5CAUA

Egfr kinase domain mutant "tmlr" with compound 41b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
323
structure length
297
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 297
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cauA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cauA01
4TYEA 2R3PA 3MVLA 3AC4A 2IVTA 1IR3A 3KN5A 4DGGA 4USFA 5L2IA 2R3IA 3QBNA 2GFSA 5CQUA 3WF7A 4ALWA 3QHWA 4EORA 1TQMA 2OXXA 4GUEA 5EG3A 2J0LA 2ZM3A 3GOPA 3L9MA 4RLLA 5AUWA 5CF4A 3O8PA 3I7BA 4JL9A 2BR1A 1LR4A 1YOJA 2R3GA 4X2GA 4MXOA 3UTOA 2QHNA 4K1BA 3Q9YA 2QQ7A 4LI5A 5IZFA 5JN2A 2WOTA 1OZ1A 4O96A 2OZOA 3K5UA 5AR3A 3TG1A 4D2RA 4MD9E 3Q3BA 4DG3E 2ZM1A 5FP6A 3LLTA 5CYIA 5I0BA 4EQCA 4K33A 5GZ8A 5HBEA 4E6CA 1PKGA 4QQ5A 4RWKA 2HOGA 3TZMA 3KF7A 2C1BA 4TNDA 4E8AA 3UC3A 2QKWB 2WTVA 3BLRA 3ELJA 2XZSA 4FTTA 4D28A 4O7NA 2JIVA 4I5MA 5H9BA 3U8WA 2BDJA 3OG7A 4LV8A 3QX4A 2PMOX 4Y95A 4RC3A 1P4OA 3Q52A 4GG5A 2FO0A 4YO6A 2Y7JA 3SOAA 4AFEA 5L2WA 2PUPA 4BR3A 2OJGA 5LVLA 1W0XC 5IISA 3RAKA 1ZXEA 4KIKB 4O6EA 5M09A 4W4VA 5IPJA 4KBKA 4CLIA 5EW3A 2VNYA 2FSLX 4U41A 4I21A 5IUIA 4HNIA 4RBLA 2JDRA 4G6NA 4NKAA 4OGRA 4RIXA 4AOTA 4O0WA 3R7VA 3CR0A 4HOKA 2JKMA 4ACCA 4QNYA 3I60A 3R9NA 4ENXA 1BI7A 3EZVA 3QZHA 3ANRA 1QMZA 4NFMA 1UU8A 3DCVA 4TWCA 4NWMA 3OROA 3EQBA 1UU3A 4M68A 4PP9A 3A61A 3C13A 3DBQA 4S34A 3SV0A 3FDNA 4HVDA 5IQBA 2SRCA 3AT3A 4RGJA 5J8IA 5HX6A 3FHIA 3ACJA 2R3OA 4FV1A 2YFXA 4UBAA 3W55A 4D2WA 2RG5A 5E8TA 4AW2A 4AFJA 1KE5A 3R63A 5DGZA 3HMPA 4OTGA 3QYZA 2J90A 4QP7A 1Q3WA 4O82A 3EN7A 5M06A 3RK9A 1XHAA 2OXDA 1U54A 2Q0NA 4JG7A 4JI9A 4OTDA 2WTWA 5CF8A 5L8KA 4GW8A 4U7ZA 1VYZA 4U80A 3ZO2A 2IWIA 1LPUA 3NSZA 3EQGA 2W1CA 3RBWA 3LFDA 1PMNA 3P5KA 3HV6A 2PE0A 5HNGA 5HVJA 4CFWA 4UMQA 1IA8A 2UZOA 1APME 1UA2A 2ERKA 4IVDA 5LMBA 3LM5A 2B0QA 1KOBA 4L6QA 5CVHA 4BYIA 2J0MB 4BZDA 