5CAUA

Egfr kinase domain mutant "tmlr" with compound 41b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
323
structure length
297
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 297
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cauA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cauA01
5FXRA 3AC8A 3FI2A 3QUDA 3QCSA 2WTJA 4NJ3A 4F9CA 2HCKA 2YERA 2UW4A 2WIPA 4PWNA 4ZK5A 3BQRA 3LFSA 4FT0A 3UYSA 1ZOGA 3VWAA 1OIQA 4DFBA 4RLLA 2BRGA 5I9ZA 1OM1A 1PHKA 4G6LA 3PY0A 4ZIMA 4J52A 4QQCA 2HZNA 4IBMA 3DS6A 2BDWA 1XH5A 1SMHA 3C1XA 4G5JA 4IC8A 5DEYA 2OJGA 5AWMA 3QD3A 5JZJA 1U54B 5ACBC 3E92A 4FV3A 3PXZA 5FXQA 4AZVA 3ORPA 3M2WA 3ZU7A 3C4CA 4YZ9A 5K4JA 4ALUA 5KMLA 2QODA 4YR8A 4D58A 3O0GA 4O82A 2J90A 2XNMA 4IZAA 2XKFA 5I5ZA 3G0FA 4MD7E 4DEHA 2JIVA 4ZAUA 4I6QA 2UUEA 1KE5A 3BBWA 2RG5A 4C2VA 3F5PA 3V5LA 3NPCA 4J97A 5FP5A 2X7GA 4BCPA 3KN6A 3OMVA 3BEAA 2W99B 5LMAA 4XLIA 2C5XA 2VRXA 4Y72A 3LAUA 5A6OA 4CEGA 3VRYA 1Q62A 4YP8A 3R1SA 2JAMA 3GQLA 3EQCA 2ERKA 4I6BA 1YRPA 1CKJA 3CKXA 2B9IA 4F65A 5BVNA 3HA8A 4ZLZA 4O91A 5L2QA 2J9MA 1VJYA 3S3IA 1PKGA 3MY5A 4IMYA 5JH6A 1KE6A 2G2IA 4CV9A 4D4SA 4H1MA 3LPBA 4BGHA 2QG5A 3KMMA 3G0EA 2CN8A 1J91A 3GOKA 3R7OA 3BBTB 4MAOA 3MWUA 4J71A 3V51A 2BRHA 4BL1A 4F64A 3I4BA 1M2QA 3QRJA 5L4QA 3SAYA 4E4LA 4O7ZA 3NUXA 4DH3A 1H08A 5AEPA 2PZRA 3LCTA 4FTKA 3FSFA 4ASZA 1FGKA 5DVRA 3HGKA 1OKYA 3RZBA 4OBQA 2XK7A 3FL5A 3AC4A 3MDYA 2PE1A 4BHZA 3WE4A 4F7NA 2XYUA 5KKRB 4F70A 3ULZA 3WZEA 4HJOA 3RALA 4D2SA 3F61A 2BZKB 3HV5A 1IA8A 4MF1A 5KO1A 3QZIA 4MQ1A 2O63A 3CQEA 3FMLA 1H8FA 4K77A 3LCKA 4U6RA 4YC6A 4EOKA 4RFMA 5EI2A 4CFNA 3H9OA 4LV8A 3F7WA 3ID6C 3PP0A 2QOIA 5KCVA 4NCTA 2VX3A 3QC9A 4ASDA 2VTMA 2V55A 4R3CA 4XEYA 3RAKA 3EFKA 3R7UA 3Q9WA 5AIKA 1OI9A 3II5A 3QFVA 2H6DA 2CKPA 4FEQA 2J0LA 1Q41A 5HNGA 3KF7A 1L3RE 2R3MA 4YTCA 3ZCLA 3R83A 5LQFA 1JKTA 2XF0A 3NZ0A 4FIGA 4USDA 2ITYA 1Q8WA 4DGNA 5M06A 2IW6A 4PMPA 5D10A 5DT4A 1J7IA 2CN5A 2J5EA 3TM0A 4U44A 3OUKA 4ZTRA 4G9CA 4HGLA 5AUTA 2QURA 2WFYA 3SHEA 3HRFA 1UKIA 5IQCA 3ELJA 2YABA 3GEQA 3LHJA 4WG4A 3RHKA 4JS8A 4AUAA 4EOSA 4BI0A 4AN2A 1EH4A 1IG1A 4M12A 2RL5A 3OCBA 3TI1A 5HE1A 4ITIA 2WMVA 4KA3A 4KWPA 4RIYB 3JS2A 4C59A 2QHMA 3NYNA 4X2KA 5IMEA 4TNDA 4WNKA 2XKCA 2A0CX 4Y73A 4A4OA 4E6AA 5CAPA 4UXLA 4Z9LA 4BDHA 4C0TA 1P14A 1GJOA 2V0DA 4BDIA 4YJPA 4Y8DA 3RM6A 1Q99A 4JR7A 4ZTMA 3QTQA 5BMSA 3VBYA 2I40A 4DLJA 5M53A 3ZSIA 4GFOA 5L8JA 4IZ7A 5CAQA 3QTSA 3RWPA 4BCGA 2CLQA 3Q60A 2R3KA 2X4ZA 3TNHA 3HDNA 5EYKA 4ZY5A 1K2PA 4AGDA 4ACGA 3ZMMA 3KMUA 3DFAA 4C61A 4HCTA 1H1WA 3EN7A 5CU2A 3MSSA 3SOCA 4AE6A 3U54A 4P5QA 4DN5A 2GS7A 1IR3A 3NUNA 4WSQA 4O0WA 4RZWA 1APME 5LOHA 3R8PA 4JBVA 4CMUA 4XP0A 2IVUA 4C33A 4EK8A 4HNIA 2P4IA 5L6WL 2G1TA 1Q3WA 4NT4A 4NJDA 5CEIA 3Q32A 3BE9A 4PY1A 2J2IB 3Q4TA 4CCBA 4B4LA 3VBVA 4IB3A 3FMKA 3FZ1A 3LM5A 3G15A 5DPVA 4OTQA 4D2VA 4X2FA 5HIBA 5C4LA 4NU1A 2O2UA 3QZHA 2PUUA 1FVVA 2GTNA 3GCQA 1PXLA 3BHYA 1Q8YA 4EWHA 5CXZA 5KNJA 4JIAA 5ANKA 4AN3A 5K4IA 5M07A 5M44A 4QMXA 3OXIA 4GS6A 4JL9A 5B2LA 4WG5A 4WOVA 1WBOA 2OZAB 3O96A 3KXNA 3GU7A 4KINA 2I7QA 3A8WA 1V0PA 1AD5A 1H1SA 2BTSA 3F69A 3GT8A 4JI9A 4RIWA 4NL0A 2VTJA 4ORKA 5GINE 4TNBA 1NW1A 4QO9A 5HQ0A 5IQAA 1PRYA 3E62A 3U51A 4FKJA 2F9GA 1XQZA 4M7IA 2VTRA 5M51A 2X0GA 3S95A 3PJ3A 5ETCA 4YTIA 4O7LA 4FOBA 3VS3A 3W2QA 4QQJA 3R21A 4ZLYA 2VWXA 1R78A 2QR8A 4H1JA 4O0UA 4JRNA 3D7TB 3CY3A 2OO8X 3F3ZA 3ULIA 4I6HA 3ZTXA 2JEDA 3F2AA 4L44A 3OWLA 4I5CA 4NFNA 4FEXA 4KRCA 2J0MB 1BI8A 4MBIA 4EZ3A 4BKJA 3MPAA 5IA2A 3IDPA 4LM5A 3V8WA 2IJMA 2J0JA 3E7VA 3LVPA 3OTVA 2Y6MA 4FVPA 4NSTA 1PMUA 4I5HA 2PHKA 3DZOA 4S30A 5HKMA 4B6LA 4O7SA 3ORXA 3E3BX 3RAHA 4EJNA 2R3GA 3EOCA 4E3CA 3VUMA 4J96A 3QQGA 3EZRA 2IZUA 4K18A 2VTAA 3CPBA 4JLCA 1W7HA 4K2RA 5DN3A 4CKIA 4DLIA 1ND4A 2J51A 3QLGA 4L42A 2E9NA 2PE2A 3FY0A 3ORIA 4FOCA 4A9YA 3LLAA 4O0YA 5E7RA 4E4MA 5K5XA 3FLQA 5ANJA 3THBA 1UWHA 4R5SA 3PXKA 2REIA 1FBNA 4IVCA 3R1YA 5AA8A 4E5AX 3HLLA 1OL6A 4D4YA 4IXPA 4K8AA 4YJSA 5AIRA 4KRDA 4U5JA 3EQIA 4PTGA 4EOMA 4ZTSA 3RPOA 5CALA 3KN5A 3DXPA 4CXAA 3BLHA 5BQ0A 3PE2A 3HAMA 1RE8A 4KIQA 4N70A 3E8EA 1VYZA 4QYGA 3TWJA 3QBNA 1J7UA 3F5GA 1RJBA 4WSYA 5C03A 4ZEGA 3MH3A 2ITQA 1MRVA 4ERWA 4FNYA 4O27B 3FDNA 4YJNA 3L8XA 5DR9A 5JFWA 3C0GA 2YA9A 1Y6BA 2DUVA 3PXRA 5JSMA 3LQ5A 4Q5EA 5CT0A 4TKSA 5AUUA 5KMNA 3D5UA 4FGRA 4AW0A 3CSVA 1UU7A 4E4NA 3I5NA 4XG2A 4NM5A 2WMSA 2JDSA 3SV0A 3CJFA 3DNEA 3LXPA 3ET7A 3ORKA 3UVQA 1BL7A 5HO6A 3I7BA 3FBVA 1F0QA 4EZ7A 5CS6A 4RVTA 2YISA 3DY7A 3FZRA 1I44A 2C30A 4FKSA 3F82A 4FUXA 4FT3A 4QYEA 5BVFA 2ZM3A 3C4ZA 4FV2A 2X8DA 4J1RA 4GFGA 4DGOA 2PVLA 4JX7A 2VWWA 4MH7A 3BLRA 4NM7A 3FPQA 5CAUA 3SW4A 3EMGA 5HU3A 2Z7SA 2GS6A 3O8TA 3A4PA 1GY3A 2QO2A 3KCKA 4BDKA 4F0IA 1FQ1B 3O2MA 1REKA 2PZPA 2Q0BA 2ZYBA 4YJRA 2C1AA 3TV7A 3IGGA 2P3GX 5DRBA 1B6CB 3CQWA 5EHLA 4HYUA 3UVPA 4I4FA 4ZTNA 3ZSHA 4A4XA 5AP7A 2J4ZA 3JXWA 1CMKE 1DI9A 4ITJA 4GYIA 4C38A 4PF4A 2FGIA 3TUDA 5HE3A 4D1XA 4V01A 3M42A 4AFEA 4A06A 2WTCA 1ZXEA 2QOQA 3A7HA 3SRVB 3F2RA 5HVYA 4DEDA 4N57A 1F3MC 3WYYA 4ZJVA 1A9UA 2C6DA 4IVAA 2BKZA 