 4IWQA 2QOLA 4MQ1A 2BFXA 2YN8A 3S2PA 5J79A 2UW5A 2GTNA 4G3EA 3RAWA 4OBOA 1ZY5A 5JSMA 1OUYA 4NM0A 4V04A 4DG3E 1JVPP 2IVTA 2BFYA 5DI1A 1URWA 5HZNA 3CQEA 4V0GB 3R1YA 5EHYA 4YJVA 3ZRKA 4AF3A 4DH1A 4KUJA 3F82A 2WU6A 3RNIA 1Q41A 2QC6A 3OBGA 1H1WA 4RX9A 4GRBA 5EW3A 4B99A 2W0JA 3QTRA 4O2PA 2EB3A 3VUMA 2A19B 3QGWA 2PZRA 4U3YA 5H8BA 3VBTA 4CKIA 5IUHA 5J5SA 4ACCA 5CVGA 4PNIA 3R8LA 2ZV8A 2VGPA 4Z16A 1YDSE 1P2AA 3V8TA 5LQFA 4FTRA 1GAGA 2BPMA 4AFJA 4K33A 4FT9A 3V5PA 1V1KA 1KSWA 3I7BA 3PXZA 4M84A 4I5MA 4IB1A 4BCNA 2A2AA 1FGIA 1ZAOA 3CGFA 2ZJWA 5AUZA 2WB8A 4O27B 5C03A 4QYEA 3NIEA 3JR1A 1MUOA 4AQCA 2EXMA 4Q9ZA 4X2NA 4RIXA 3FQSA 4FV1A 4QMPA 4YNEA 5DBXA 4WD5A 2VRXA 1Y57A 4G6LA 3TWJA 5JRSA 4BVUA 3RMFA 3HV4A 3DK3A 3NVMB 4BKJA 2QKRA 3RPVA 1Z9XA 3JVRA 4IW0A 3BGQA 3RWPA 1FQ1B 1ZWSA 5LJJA 3UZTA 4W4WA 4QMMA 3JVSA 2WEVA 1G8SA 3EFJA 4E8AA 1BL6A 3ALNA 3MWUA 3OXTA 3WYXA 2Y4PA 4EJNA 2WXVA 2XA4A 5BX0A 1KUTA 1ZARA 4C34A 2XYUA 5L4QA 5CSVA 4CD0A 4MX9A 1OL2A 2J50A 4FIHA 2I7QA 1OL6A 2CN5A 2ZM3A 4O1PA 5KMMA 4CYIA 4FEVA 2X8EA 2R3PA 4USFA 4D5HA 3EJ1A 3TACA 2R0IA 3VBVA 5IA4A 4LRKA 1RQQA 4BCOA 2PUPA 4ANNA 2OI4X 4C8BA 4OAVB 3RM6A 4XV1A 5E8SA 1Q24A 5EM8A 2Z2WA 4S32A 3AXWA 2OIBA 4GK2A 1E1XA 2VX3A 4XUFA 4UX9A 5EQPA 3ROYA 4EK4A 2OFVA 4ACDA 1GZNA 4QP8A 2QOBA 4O82A 2VGOA 3KB7A 5HLNA 1UA2A 3WI6A 3F6XA 1GIIA 2AC5A 3B2TA 2C0OA 4O0VA 3COIA 5AV3A 3CC6A 5L8KA 2C6LA 4IIRA 5CSPA 5HNBA 5ANKA 2ETMA 4M13A 3TL8A 5EQYA 1ZRZA 4AGWA 4O0YA 3ANRA 5IA2A 1YHVA 3NNXA 4FA2A 4S34A 1PKDA 2JAVA 4JRVA 3W2CA 2XKEA 3LQ5A 2W4JA 2QOFA 1UWHA 3ATSA 2FSOX 2R2PA 3BLHA 3JY0A 4V01A 2A0CX 5KMLA 3T3UA 3F5UA 1P14A 4EWQA 1H1RA 1J91A 1UU3A 3DK7A 3LLAA 4O7TA 2W7XA 1V0OA 4IZ7A 1ZOEA 5C9CA 5KZIA 3A4PA 3S1HA 4TYIA 3LXKA 3SDJA 4ACMA 3A62A 4O81A 3TKUA 4R8QA 4B8MA 5M08A 3FLZA 1GNGA 3BBTB 4MYGA 5FGKA 3LXPA 3R28A 4L46A 3RNYA 4DEEA 4EBWA 1R0EA 3KN5A 1XR1A 3TKIA 3KULA 4O7VA 3NIZA 3G2FA 4KBKA 2Y8OA 4FE2A 4DFYA 5I5ZA 5HO7A 2G2HA 4Z9LA 5KMOA 2YCRA 3QRJA 1JBPE 4N0SA 4JOAA 4JL9A 3BI6A 2VTTA 3BV2A 2DWBA 3F3TA 3WZKA 4O0XA 3PA5A 1JAMA 4MEDA 4F0FA 4TNBA 2YM4A 3PPJA 1YOJA 3ZZWA 3LFFA 4BCQA 2G15A 5B0XA 4EOIA 5IQCA 4FTUA 1H0VA 5I9ZA 3DDQA 2R7IA 2VTAA 1DI9A 2WMWA 3BYMA 2W1HA 4M7IA 1REJA 3EWHA 2PE0A 3F3ZA 3IECA 4R1VA 3WZEA 4JS8A 2REIA 3EL7A 3UODA 4CQGA 4GV1A 5M07A 4QTEA 4UALA 4YJPA 3GU6A 5E8ZA 3BRBA 4JNWA 4EZ3A 3HAVA 3N9XA 4K6ZA 4QTDA 4IJPA 4UY9A 4ZY6A 5JFVA 3NYOA 2RG5A 3QQFA 3P79A 4G17A 4LMNA 5M55A 4RGJA 4O86A 4RIYA 2XZSA 3SG9A 4NIFB 3MBLA 2VWVA 3PRIA 4TWCA 3VUHA 4BWPA 5JFSA 3UNJA 1ZYLA 2CLQA 2CSNA 2RSVA 4L45A 2RIOA 4M0YA 2ZMCA 3TT0A 1ZMVA 3R1NA 2UW8A 3VBYA 4EH3A 3FI2A 2XNOA 3SW4A 2C47A 4CLJA 4RFYA 4ORKA 4FUYA 3QHRA 4M69B 4Y5HA 5E8UA 4ARKA 4D2SA 4XV2A 3NUPA 2VWWA 2PWLA 5CT7A 4C7TA 2XNMA 3DJ5A 2CHLA 3DBCA 5ANEA 2PVMA 3BGPA 3OS3A 2QCSA 1P4OA 1XKKA 4ALVA 3UO4A 3SOAA 4NFMA 1MRUA 2BMCA 3IOPA 3QTQA 4R3RA 4DCEA 1PKGA 5M4UA 2OK1A 3HAMA 5A6NA 2IZRA 4BR3A 4KB8A 2VTMA 3KA0A 4XG7A 5FDXA 4ANQA 4F9AA 1GIJA 3D5UA 3F2NA 3A2CA 5L8JA 5I0BA 4FV2A 3LQ8A 2C6MA 5HD4A 4XLVA 4FF8A 3U6JA 3ZLXA 3FKNA 3RINA 2YCFA 2ITOA 4RSSA 4F1MA 2NRUA 4BB4A 4EJ7A 4XMOA 3SV0A 2UZDA 1H01A 4FKWA 2HXLA 3Q6UA 4JT3A 4ZK5A 3FXZA 5K5XA 5M4FA 4FVPA 4U8ZA 3BYUA 3HUBA 2Y6OA 2VX0A 4LMUA 3VF9A 3W2PA 3ZBXA 5HTIA 3QWJA 4DT9A 4J99A 4M15A 3DZOA 3IS5A 5HNIX 5LWNA 3DGKA 3MPTA 3PXFA 4NWMA 3DOGA 3EHAA 4FZFB 3W18A 4TTHB 2YM7A 4ANOA 5HLPA 3PZEA 3FMJA 5CVHA 3AC8A 5EYKA 2YAKA 5JEBA 4XBRA 5I9WA 3QX2A 3DKFA 3FMDA 4FSYA 4CVAA 2R5TA 5J9YA 4JBQA 3L9MA 2ZAZA 4JAJA 