3DAJA 4OBQA 4ZEGA 5M4IA 1SYKA 4NKSA 2F49A 2JBPA 3KXHA 4F9BA 2QOLA 3AXWA 3Q96A 3FKNA 3TCPA 4BGGA 1XH8A 3COMA 4MVFA 2X6DA 2B55A 2XIXA 5J9LA 4JIKA 4QTBA 5HNBA 5EYKA 4DYMA 2VTQA 2XKDA 1ZAOA 4AAAA 3NS9A 5DIAA 2OIQA 1H28A 4FR4A 4RC4A 4YGAA 3AD5A 4YBJA 1GIIA 2R3QA 4QMOA 4R5YA 4C4IA 4C3FA 2JAVA 3OTUA 2XRWA 1JQHA 1JSUA 2E9VA 5A4CA 1YQJA 2I0EA 3F5UA 4MBJA 3UOLA 4IE9A 3ZUVA 5E9EA 2WIHA 5FBOA 4O0XA 3AD4A 4Z7HA 2QOKA 4PMSA 3C4ZA 4BDBA 4DC2A 5C8KA 4FTCA 4QP8A 1Y91A 3UP2A 4DTAA 3DBFA 4F64A 4QPSA 3TNHA 3PIYA 5GJFA 3MN3A 4DEIA 3V8TA 1KE9A 5A54A 5HIDA 1MP8A 4A7CA 4S31A 3IW7A 2X1NA 4NTTA 3IO7A 3OUNB 5JH6A 3GEQA 3VF9A 3NAXA 3C5IA 3B2WA 5H3QA 4ANBA 2X39A 2Z8CA 3GCPA 3PSCA 4ASZA 4PY1A 2UW6A 4WOVA 5IA5A 5KZ0A 3FMNA 5CF6A 2Y8OA 2B53A 3AOXA 4U43A 4CCUA 3SG8A 2RG6A 3T9IA 3RKBA 1Y8GA 2O3PA 3QYWA 4FBXA 4ASXA 4GCJA 4RPVA 3PDTA 4GT3A 4R7IA 5AUYA 3V3VA 2NO3A 4EH2A 3CPBA 5H2UA 3QTXA 5CNOA 3QQHA 4HJOA 1LP4A 3QRKA 4XBRA 5JGBA 3G0FA 1UVRA 4IB3A 4DAWA 1YXXA 2FYSA 1WBOA 2VAGA 4HVGA 2UZWE 2YM4A 3DJ5A 4C3PA 3GENA 5JRSA 3PA5A 2XIYA 3GBZA 4J99A 3OT8A 3QRTA 3BGQA 4EHGA 4IANA 3L8XA 3HGKA 3ORIA 4G17A 4BDCA 4JQ7A 3FSKA 2RKUA 2C5VA 4TYJA 3ALOA 3H9RA 5AR5A 2C1AA 3TT0A 4QYFA 5JZJA 4GFMA 5C4KA 4V01A 2B9JA 4GJ3A 2XCHA 3HVCA 4E6AA 3GXLA 2RFDA 4AA4A 1F3MC 4XHKB 4D1SA 5CS6A 4QYYA 4RC2A 3OMVA 2I1MA 4CLJA 3V5WA 3MPMA 2VO7A 3DGKA 3DJ7A 3KQ7A 4G31A 2WOUA 3I0OA 3ZSHA 3H9FA 2IW6A 3CSVA 4JS8A 5I9VA 1IRKA 3KGAA 2HZIA 1H27A 3KRJA 5IUHA 1H4LA 1JSTA 1V0OA 1NY3A 3ENMA 5DEWA 4BDIA 4M13A 2VTLA 4OTFA 3GU8A 3LHJA 5LVNA 4EOPA 2OJIA 3PRIA 5DR2A 3QD0A 3QXOA 3R7OA 4BCMA 4DEHA 3HMOA 4G5PA 5FD2A 2VGOA 4AT3A 5T3QA 4C02A 1YHSA 4K18A 2GHMA 3MFSA 4HZRA 3HECA 4TYIA 2YM5A 4OAVB 4X2NA 4N4SA 3I5ZA 3PY0A 4OW8A 2VUWA 4KS7A 5DA3A 1Z9XA 3GGFA 4TW9A 4ZLOA 4C33A 5EDQA 3IGGA 4IJ9A 1CDKA 3UBDA 2VTOA 3BEAA 3RWPA 4FVRA 4OR5A 3QQJA 