4Y95A 5LARA 3UP7A 5C1QB 1OMWA 3ZUUA 2VGPA 3MVJA 4YZDA 3EQFA 4U9AA 4XH6A 2IWIA 4YNEA 2RIOA 4AN9A 2QR7A 2YZAA 3NUYA 4MBLA 4FEWA 4R7HA 1DS5A 3R01A 3ZDIA 4RVLA 3TACA 3VJOA 4IWDA 4DGLC 1NA7A 4FZAB 4QOXA 4RVKA 4BCHA 4UN0C 4JIKA 3VUIA 4DF3A 4GCJA 3NUPA 4PMMA 4NH1A 2HZ0A 4YLJA 4BCQA 4O83A 3ODZX 4RZVA 4AP7A 5C4KA 3MTLA 5L6OA 4O2ZA 2ITPA 3L8SA 4TPTA 4YTFA 2BMCA 4GIIA 2C6IA 3EQDA 4EQCA 1OPJA 4KABA 4N4SA 3HZTA 5K0KA 2X6EA 4KS8A 5HCYA 4YURA 3ANQA 3R71A 3GC7A 3ORMA 3SLSA 3P9JA 2OXXA 4QNAA 4O96A 4UB7A 4BDJA 3MY1A 4AAAA 2UZWE 4ZXTA 1H1PA 3ORNA 3C4FA 5D7AA 4BIDA 4ZSGA 4DH5A 3KREA 4U45A 3R9HA 3P78A 4OR5A 1Q8UA 2XJ0A 3BRBA 2IN6A 5HIDA 5EYCA 5IH6A 3T8OA 4AA4A 4O7VA 2OICA 4LFIA 1OL7A 3LQ8A 3MH2A 1WAKA 4USFA 5EK7A 2UZLA 2PE0A 2VO0A 2O8YA 1OZ1A 2UZTA 3FKLA 4P4CA 4QTBA 5LWMA 5M4CA 3NAYA 2Y0AA 4FTUA 4N0SA 5FM2A 2UVZA 4M97A 5AFVA 2PUPA 3BU6A 2YIXA 3L9PA 2C3LA 4MK0A 2A2AA 4EJ7A 4GU9A 2XK6A 3TTIA 3BPRA 2ITXA 2VWYA 2XNOA 4I93A 3R8ZA 4EC8A 4WA9A 3FJQE 4F6SA 5AAEA 3DAEA 3HV6A 4UMQA 4G3EA 4JG7A 3OEFX 3R8UA 3UOLA 4EEVA 5L6PA 4UALA 2ZAZA 2EXCX 2OH4A 4RG0A 1G8AA 3NAXA 2XCHA 2XH5A 1ZMWA 4ZJJA 5ETIA 2PSQA 4FTAA 4EBWA 4R1VA 5GZ8A 5GIOE 1LEZA 1Y57A 1W98A 4DFYA 5IF1A 5K9IA 4NYEA 3EKNA 4FKRA 5FDPA 5FG8A 1FVTA 4RSSA 5IA5A 3R7EA 3I7CA 4DG2E 3MH1A 2C5NA 1UVRA 5AAFA 2WD1A 2EWAA 4FL3A 2F57A 3U6HA 1PXMA 2C3IB 2GHGA 3Q6UA 4RX8A 4FV9A 1SVEA 2FVDA 3GP0A 3QA0A 4IDTA 4FZ6A 4QMSA 4CRSA 3RGFA 3GENA 4TWNA 1J7LA 4HYSA 1P2AA 3RPSA 4EK5A 1U4DA 5EW9A 3OVVA 4OGRA 4CYIA 2VNYA 4ANNA 2PMOX 5IH5A 2XK8A 3I5ZA 1O6YA 4YZMA 2ITNA 3PXYA 5HG9A 3W33A 2PVHA 5FEEA 3Q96A 3T3UA 1B38A 2NNWB 3QKKA 5AP2A 3P7BA 2QKRA 1M17A 4M67A 4K1BA 4IWPA 1YOJA 3OFMA 1H28A 3ITZA 4IAIA 3QX4A 3IS5A 4BI2A 2F7EE 5JRSA 3H30A 3RAWA 3ZLXA 3O7LD 4F9WA 3CQUA 4GUEA 1YI3A 3FQEA 1WBTA 5G6VA 3QC4A 4FR4A 5C01A 2HY0A 4GT4A 1SVGA 4UY9A 3A7FA 2GQGA 4M0ZA 5EW3A 3ALNA 3UDBA 4QTAA 3VUGA 1ZYCA 3NMUF 2I0YA 2OJFE 3QRIA 4L01A 3VS2A 2VTLA 4LOQA 3TIZA 3CLYA 4C37A 5A4CA 3KRXA 3RI1A 2FYSA 2YM3A 4BDFA 2WMQA 4EOLA 3DB6A 2WTKC 3DTCA 3CTJA 3AC5A 2WKMA 3FZOA 4QMMA 4D28A 5E90A 3VF8A 3RNIA 4D4VA 3HV4A 3PG3A 5J1VA 4MD8E 2PYWA 2YHVA 3L9NA 2C5VA 2C5OA 5KMJA 3LCDA 4W4VA 4APCA 4JQ8A 2CNUA 4BZOA 4F09A 3NNXA 4XG3A 4G6NA 4PL3A 3VAPA 3Q4CA 2WQNA 4R5YA 4TWOA 2OBJA 3GOPA 3WF5A 4BDGA 5CSWA 3VBWA 1H0WA 4Y83A 1YKRA 4DH1A 4MF0A 1CDKA 2QQ7A 2IW8A 4Y46A 3U9CA 5AX3A 2AC3A 2RFEA 2YIWA 4M3QA 3KULA 5CEOA 3D9VA 2UW7A 2C6EA 4WD5A 1DAYA 3DLZA 4TL0A 5DI1A 3RPVA 3FMDA 2C3KA 1PXIA 2W1HA 4X0MA 4BIEA 4A4LA 3W10A 3ZUVA 3QTWA 1OBDA 4MBJA 5CY3A 3VS4A 5KHWA 3UIUA 3OC1A 3MYGA 4FNXA 4ZS4A 1KV1A 4GVJA 5CVHA 3LM0A 4CSVA 2XRWA 3W16A 1UU9A 4C4JA 1JWHA 4F0FA 2XNBA 3PSBA 5EDRA 3FYJX 4HPUE 3HYHA 4L3PA 4KAOA 4ZZMA 1YW2A 2UVYA 3ZM4A 3D5XA 2FA2A 4DEGA 1BI7A 2DQ7X 4WRGA 2BAJA 2R3QA 4BCFA 3TKIA 4F4PA 2ETMA 3W1FA 4FEUA 4X6RA 4AZWA 3MIYA 4F0GA 3IO7A 2PVJA 4YC3A 3PWYA 4FMQA 1QPCA 3IQ7A 3PY3A 4BTJA 2Q83A 5M57A 4OTPA 4KKHA 3UO6A 2GCDA 3OT3A 1KUTA 1ZWSA 3BEGA 2GNGA 2XVDA 4JG8A 1OB3A 4XV9A 3R0TA 3JVSA 3IDBA 5D12A 2C0IA 5K3YA 3NNWA 3VS0A 1KE9A 2YAAA 3PJ2A 1H1RA 2X1NA 3DTWA 3QQUA 1B39A 1KOBA 3KC3A 1OIYA 4DT9A 4ZSAA 4WUAA 5CXHA 4MXZA 3SA0A 2RKUA 4RQVA 5A4QA 5JK3A 4FNZA 3FZPA 3NGAA 5LMBA 3H0YA 3QUEA 4PX6A 3RBWA 4QP6A 4TW9A 2P2HA 3O8PA 3PTGA 3R30A 4UZHA 5E8ZA 2CGVA 4LGGA 4OLIA 4U80A 3ORLA 3FMNA 4IEBA 2XUUA 2W4JA 5KMOA 3F5XA 1A48A 4Z55A 3FKOA 3QTRA 5E1EA 2KULA 2GNLA 3WZDA 4QMZA 3K5UA 3T9TA 3EQRA 3EN4A 1ZYDA 2OGVA 2JD5A 3PIXA 1OL2A 4HYHA 5EYMA 3VIDA 3IW4A 4FIEA 4IANA 4RT7A 3ZXTA 2ONLC 4WG3A 4RJ8A 2XP2A 4ITHA 3DPKA 3KRRA 3RPRA 3UVRA 1UNGA 4I0RA 3OZ6A 4D1ZA 2CGWA 4U40A 2B55A 5J5TA 4Z7HA 5IEXA 3I0OA 3TDVA 3POZA 4V0GA 3UOKA 4FKUA 3WBLA 2X2KA 4LQMA 2XS0A 3OY1A 4JQEA 3ERKA 3LKMA 1IRKA 4EL9A 3PA3A 2ITZA 3N51A 4QMUA 3QL8A 5D41A 4EQUA 1TQIA 3QALE 2BZJA 5EM8A 1M52A 4MYGA 4P2KA 2Y4IC 3WIGA 4O81A 2DYLA 4EH3A 1WZYA 4RJ7A 3R9OA 2XB7A 3NEWA 3COMA 4QMVA 3VS1A 2F7XE 3A60A 4EHZA 1ZZ2A 3AD5A 3DKCA 2BHEA 3EN6A 2QOFA 3QTZA 5EDQA 3E93A 5BMMA 2WMWA 3A7GA 1NVSA 5JMSA 3TNWA 3DKFA 3OY3A 4S32A 3OWKA 2OSCA 1QPDA 1R39A 2ETKA 2VWBA 3LXKA 4FV8A 5DT0A 4R1YA 3LJ1A 4FEVA 3LFCA 2WPAA 2YLEA 4MXAA 4H39A 4QPMA 3QRKA 5M55A 4DH7A 2R0UA 4ZSEA 3VUKA 2O0UA 5F1ZA 3EQBA 1V1KA 4XMOA 5HG8A 1YWNA 3W2SA 4W4WA 4RGJA 5DEWA 5F9EA 3KU2A 3QQJA 5CEMA 2R4BA 4FTQA 4FK3A 4RC3A 4U7ZA 2GFSA 2FO0A 3G33A 3V01A 3UQFA 4M14A 4F6WA 4W8DA 3HMIA 4EC9A 2ZV9A 3DBFA 4L6QA 2G01A 5AP5A 3AT3A 4QP8A 4BR3A 3BGPA 4S34A 5ANOA 2OZOA 2VTSA 4JDIA 2R5TA 2QOCA 4I4EA 5A54A 2XNPA 3NX8A 2VTPA 2OWBA 4G3GA 3S1HA 4YHJA 2R3FA 2ZOQA 4JBQA 4FZFB 4H3QA 5DOSA 1JKKA 4AFJA 5EKNA 3PSCA 2XNNA 3DJ7A 3I0QA 4ZY6A 5EI8A 5I3OA 4FSMA 5GNKA 3DFCB 4CZTA 1H01A 4FTRA 3V8TA 4FSQA 3MH0A 3BZ3A 4QMNA 4FK6A 4QP7A 3DXQA 5AADA 2B52A 4G17A 3ZO4A 3DK6A 5L2SA 3EHAA 1U5QA 1XBBA 2CHLA 3ZFYA 4C3PA 3R63A 3L8VA 1FMKA 1JBPE 1OPKA 5KE0A 1BYGA 2F2UA 4KBAA 3RTPA 3ZO1A 2PU8A 4G34A 5FBNC 3LJ0A 4KIOA 4D5HA 3DOGA 3DK3A 3I81A 4I22A 3FXZA 5FP6A 3HMPA 3QYZA 2NRYA 4HVHA 3Q2JA 4FTNA 3TIYA 5IA1A 3N4UA 4JQ7A 2OK1A 2YM6A 5IPJA 