3LQ3A 2NPQA 4FSTA 2CCIA 3C9WA 4NEUA 3NUUA 4O0SA 1NW1A 2EWAA 3OOGA 1CDKA 1OI9A 3QA0A 2H34A 3EQIA 4H58A 4JBOA 3WZDA 2EUFB 3FI4A 5EYDA 2IJMA 1WVWA 5E8VA 4AXAA 3WYYA 3PA3A 3D7TA 3Q6WA 3NLBA 2B0QA 4FYNA 5HIEA 1G3NA 3DAJA 4AOJA 3OC1A 2OXDA 2BAQA 4WG5A 4ZTQA 4D55A 4YZ9A 2W96B 4O2ZA 3UIXA 4B8LA 4QTBA 2HWPA 1GZ8A 3RP9A 3MGYA 4HGSA 4TT7A 3HEGA 5F94A 5C27A 4KBAA 4A7CA 2F9GA 4U42A 4GUEA 2C6EA 3QRIA 4J8MA 3RZBA 2P55A 4MNEA 5JQ8A 3LCSA 1YOMA 2OGVA 1U5QA 1BUHA 1ZMWA 1DI8A 2GTMA 3B8QA 2WMVA 1OL5A 4IACA 2B9HA 1RDQE 4HZSA 1SNXA 4KAOA 3SXFA 3P78A 3ZXTA 4EOOA 4P5ZA 1UNGA 2ERKA 3HA8A 5FXRA 3EQHA 3DDPA 1J7UA 4RWIA 1FGKA 2C3KA 4UWYA 3ZDIA 1X8BA 4OTFA 4AE6A 4ASDA 4EK5A 1UU8A 4U44A 3V5QA 4ALUA 3MH2A 1YQJA 3LCKA 4JDHA 2OIQA 5AADA 4H39A 3KCFA 4CMUA 4FTTA 4IAKA 3IG7A 2YIRA 4LOQA 3TEIA 2PUNA 3QD3A 4UEUA 2QHNA 5T68A 3BGZA 4I6BA 3R9RA 3GT8A 3CJGA 3Q4TA 4W9WA 3R7VA 2O64A 1Y8GA 1W82A 5HX8A 4PNKA 3OW4A 2NRYA 3PVGA 4FSWA 4YUQA 4E73A 4FICA 4HGLA 3MS9A 4K1BA 4YTCA 5BNJA 1OKYA 2FA2A 3OY1A 2PHKA 3D0EA 3BKBA 5CTPA 3ACKA 4XCUA 4A4OA 3CKWA 4HYHA 5IQFA 5DN3A 2FSTX 3SOCA 4AZVA 5CY3A 2GQRA 1ZMUA 2W5HA 4M14A 4XRJA 3PDTA 5IQHA 3FV8A 1WVYA 3GC9A 4J96A 3DPKA 2HY81 4BHNA 5CALA 5L2WA 4E5AX 4MKCA 5KMNA 2AUHA 2C5YA 5CU3A 4PL3A 4QMVA 1Q8ZA 5JFXA 5CU2A 1F0QA 4CFWA 4X2KA 3EIDA 4FT3A 3HNGA 3LIJA 2C3JA 4FSQA 2VTQA 1LP4A 3V5TA 4AA4A 5DEWA 4EHVA 2E9OA 2UZVA 1OBDA 5DEYA 3DU8A 3CBLA 4U79A 2ZM1A 3RVGA 5EM5A 4E5WA 3AC3A 4D4YA 3QZFA 1Q8WA 5I9UA 4L7SA 3ODZX 3OEZA 4QMNA 4MXAA 3NX8A 2VTOA 4TYJA 4G34A 2JC6A 1MRVA 4FI1A 2OZAB 5C4LA 2XF0A 1XH7A 1ZOHA 3BLRA 3COHA 4WA9A 4N70A 1JPAA 4TWPA 2WQMA 2IVUA 3W32A 4RZVA 4NSTA 5LMBA 2PULA 3LCDA 4L42A 4HYIA 3CEKA 1Q8YA 4O1OA 3AC4A 3ZYAA 4HPUE 4ZSLA 1OITA 3ALOA 3R04A 5HIBA 3AC1A 1T45A 2BDJA 4FVQA 4I94A 1H8FA 3IOKA 4WRGA 2LAVA 2XBAA 2VWUA 1WBTA 4RX5A 4BDFA 3S0OA 4MXZA 3OUNB 4RVTA 4Y5QA 3AMBA 3R71A 2PVKA 1PYXA 3AGMA 4W4YA 3SKCA 2BKKA 3C5IA 1U46A 1OPLA 4RRVA 5HLWA 3PLSA 4ZTLA 4YO4A 1TQIA 1XBAA 2B4SB 4XG6A 2HK5A 2VX1A 4FKGA 4L9IA 2B7AA 5I9XA 4GFGA 2I0EA 4TN6A 3O17A 3UNZA 5AIKA 1QL6A 4W4VA 5L2TA 4MWIA 3HV5A 4UZDA 2GNFA 3FYKX 3CR0A 3ZSIA 2H8HA 5CF8A 3LHJA 4Y73A 4EH4A 3OT3A 5AP4A 1Q99A 2I0VA 4C33A 2UZOA 4E20A 4F9YA 3KQ7A 4GG5A 4QD6A 3POOA 4TNDA 4G2FA 3VAPA 2WU7A 1WMKA 2BUJA 3C7QA 4U0IA 3WE4A 3T9IA 1S9JA 4D9TA 4R1YA 4BRXA 3FL5A 4FBXA 3LXLA 2UW0A 5AAEA 5IDNA 3BCEA 2P0CA 4PY1A 4FC0A 2R3JA 4USDA 2BDWA 3ZLWA 3ZO1A 4C4FA 4DE4A 4PP7A 4YTFA 4PF4A 4MHAA 3RK7A 4AAAA 4CZYB 4BGGA 2GHLA 3VUTA 2YJRA 4FNXA 1OKVA 1J3HA 3QZHA 4TKSA 5M4IA 2QG5A 5M4CA 2I0YA 4FL1A 4G3FA 2BRNA 5IEXA 4KIKA 4IVCA 3EN5A 2PVNA 3UO6A 5DE2A 3SHEA 3QALE 1PXPA 4FKUA 3FY0A 3MW1A 1ZYDA 4HYSA 4DH7A 4FEWA 3V6SA 3TDWA 2J7TA 5DMZA 5FUTA 2WMRA 3DTCA 4IDVA 2UZEA 3IW4A 4HOKA 1M2RA 4LGGA 3NVKI 4MXXA 3JXWA 5FP5A 5M57A 4OTDA 5F95A 2RFEA 3NW5A 3SLSA 1B39A 3DJ7A 3DS6A 3Q2MA 5AUTA 3KMUA 4Q9SA 4FTMA 3W2QA 2HIWA 3UIUA 2J0JA 2WTIA 5J7HA 4PMTA 3PVBA 1E9HA 3CTJA 3G9NA 4FOCA 2X8DA 3D5WA 4JXFA 4X3FC 1LEZA 3IONA 4NM5A 3I5NA 2XS0A 4AUAA 5AM6A 3OUKA 2CN8A 1ZYSA 3LFCA 4O96A 4AW2A 2XP2A 4BDJA 1VYZA 3PJCA 4RJ7A 4WG3A 5EM6A 5AR2A 4EH6A 5DRDA 3DBEA 1IA9A 3QWKA 4BDHA 4BCKA 4QMQA 4EKKA 2ZV2A 3MVJA 4G9CA 4AA5A 3BU6A 3ULIA 4C2VA 3O23A 3Q9ZA 5AR4A 1U5RA 2XIRA 4OW8A 3R1QA 2BROA 1PY5A 3K3JA 4YC8A 2VNYA 4BCMA 4GH2A 4JG6A 2X81A 3MV5A 3UIBA 4BKZA 5JKGA 5GIPE 3Q96A 3O50A 3GCPA 4I5HA 4IAIA 1IR3A 3O0GA 2GU8A 4DH5A 1OIQA 5M44A 3G51A 3ID6C 1VYWA 2YITA 4GIIA 4MTAA 4LYNA 3R9OA 3VJNA 4LV8A 3UQGA 4EOJA 2BZKB 3T9TA 