3ZZWA 5C1QB 4JJRA 3AG9A 4CV9A 1Q4LA 2BROA 1A48A 3C7QA 2G9XA 3R02A 4P2KA 3PLSA 4UXLA 1W7HA 5K3YA 5B0XA 3NIZA 4B8LA 3ZCLA 5FDPA 3LLAA 1LEZA 1UNHA 1Q8WA 2CGUA 3KRRA 5M55A 2XNNA 3ZLWA 4F08A 4YTCA 2GNGA 5LVOA 3PA3A 3UIUA 4LQMA 3PXRA 3MA6A 4G9RA 2VO0A 1K2PA 5AP7A 3Q6WA 2ETKA 3P1AA 4AZVA 3VJOA 4G6LA 4YJSA 2PULA 5DT0A 4ALUA 2IZRA 4WNKA 3CGOA 2ITTA 5ANIA 3DLSA 5J9YA 1QPEA 3DKGA 4O2ZA 4FV4A 3ZONA 5AUUA 3F6XA 3VVHA 4O7YA 5LWNA 1JWHA 2YAKA 4X0MA 4O0SA 2OICA 1JVPP 4UV0A 1WBPA 4ANQA 4WNMA 3RJCA 2WZJA 2XB7A 4LGDA 4E20A 1T46A 2J2IB 5CU0A 2C3KA 5G1XA 4ZSAA 4CCBA 3KK9A 1J1CA 1SVHA 3VS6A 1PHKA 4C4HA 4ZLYA 3GC7A 5M07A 3FZ1A 4FIGA 2YZAA 3SXRA 2EVAA 3BCEA 4JBVA 2VN9A 4BTMA 4LL5A 3MIYA 1WBVA 2E9OA 1FVVA 4I6BA 4J7BA 5LMKC 3BZ3A 3MDYA 4XP0A 1YRPA 5J87A 2AUHA 1DAWA 5AAFA 1XKKA 2C0TA 2VO3A 5EYCA 2XK3A 1YXVA 2WTIA 3NW5A 4NJ3A 3NUXA 3Q4CA 3QTZA 1P4FA 2OKRA 1WFCA 4IAKA 4IZAA 4JX7A 5D12A 5D7VA 4ZTLA 4H39A 1CKIA 1E1VA 4C4JA 4RA5A 3FC1X 4AGWA 4OLIA 4Y85A 2VTSA 5GIPE 3LJ2A 4RVTA 2OLCA 4OAUC 4FL1A 4FKTA 3WARA 4FEVA 3MJ2A 3MSSA 2X4ZA 1VZOA 3PSDA 4AWIA 2YDIA 4H58A 2X8DA 4YHFA 2R3LA 3BHHA 4ZOGA 4RX5A 4TYHA 2RF9A 3FKLA 2CCIA 1ZYDA 2IZTA 2WU6A 3Q4ZA 4RSSA 2BZIB 3BE2A 3Q9ZA 5DI1A 4PQNA 4QTAA 5B2KA 4AS0A 4F7SA 4OTPA 2PVNA 5C4LA 3Q60A 1PF8A 4R3RA 4EOSA 2C3IB 3GQIA 4DGOA 4TTHB 2VU3A 4OBOA 2C30A 5FGKA 3V6RA 4CV8A 1CSNA 4MNFA 3NUSA 2C4GA 5CY3A 4GKHA 3EQDA 3ID6C 4DCEA 3U54A 4KABA 2QU6A 3H30A 4RWLA 1X8BA 1PXJA 3VS4A 4MF1A 4O7WA 3TM0A 3COIA 2WMSA 5CSWA 2I0VA 4L42A 4QOXA 3KREA 4MQ1A 2UVYA 5BPYA 2Q0BA 3P86A 4IVAA 2BIKB 3NUYA 5E4HA 3R7YA 4EZ7A 1LEWA 2XVDA 5C9CA 5AMNA 5EHYA 5L2QA 4F1MA 3JS2A 4EK5A 3BWFA 5J1WA 3U55A 4DLJA 2PVFA 3TNPC 2H34A 4XG3A 2UZBA 2VZ6A 4FNWA 4MHAA 3PP1A 4RJ3A 1M2PA 5AM6A 2ETMA 3CIKA 4TN6A 5F9EA 4ANLA 1G8AA 5DPVA 3LOKA 3D5UA 3HRFA 3T8OA 2E9NA 3C1XA 3OHTA 5T6KA 1ZMUA 