4NKSA 1XR1A 4OBPA 3RPYA 2HW6A 3G6HA 4EYMA 3V5WA 4IB0A 5B7VA 5CF4A 4B99A 4RIWB 2AUHA 3QU0A 4FC0A 2PZ5A 4GJ2A 1O6LA 4NKAA 5AR8A 3FLYA 5HLWA 5KMKA 4FVRA 5FWKK 2WMBA 3NUAA 4TYHA 1Q61A 1WBSA 3MVHA 2QONA 2QNJA 2W5AA 1T46A 4FSNA 2IZRA 2WNTA 1KE8A 2H96A 4FTIA 2CCHA 3C9WA 1YXUA 2A27A 4PPCA 4RA5A 1AQ1A 5CENA 4FYNA 3QHWA 5EKOA 4GEOA 4TY1A 2OXDA 5DA3A 5L3AA 5JZNA 4EHVA 4JR3A 4YHFA 4DFXE 4M0YA 3QA8A 1NXKA 5IZFA 2R3IA 3GC8A 3F7ZA 2IO6A 5AV2A 5GHVA 1F5QA 4Q2AA 4BGGA 2WU7A 3UQGA 4A9UA 4BHNA 5EFQA 3HV3A 4LYNA 4RJ6A 4ZP5A 3NIEA 2YWVA 3MVMA 1PW2A 5FLFA 1H24A 4FT9A 2ONLA 3AMAA 5CX9A 5DR2A 5JEBA 5HVKA 2R3PA 3RVGA 4QP1A 2Z60A 4K9YA 1YHSA 4DEIA 3CTQA 3QRUA 4FT5A 4LMUA 3RINA 3A7JA 5IISA 1YDRE 1GZNA 3ORZA 4EH8A 4HVIA 2J0IA 2W1GA 2ACXA 1TVOA 2B53A 5LVNA 2XIXA 4J98A 5HG7A 3QKMA 3QCXA 3AC3A 4L9IA 3U4UA 4XCUA 1Q97A 1STCE 5HICA 4I5PA 1XH8A 3BHHA 3NRMA 3G9LX 2XRUA 3DAKA 4IACA 5HLPA 3NNVA 4F1TA 3MTFA 4FG9A 2JBPA 5FXSA 3BU5A 2E9PA 4A9TA 3ZEWA 4M69A 3TXOA 1M7NA 5IQEA 2CCIA 2UZDA 4IB1A 4L52A 4WKQA 2VUWA 4I24A 3VO3A 3HP2A 4R3RA 4F9AA 2HXLA 4ENYA 4PV0A 4OW8A 3GGFA 3OT8A 4A9SA 1YWRA 1ZYSA 3LFFA 1E9HA 5F94A 4ERKA 4B9DA 5ANGA 3WIKA 3FL4A 3VBXA 4TWCA 1GOLA 2ITVA 2UZOA 3ROCA 5IQHA 3QF9A 5D7VA 4FKIA 4AW2A 4CTCA 4RX5A 2XBJA 1FVRA 4O38A 4KIKA 3VBQA 3MFUA 4YZNA 1Q8ZA 3W2CA 4BKYA 2GDOA 4E26A 1LPUA 2WMUA 3ROYA 4I23A 4TZRA 4USEA 2GSFA 4FKLA 3S2PA 2G2FA 4FUYA 4G9RA 4BDCA 5IU2A 5CNOA 4IHPA 5CEPA 5BYZA 2BRBA 3EQGA 5BYYA 5CNNA 4F9BA 1H1QA 3I79A 5E4HA 4PPAA 4I92A 2YM4A 3K3JA 3ZH8A 4CT2A 3H10A 1WBNA 4O6EA 4BWPA 3IECA 3IW5A 4O0RA 4JXFA 4UV0A 5E9EA 4RC4A 4JG6A 4N6YA 3R8VA 3LXLA 4IM0A 4ALVA 2W1FA 2YITA 4X6QC 1MRYA 5EI6A 5BVDA 3ATSA 5BUJA 4CVAA 4QYHA 5CZIA 5FEDA 1E1VA 1G3NA 4D2RA 1IAJA 4O0VA 4RRVA 3C4WA 1V0BA 1Y8YA 2XIRA 3R22A 5AMNA 4D0WA 2JDTA 2B4SB 4MNEB 3PA5A 3ZFMA 2GNHA 3PRIA 4I41A 2YWPA 4XRJA 4ALWA 5AUWA 2PVNA 2WU6A 1UWJA 5T3QA 3IW6A 3CCNA 2ESMA 5A6NA 4NM3A 2X6DA 3A99A 3V6RA 2ZV2A 3CGFA 4FSTA 4BWKA 2I6LA 4JNWA 2I1MA 4OT6A 4RBLA 3LW0A 4GUBA 5L2TA 1YQJA 3LFDA 2G15A 2VGOA 4LL0A 3VUHA 4UMTA 5A4TA 1P4FA 5IEVA 2WO6A 3H4JA 4I3ZA 2QU6A 1H4LA 4IAFA 5TO8A 2HAKA 4QMLA 3OF0A 4C8BA 4RJ5A 4E1ZA 3EQPA 3QXOA 3MS9A 3Q5ZA 4I1ZA 5B2KA 4L7SA 4Z3VA 4ARKA 4XP3A 2QU5A 3PRFA 4ZOGA 4S33A 5J7BA 4D9TA 2R3OA 2YZLA 4FTMA 4I20A 3ZBXA 1UNLA 3D2KA 1P4OA 5IDNA 2WQEA 4FT7A 2QO7A 3DU8A 4DE4A 5I9VA 4EORA 2W4KA 3UO4A 4DGMA 4W9WA 1SM2A 4FV6A 5JRQA 4RIXA 3FEGA 4PPBA 1J1BA 3FLSA 3UZRA 1H26A 5I9XA 1YOMA 2ZV8A 4YSJA 5DYJA 4BCMA 1REJA 3K3IA 3EWHA 3GB2A 2ERZE 5KBRA 4ZZOA 2UW3A 4EWQA 3GQIA 4OT5A 3WE8A 4DCEA 4QTEA 3CE3A 3FHIA 4RMZA 3TG1A 4WIHA 5M08A 4IFGA 3DNDA 2HXQA 3KF4A 5ANDA 4L7FA 3O51A 3FY2A 4YLKA 2HIWA 3TV4A 2OJJA 4EZ5A 3QQKA 5EOLA 1Q8TA 4FNWA 2Y6OA 3ZONA 4CT1A 2GNJA 2UW5A 4ZTHA 4APPA 3CIKA 3DJ5A 5FTGA 4GG7A 3AC2A 2UW9A 1ZYJA 4CV8A 3WZUA 2VO3A 3F66A 2Z7RA 4NTSA 3HRCA 4XBRA 4R3PA 2WMTA 1TQMA 2XK9A 3SQQA 3UZTA 4DCAA 3P4KA 5KX8A 5HOAA 4AZTA 3NUUA 5CSXA 1VEBA 2V7AA 3RK5A 3TNQB 3FQSA 4AX8A 4C4EA 4RFYA 3UIXA 1IA9A 3HAVA 5CZHA 1K3AA 2F4JA 3VHKA 5LXMA 3UNKA 4AZFA 5BVEA 3VBTA 3QTUA 3QYWA 5BUEA 4LL5A 4BF2A 3HA6A 2JITA 1IAHA 4TYGA 1PYXA 3DDQA 4O7YA 1Q24A 5CYIA 3Q6WA 1UKHA 2BUJA 2YN8A 4F7LA 3E63A 4U43A 4EHEA 4QQ5A 1Z9XA 4X2JA 5L8LA 3H0ZA 2FSLX 2UZUE 4O21A 5E8WA 3U55A 3UOHA 3FKNA 4MQ2A 4M84A 1NT2A 3MBLA 3FC1X 5FM3A 2YJSA 3B2TA 4HCUA 1Z57A 4FIJA 3ZEPA 2Y7JA 3KRJA 3RKBA 3BI6A 4CCUA 1URCA 3F6XA 3GBZA 2VWUA 2XYNA 3T9IA 4QRCA 4ANOA 1DI8A 5EH0A 1Q4LA 4H36A 1W83A 5FTOA 2IVTA 5E8TA 2XM8A 2F7ZE 4D2PA 3NVKI 5JFSA 2XEZA 4IWOA 3QRTA 2CNVA 2FSTX 5A14A 3O50A 1Z5MA 4YC8A 2VWIA 1T45A 4BN1A 1W84A 3SG9A 2IZSA 4NUSA 1R3CA 4AGWA 4UWCA 3G2FA 4IZ5A 3FI4A 3KRWA 4ASEA 2BCJA 3LQ3A 3Q9ZA 4WNPA 1JQHA 2BPMA 3PSDA 3NYOA 3F9NA 4UMRA 5HTBA 4XUFA 3E8NA 2XJ1A 4PQNA 5HCXA 3GNIB 1ZY4A 5IEYA 4U81A 5HNIX 4ZMEA 5E1SA 4BVUA 2R3NA 4L67A 3PWDA 3NVMB 4OTFA 4GKIA 2X81A 3TUBA 2YDJA 4AA0A 4TYIA 4BDBA 3P1AA 2O3PA 4XHKB 3D7TA 4QP4A 4EUUA 3OG7A 1KWPA 5ANEA 5CVGA 3W8QA 5H8GA 4FV7A 5HD7A 3AGLA 3LFNA 2X2LA 3D0EA 2EXMA 1UA2A 3TZ9A 1PMNA 1PXKA 3SXFA 3SDJA 4A7CA 3U9NA 3Q4ZA 4QTDA 5LMKC 3A61A 3KXXA 3PLSA 3NYVA 3LMIA 1PXNA 3AD6A 2O65A 4C3RA 3PVGA 4YZCA 2HWOA 3N4TA 4DT8A 3LMGA 3MA3A 3QLFA 4PDPA 5AAGA 5HBJA 1O6KA 3QD2B 2BKKA 2YJRA 5DLSA 3DXNA 5IA4A 4D2WA 3FI3A 4M66A 4AE9A 5IQGA 2P2IA 2AYPA 1QCFA 1PXJA 5FBOA 1CSNA 3NDMA 3PUPA 4FSYA 4DAWA 5CVFA 2JIUA 3R04A 3KULB 3NR9A 3SD0A 3GU6A 4QYFA 4C62A 3G5DA 3PVUA 2GHLA 3NUSA 3M1SA 3VQUA 3GUBA 3COIA 5HO7A 2XKDA 3BE2A 1OKVA 4DFNA 4J7BA 4PTEA 4KNBA 2H9VA 1OL5A 2Z7QA 4QP9A 4EK3A 3VUDA 2R3RA 2PVKA 4YBKA 3T3VA 3VN9A 3U4WA 3GVUA 1JPAA 5GJFA 2W05A 4JOAA 4EHGA 4AS0A 4FIFA 3TUCA 4DEAA 5CLPA 3B8RA 5IQFA 4TXCA 4UBAA 3MY0A 4IJPA 1H00A 2A19B 4OTWA 2WGJA 4UWYA 5EOBA 3TV6A 4ENXA 4F6UA 5JFVA 2C6MA 4FE2A 4ID7A 5LVOA 2GMXA 4BYIA 4KUJA 3A2CA 3LLTA 3O17A 1WVWA 3OHTA 2HOGA 5AP3A 5H9BA 4IM3A 5FGKA 4CFMA 4YJUA 5AV0A 3JYAA 3HEGA 2QKWB 3R1QA 4FG8A 4BI1A 1V0OA 3EZVA 1G5SA 4BBFA 4EH4A 2W06A 2CKEA 4HYIA 5DRDA 3DGKA 2XBAA 3LFEA 3AC1A 4QMYA 4OAVB 1KV2A 3ZUTA 