4NL0A 1APME 2XCKA 3ZS5A 4CRSA 5HBHA 1H07A 4CMTA 4FSMA 2OJGA 4UMQA 2C1BA 3TTIA 4EC9A 4F0GA 4EONA 1CKPA 4NFNA 3E7VA 3OG7A 3E8DA 2C3IB 1YXXA 3TIYA 3W16A 2I0HA 3JS2A 3CS9A 3GCQA 4F6SA 2PU8A 2X9EA 4WNOA 4RZWA 2VU3A 3K5UA 3UQCA 5IQIA 3QLGA 2WTKB 1XH6A 1U54A 1ZY4A 3VHKA 3F69A 5CAQA 2WKMA 4BBFA 2NO3A 3QQLA 4RX7A 5HO6A 2JDOA 3LFDA 3OBJA 4J53A 4CKJA 4JQEA 3MTFA 2ONLC 2QO9A 2CGXA 4WUAA 5ETFA 3ORPA 4YPSA 5EW8A 2E9NA 3OTVA 5AIRA 2B9FA 4WBBB 4X3FA 2ITXA 4DGLC 2VAGA 4R3CA 5L2SA 3R83A 1LR4A 3E92A 5IKWA 4FEUA 2YDIA 3R02A 4HVIA 4BKYA 3FZPA 4ZLOA 2XIKA 3PY3A 5I4NA 4AS0A 4W4XA 4IXPA 3ORTA 4WO5A 2R3GA 4QTAA 3MIAA 5JQ5A 3REPA 3KCKA 2IVSA 4G1WA 1Q4LA 4RVKA 1QPCA 2QODA 2YCQA 3W8LA 1OMWA 2BRBA 1HOWA 3VS1A 3V8SA 4DFZE 3C0IA 2VWXA 3BV3A 3UOHA 1H0WA 4F0IA 2OJJA 5EDQA 2GS2A 3G15A 2C5XA 4BIBA 3V5WA 3PG3A 1JSUA 3IW5A 3ROCA 4BBEA 4BDGA 4EK6A 3UMWA 1WCCA 4HPTE 3IK3A 3PWYA 3FSFA 3HMNA 3KFAA 2C6KA 1OKZA 3MI9A 4YBKA 3T8OA 5HTCA 4YZCA 5CX9A 5CAVA 4KRCA 1YWVA 4F65A 2YERA 3F2AA 2OH0E 5DLSA 2IW9A 5JZJA 4E5BA 4IWOA 3KXHA 4GS6A 3FMNA 1VEBA 4MBJA 2OJFE 3FLWA 4Q5EA 4NTTA 4FKTA 3C4EA 2EB2A 4CV9A 4D5KA 3Q60A 2JIUA 4XG3A 4DITA 2J51A 3KKVA 3OWPA 1KV1A 2J5FA 3P9JA 4FSNA 4KKHA 2ONLA 4BIEA 4QP4A 3PSDA 4L8MA 4FZAB 4L44A 2WHBA 3I4BA 1W98A 5BVKA 4BDIA 3UQFA 5FP6A 3DQXA 4L7FA 4AGUA 1GIHA 4IM2A 5HESA 1H4LA 5AMNA 2PZPA 5I9VA 3G33A 4QO9A 3PVWA 3DA6A 5KCVA 2R3KA 2Z02A 5BVDA 3C4ZA 3NNWA 2DQ7X 3R00A 3RWQA 3PP0A 4USEA 3G5DA 1CKIA 1CSNA 3L8VA 3VBQA 4JDIA 4OBQA 2JAMA 4GT3A 2CCHA 2Q0NA 5BPYA 1SMHA 2X7FA 5ETIA 2BAKA 5CNOA 3COMA 4DLIA 4F63A 1KE5A 2GHGA 3IO7A 3I0OA 3S95A 4ACHA 5CWZA 4U80A 1LUFA 4W8EA 4CGAA 4JIAA 4JG8A 5IEVA 1WFCA 2P4IA 3JPVA 4ANMA 3LKMA 4FV0A 2PVRA 3EQGA 4RIOA 4EH7A 4DINA 3DCVA 3HDNA 1FOTA 3H9RA 1B6CB 3IGOA 4JQ7A 4QMLA 2UW6A 1V0PA 4ZS0A 2UZUE 3ET7A 2R3RA 1YXUA 5ACBC 3EN7A 4Y72A 5TOZA 1H24A 4C62A 1VZOA 2Z7RA 3GC0A 2YIYA 3LMIA 3AGLA 1Y6AA 3LXNA 4FL3A 3VRYA 2RFNA 4RJ3A 2GCDA 3H9OA 3FY2A 3ZO4A 5CAUA 3MY1A 5H2UA 3QA8A 4F9WA 4FNYA 5ICPA 4QOXA 2OO8X 4C3FA 3QRTA 2RL5A 3ORIA 4EOSA 5HX6A 2Y4IC 5T3QA 2CNQA 3BX5A 3NCZA 4GL9A 2JBPA 5H9BA 4MD9E 4IC7A 5FXSA 4RIXB 3ZRMA 2X2MA 5CI6A 3CKXA 5GINE 2BHEA 5BMMA 4IZ5A 3H4JA 4FR4A 3NSZA 3ZCLA 3HL7A 3LFNA 2C5VA 2W06A 4FKOA 4FZDB 5HCZA 3CXWA 3AG9A 4TWNA 5HE3A 4WSQA 4EUTA 3PXQA 3ORNA 3FXWA 3HYHA 5EW9A 3FXXA 1REKA 2J9MA 5KKRB 4QQTA 2W1FA 4FT5A 1FVTA 3KL8A 2QQ7A 1W0XC 5IDPA 2GFCA 4O7YA 3QQUA 3GU7A 4EHEA 5LMKC 2E9UA 4MNFA 3ORKA 3KF4A 5AUWA 4JX7A 4ZSGA 3TNIA 2OICA 2I40A 1ZOGA 4KKGA 3V01A 3R01A 4LRMA 2DS1A 3UIMA 3RAKA 1FBNA 3NYNA 1SZMA 1YKRA 1Q8UA 3RPSA 4KRDA 1U4DA 3KXNA 3VBWA 2ZDTA 2VTLA 4KA3A 3HUCA 4F70A 4IAAA 5E1EA 3I6WA 3BPRA 1QPEA 4PPBA 3SC1A 2HOGA 4YJNA 4G5PA 4NKSA 4A07A 4L43A 5IA3A 1WBSA 1R78A 2W1EA 5IQAA 3LMGA 3WILA 3QQGA 4UXQA 4TY1A 4WNMA 4HNIA 4JJRA 3NUSA 2QR8A 5LVOA 4CG8A 3MH1A 3HA6A 3IW7A 4TYHA 5DOSA 4YLKA 3UGCA 3MVLA 3LAUA 5GHVA 3QLFA 2VO6A 3Q4ZA 5DFPA 3AT4A 4FTCA 5HICA 4E4NA 1I09A 4HYUA 1Q62A 1YDTE 2JKMA 2JD5A 3O96A 4YU2A 3GP0A 4FG8A 4QP2A 4P2KA 3ZC5A 3QRKA 1FVRA 3QU0A 4IWDA 5HVYA 2GNLA 1AD5A 2WQBA 5KZ0A 3U4WA 3R8PA 4IZYA 2QOCA 2YABA 4HGEA 4B4LA 2GNIA 1DM2A 3DT1A 3WIKA 3C4WA 4XG4A 3PXRA 2XK8A 4AZEA 3GC7A 5C8KA 2ITVA 3F88A 3L9LA 4QMSA 4A9RA 4APCA 3CQUA 4QYHA 5HIDA 4BI0A 3PJ2A 5JGAA 1PW2A 1B38A 1GY3A 3DKGA 5CEMA 4DN5A 3K5VA 4FODA 4ID7A 4BTJA 2LGCA 4G9RA 5HOAA 4PUZA 3DBDA 1JSTA 1UU9A 4F4PA 3ZFYA 3F7ZA 3AD4A 3QZGA 4PDPA 2ITYA 2O3PA 3KULB 5ANOA 4IHPA 4K8AA 4NW5A 5JT2A 3UNKA 3A7FA 5LMKA 1XHAA 4OGRA 4AZFA 