1YXSA 4D9UA 3MJ1A 4EH5A 5AUYA 4IX6A 4MWHA 4E73A 4E93A 5IUHA 1FMOE 4CFVA 2RFDA 3UBDA 4HW7A 2UZEA 4JVGA 3C5UA 3D5VA 4IC7A 4WBBB 5E8VA 4OTGA 1VYWA 4C02A 2BIKB 3K5VA 4IX4A 4FVQA 4FV4A 4TWPA 2JKKA 5J9YA 3FI8A 3Q3BA 4IX3A 3PJ1A 5AP4A 1OL1A 2ITOA 2I0EA 2DWBA 4RJ4A 4GT5A 3UZPA 3L9LA 2WTVA 5CI7A 3WZJA 2DS1A 2J5FA 1OKZA 2X7FA 3E7OA 4O0TA 4L00A 3ZZWA 3TJCA 5C26A 4C58A 2UV2A 3PJ8A 3QTIA 4CMTA 4CZYB 1K9AA 4IX5A 2ZV7A 5CEQA 5BVOA 2EU9A 4O0SA 4CFFA 3D7ZA 3UYTA 3FE3A 3C4EA 4L8MA 5IUIA 3UTOA 1FOTA 3ZOSA 4F7SA 3S0OA 1J3HA 5E91A 4M13A 1WVXA 3FPMA 3BWJA 2ITWA 3OCTA 4WO5A 4H05A 4YBJA 1CKIA 5CSHA 3EQHA 2HW7A 2CLXA 3ENHA 3R9DA 3UNJA 4B8LA 3GU5A 2WMXA 4DBXA 2GFCA 2XZSA 5E8UA 4ACMA 4CKJA 4TT7A 2BTRA 4LG4A 4LOPA 3SG8A 3UOJA 3D15A 2ZM1A 3G6GA 4DEEA 3ZHPC 3TCPA 4LGHA 3A4OX 3FWQA 1ZMUA 3DV3A 4UYNA 3ODYX 4M8TA 1MUOA 5CF8A 3RCJA 2B0QA 2G2HA 2R64A 3QCYA 4LI5A 5FEQA 4BYJA 3JR1A 1GIIA 4C35A 4XJ0A 2WTKB 2OLCA 3K54A 2PZYA 3ATTA 2WEVA 5DR6A 1YOLA 2CKQA 3MIAA 2UZNA 4AG8A 4EH2A 4BDEA 4EOJA 4DC2A 3OUNB 2GU8A 3TEIA 3SW7A 5LMKA 4W8EA 2UW0A 1QMZA 2QOOA 3C50A 4CFWA 1ERKA 4OAUC 2W1CA 2W1IA 1JKLA 3MFTA 4ANMA 4PTCA 5FRIA 3FMMA 1QL6A 3C0IA 2J6MA 3HL7A 4KIPA 2B9FA 3MGYA 1YI4A 2CKOA 1KOAA 3BYOA 5IH4A 3WARA 3KGAA 4ACHA 3P7AA 5L2WA 2IG7A 1JNKA 1QPJA 3ACKA 3E3PA 1SZMA 3OXZA 3Q4UA 3RMFA 2QCSA 4LRJA 3V5JA 4F08A 5DBXA 1O9UA 2Z7LA 1H27A 3DBQA 2W1ZA 1R0PA 1XWSA 5DFPA 2ITTA 4DTAA 2JDOA 1XH6A 3W8LA 3CGOA 5GJDA 3G90X 4O22A 3TL8A 4EBVA 3R73A 4FTTA 1E1XA 2P33A 5EDPA 2W0JA 4LGDA 4O1OA 4YNOA 3IW7A 2QOHA 5HVJA 3AMBA 3R7VA 4AW1A 3A62A 3GU4A 3QQLA 5EHYA 5GJGA 1BKXA 1OIRA 5KZ0A 3RK7A 3ZRKA 1LR4A 2WAJA 4PP9A 5AUVA 3R7YA 1WVYA 1ZYLA 3CEKA 3Q9XA 2FSOX 2UZVA 1PMEA 4QYYA 1FPUA 3L8PA 4W4XA 3P7CA 4QD6A 4ANBA 5C8NA 4CYJA 4EONA 2W1EA 4GG5A 3ZLYA 3C7QA 4GV1A 3V5PA 1XO2B 4LUEA 4C4HA 4L68A 5T6KA 3VF9A 3JY9A 3C51A 4YO4A 3N4VA 4G3DA 5HNBA 5ACKA 1LP4A 4R8QA 3QXPA 3FSKA 4MXYA 5I4NA 2VAGA 2VTTA 5CAOA 4N6ZA 2VD5A 3D2IA 3MFSA 2OJ9A 1XJDA 3KEXA 2X4FA 3V3VA 4W9XA 4GSBA 4C2WA 1HCKA 5IQIA 4L43A 4G16A 1MQBA 4L45A 4M68A 4XG7A 4MHAA 3QWKA 2QG7A 3LZBA 4FGBA 4P5ZA 3MESA 3FZSA 3WZKA 4YJTA 4LOOA 2C6LA 2V5QA 4FTOA 2OG8A 4PDOA 3D94A 4BDAA 3PE1A 2GHMA 4TYHB 2YFXA 3NYXA 4B0GA 1XH4A 3UO5A 5CF6A 1ZAOA 4GMYA 3NLBA 3COKA 4LRKA 5FTQA 4XP2A 3TJDA 3ENMA 2C4GA 4FX3A 4JBPA 3KKVA 5M56A 3A8XA 4RWKA 4EOIA 4U42A 4EH9A 4QMPA 2CPKE 4EH7A 5AV1A 3UPXA 2C5YA 2ZB0A 2C6KA 1SYKA 4FZ7A 5J95A 3TKHA 4IH8A 3HUBA 5HCZA 5EQYA 4P7EA 1JAMA 3I1AA 5HG5A 2JKOA 4R7BA 2XIYA 2YCRA 3OBJA 4MTAA 2NRUA 3FAAA 3L9MA 2WQOA 4EKLA 4BZNA 5BVWA 2O5KA 2YDIA 4MKCA 4NZWB 5AR3A 3OW4A 3UP2A 5LVLA 4UZDA 4MXOA 3FMEA 3N9XA 4F1OA 4YZBA 1ZOHA 5EM6A 5B0XA 3EFLA 2JFLA 2ZDUA 4RA4A 4ZJIA 3BYUA 4BC6A 4E4XA 4YU2A 3AGMA 4UYAA 2ZVAA 4X3FA 2XMYA 2WHBA 1Y91A 4HPTE 3GFWA 3OD6X 4A9RA 4BTKA 4NWMA 3LFAA 4PP7A 4GK4A 2B54A 3KVWA 3DBEA 4CMOA 2LGCA 4CGAA 3RCDA 2Y4IB 5HX6A 3KFAA 1YDTE 2YAKA 4HOKA 4UX9A 3DBDA 1QPEA 2UVXA 5E8XA 2R7IA 3D83A 2IZTA 4OTHA 4D1SA 5CAVA 4X21A 3IKAA 3KK8A 3VUTA 4FG7A 4B7TA 4D5KA 3FXWA 3HDMA 4FTCA 4K33A 4M69B 4E6CA 2QLQA 1URWA 4FKWA 2QD9A 3EIDA 5ICPA 5DMZA 5I9YA 3HMOA 4K0YA 5HD4A 4D55A 2VWVA 3TT0A 3FXXA 3IDCA 3IG7A 1XHAA 4RLKA 2YIYA 2VV9A 2WZJA 4MWIA 3SKCA 3HMMA 4NFMA 4FYOA 3PA4A 3Q9YA 1DM2A 4CQGA 4G2FA 2PZIA 4DEBA 1YHVA 2F2CB 4NIFA 4G1WA 4KIKB 3BHVA 3RP9A 2CGXA 4GW8A 1S9JA 2A4LA 2VX1A 4YMJA 4FKOA 4R78A 3GCUA 4FKGA 5HE0A 1MP8A 3C13A 3QCQA 4AU8A 2H34A 5I0BA 3VS5A 4OTIA 3IPHA 4Y85A 2VX0A 2BILB 3MPTA 4ZSLA 4HNFA 4FV5A 5AR7A 4ZTLA 5CSVA 3PJCA 4ZZNA 4PDSA 2Z8CA 3FLNC 2WB8A 3P86A 4IFCA 2VTNA 4BDDA 4DTKA 3OP5A 4RPVA 3KXGA 2C0TA 3Q53A 4CLJA 4EKKA 5L2IA 2A1AB 5KKRC 5HI2A 3CC6A 2E9UA 1Y6AA 4FSZA 3I6UA 3LMHA 4L3LA 2ZDTA 3TDWA 5EM7A 4L3JA 1PXOA 4A07A 1OGUA 1GZ8A 2PMNX 4KKGA 2XIKA 3BQCA 4R77A 5EQPA 4NEUA 4BTMA 3E8CA 3WF7A 5IG1A 1NVRA 4YGAA 3ZC6A 3HX4A 2X39A 3CBLA 5TKDA 5EYDA 3OW3A 2WOUA 3OTUA 2YLFA 2ZMCA 3PPKA 3R7IA 3NS9A 1GIJA 2FH9A 4EOQA 4E5WA 5KMIA 5J9ZA 3FQHA 4IVDA 3COHA 2C6OA 4XOZA 2OJIA 3BIZA 4FZDB 2R3HA 4JRVA 5AUXA 5IQBA 3CD3A 2QI8A 4M15A 4YO6A 4ACDA 5K0XA 3KVXA 4O7WA 3P0MA 3M11A 2BZIB 1U59A 2YCQA 4H58A 4QMWA 3RK9A 4CLIA 4E20A 4BY9E 2QOKA 4AOJA 4I94A 3VHEA 5DH3A 4DH8A 1NY3A 1ZZLA 4IJ9A 3OWPA 5J5SA 3POOA 3ZSGA 3F3WA 5IA0A 1BX6A 2IVSA 2WELA 5IA3A 4CG8A 5J8IA 1RDQE 1R1WA 3BKBA 4PRJA 4RIXB 3VVHA 4XLVA 4RWLA 3AOXA 3PXFA 3PVWA 4WT6A 3PIYA 5JN2A 4QPSA 5JQ8A 3LCSA 4G3FA 4QMOA 4C36A 2YIQA 3KK9A 2X8EA 4OBOA 5A9UA 5FD2A 4EH6A 3CKWA 3RNYA 2CJMA 5EHOA 3WILA 1AGWA 1M2PA 1BMKA 3BWFA 1OVEA 4YHTA 3NWWA 4YJOA 3RWQA 5AJQA 3RZFA 4GYGA 3OEZA 4UXQA 2OF2A 4V05A 3OS3A 4XG8A 4J8MA 3QHRA 4BCOA 3EN5A 2CGUA 2PMLX 1JVPP 1UV5A 4DTBA 3QD0A 3E87A 4AT3A 1OPLA 3R2BA 4CD0A 2JDVA 2VU3A 1G8SA 4OUCA 3REPA 5J1WA 2BAQA 2NPQA 3Q5IA 4MCVA 1Q5KA 1U54A 5K5NA 4TYJA 4AQCA 3ZS5A 4AACA 5LVPA 5M4UA 1OKWA 1YI6A 3UE4A 1LUFA 3VW6A 3IOKA 2FB8A 3R02A 3R28A 5C9CA 2WIHA 4IAKA 5HX8A 2HENA 3QZFA 2WTDA 5CF5A 4NM0A 3VC4A 4QMTA 4TTHB 2YCSA 4D2TA 3GCVA 4FL2A 2RSVA 4FSRA 4W4YA 5IKWA 2JLDA 3W32A 3I6WA 1PF8A 3ZRLA 5FUTA 3GCSA 3QD4A 5HBEA 4B8MA 3ZZEA 4Q9ZA 4JAIA 2UW8A 3OOMA 5D9HA 1ZY5A 3VS6A 3FYKX 4V04A 3AXWA 4CNHA 5ITAA 3F5UA 3FMJA 3K2LA 5JGDA 4PUZA 3E64A 4PMSA 4LMNA 4UMUA 5AA9A 4PMTA 5DIAA 4LUDA 3BU3A 2WXVA 2W4OA 4ZTQA 4PNKA 5J87A 2PUIA 3P79A 3IGOA 4BKZA 3AG9A 3BYMA 5LJJA 3GC9A 2JKQA 3R2YA 4FKPA 2EVAA 2OIQA 3CXWA 3RAIA 2BVAA 1WCCA 3F3VA 3OOGA 3VNTA 3SC1A 2W5BA 3AT2A 3Q52A 2RFSA 4HVDA 3TZ7A 3EN9A 2PWLA 3FZTA 3I60A 5HTCA 5HGIA 5LVMA 3KL8A 4DINA 4XYFA 1U46A 4AT4A 5KBQA 3BLQA 2JKMA 2EB2A 4QPAA 3VRZA 4AF3A 5M4FA 3LFQA 4O7TA 3AD4A 4XV1A 3Q04A 4GK3A 4BCIA 4YSMA 1IASA 3DZQA 3FV8A 3DLSA 4MNFA 4TN6A 4U79A 1NVQA 4H3PA 5F95A 1XH9A 1JLUE 1M2RA 4DA5A 4GFMA 3DCVA 4GVAA 2HYYA 1OBGA 2WOTA 2W1DA 2JC6A 3PFQA 5HHWA 4ASXA 4O2PA 3ZLSA 4F63A 2W7XA 4FV0A 2GS2A 3DK7A 4RWIA 4WNOA 2OU7A 2C47A 2R9SA 2VTOA 2O64A 4BBEA 3BHTA 3KRLA 3QTXA 1OITA 3LJ2A 3QGWA 3CTHA 5CU3A 2Z02A 4KB8A 1P5EA 5A4LA 1PKDA 1TQPA 4WBOA 1OUYA 4GL9A 2W5HA 4HGEA 3NW6A 2Y9QA 5E8SA 5JGBA 4QP2A 5CI6A 5TE0A 5D1JA 4IADA 4Z7GA 4ANLA 2HK5A 5CT7A 3GU8A 1KSWA 4JT3A 4RC2A 1WMKA 4BCJA 3PY1A 4D0XA 4FI1A 1PY5A 3EB0A 2OF4A 2BIYA 1MRUA 2C1BA 2OFUA 1W8CA 2WMRA 3WF6A 2QO9A 4IE9A 2BRNA 4E6DA 4E8AA 5IQDA 3H3CA 1YDSE 4IVBA 2ZJWA 3HVCA 1YVJA 4EQMA 4HVGA 4YJVA 4C57A 4DYMA 5BUIA 5EQEA 5TT7A 2JBOA 1Q3DA 2XM9A 4FTLA 2AC5A 2P55A 3G51A 5ANIA 3UNZA 3MJ2A 5H3QA 5JQ5A 2YDKA 5CQWA 3PDTA 2R7BA 4FV1A 4CG9A 3JPVA 3ZC5A 4F9YA 2BFYA 3SX9A 5HU9A 1RQQA 4RIYA 5BYLA 4DHFA 1SVHA 2VO6A 2OI4X 4U97A 2ZB1A 3IONA 4YJQA 5CU6A 3SGCA 2XK3A 3EH9A 3G9NA 3NW5A 4RWJA 2CMWA 5DNRA 4I6FA 1FINA 2HELA 3S00A 4AWIA 3V5QA 4DFLA 2UW6A 4DG3E 3CS9A 2R2PA 1W0XC 3W2OA 1X8BA 3VULA 3U6IA 1H07A 4KKEA 2VO7A 5FQDC 5AV4A 3LCOA 2NO3A 2B9HA 5AR5A 2YM8A 4FKVA 2XKEA 2JIIA 1UU8A 3UMXA 5I3RA 5D11A 5DE2A 1ZARA 2WQMA 2HY81 3E8DA 4HCVA 4L53A 2XCKA 3SOAA 2PVFA 1OUKA 4BZDA 4X2NA 3DB8A 3QQHA 2XNGA 5H8BA 3R00A 4AZEA 3JUHA 2C69A 3OCGA 2C3JA 3W18A 3FUPA 1HCLA 2Y8OA 1J1CA 3PYYA 4NW6A 3ORTA 3WI6A 1UU3A 2B9JA 1YWVA 3KXZA 4LV5A 2J7TA 4IW0A 3KMWA 5EM5A 4JDJA 2JDRA 3OROA 2WEIA 4MXCA 3QZGA 5DGZA 1SNXA 3D5WA 2OZAA 1XKKA 5DHJA 4UWBA 3E5AA 3EFJA 4UEUA 3MFRA 5C27A 3U87A 1VR2A 3OCSA 5AP1A 3RJCA 4BTFA 5I9WA 3OBGA 3W55A 1I09A 4CKRA 4FSUA 3H9RA 5FDXA 4FTJA 4EK4A 3EJ1A 2XIZA 4GRBA 4AGCA 4IAZA 5J79A 4JDHA 2GPHA 4QT1A 5EG3A 2E9VA 4UMPA 3QAME 3SXSA 3FMHA 4I5MA 4MNEA 3Q2MA 3P5KA 1PJKA 3CR0A 5HLNA 5A4EA 2BDJA 2OIDA 4RX7A 5DG5A 4FICA 2XK4A 3NW7A 4JBOA 5AUZA 5G1XA 3FHRA 5TF9A 4IIRA 2X9FA 2OIBA 5F20A 2X2MA 2BR1A 5AX9A 3F3UA 2RGPA 3MB6A 1A06A 3QGYA 3R1NA 1JSTA 3HKOA 3UPZA 3NCGA 1M7QA 1PYEA 5HE2A 2GNFA 1BUHA 2XEYA 3D4QA 4RVMA 2R3LA 1JSVA 2OKRA 4DBNA 2JFMA 4F7JA 5DWRA 2V7OA 3R8MA 4DFUA 5BNJA 2VTIA 2RG6A 1XH7A 3FLWA 4JAJA 4IM2A 4AZSA 3TNIA 4I0SA 3PPZA 4XV3A 1ZMVA 4GIHA 4S2ZA 3ZBFA 2GQSA 3PPJA 2VZ6A 4GT3A 4F1MA 2RFNA 3NIZA 2EUFB 3DAJA 3PZHA 4MX9A 4C7TA 4ZY4A 1GZKA 3CPCA 2LAVA 2XNEA 4P90A 2CDZA 1L8TA 4QP3A 2W17A 2JAVA 3OXTA 4K6ZA 3SXRA 3CD8A 5T68A 4AW5A 1DAWA 2X9EA 4IAYA 3U8WA 1JOWB 4BFMA 3C4XA 3UC4A 3PLAE 4J95A 4IAAA 3H9FA 4U3YA 4FA2A 4BICA 4H3BA 1RW8A 3UC3A 2HZ4A 4C3FA 3MW1A 3VS7A 3TNPC 3V8SA 3KXHA 4U3ZA 3P08A 3PXQA 2GNIA 3UGCA 3SVVA 1VZOA 1S9IA 4CTBA 1BLXA 3NCZA 4JX3A 4CQEA 2ZMDA 3KQ7A 3MV5A 3WF8A 4C4IA 4PL5A 5KUPA 1M14A 3B2WA 3QKLA 3R7GA 2W96B 3U6JA 3IW8A 3HP5A 2SRCA 4YPDA 1CKPA 5F4NA 3BGQA 2I0HA 3CY2A 3HV7A 4S31A 3AMYA 5CSPA 2J0KA 2QOBA 3BHUA 5A46A 4DGGA 3FLZA 1WBWA 2IW9A 4Q5HA 3HMNA 3S4QA 4IQ6A 4IWQA 4GK2A 4X3JA 2PUNA 2VNWA 4O6LA 5BPYA 4RJ3A 5CWZA 4O86A 3MB7A 1TKIA 3MVLA 4G3CA 4IB5A 3UIBA 3PVBA 2YCFA 2W9FB 4IDVA 2YM5A 3ACJA 3BV3A 2P0CA 1GZOA 3F2NA 1WBVA 2R0IA 5HESA 5KHXA 1YHWA 2V62A 3KCFA 1OECA 3BELA 3DJ6A 4C4GA 2R3JA 3DBCA 3W2PA 2PMIA 3EYHA 2C0OA 4NW5A 4RIOA 4XBUA 3EYGA 3RM7A 5AR2A 5LCKA 5JFXA 5JKGA 1BL6A 3R9RA 2BAKA 4GU6A 1OIUA 3QWJA 5HBHA 4CFXA 2QLUA 5HIEA 4J53A 3SRVA 5JGAA 3BYSA 4I21A 3V5TA 4GKHA 5B2MA 2PVMA 4LRMA 3HECA 4RQKA 4E5BA 2BROA 4PL4A 4YTHA 4PDYA 5HO8A 3FC2A 4BCKA 4MVFA 1HOWA 1SNUA 2J50A 5KMMA 4GJ3A 1H25A 3GC0A 3VW8A 3L1SA 4X2GA 3V6SA 1LEWA 4QQTA 5JT2A 4HVSA 3WF9A 5CASA 4I0TA 2WQBA 2KTYA 3CJGA 4DFZE 4V0GB 3D14A 2NP8A 3UQCA 2Y4PA 5J7HA 3LE6A 4WNMA 1CM8A 2PVYA 2QVSE 4X3FC 4XV2A 4YLLA 3LFBA 5AP6A 3TN8A 3KXMA 4AT5A 4D4RA 2JGZA 4BBMA 4WHZA 3MN3A 4R7IA 3ZYAA 5M09A 4J99A 5CTPA 4XOYA 4BWXA 2E9OA 4FODA 4ZSJA 5GZ9A 4JJRA 5HORA 2ETRA 4O7RA 2WTIA 4G31A 5AV3A 3ZFXA 2YIRA 5A3XA 4EK6A 1Y8GA 3R6XA 2CSNA 2UZBA 4RX9A 2H8HA 1MQ4A 2BZHB 3BV2A 4O1PA 2BRMA 2FUMA 3JVRA 2IVVA 4MXXA 4DG0E 2OFVA 4HGTA 1YXVA 2W9ZB 4XG4A 3P23A 4U0IA 4X3FB 3VJNA 1JSUA 3KB7A 4C34A 1GNGA 3AT4A 4XRLA 4HZRA 2VTQA 2OXYA 2HWPA 3O8UA 2VTHA 2EXEA 1KE7A 3R8LA 3UJGA 2B1PA 3HUCA 5ETAA 3ZO3A 4II5A 5GIPE 2BHHA 4QMQA 3TZ8A 2ITUA 4FKQA 2X8IA 4KD1A 4FBXA 3B8QA 3BX5A 3GCPA 3A7IA 4AGUA 3NNUA 2F49A 2PPQA 3PG1A 3O71A 5EW8A 3UG1A 2G9XA 4GH2A 4CZUA 3DKGA 4IZYA 5AR4A 5LCJA 1YXTA 1PXPA 4BCNA 4Z16A 3BYVA 1FGIA 4XG9A 5H2UA 3PIZA 4F99A 3C0HA 5CEKA 5J9LA 3QX2A 5CQUA 4U41A 4CRLA 3LOKA 5AP0A 3W2RA 2VWZA 2XA4A 3ZO2A 1YXXA 4K11A 2PK9A 4G5PA 1GIHA 4EOPA 1ZLTA 5GZAA 