4F99A 4XH6A 5AAFA 4M68A 4E6AA 3DZQA 3HVCA 1JKKA 3IDCA 3VW8A 1A06A 4GW8A 1XBCA 4FIGA 3Q4UA 3UYTA 2X1NA 4DGOA 4ITJA 3R9DA 3HRCA 5FD2A 3EQPA 4UMRA 4I4EA 4FUXA 1KE8A 3TUCA 3UPXA 1Q3DA 4KKEA 1M7NA 1UU7A 3H9FA 3ITZA 4QQ5A 3TJDA 2AC3A 2J4ZA 4ENXA 2G01A 5E91A 1RW8A 4LGHA 4AW0A 3C4FA 4C4HA 5CSHA 4MBLA 3WZJA 4N6YA 1Q97A 4O7WA 1FVVA 4U41A 1OECA 3LFAA 4CFMA 2PE1A 1KE6A 2C68A 2JDRA 4RC3A 3TTJA 3R6XA 5FXQA 3OWKA 4A4XA 3EKNA 5AV4A 2ITTA 3NEWA 2X7OA 1OPKA 4M67A 4CFVA 4A9UA 2W1GA 4WG4A 4EORA 3PXKA 4RIYB 4HCUA 2WELA 4IQ6A 3GFWA 2QU6A 5EOBA 4FSUA 4IX4A 3VS3A 2IZTA 5CEOA 4FEQA 3K3IA 3MFRA 4R3PA 5C4KA 4YLLA 3I1AA 5CF6A 3G6HA 2A27A 1GJOA 2JDTA 4HZRA 4EH8A 1O6KA 2OLCA 5CEIA 3ZDUA 5HE2A 4QPAA 2C0IA 1V0BA 1JKLA 3EN4A 3R2BA 4QMYA 4CT1A 4F7SA 3ZO3A 5IA0A 1OIUA 4MD8E 5HG7A 3CQWA 5DVRA 4ZLZA 4ZSAA 5K4IA 2I1MA 3LM5A 4A4LA 4BCPA 4H3PA 2ZVAA 1IG1A 3MYGA 3A7IA 5HEZA 4AT5A 3ZRLA 4ITIA 4ZTHA 3P7AA 5KMKA 4IFGA 3FWQA 4FV7A 4B0GA 3E62A 1YW2A 2C0TA 4M66A 2C5NA 2ITUA 2ZYBA 2W9FB 3BU3A 4FIEA 4IVDA 3RK5A 2Z7QA 5BYYA 3MSSA 5EM7A 4XX9A 2PYWA 2X6DA 3FAAA 1R39A 3LCOA 4CG9A 5KMJA 2BZHB 3DFAA 4Q2AA 4X2JA 5DG5A 4QMOA 3UC3A 5IQBA 5IPJA 2IVVA 4UWBA 1QCFA 3UYSA 3RK9A 4NT4A 3QKKA 2E9PA 1YHSA 4P5QA 5A4CA 4GT5A 3A8XA 3D14A 4LG4A 3HGKA 4QP3A 4H05A 3V04A 4OLIA 4HJOA 4CQEA 4F1OA 5FTGA 3DKOA 4JG7A 2YHVA 3L8XA 4GK3A 5AM7A 5ANDA 3ZEPA 4BCFA 3AQVA 2PVFA 3D83A 2WMXA 4BYJA 2HENA 2XK3A 4A9SA 1YDRE 2OH4A 3TV4A 3S00A 4U81A 5E7RA 2ZB1A 3DAKA 3GEQA 3OWLA 4XEYA 4EEVA 3GVUA 4CTCA 3SD0A 5TO8A 3R8UA 4AW1A 3TI1A 5IH5A 4DTAA 3C0GA 3OWJA 1BL7A 3TKHA 3GCUA 3TZMA 3OZ6A 2XB7A 3ELJA 4QQJA 3N4TA 1M2PA 2ZV9A 1JOWB 2OU7A 3D7TB 2VO7A 4IX5A 2XNNA 4RC4A 4BDBA 4NUSA 3LZBA 3R7UA 4RJ5A 4G3DA 5BVWA 4EHGA 3DXNA 2UW9A 4WUNA 4OTWA 4HVGA 5E8YA 4ENYA 3IGGA 1OB3A 3E3PA 3P4KA 2CLXA 3QKMA 3KGAA 3ORLA 1ERKA 4XG2A 3VF8A 4D2VA 3EQBA 3HV6A 3PZHA 3UOKA 3ULZA 4MNEB 1LEWA 3FMMA 1OIYA 3MA3A 4LM5A 4FL2A 5HG5A 4FIFA 2GQGA 2X4ZA 3NYXA 2ITWA 4YR8A 5F9EA 2XIXA 2Y7JA 4O21A 4XHKB 3KVXA 2JFLA 4U9AA 4F6UA 5A4TA 2FB8A 3H10A 1RE8A 3WF7A 2DUVA 4W8DA 1H28A 4XRLA 2BHHA 1P5EA 2XVDA 2YDKA 1XQZA 5AP7A 2BKZA 2W4KA 2PVLA 4C3PA 4BWXA 3R63A 1GZKA 5DNRA 3Q4CA 4C4JA 4JVGA 2FO0A 4JX3A 3O71A 2XK7A 4ZTNA 3MFSA 5B2LA 3SQQA 2IZUA 1PXNA 3C50A 2XEYA 4MF0A 4TZRA 3V51A 5CSXA 3ZLYA 3OEFX 3O8UA 2YM5A 3R2YA 4C61A 3CLYA 5TT7A 4XOYA 2O65A 3NS9A 4L6QA 4PL5A 2XJ0A 5CEQA 4UN0C 2YIQA 4GU6A 4XP3A 5ITAA 2UZNA 3P08A 4DGGA 5IQEA 1HCKA 3DBQA 3CY3A 3GOPA 4FTNA 2ITZA 2V0DA 5EDRA 3VUKA 5C26A 4F64A 4IH8A 4A06A 4RIWA 2R9SA 3BQRA 3G0FA 2UZBA 2OSCA 3NRMA 3D5VA 4FZ7A 3QQJA 4RBLA 3VNTA 4BDAA 3LJ1A 1ZZ2A 1WBOA 2X7GA 4X21A 2JKOA 3R22A 2WFYA 1XBBA 2HZIA 3HX4A 2P2HA 4M12A 5HG8A 2J0KA 5A54A 5EYCA 2CKEA 3DLZA 4XJ0A 5EOLA 3FMKA 3BHTA 4WNPA 4E7WA 4KD1A 5M51A 3RPRA 3OHTA 5FTQA 3GC8A 1J7LA 1BYGA 2UZWE 2YAAA 3IDPA 4U7ZA 4DGNA 3EZRA 3V3VA 5JGBA 4EK8A 5CQUA 3VUGA 3OW3A 1FMKA 3MPAA 4E6CA 2VO3A 4IB0A 4BCJA 4F7JA 5CLPA 5K0KA 5DR2A 3QL8A 4KSQA 5A9UA 1OGUA 2A4LA 3QC9A 1YXVA 3D15A 4GVJA 2YIXA 4M3QA 4WRSA 5LARA 3QZIA 1PXKA 2BZJA 3R9NA 2YWPA 1H1QA 2BRMA 3SRVA 4EH9A 4BN1A 5KO1A 3LFBA 3DTWA 4GK4A 4PTGA 4DFLA 2HW7A 4IX3A 3U51A 4QMTA 1PXIA 1KWPA 2B1PA 2BDFA 2R3QA 3RJCA 2OWBA 4AU8A 4P4CA 3BE9A 4FX3A 4FZ6A 4IADA 2Y9QA 3LJ0A 2YM3A 5H8EA 2OF4A 2PVJA 3PE1A 2WIHA 5F4NA 4C2WA 5ANIA 2BTRA 4BHZA 3EL8A 3I81A 3R8VA 4HW7A 1F3MC 3ZFXA 2XK4A 1WBWA 4RJ6A 5LVLA 4X7QA 4AT4A 4XG9A 5HQ0A 2R3NA 1DAYA 2JIVA 4ZY4A 3CIKA 4MWHA 4IBMA 3UOLA 2IW6A 5EFQA 5AJQA 5GJDA 4F7LA 3ZZEA 5D41A 5HGIA 4CFNA 2XKDA 2UUEA 3QAME 4EOQA 4MQ2A 2JLDA 3KRXA 2OBJA 3JYAA 4FKJA 3DNEA 5C8NA 4QNYA 5GIOE 5KBRA 2UVYA 4YZNA 4R5YA 3VS6A 3F9NA 4HGTA 5J8IA 4D2WA 3G0EA 2PE2A 3PIXA 2KTYA 3P23A 2R3LA 3QX4A 4PMPA 1R1WA 3EB0A 4C4EA 4LQMA 4KIPA 4ZAUA 3OY3A 1J1BA 1OKWA 3TUDA