3EL8A 4FIHA 2QOLA 2HZIA 3EL7A 4YPSA 3UG2A 1IEPA 2X7OA 3F88A 1XBAA 3UMWA 3QUPA 2IPXA 3R9NA 2E2BA 5M4IA 3UODA 3DDPA 2I0VA 3F3TA 4Y5QA 4NK9A 3ANRA 4BGQA 4EUTA 4HZSA 4AA5A 3CP9A 3LIJA 3DT1A 3KA0A 3O23A 2WMAA 3PP1A 4KBKA 2EB3A 4NIFB 3ZXZA 3DQXA 4BRXA 4O0XA 4O84A 1JKSA 3GI3A 3TZMA 1H0VA 2PL0A 2CNQA 4QNYA 4E7WA 2YEXA 3MA6A 5ETFA 3AQVA 2Q0NA 1CTPE 1W82A 1ZOEA 4ANSA 5HZNA 4E6QA 2PTKA 4Y5HA 2YM7A 3JY0A 2FSMX 4KSPA 4Q9SA 4XX9A 5H8EA 2V22A 5IUGA 5LWNA 2C6TA 2VN9A 4U8ZA 4ACCA 4C4FA 4MEDA 4WUNA 2QHNA 3QQFA 5C8MA 3LXNA 4EI4A 3EFWA 2Z2WA 2GTMA 5IDPA 2OH0E 3DA6A 2ZM4A 5DT3A 2OW3A 3PZEA 3HRBA 3RHXA 4X7QA 3BCEA 4R6VA 1PMVA 1ZRZA 2BFXA 5CU4A 3ZDUA 3GFEA 5I9UA 5KZIA 3UIMA 4RFZA 3ETAA 1WBPA 1R0EA 3EKKA 4JDKA 4PNIA 3ALOA 4L46A 5E8YA 4ZS0A 4XG6A 2GQRA 4YUQA 4NCTC 2BDFA 5AM7A 3ZLWA 4KS7A 3GXLA 5HTIA 4OTRA 4KBCA 4WRSA 5IMXA 2XJ2A 5CANA 2C68A 4HGSA 2QC6A 3OWJA 3KY2A 3HNGA 5L8KA 4CFUA 3IK3A 1XBCA 4FSWA 4BIBA 5BVKA 3MI9A 4G6OA 4ONAA 5E92A 2RF9A 3NSZA 3WOWA 3ZRMA 3DKOA 3MPMA 3V04A 3WYXA 4DITA 2PVRA 4BB4A 4QTCA 1ATPE 4XS2A 3BGZA 3DQWA 4OTDA 5C8KA 3C5IA 4AXAA 4FKTA 4TRLA 3IOPA 1GAGA 1U5RA 4FF8A 4J8NA 4KSQA 2YACA 4NTTA 5TOZA 2PULA 5CU0A 4EOOA 4XNEA 2B7AA 2PY3A 4FIIA 4ZLOA 4AOIA 2WTWA 4TYEA 4AOTA 5BX0A 4O7NA 2BALA 5HEZA 3ZM9A 4EYJA 3E88A 4FL1A 5AM6A 5TR6A 3VQHA 1UNHA 4ANQA 4ZMFA 1WFCA 3O7LB 3TTJA 3TKUA 4MD9E
chains in the Genus database with same CATH superfamily
5FXRA 3AC8A 3FI2A 3QUDA 3QCSA 2WTJA 4NJ3A 4F9CA 2HCKA 2YERA 2UW4A 2WIPA 4PWNA 4ZK5A 3BQRA 3LFSA 4FT0A 3UYSA 1ZOGA 3VWAA 1OIQA 4DFBA 4RLLA 2BRGA 5I9ZA 1OM1A 1PHKA 4G6LA 3PY0A 4ZIMA 4J52A 4QQCA 2HZNA 4IBMA 3DS6A 2BDWA 1XH5A 1SMHA 3C1XA 4G5JA 4IC8A 5DEYA 2OJGA 5AWMA 3QD3A 5JZJA 1U54B 5ACBC 3E92A 4FV3A 3PXZA 5FXQA 4AZVA 3ORPA 3M2WA 3ZU7A 3C4CA 4YZ9A 5K4JA 4ALUA 5KMLA 2QODA 4YR8A 4D58A 3O0GA 4O82A 2J90A 2XNMA 4IZAA 2XKFA 5I5ZA 3G0FA 4MD7E 4DEHA 2JIVA 4ZAUA 4DHIB 4I6QA 2UUEA 1KE5A 3BBWA 2RG5A 4C2VA 3F5PA 3V5LA 3NPCA 4J97A 5FP5A 2X7GA 4BCPA 3KN6A 3OMVA 3BEAA 2W99B 5LMAA 4XLIA 2C5XA 2VRXA 4Y72A 3LAUA 5A6OA 4CEGA 3VRYA 1Q62A 4YP8A 3R1SA 2JAMA 3GQLA 4QEBA 3EQCA 2ERKA 4I6BA 1YRPA 1CKJA 3CKXA 2B9IA 4F65A 5BVNA 3HA8A 4ZLZA 4O91A 5L2QA 2J9MA 1VJYA 3S3IA 1PKGA 3MY5A 4IMYA 5JH6A 1KE6A 2G2IA 4CV9A 4D4SA 4H1MA 3LPBA 4BGHA 2QG5A 3KMMA 3G0EA 2CN8A 1J91A 3GOKA 3R7OA 3BBTB 4MAOA 3MWUA 4J71A 3V51A 2BRHA 4BL1A 4F64A 3I4BA 1M2QA 3QRJA 5L4QA 3SAYA 4E4LA 4O7ZA 3NUXA 4BJJB 4DH3A 1H08A 5AEPA 2PZRA 3LCTA 4FTKA 3FSFA 4ASZA 3UDSA 1FGKA 5DVRA 3HGKA 1OKYA 3RZBA 4OBQA 2XK7A 3FL5A 3AC4A 3MDYA 2PE1A 4BHZA 3WE4A 4F7NA 2XYUA 5KKRB 4F70A 3ULZA 3WZEA 4HJOA 3RALA 4D2SA 3F61A 2BZKB 3HV5A 1IA8A 4MF1A 5KO1A 3QZIA 4MQ1A 2O63A 3CQEA 3FMLA 1H8FA 4K77A 3LCKA 4U6RA 4YC6A 4EOKA 4RFMA 5EI2A 4CFNA 3H9OA 4LV8A 3F7WA 3ID6C 3PP0A 2QOIA 5KCVA 4NCTA 2VX3A 3QC9A 4ASDA 2VTMA 2V55A 4R3CA 4XEYA 3RAKA 3EFKA 3R7UA 3Q9WA 5AIKA 1OI9A 3II5A 3QFVA 2H6DA 2CKPA 4FEQA 2J0LA 1Q41A 5HNGA 3KF7A 1L3RE 2R3MA 4YTCA 3ZCLA 3R83A 5LQFA 1JKTA 2XF0A 3NZ0A 4FIGA 4USDA 3BLAA 2ITYA 1Q8WA 4DGNA 5M06A 2IW6A 4PMPA 5D10A 5DT4A 1J7IA 2CN5A 2J5EA 3TM0A 4U44A 3OUKA 4ZTRA 4G9CA 4HGLA 5AUTA 2QURA 2WFYA 3SHEA 3HRFA 1UKIA 5IQCA 3ELJA 2YABA 3GEQA 3LHJA 4WG4A 3RHKA 4JS8A 4AUAA 4EOSA 4BI0A 4AN2A 1EH4A 1IG1A 4M12A 2RL5A 3OCBA 3TI1A 5HE1A 4ITIA 2WMVA 4KA3A 4KWPA 4RIYB 3JS2A 4C59A 2QHMA 3NYNA 4X2KA 5IMEA 4TNDA 4WNKA 2XKCA 2A0CX 4Y73A 4A4OA 4E6AA 1W2DA 5CAPA 4UXLA 4Z9LA 4BDHA 4C0TA 1P14A 1GJOA 2V0DA 4BDIA 4YJPA 4Y8DA 3RM6A 1Q99A 4JR7A 4ZTMA 3QTQA 5BMSA 3VBYA 2I40A 4DLJA 5M53A 3ZSIA 4GFOA 5L8JA 4IZ7A 5CAQA 3QTSA 3RWPA 4BCGA 2CLQA 3Q60A 2R3KA 2X4ZA 3TNHA 3HDNA 5EYKA 4ZY5A 1K2PA 4AGDA 4ACGA 3ZMMA 3KMUA 3DFAA 4C61A 1ST4A 4AXEA 4HCTA 1H1WA 3EN7A 5CU2A 3MSSA 3SOCA 4AE6A 3U54A 4P5QA 4DN5A 2GS7A 1IR3A 3NUNA 4WSQA 4O0WA 4RZWA 1APME 5LOHA 3R8PA 4JBVA 4CMUA 4XP0A 2IVUA 4C33A 4EK8A 4HNIA 2P4IA 5L6WL 2G1TA 1Q3WA 4NT4A 4NJDA 5CEIA 3Q32A 3BE9A 4PY1A 2J2IB 3Q4TA 4CCBA 4B4LA 3VBVA 4IB3A 3FMKA 3FZ1A 3LM5A 3G15A 5DPVA 4OTQA 4D2VA 4X2FA 5HIBA 5C4LA 4NU1A 2O2UA 3QZHA 2PUUA 1FVVA 2GTNA 3GCQA 1PXLA 3BHYA 4AQKA 1Q8YA 4EWHA 5CXZA 5KNJA 4JIAA 5ANKA 1W2CA 4AN3A 5K4IA 5M44A 4QMXA 5M07A 3OXIA 4GS6A 4JL9A 5B2LA 4WG5A 4WOVA 1WBOA 2OZAB 3O96A 3KXNA 3GU7A 4DDIA 4KINA 2I7QA 3A8WA 1V0PA 1AD5A 1H1SA 2BTSA 3F69A 3GT8A 4JI9A 4RIWA 4NL0A 2VTJA 4ORKA 5GINE 4TNBA 1NW1A 4QO9A 5HQ0A 5IQAA 1PRYA 3E62A 3U51A 4FKJA 2F9GA 1XQZA 4M7IA 2VTRA 5M51A 2X0GA 3S95A 3PJ3A 5ETCA 4YTIA 4O7LA 4FOBA 3VS3A 3W2QA 4QQJA 3R21A 4ZLYA 2VWXA 1R78A 2QR8A 4H1JA 4O0UA 4JRNA 3D7TB 3CY3A 2OO8X 3F3ZA 3ULIA 4I6HA 3ZTXA 2JEDA 3F2AA 4L44A 3OWLA 4I5CA 4NFNA 4FEXA 4KRCA 2J0MB 1BI8A 4MBIA 4EZ3A 4BKJA 3MPAA 5IA2A 3IDPA 4LM5A 3V8WA 2IJMA 2J0JA 3E7VA 3LVPA 3OTVA 2Y6MA 4FVPA 4NSTA 1PMUA 4I5HA 2PHKA 3DZOA 4S30A 5HKMA 4B6LA 4O7SA 3ORXA 3E3BX 3RAHA 4EJNA 2R3GA 3EOCA 4E3CA 3VUMA 4J96A 3QQGA 4QDVA 3EZRA 2IZUA 4K18A 2VTAA 3CPBA 4JLCA 1W7HA 4K2RA 5DN3A 4CKIA 4DLIA 1ND4A 2J51A 3QLGA 4L42A 2E9NA 2PE2A 3FY0A 3ORIA 4FOCA 4O4CA 4A9YA 4O0YA 5E7RA 3LLAA 4E4MA 5K5XA 3FLQA 5ANJA 3THBA 1UWHA 4R5SA 3W0PA 3PXKA 2REIA 1FBNA 4IVCA 3R1YA 5AA8A 4E5AX 3HLLA 1OL6A 4D4YA 4IXPA 4K8AA 4YJSA 5AIRA 4KRDA 4U5JA 3EQIA 4PTGA 4EOMA 4ZTSA 3RPOA 5CALA 3KN5A 3DXPA 4CXAA 3BLHA 5BQ0A 3PE2A 3HAMA 1RE8A 4KIQA 4N70A 3E8EA 1VYZA 4QYGA 3TWJA 3QBNA 1J7UA 3F5GA 1RJBA 4WSYA 5C03A 4ZEGA 3MH3A 2ITQA 1MRVA 4ERWA 4FNYA 4O27B 3FDNA 4YJNA 3L8XA 5DR9A 5JFWA 3C0GA 2YA9A 1Y6BA 2DUVA 3PXRA 5JSMA 3LQ5A 4Q5EA 5CT0A 4TKSA 5AUUA 5KMNA 3D5UA 4FGRA 4AW0A 3CSVA 1UU7A 4E4NA 3I5NA 4JMQA 4XG2A 4NM5A 2WMSA 2JDSA 3SV0A 3CJFA 3DNEA 3LXPA 3ET7A 3ORKA 3UVQA 1BL7A 5HO6A 3I7BA 3FBVA 1F0QA 4EZ7A 5CS6A 4RVTA 2YISA 3DY7A 3FZRA 1I44A 2C30A 4FKSA 3F82A 4FUXA 4FT3A 4QYEA 5BVFA 4DDGA 2ZM3A 3C4ZA 4FV2A 2X8DA 4J1RA 4GFGA 4DGOA 2PVLA 4JX7A 2VWWA 4MH7A 3BLRA 4NM7A 3FPQA 5CAUA 3SW4A 4O4BB 3EMGA 5HU3A 2Z7SA 2GS6A 3O8TA 3A4PA 1GY3A 2QO2A 3KCKA 4BDKA 4F0IA 1FQ1B 3O2MA 1REKA 2PZPA 2Q0BA 2ZYBA 4YJRA 2C1AA 3TV7A 3IGGA 2P3GX 5DRBA 1B6CB 3CQWA 5EHLA 4HYUA 3UVPA 4I4FA 4ZTNA 3ZSHA 4A4XA 5AP7A 3BL7A 2J4ZA 3JXWA 1CMKE 1DI9A 4ITJA 4GYIA 4C38A 4PF4A 2FGIA 3TUDA 5HE3A 4D1XA 4V01A 3M42A 4AFEA 4A06A 2WTCA 1ZXEA 2QOQA 3A7HA 3SRVB 3F2RA 5HVYA 4DEDA 4N57A 1F3MC 3WYYA 4ZJVA 1A9UA 2C6DA 4IVAA 2BKZA 4Y95A 5LARA 3UP7A 2NYAA 5C1QB 1OMWA 3ZUUA 2VGPA 3MVJA 4YZDA 3EQFA 4U9AA 4XH6A 2IWIA 4YNEA 2RIOA 4AN9A 2QR7A 2YZAA 3NUYA 4MBLA 4FEWA 4R7HA 1DS5A 3R01A 3ZDIA 4RVLA 3TACA 3VJOA 4IWDA 4DGLC 1NA7A 4FZAB 4QOXA 4RVKA 4BCHA 4UN0C 4JIKA 3VUIA 4DF3A 4GCJA 3NUPA 4PMMA 4NH1A 2HZ0A 4YLJA 4BCQA 4O83A 3ODZX 4RZVA 4AP7A 5C4KA 3MTLA 5L6OA 4O2ZA 2ITPA 3L8SA 4TPTA 4YTFA 2BMCA 4GIIA 2C6IA 3EQDA 4EQCA 1OPJA 4KABA 2X0QA 4N4SA 3HZTA 5K0KA 2X6EA 4KS8A 5HCYA 4YURA 3ANQA 3R71A 3GC7A 3ORMA 3SLSA 3P9JA 2OXXA 4QNAA 4O96A 4UB7A 4BDJA 3MY1A 4AAAA 4DHJA 2UZWE 4ZXTA 1H1PA 3ORNA 3C4FA 5D7AA 4BIDA 4ZSGA 3UDTA 4DH5A 3KREA 4U45A 3R9HA 3P78A 4OR5A 1Q8UA 2XJ0A 3BRBA 2IN6A 5HIDA 5EYCA 5IH6A 3T8OA 3PUFC 4AA4A 4O7VA 2OICA 4LFIA 1OL7A 3LQ8A 3MH2A 1WAKA 4USFA 5EK7A 2UZLA 2PE0A 2VO0A 2O8YA 1OZ1A 2UZTA 3FKLA 4P4CA 2AQXA 4QTBA 5LWMA 5M4CA 3NAYA 2Y0AA 4FTUA 4N0SA 5FM2A 2UVZA 4M97A 4O4EA 5AFVA 2PUPA 3BU6A 2YIXA 3L9PA 2C3LA 4MK0A 2A2AA 4EJ7A 4GU9A 2XK6A 3TTIA 3BPRA 2ITXA 2VWYA 2XNOA 4I93A 3R8ZA 4EC8A 4WA9A 3FJQE 4F6SA 5AAEA 3DAEA 3HV6A 4UMQA 4G3EA 4JG7A 3OEFX 3R8UA 3UOLA 4EEVA 5L6PA 4UALA 2ZAZA 2EXCX 2OH4A 4RG0A 1G8AA 4AAYA 3NAXA 2XCHA 2XH5A 1ZMWA 4ZJJA 5ETIA 2PSQA 4FTAA 4EBWA 4R1VA 5GZ8A 5GIOE 1LEZA 4FJVA 1Y57A 1W98A 4DFYA 5IF1A 5K9IA 4NYEA 3EKNA 4FKRA 5FDPA 5FG8A 1FVTA 4RSSA 5IA5A 3R7EA 3I7CA 4DG2E 3MH1A 2C5NA 1UVRA 5AAFA 2WD1A 2EWAA 4FL3A 2F57A 3U6HA 1PXMA 2C3IB 2GHGA 3Q6UA 4RX8A 4FV9A 1SVEA 2FVDA 3GP0A 3QA0A 4IDTA 4FZ6A 4QMSA 4CRSA 3RGFA 3GENA 4TWNA 1J7LA 4HYSA 1P2AA 3RPSA 4EK5A 1U4DA 5EW9A 3OVVA 4OGRA 4CYIA 2VNYA 4ANNA 2PMOX 5IH5A 2XK8A 3I5ZA 1O6YA 4YZMA 2ITNA 3PXYA 5HG9A 3W33A 2PVHA 5FEEA 3Q96A 3T3UA 1B38A 2NNWB 3QKKA 5AP2A 3P7BA 2QKRA 1M17A 4M67A 4K1BA 4IWPA 1YOJA 3OFMA 1H28A 3ITZA 4IAIA 3QX4A 3IS5A 4BI2A 2F7EE 5JRSA 3H30A 3RAWA 3ZLXA 3O7LD 4F9WA 1G8JA 3CQUA 4GUEA 1YI3A 3FQEA 1WBTA 5G6VA 3QC4A 4FR4A 5C01A 2HY0A 4GT4A 1SVGA 4UY9A 3A7FA 2GQGA 4M0ZA 5EW3A 3ALNA 3UDBA 4QTAA 3VUGA 1ZYCA 3NMUF 2I0YA 2OJFE 3QRIA 4L01A 3VS2A 2VTLA 4LOQA 3TIZA 3CLYA 4C37A 5A4CA 3KRXA 3RI1A 2FYSA 2YM3A 4BDFA 2WMQA 4EOLA 3DB6A 2WTKC 3DTCA 3CTJA 3AC5A 2WKMA 3FZOA 4QMMA 4D28A 5E90A 3VF8A 3RNIA 4D4VA 3HV4A 3PG3A 5J1VA 4MD8E 2PYWA 2YHVA 3L9NA 2C5VA 2C5OA 5KMJA 3LCDA 4W4VA 4APCA 4JQ8A 2CNUA 4BZOA 4F09A 3NNXA 4XG3A 4G6NA 4PL3A 3VAPA 3Q4CA 2WQNA 4R5YA 4TWOA 2OBJA 3GOPA 3WF5A 4BDGA 5CSWA 3VBWA 1H0WA 4Y83A 1YKRA 4DH1A 4MF0A 1CDKA 2QQ7A 2IW8A 4Y46A 3U9CA 5AX3A 2AC3A 2RFEA 2YIWA 4M3QA 3KULA 5CEOA 3D9VA 2UW7A 2C6EA 4WD5A 1DAYA 3DLZA 4TL0A 2IF8A 5DI1A 3RPVA 3FMDA 2C3KA 1PXIA 2W1HA 3W0QA 4X0MA 4BIEA 4A4LA 3W10A 3ZUVA 3QTWA 1OBDA 4MBJA 5CY3A 3VS4A 5KHWA 3UIUA 3OC1A 3MYGA 4FNXA 4ZS4A 1KV1A 4GVJA 5CVHA 3LM0A 4CSVA 2XRWA 3W16A 1UU9A 4C4JA 3P5JC 1JWHA 4F0FA 2XNBA 3PSBA 5EDRA 3FYJX 4HPUE 3HYHA 4L3PA 4KAOA 4ZZMA 1YW2A 2UVYA 3ZM4A 3D5XA 2FA2A 4DEGA 1BI7A 2DQ7X 4WRGA 2BAJA 2R3QA 4BCFA 3TKIA 1TFFA 4F4PA 2ETMA 3W1FA 4FEUA 4X6RA 4AZWA 3MIYA 4F0GA 3IO7A 2PVJA 4YC3A 3PWYA 4FMQA 1QPCA 3IQ7A 3PY3A 4BTJA 2Q83A 5M57A 4OTPA 4KKHA 3UO6A 2GCDA 3OT3A 1KUTA 1ZWSA 3BEGA 2GNGA 2XVDA 4JG8A 1OB3A 4XV9A 3R0TA 3JVSA 3IDBA 5D12A 2C0IA 5K3YA 3NNWA 3VS0A 1KE9A 2YAAA 3PJ2A 1H1RA 2X1NA 3DTWA 3QQUA 1B39A 1KOBA 3KC3A 1OIYA 4DT9A 4ZSAA 4WUAA 5CXHA 3NFFB 4MXZA 3SA0A 2RKUA 4RQVA 5A4QA 5JK3A 4FNZA 3FZPA 3NGAA 5LMBA 3H0YA 3QUEA 4PX6A 3RBWA 4QP6A 4TW9A 2P2HA 3O8PA 3PTGA 3R30A 4UZHA 5E8ZA 2CGVA 4LGGA 4OLIA 4U80A 3ORLA 3FMNA 4IEBA 2XUUA 2W4JA 5KMOA 3F5XA 1A48A 4Z55A 3FKOA 3QTRA 5E1EA 2KULA 2GNLA 3WZDA 4QMZA 3K5UA 4LDTA 3T9TA 3EQRA 3EN4A 1ZYDA 2OGVA 2JD5A 3PIXA 1OL2A 4HYHA 5EYMA 3VIDA 3IW4A 4FIEA 4IANA 4RT7A 3NFGB 3ZXTA 2ONLC 4WG3A 4RJ8A 2XARA 2XP2A 4ITHA 3DPKA 3KRRA 3RPRA 3UVRA 1UNGA 4I0RA 3OZ6A 4D1ZA 2CGWA 4U40A 2B55A 5J5TA 4Z7HA 5IEXA 3I0OA 3TDVA 3POZA 4V0GA 3UOKA 4FKUA 3WBLA 2X2KA 4LQMA 2XS0A 3OY1A 3W0MA 