chains in the Genus database with same CATH superfamily
5AP3A 2XRWA 1J1CA 4OTQA 3BE2A 5HBJA 4R7HA 4HVSA 3MJ1A 2F2CB 3U9NA 3IW6A 5FEDA 3MJ2A 3RZFA 4FV8A 5EI2A 4D2TA 3LOKA 3O8TA 2QI8A 2YJSA 5I9YA 3PWDA 5LVMA 3NCGA 3A60A 4JLCA 2O2UA 3R7IA 2QOHA 5BUIA 4O22A 2SRCA 1VJYA 2F7EE 4ZSJA 5FTOA 3T3VA 5HORA 3QGYA 2BRHA 2XEZA 3PY0A 3WZUA 4KIKB 5LCJA 4OBPA 3I5ZA 3PVUA 2OJIA 3RTPA 4AX8A 4Z55A 5JFWA 4DTKA 4AAYA 1SVGA 2J2IB 3BBWA 2XNPA 4ANBA 5BVNA 3FQHA 4PMMA 2YLFA 1ND4A 3ERKA 3U6HA 3UPZA 1XMMA 4II5A 4GU9A 3QCXA 4TWOA 5J7BA 3GBZA 4QYFA 3W10A 5GZ8A 5IISA 3OT8A 4QYYA 5AFVA 3QYWA 4BJJB 3HZTA 3R7GA 3RPYA 2W99B 4O4FA 3K54A 3ZU7A 4QMWA 1BLXA 3ODYX 4R7IA 5E92A 5K4JA 4ZIMA 5CF5A 3ETAA 4ASEA 2YWVA 2GNHA 2VZ6A 5CANA 4QPMA 3GQLA 5DT3A 5KMIA 4G6OA 3D4QA 4EYMA 3QTUA 4Y8DA 5AP6A 2OG8A 4DEAA 3Q9WA 3NZ0A 2UW7A 4KWPA 5KBQA 4BCHA 3FL4A 3LLTA 3O7LD 3TV7A 4D28A 4EQUA 5M53A 1I44A 5HCYA 4NJDA 4CFXA 3HMMA 3LFQA 4FIIA 2CNVA 5IH4A 2YACA 4G16A 4F9BA 3PUPA 2BR1A 4B6LA 4I92A 1CKJA 3MH0A 5HKMA 2O63A 3ZSHA 4GFOA 4ANLA 2RFDA 3GOKA 4UMTA 3RCDA 2WTCA 5EYMA 3TG1A 4UYAA 5D7AA 1NVSA 3BLQA 4TYEA 3WF8A 4E93A 4E26A 4YP8A 3ZHPC 4PQNA 3QD4A 2YZLA 1L8TA 3Q53A 2BVAA 4YSMA 3RHXA 3WF6A 2F7ZE 4CKRA 2W17A 2OIDA 2ZFYA 4ZMFA 4P7EA 1NY3A 4ZTSA 5HVKA 3FI3A 5D12A 2GPHA 1O6YA 5BMSA 1U54B 2OF2A 3FMHA 3GQIA 2J0MB 2WMTA 3W2OA 1W2DA 4LFIA 4QPSA 3UO5A 4ASXA 3BYVA 1YWNA 3F5PA 2XAMA 4ZZOA 3EFKA 3G90X 3AC2A 3EFWA 3VS4A 1BKXA 2PZIA 2RGPA 3N51A 2XCHA 3DAEA 3QRUA 4KSPA 3DV3A 3HECA 3FQEA 3FC1X 4M97A 3VS2A 4YJRA 4YBJA 3R1SA 1A9UA 3BHUA 4HCVA 4FEXA 1O9UA 3R30A 5CNNA 4BI2A 4O83A 4L68A 3LE6A 4OTPA 5CXHA 5AEPA 3MY5A 5AP2A 2YDJA 4C37A 1S9IA 4YHFA 3DJ6A 1PXLA 2V62A 4F08A 2WTDA 2CKOA 3LVPA 4BICA 3PFQA 4G31A 4ZSEA 2ESMA 5FBOA 2QO7A 3R9HA 2F4JA 3OCBA 4D2PA 5AV1A 2ITQA 4BC6A 3QTZA 4QMXA 2VWIA 4QEBA 4UMUA 1XJDA 2QOKA 3Q52A 4UXLA 3P86A 2GHMA 3UVPA 4BDCA 3W0NA 2JDVA 4I93A 3KN6A 2PL0A 3OCGA 4RQVA 4CSVA 4ZY5A 5KNJA 2JKQA 3FLSA 2X4FA 2OXYA 4RPVA 3DKCA 2JEDA 3ENMA 3WF5A 3H30A 3EYHA 2EU9A 2VO0A 3GU8A 1ZXEA 2HZ0A 3TV6A 3HV3A 1WZYA 3C4CA 4H1JA 3EQCA 3V6RA 5E90A 2AQXA 1G8KA 3F3VA 4GYIA 4YZBA 3N4VA 5J9ZA 1PMNA 2VWZA 3MY0A 3ML1A 4DTBA 4FKQA 2F57A 5EHLA 3R21A 3FLYA 4L3PA 1R0PA 3VC4A 4LV5A 1WAKA 4DH8A 4Y83A 4XLIA 4ASZA 5G6VA 3IQ7A 3RBWA 5T6KA 4BCIA 1XMLA 4RVLA 4RLLA 2YZAA 4DFUA 3MFTA 4G5JA 1PXOA 4UBAA 4CNHA 5CZHA 4ALWA 1BI7A 3LCTA 3FLNC 4LDTA 3EFLA 4LV7A 4DBXA 4D9UA 4RA5A 3VS0A 2VTSA 2VTIA 4FRFA 4GUBA 5EH0A 3VQHA 4K2RA 1NVQA 3CTQA 4KIOA 2CMWA 4FKRA 1OVEA 4I20A 5IA5A 3EN9A 2WTJA 4DA5A 1UNHA 1IASA 2R7BA 2HWOA 1ZLTA 3UVQA 5A4EA 5LWMA 4NCTC 4DEGA 3GXLA 2G2FA 2QVSE 4GT4A 4HNFA 4K0YA 5BVFA 2WOUA 4RT7A 4BZDA 1MP8A 3GENA 3PIZA 3ZLSA 4C3RA 3S4QA 2OW3A 2I6LA 1Q8TA 4DC2A 1XH4A 5CQWA 2QR7A 3RAHA 3BYOA 3FPMA 4PWNA 2W1ZA 4QMUA 5I3OA 5A6OA 2ZDUA 3M2WA 4XBUA 4ZJVA 2C6TA 5CU6A 3NDMA 2BAJA 2GDOA 4C57A 3EH9A 4FKLA 4R78A 3TDVA 5IQGA 3CD8A 3GB2A 4GFMA 3R7EA 4U5JA 2C6OA 2QO2A 2R3OA 3G9LX 4HVDA 5A4LA 3COKA 1LPUA 4EQCA 1Y6BA 5BUJA 4J98A 5LVNA 1GOLA 4V05A 3GUBA 4NW6A 3V5JA 1IEPA 5EKNA 3EMGA 1H00A 2XKFA 4O7ZA 2FH9A 3OP5A 1YI6A 3EYGA 3QQHA 2PUUA 3KK9A 5BYZA 2G2IA 5LVPA 5GNKA 4DEDA 5D11A 1JSVA 4X6QC 4N57A 2VWYA 4BY9E 2ITPA 1MQBA 2VTRA 3PJ1A 4QMZA 4D0XA 4B7TA 4PV0A 4O7NA 3GFEA 3NNUA 5J87A 2CGWA 3DBFA 3FMLA 4HCTA 4IZAA 4JIKA 5AP0A 4BL1A 4L3JA 5ANGA 3SVVA 5CYIA 4FG7A 3P1AA 3N4UA 2YEXA 5HG9A 4MXCA 3MIYA 4O38A 4V0GA 5J9LA 3VHEA 3EQDA 3PP1A 4QP1A 5M56A 3P0MA 4F6WA 1YVJA 1OBGA 4CFFA 4QTCA 5CXZA 2BCJA 5IF1A 3JUHA 4UB7A 5HHWA 4DT8A 4ANSA 1M7QA 4WIHA 3ZH8A 3Q3BA 1H08A 3PIYA 4GKHA 3ENHA 2QG7A 4FNZA 1IRKA 3KXZA 4XG8A 1NT2A 5DH3A 1BX6A 4NCTA 4BGHA 3RCJA 3I7CA 2V5QA 2XUUA 2IG7A 1XH9A 5CT0A 3WOWA 2WZJA 3CD3A 4I22A 4D4SA 2OZOA 2PMNX 3NAXA 4EWHA 3DNDA 3AD6A 3BEGA 4RLKA 3OOMA 3IW8A 1TVOA 3IKAA 5L2IA 1DS5A 5BVEA 1H27A 3KXGA 4FKIA 1ZYJA 3B8RA 4AFEA 4E4XA 3FC2A 1OL1A 4YSJA 5CSWA 1UKHA 5L3AA 2RG6A 1XH8A 3PG1A 3Q5ZA 5BQ0A 4WSYA 2R3FA 4L67A 5F20A 4R7BA 4ZS4A 4RQKA 4CZUA 1Y8YA 2HY0A 2Z8CA 3AT2A 4WBOA 1AQ1A 3Q5IA 1UV5A 5IU2A 3I79A 4X6RA 4J52A 4TYHB 4PPCA 3O7LB 4FTIA 4B9DA 1CMKE 3NW7A 2Z7SA 5DT4A 4GVAA 2C6IA 2IN6A 4WOVA 1YI3A 3U4UA 1G8AA 4EOLA 2VWBA 3DK6A 5FLFA 1WBPA 1OM1A 5EHOA 4AT3A 2Y4IB 3SX9A 3R7YA 3UZPA 4JDKA 1PMEA 5E4HA 4XV3A 3FKOA 3EQFA 2W5BA 3E7OA 3L8SA 2C69A 3OD6X 5AUVA 1QPDA 1AGWA 3QF9A 4W9XA 2WEIA 3E64A 3FZRA 3QBNA 2HELA 2V55A 5A14A 3P7BA 3QYZA 5JGDA 4YURA 5EI6A 5C1QB 4LOPA 5D10A 2J0LA 3FE3A 1TZDA 2RFSA 4HVHA 5IUIA 4MVFA 1RJBA 3MDYA 2YIWA 4FTAA 3POZA 3FLQA 4DG2E 4I5PA 2P3GX 5CASA 2CNUA 1YWRA 3QTXA 3TYKA 1QPJA 2QU5A 4I0RA 3NUYA 2WD1A 2GFSA 4IFCA 3AD5A 2YFXA 3VW6A 4O7SA 2J5EA 4YC6A 4EI4A 3QUPA 3R8MA 4EC8A 3FI8A 4KBCA 2WQOA 3MVHA 1J7IA 5A4QA 2RKUA 4AP7A 5KHWA 2VD5A 3ZMMA 4ZXTA 1K9AA 2CDZA 2V22A 3P5JC 3KRRA 3R8ZA 2C30A 5CAOA 2WO6A 3FZSA 4H1MA 3KRWA 1JWHA 4O0RA 5C8MA 5HCXA 2GSFA 3RAIA 3M42A 4AG8A 1W2CA 4MXOA 4ERWA 5AR3A 3D2KA 3RM7A 5D7VA 4U6RA 1JQHA 4JBVA 4EKLA 4O7LA 2X0GA 3LM0A 2W05A 5DPVA 3WARA 4MF1A 5J1WA 3Q9YA 3BU5A 3AKKA 4DCAA 4FTKA 5AA8A 5CU4A 4TPTA 3BEAA 3GU4A 2XK9A 4EL9A 4IM3A 3QD2B 3PJ3A 4I3ZA 2R3MA 4GSBA 5BVOA 1PYEA 4GEOA 1M2QA 2WMBA 4CLIA 3LJ2A 4GCJA 2UW3A 1G5SA 5AX9A 3AMAA 5H3QA 3MTLA 3R7OA 3WE8A 2QURA 5M09A 1NA7A 2PVYA 4MAOA 4Q5HA 4UZHA 5D9HA 5CEPA 1YXSA 3VJOA 3Q04A 4BDKA 2JIIA 3TM0A 3TNQB 3C1XA 3OXZA 3HRFA 4D58A 3CCNA 3A4OX 3U55A 5BYLA 3NFFB 1IAHA 4G3CA 4CXAA 2W5AA 2XM9A 2PTKA 2JITA 4X2GA 2YA9A 5HNGA 5E1SA 2FGIA 5GZ9A 2BIYA 1NVRA 2HXQA 4XP0A 4EK3A 4NK9A 3MN3A 4ACGA 4E6QA 5B2MA 3F3UA 1SYKA 4NH1A 3F2RA 3ZFMA 2XRUA 3A99A 3IPHA 3QHWA 4JQ8A 4QP7A 2HCKA 4GYGA 4DFXE 3DXPA 2XH5A 3W8QA 3KK8A 4IX6A 5DR6A 2R3IA 3UG2A 5K5NA 3L9PA 4JBPA 4CT2A 3EKKA 1WVXA 4YJSA 4ZJIA 4OR5A 2FUMA 4JDJA 2ZB0A 3ZC6A 3ZUTA 4YJOA 5KUPA 3B2WA 4ITHA 3L9NA 1XH5A 2XNEA 4NIFA 4RMZA 3RPOA 2PVHA 3PSCA 5JZNA 3WBLA 3GCVA 1L3RE 3GI3A 1ATPE 4EBVA 2X39A 3NWWA 4QT1A 2QLUA 4FV4A 4BI1A 4FV9A 4I6QA 3E8EA 4YNOA 3NR9A 2UV2A 4M69A 3SA0A 1JKSA 4QNAA 3H0YA 4KS8A 5ETAA 4IANA 2V7AA 4R6VA 2PK9A 3QCQA 2PZ5A 3D94A 3QCYA 3NUNA 4CZTA 4DHIB 5AR5A 1STCE 3KRJA 3QC4A 1IA8A 3F5GA 1KOBA 4FMQA 3A61A 1R3CA 3NUXA 4ONAA 2Y0AA 4YHTA 2QOIA 3ZOSA 4E1ZA 3D5XA 4XOZA 4LI5A 4GKIA 1UNLA 2XIYA 3Q2JA 3VQUA 5E8TA 1PMVA 2IEWA 3ZM4A 3DQWA 1SVHA 3KVWA 4M0ZA 4RWJA 5TE0A 4DYMA 1OIRA 3OMVA 4KNBA 4FIJA 4DH3A 5JN2A 1PXMA 5H8GA 2HYYA 1PJKA 4DG0E 4LRJA 4EH2A 4LL0A 4DEBA 3ZUUA 4N6ZA 4YMJA 5EK7A 5DR9A 5E8WA 1UVRA 1G8JA 5L6WL 2YLEA 3NPCA 2GNJA 4FKPA 1HCLA 4AQKA 3UZRA 4K18A 3ZUVA 4K9YA 4XNEA 5GZAA 3ZONA 4CTBA 5FEEA 2ERZE 3TCPA 2QOQA 2XJ1A 4D2RA 4RC2A 4IB3A 1YHWA 4BZOA 2XNGA 4F1TA 1H25A 2IO6A 2R64A 3CPCA 3O2MA 4OT5A 3UMXA 4NYEA 5DYJA 3G6GA 2B53A 5AA9A 4DLJA 2Q83A 4IM0A 5IUGA 1JLUE 4LGDA 2XK6A 4NM3A 2YISA 4WKQA 3BZ3A 2Y6MA 4N4SA 3OTUA 1P4FA 4MK0A 