4JQEA 3ERKA 3LKMA 1IRKA 4EL9A 3PA3A 2ITZA 3N51A 4QMUA 3QL8A 5D41A 4EQUA 1TQIA 3QALE 2BZJA 5EM8A 1M52A 4MYGA 4P2KA 2Y4IC 3WIGA 4O81A 2DYLA 4EH3A 1WZYA 4RJ7A 3R9OA 2XB7A 3NEWA 3COMA 4QMVA 3VS1A 2F7XE 3A60A 4EHZA 1ZZ2A 3AD5A 3DKCA 2BHEA 3EN6A 2QOFA 3QTZA 5EDQA 3E93A 5BMMA 2WMWA 3A7GA 1NVSA 5JMSA 3TNWA 3DKFA 3OY3A 4S32A 3OWKA 2OSCA 1QPDA 1R39A 2ETKA 2VWBA 3LXKA 4FV8A 5DT0A 4R1YA 3LJ1A 4FEVA 3LFCA 2WPAA 2YLEA 4MXAA 4H39A 4QPMA 3QRKA 5M55A 4DH7A 2R0UA 4ZSEA 3VUKA 2O0UA 5F1ZA 3EQBA 1V1KA 4XMOA 5HG8A 1YWNA 3W2SA 4W4WA 4RGJA 5DEWA 5F9EA 3KU2A 3QQJA 5CEMA 2R4BA 4FTQA 4FK3A 4RC3A 4U7ZA 2GFSA 2FO0A 3G33A 3V01A 3UQFA 4M14A 4F6WA 4W8DA 3HMIA 4EC9A 2ZV9A 3DBFA 4L6QA 2G01A 5AP5A 3AT3A 4QP8A 4BR3A 3BGPA 4S34A 5ANOA 2OZOA 2VTSA 4JDIA 2R5TA 2QOCA 4I4EA 5A54A 2XNPA 3NX8A 2VTPA 2OWBA 4G3GA 3S1HA 4YHJA 2R3FA 2ZOQA 4JBQA 4FZFB 4H3QA 5DOSA 1JKKA 4AFJA 5EKNA 3PSCA 2XNNA 3DJ7A 3I0QA 4ZY6A 5EI8A 5I3OA 4FSMA 5GNKA 3DFCB 4CZTA 1H01A 4FTRA 3V8TA 4FSQA 3MH0A 3BZ3A 4QMNA 4FK6A 4QP7A 3DXQA 5AADA 2B52A 4G17A 3ZO4A 3DK6A 5L2SA 3EHAA 1U5QA 1XBBA 2CHLA 3ZFYA 4QDEA 4C3PA 3R63A 4MUQA 3L8VA 1FMKA 3ML1A 1JBPE 1OPKA 5KE0A 1BYGA 2F2UA 4KBAA 3RTPA 3ZO1A 2PU8A 4G34A 5FBNC 3LJ0A 4KIOA 4D5HA 3DOGA 3DK3A 3I81A 4I22A 3FXZA 5FP6A 3HMPA 3QYZA 2NRYA 4HVHA 3Q2JA 4FTNA 3TIYA 5IA1A 3N4UA 3W0SA 4JQ7A 2OK1A 2YM6A 5IPJA 3W0OA 4NKSA 1XR1A 4OBPA 3RPYA 2HW6A 3G6HA 4EYMA 3W0NA 3V5WA 4IB0A 5B7VA 5CF4A 4B99A 4RIWB 3VONA 2AUHA 3QU0A 4FC0A 2PZ5A 4GJ2A 1O6LA 4NKAA 5AR8A 3FLYA 5HLWA 5KMKA 4FVRA 5FWKK 2WMBA 3NUAA 4TYHA 1Q61A 1WBSA 3MVHA 2QONA 2QNJA 2W5AA 1T46A 4FSNA 2IZRA 2WNTA 1KE8A 2H96A 4FTIA 2CCHA 3C9WA 1G8KA 1YXUA 2A27A 4PPCA 4RA5A 1AQ1A 5CENA 4FYNA 3QHWA 5EKOA 4GEOA 4TY1A 2OXDA 5DA3A 5L3AA 5JZNA 4EHVA 4JR3A 4YHFA 4DFXE 4M0YA 3QA8A 1NXKA 5IZFA 2R3IA 3GC8A 3F7ZA 2IO6A 5AV2A 5GHVA 1F5QA 4Q2AA 4BGGA 2WU7A 3UQGA 4A9UA 4BHNA 5EFQA 3HV3A 4LYNA 4RJ6A 4ZP5A 3NIEA 2YWVA 3MVMA 1PW2A 5FLFA 1H24A 4FT9A 2ONLA 3AMAA 5CX9A 5DR2A 5JEBA 5HVKA 2R3PA 3RVGA 4QP1A 2Z60A 4K9YA 1YHSA 4DEIA 3CTQA 3QRUA 4FT5A 4LMUA 3RINA 3A7JA 5IISA 1YDRE 1GZNA 3ORZA 4EH8A 4HVIA 2J0IA 2W1GA 1OGYA 2ACXA 1TVOA 2B53A 5LVNA 2XIXA 4J98A 5HG7A 3QKMA 3QCXA 3AC3A 4L9IA 3U4UA 4XCUA 1Q97A 1STCE 5HICA 4I5PA 1XH8A 3BHHA 3UDZA 3NRMA 3G9LX 2XRUA 3DAKA 4IACA 5HLPA 3NNVA 4F1TA 3MTFA 4FG9A 2JBPA 5FXSA 3BU5A 2E9PA 4A9TA 3ZEWA 4M69A 3TXOA 1M7NA 5IQEA 2CCIA 2UZDA 4IB1A 4L52A 4WKQA 2VUWA 4I24A 3VO3A 3HP2A 4R3RA 2X0OA 2HXLA 4ENYA 4F9AA 4PV0A 4OW8A 3GGFA 3OT8A 4A9SA 1YWRA 1ZYSA 3LFFA 1E9HA 5F94A 4ERKA 4B9DA 5ANGA 3WIKA 3FL4A 3VBXA 4TWCA 1GOLA 2ITVA 2UZOA 3ROCA 5IQHA 3QF9A 5D7VA 4FKIA 4AW2A 4CTCA 4RX5A 2XBJA 1FVRA 4O38A 4KIKA 3VBQA 3MFUA 4YZNA 1Q8ZA 3W2CA 4BKYA 2GDOA 4E26A 1LPUA 2WMUA 3ROYA 4I23A 4TZRA 4USEA 2GSFA 4FKLA 3S2PA 2G2FA 4FUYA 4G9RA 4BDCA 5IU2A 5CNOA 4IHPA 5CEPA 5BYZA 2BRBA 3EQGA 5BYYA 5CNNA 4F9BA 1H1QA 3I79A 5E4HA 4PPAA 4I92A 2YM4A 3K3JA 3ZH8A 4CT2A 3H10A 1WBNA 4O6EA 4BWPA 3IECA 3IW5A 4O0RA 4JXFA 4UV0A 5E9EA 4RC4A 4JG6A 4N6YA 3R8VA 3LXLA 4IM0A 4ALVA 2W1FA 2YITA 4X6QC 1MRYA 5EI6A 5BVDA 3ATSA 5BUJA 4CVAA 4QYHA 5CZIA 5FEDA 1E1VA 1G3NA 4D2RA 1IAJA 4O0VA 4RRVA 3C4WA 1V0BA 1Y8YA 2XIRA 3R22A 5AMNA 4D0WA 3AKKA 2JDTA 2B4SB 4MNEB 3PA5A 3ZFMA 3KIOC 2GNHA 3PRIA 4I41A 2YWPA 4XRJA 4ALWA 5AUWA 2PVNA 2WU6A 1UWJA 5T3QA 3IW6A 3CCNA 2ESMA 5A6NA 4NM3A 2X6DA 3A99A 3V6RA 2ZV2A 3CGFA 4FSTA 4BWKA 2I6LA 4JNWA 2I1MA 4OT6A 4RBLA 3LW0A 4GUBA 5L2TA 1YQJA 3LFDA 2G15A 2VGOA 4LL0A 3VUHA 4UMTA 5A4TA 1P4FA 5IEVA 2WO6A 3H4JA 4I3ZA 2QU6A 1H4LA 4IAFA 5TO8A 2HAKA 4QMLA 3OF0A 4C8BA 4RJ5A 4E1ZA 3EQPA 3QXOA 3MS9A 3Q5ZA 4I1ZA 5B2KA 4L7SA 4Z3VA 4ARKA 4XP3A 2QU5A 3PRFA 4ZOGA 4S33A 5J7BA 4D9TA 2R3OA 2YZLA 4FTMA 4I20A 3ZBXA 1UNLA 3D2KA 1P4OA 5IDNA 2WQEA 4FT7A 2QO7A 3DU8A 4DE4A 5I9VA 4EORA 2W4KA 3UO4A 4DGMA 4W9WA 1SM2A 4FV6A 5JRQA 4RIXA 3FEGA 4PPBA 1J1BA 3FLSA 3UZRA 1H26A 5I9XA 1YOMA 2ZV8A 4YSJA 5DYJA 4BCMA 1REJA 3K3IA 3EWHA 3GB2A 2ERZE 5KBRA 3AKLA 4ZZOA 2UW3A 4EWQA 3GQIA 4OT5A 3WE8A 1ST0A 4DCEA 4QTEA 3CE3A 3FHIA 4RMZA 3TG1A 4WIHA 5M08A 4IFGA 3DNDA 2HXQA 3KF4A 5ANDA 4L7FA 3O51A 3FY2A 4YLKA 2HIWA 3TV4A 1XMLA 2OJJA 4EZ5A 3QQKA 5EOLA 1Q8TA 4FNWA 2Y6OA 3ZONA 4CT1A 2GNJA 2UW5A 4ZTHA 4APPA 3CIKA 3DJ5A 5FTGA 4GG7A 3AC2A 2UW9A 1ZYJA 4CV8A 3WZUA 2VO3A 3F66A 2Z7RA 4NTSA 3HRCA 4XBRA 4R3PA 2WMTA 1TQMA 2XK9A 3SQQA 3UZTA 4DCAA 3P4KA 5KX8A 5HOAA 4AZTA 3NUUA 5CSXA 1VEBA 2V7AA 3RK5A 3TNQB 3FQSA 4AX8A 4C4EA 4RFYA 3UIXA 1IA9A 3HAVA 5CZHA 1K3AA 2F4JA 3VHKA 5LXMA 3UNKA 4AZFA 5BVEA 3VBTA 3QTUA 3QYWA 5BUEA 4LL5A 4BF2A 3HA6A 2JITA 1IAHA 4TYGA 1PYXA 3DDQA 4O7YA 1Q24A 5CYIA 3Q6WA 1UKHA 2BUJA 2YN8A 4F7LA 2XAMA 3E63A 4U43A 3TYKA 4EHEA 4QQ5A 1Z9XA 4X2JA 5L8LA 3H0ZA 2FSLX 2UZUE 4O21A 5E8WA 3U55A 3UOHA 3FKNA 4MQ2A 4M84A 1NT2A 3MBLA 3FC1X 5FM3A 2YJSA 3B2TA 4HCUA 1Z57A 4FIJA 3ZEPA 2Y7JA 3KRJA 3RKBA 3BI6A 4CCUA 1URCA 3F6XA 3GBZA 2VWUA 2XYNA 3T9IA 4QRCA 4ANOA 1DI8A 5EH0A 1Q4LA 4H36A 1W83A 5FTOA 2IVTA 5E8TA 2XM8A 2F7ZE 4D2PA 3NVKI 5JFSA 2XEZA 4IWOA 3QRTA 2CNVA 2FSTX 5A14A 3O50A 1Z5MA 4YC8A 2VWIA 1T45A <