5AWMA 4EHZA 3FDNA 5F1ZA 3W0PA 4IVAA 4J71A 2CJMA 4Y95A 5TF9A 4DFNA 4F9CA 4AN2A 1WBVA 2UZLA 3ZTXA 4A9TA 3PE2A 4OT6A 4QQCA 1U59A 4IWPA 4ZLYA 4C0TA 4D1XA 2Z60A 4XV9A 4IC8A 4Y46A 4ZMEA 2JDSA 2V7OA 2QNJA 2PMLX 3CP9A 2WAJA 4BBMA 2Q0BA 4KS7A 3OF0A 4AZTA 2R3HA 5FM3A 4EZ5A 1F5QA 5HU3A 4CFUA 2W9ZB 4ZEGA 1TKIA 4RFZA 4YGAA 3UBDA 3PSBA 2WMUA 5EKOA 3F66A 4ZZNA 4YC3A 2ITNA 4I41A 2R0UA 3DY7A 3VVHA 5KE0A 2GMXA 5DRBA 4MH7A 4UYNA 4YJUA 3VIDA 3TIZA 1Y91A 4FTJA 2FYSA 2J6MA 3PPZA 3VBXA 4C4GA 4DF3A 1H26A 1SM2A 4CV8A 3RI1A 3VRZA 4C4IA 4F09A 4Z7GA 4D1SA 4EOMA 2J0IA 5IH6A 4NZWB 1OZ1A 3DB8A 4FV5A 4O7RA 2ETRA 5TR6A 5HTBA 2UZTA 4RIWB 2W1IA 2WMSA 5HE1A 3SG8A 2BRGA 4AXCA 3EN6A 5FEQA 3ZSGA 5D1JA 5AP5A 2W1DA 4OTIA 4DDIA 4I1ZA 4QRCA 2VNWA 2C6DA 2X2LA 5CS6A 5CVFA 5DHJA 2BIKB 4K11A 4PDYA 4Y85A 3RHKA 3AMYA 3GNIB 5IQDA 5AV2A 4O91A 4S2ZA 3WIGA 4AN3A 2F2UA 2XYNA 4ZZMA 4DHFA 4EH5A 3ZM9A 3ACJA 3AT3A 2IF8A 1Q61A 2PZYA 4PRJA 3E3BX 4PPAA 4FTQA 4YO6A 4J8NA 3QKLA 3U6IA 3W2RA 5AUYA 4LL5A 3BWFA 4BZNA 1Z57A 5IG1A 2PSQA 4AA0A 3CSVA 1E1VA 4J97A 4PTCA 3S3IA 5KX8A 3UP7A 4I5CA 5CAPA 3O51A 4AE9A 4CRLA 4I21A 4FNWA 5LCKA 4FTLA 4DEIA 4FK6A 4FGBA 4RWLA 3KY2A 1QMZA 1BMKA 4YTIA 5M06A 1DAWA 3QXPA 4RA4A 2G9XA 4IVBA 3SRVB 1MRYA 3F7WA 2HW6A 4L01A 5AR8A 2UW4A 3CGOA 4NU1A 4YTHA 2JKKA 4RJ8A 2PMIA 3FJQE 4RX8A 4S31A 5DWRA 2XMYA 4RWKA 4S30A 3HDMA 3HMIA 3OROA 2QONA 4QP9A 2WQNA 5CZIA 4CCUA 3D9VA 4JR3A 4A9YA 1MQ4A 4PTEA 2X2KA 2NP8A 2PUIA 3PPKA 3R73A 1KOAA 4LOOA 3F61A 4OUCA 4CCBA 3PA4A 2C5OA 2DYLA 4ZJJA 4DGMA 5LXMA 3TXOA 5FQDC 2GQSA 2WTVA 4D4RA 1CTPE 3C13A 3HLLA 3LW0A 3OCTA 3SXRA 5E8XA 4BWKA 2ZM4A 1Q3WA 3LFEA 1M14A 4PDSA 1SNUA 3W1FA 3K2LA 3SXSA 4E4LA 2CKPA 5IZFA 3MB6A 5JK3A 4TXCA 3NMUF 4G3GA 1PF8A 2CPKE 1UWJA 2VV9A 2F49A 1W84A 2BALA 2HAKA 2OZAA 4D1ZA 4O0UA 3ZBFA 4NM7A 3FZOA 3A7JA 3DB6A 3OCSA 3OXIA 3FEGA 5IMEA 5DIAA 4E6DA 4AW5A 4YJTA 3VWAA 5FG8A 5GJFA 4U3ZA 3TZ7A 4ZTRA 2JFMA 4ZOGA 3GGFA 1BI8A 1K3AA 3BHVA 4EOKA 3TNHA 5AV0A 3CY2A 4IMYA 2BZIB 5LOHA 4IE9A 3EOCA 4KIQA 4DAWA 4X3JA 3E63A 5FBNC 3TNWA 3Q9XA 4O6LA 4YZDA 3HRBA 3LFSA 1UKIA 5HD7A 2H9VA 4UMPA 3M11A 5JRQA 2H96A 3GCSA 3U9CA 3BHYA 4H3BA 4TYGA 3ORXA 3ORMA 3BHHA 1H1SA 3TJCA 2EXCX 2VTPA 1IAJA 4ZTMA 4R5SA 3W55A 3UE4A 3FHRA 2B55A 3FYJX 4I24A 5JH6A 3FHIA 3QUEA 3BELA 1O6LA 2AYPA 2QOOA 3KC3A 3AKLA 5J5TA 4Z3VA 2XBJA 2B52A 3I6UA 5G1XA 3L1SA 4AOTA 5L6OA 2FSLX 1CM8A 3PJ8A 2B54A 2X8IA 4UV0A 1PRYA 4YLJA 5A46A 3TUBA 4G6NA 4EUUA 3CTHA 5C01A 4YHJA 3D7ZA 1W8CA 4L00A 4O0TA 3CJFA 4WNKA 2PY3A 4CYJA 3FUPA 2F7XE 4GJ2A 4OTRA 3UTOA 1K2PA 2E2BA 2P33A 2XNBA 4RJ4A 5HO8A 3ZO2A 3C0HA 5FM2A 3NYVA 3RKBA 3UJGA 4U43A 4TRLA 3AOXA 5CF4A 2B9JA 4RG0A 1GZOA 4I6HA 4IAFA 5FRIA 3NUAA 3HKOA 2YM8A 1YI4A 4AGDA 4FGRA 4RVMA 4J1RA 3F3WA 1M17A 3KMMA 4NTSA 4PMSA 3MFUA 1PXJA 3MA6A 2C4GA 3HV7A 2ETKA 4BTMA 3BQCA 2OJ9A 3KEXA 2EXEA 2W1CA 2P2IA 3KRLA 3P7CA 2WMAA 3KXXA 2GS6A 1YRPA 4XP2A 5I3RA 2WTWA 5ETCA 3BL7A 2VN9A 3A8WA 4U45A 3DXQA 3NW6A 4FSRA 2IZSA 2YCSA 1SVEA 5TKDA 3PXYA 4EOPA 2WTKC 4FV6A 1A48A 2VTHA 2UVZA 2E9VA 4AOIA 4I4FA 4RFMA 2ZV7A 2CGVA 3I0QA 5E9EA 4NKAA 3PRFA 4I0SA 2IPXA 4OAUC 1W83A 2J90A 2CGUA 4JI9A 3LMHA 2QKWB 1OUKA 3KMWA 4IEBA 3VN9A 5IA1A 3VS5A 3FBVA 5HVJA 3RALA 4FT0A 1PMUA 4X0MA 1VR2A 1XO2B 4AACA 3MVMA 2X9FA 3U54A 1KE7A 2RF9A 2C3LA 2OXXA 4LUDA 4CMOA 3H0ZA 2BILB 3KF7A 4BDEA 3F5XA 4FSZA 5EG3A 5ANJA 4FKSA 4U97A 3L8PA 4OTGA 5L8LA 4QDEA 4DBNA 3IDBA 4BCGA 1TQMA 4NJ3A 3CE3A 3E87A 4AZWA 4D4VA 3ZEWA 2ZOQA 3LPBA 3FPQA 3C51A 3RGFA 3O5AA 3M1SA 2WQEA 2XM8A 4JR7A 5IEYA 1W7HA 3JY9A 3SW7A 3HP2A 4QYGA 4FYOA 2R4BA 4AWIA 3P5KA 3A7HA 3E5AA 3NAYA 4C02A 4PL4A 3THBA 4BDDA 5IMXA 4L53A 2ZMDA 3MESA 1FMOE 4AXEA 2WNTA 3UP2A 3E93A 3W33A 4C36A 1JNKA 4FKVA 4IAZA 5L2QA 2XKCA 4BGQA 3PLAE 4X3FB 4O84A 4KABA 2G1TA 3SGCA 2ACXA 3SAYA 3FMEA 4BFMA 2WOTA 4H3QA 3ANQA 3QTSA 1M52A 4I0TA 3FZ1A 3FSKA 3FZTA 3QTWA 4MBIA 4O0WA 4PDOA 5J95A 5K3YA 3TN8A 3E8NA 3UVRA 3C5UA 4O6EA 5DGZA 4Z7HA 1ZZLA 2GS7A 4IJ9A 4IB5A 1JKTA 3HMPA 5HE0A 2BTSA 4EYJA 3MB7A 4KINA 4L3LA 4PP9A 3C4XA 4IDTA 5CI7A 3UDTA 4BTKA 4BIDA 1YOLA 3E8CA 4YZMA 4C35A 5AUUA 2PPQA 3QTIA 3UG1A 5EQEA 1URCA 2WGJA 3OVVA 4FT7A 4QP6A 3UC4A 4M8TA 2QD9A 4XS2A 5DT0A 4CEGA 4AXDA 4ZP5A 3TNPC 4S33A 2FSMX 4FVRA 2XJ2A 5DA3A 4GJ3A 5KHXA 2O5KA 2OKRA 3PY1A 4GG7A 5GJGA 2JGZA 3E88A 1PHKA 3QFVA 5EI8A 4C38A 4MXYA 3ZXZA 3VUDA 3PYYA 1OL7A 4TW9A 3BYSA 5HBEA 1FINA 2A1AB 2VTNA 3BIZA 4BYIA 1Z5MA 5BUEA 2AEGA 2JBOA 2QLQA 2UVXA 4X2FA 3I60A 3VULA 3D2IA 4J7BA 4APPA 2VTJA 2WIPA 4IAYA 4WHZA 1H1PA 5FWKK 2IW8A 3PTGA 4WT6A 3V8WA 5J1VA 4K77A 4ERKA 3NGAA 3UDBA 2H6DA 3UOJA 3Q32A 4I6FA 2X6EA 5EDPA 5AP1A 4EQMA 5B7VA 2VUWA 3WF9A 3VS7A 1FPUA 4L52A 2XIZA 3GU5A 3HP5A 4AZSA 1KE9A 3II5A 2B9IA 4R77A 2PMOX 1Q5KA 4UWCA 4FTOA 4AGCA 3FKLA 3AC5A 4JRNA 4I23A 5B2KA 2KULA 4MCVA 3KREA 4J95A 4GMYA 5HI2A 3TZ8A 3ATTA 3H3CA 5K9IA 3QXOA 3U8WA 2EVAA 3TZ9A 1TQPA 3VUIA 4FOBA 2YM6A 4F7NA 1KV2A 4AN9A 5AR7A 4TL0A 3CPBA 4H36A 4XYFA 4E4MA 3ORZA 2NNWB 4C59A 4YJQA 4C58A 2GNGA 4DFBA 5AX3A 3MPMA 3UDSA 2CKQA 2HZ4A 3DLSA 4FV3A 5FDPA 1T46A 4LUEA 3QCSA 2WPAA 1WBNA 2FVDA 3U87A 3QUDA 5A3XA 2OFUA 3EZVA 2O8YA 3KU2A 5ACKA 1EH4A 3O8PA 1OPJA 3OFMA 3W2SA 5LMAA 1NXKA 4MD7E 3BWJA 1XWSA 3NNVA 5CU0A 5K0XA 1ZYCA 2C1AA 4P90A 4BTFA 2HZNA 4YPDA 2O0UA 4EZ7A 4JAIA 4PX6A 3R0TA 5AAGA 4BF2A 4FK3A 3HMOA 3A7GA 4E3CA 3QQKA 4OTHA 2W4OA 2IWIA 3EQRA 3V5LA 4D0WA 2QHMA 2WMQA 3QD0A 5CEKA 1YXTA 3VO3A 4DEHA 3MH3A 4GIHA 5KKRC 3KXMA 4FG9A 4U40A 5HU9A 2Z7LA 5CENA 5L6PA 3DFCB 5AUXA 5JMSA 4IWQA 2QOLA 3PUFC 4MQ1A 2BFXA 2YN8A 3S2PA 5J79A 2UW5A 2GTNA 4G3EA 3RAWA 4OBOA 1ZY5A 3W0OA 5JSMA 1OUYA 4NM0A 4V04A 4DG3E 1JVPP 2IVTA 2BFYA 5DI1A 1URWA 5HZNA 3CQEA 4V0GB 3R1YA 5EHYA 4YJVA 3ZRKA 4AF3A 4DH1A 4KUJA 3F82A 2WU6A 3RNIA 1Q41A 2QC6A 3OBGA 1H1WA 4RX9A 4GRBA 5EW3A 4B99A 2W0JA 3QTRA 4O2PA 2EB3A 3VUMA 2A19B 3QGWA 3W0MA 2PZRA 4U3YA 5H8BA 3VBTA 4CKIA 5IUHA 5J5SA 4ACCA 5CVGA 4PNIA 3R8LA 2ZV8A 2VGPA 4Z16A 1YDSE 1P2AA 3V8TA 5LQFA 4FTRA 1GAGA 2BPMA 4AFJA 4K33A 4FT9A 3V5PA 1V1KA 1KSWA 3I7BA 3PXZA 4M84A 4I5MA 4IB1A 4BCNA 2A2AA 1FGIA 1ZAOA 3CGFA 2ZJWA 5AUZA 2WB8A 4O27B 5C03A 4QYEA 3NIEA 4O4BB 1MUOA 3JR1A 4AQCA 2EXMA 4Q9ZA 4X2NA 4RIXA 3FQSA 4FV1A 4QMPA 4YNEA 5DBXA 4WD5A 2VRXA 1Y57A 4G6LA 3TWJA 5JRSA 4BVUA 3RMFA 3HV4A 3DK3A 3NVMB 4BKJA 4FJVA 2QKRA 3RPVA 1Z9XA 3JVRA 4IW0A 3BGQA 3RWPA 1FQ1B 1ZWSA 5LJJA 3UZTA 4W4WA 4QMMA 3JVSA 2WEVA 1G8SA 3EFJA 4E8AA 1BL6A 3ALNA 3MWUA 3OXTA 3WYXA 2Y4PA 4EJNA 2WXVA 2XA4A 5BX0A 1KUTA 3AKJA 3PFYA 1ZARA 4C34A 2XYUA 5L4QA 5CSVA 4CD0A 4MX9A 1OL2A 2J50A 4FIHA 2I7QA 1OL6A 2CN5A 2ZM3A 4O1PA 5KMMA 4CYIA 4FEVA 2X8EA 2R3PA 4USFA 4D5HA 3EJ1A 3TACA 2R0IA 3VBVA 5IA4A 4LRKA 1RQQA 4BCOA 2PUPA 4ANNA 2OI4X 4C8BA 4OAVB 3RM6A 4XV1A 5E8SA 1Q24A 5EM8A 2Z2WA 4S32A 3AXWA 2OIBA 4GK2A 1E1XA 2VX3A 4XUFA 4UX9A 5EQPA 3ROYA 4EK4A 2OFVA 4ACDA 1GZNA 4QP8A 2QOBA 4O82A 2VGOA 3KB7A 5HLNA 1UA2A 3WI6A 3F6XA 1GIIA 2AC5A 3B2TA 2C0OA 4O0VA 3COIA 5AV3A 3CC6A 5L8KA 2C6LA 4IIRA 5CSPA 5HNBA 5ANKA 2ETMA 4M13A 3TL8A 5EQYA 1ZRZA 4AGWA 4O0YA 3ANRA 5IA2A 1YHVA 3NNXA 4FA2A 4S34A