3THBA 3SX9A 3S2PA 5K4IA 3OTVA 5I9XA 2W1GA 2CHLA 3E8CA 3G2FA 5AA8A 5HD4A 4HCTA 2Y4IC 4RVMA 2YZLA 5HCYA 3RPVA 1FINA 4U44A 5EHOA 4IVBA 2H96A 4BDHA 3SDJA 4DGLC 4K77A 5BUEA 2BALA 5CTPA 2W5HA 3SW4A 4YJQA 1H0VA 3U6HA 3PIXA 4ZTSA 4M15A 2WIPA 5HI2A 2C6IA 3F5GA 4E5WA 5JFVA 5IH4A 4HGSA 4BTFA 2A4LA 4A07A 4EOIA 2W7XA 4GYIA 5JRQA 5CU6A 2P2HA 3ZDIA 4U5JA 2IO6A 4X3FC 2E9PA 5AR2A 3CPCA 4IB0A 4FKQA 2ITNA 4AA5A 4YHTA 4FKLA 4BZOA 2XNBA 2HWPA 4GIHA 4BFMA 4AG8A 1JOWB 2WB8A 1SZMA 4G16A 4PPBA 2A19B 1ZWSA 2Y6MA 2O5KA 3P78A 2QLQA 1UNLA 3P7AA 4J98A 3VW8A 4NM7A 3C5UA 3I79A 4L46A 4TZRA 1KE8A 3P7CA 1A9UA 3ULZA 3GCVA 4YC6A 2GTNA 5L2SA 2XKFA 3LFAA 4KBCA 4BCFA 4FG7A 3Q2MA 1WBTA 1BLXA 2BDWA 2XJ0A 1PYXA 2ZMDA 3IW4A 4FNYA 5IA0A 2W4KA 3Q9XA 1OB3A 5E1SA 2PVMA 3NR9A 2F2CB 2W0JA 3KRXA 3RHXA 4OTHA 3QCXA 3LCKA 2W1HA 2DS1A 2YJSA 3IONA 3MV5A 4GT4A 4PMMA 5KX8A 1LUFA 4EQMA 2WAJA 4EOOA 4F6SA 2LAVA 2F57A 4FMQA 4NT4A 2QOOA 4A4OA 4IWQA 5ANJA 3TJDA 4ACDA 4TRLA 3VBVA 1UWHA 2RL5A 3QZFA 2Y4IB 3FY0A 4ITHA 4C61A 3PJ8A 4MWHA 1O6LA 2PY3A 3BV3A 4FKVA 2KULA 4IH8A 4BGQA 1ZRZA 3DXQA 4MK0A 5CZIA 2BRGA 4UZHA 5EQYA 3PZEA 3EN9A 2F4JA 1YDTE 2PVYA 3VRYA 4C62A 4F9YA 5J7HA 2VTJA 2O64A 2WHBA 4YJOA 2CLQA 3M11A 4QD6A 4YNOA 4DFXE 2G15A 4G6OA 4IZ5A 4X3FB 1L8TA 3COKA 4BN1A 2VWVA 3C4CA 2ITZA 1DS5A 2BPMA 2QNJA 4WUAA 3QRUA 5E8YA 2OH0E 5F94A 2GCDA 5AUZA 4S32A 5CI6A 4BCKA 4F4PA 3SXFA 1DAYA 4EONA 4BI1A 3QCSA 4H1MA 2IZSA 5B2LA 4M3QA 3WF5A 3GB2A 4C34A 3RPYA 3PTGA 3QL8A 4L8MA 3FMMA 4NIFB 3KRLA 5I5ZA 4CG9A 2XIZA 4B0GA 1PY5A 3K5VA 5HG8A 5ETCA 4AX8A 3C51A 2J0IA 3A4PA 4XS2A 4GV1A 3UO4A 4FV0A 5CU3A 3FL5A 2R3RA 3GU6A 3R73A 4WG5A 5TT7A 5A4QA 3DXNA 5IUGA 1J1BA 3EYHA 4GKIA 3DTCA 4BZNA 3ORXA 3UIBA 3ETAA 4FT7A 3ODYX 4XCUA 3GQLA 4YJRA 4BCPA 1FOTA 2QLUA 3IQ7A 3C4EA 3ORKA 4E1ZA 5K0XA 4PL3A 3OEZA 4PL4A 4XOYA 3DY7A 3UG1A 3DK3A 5CZHA 2WMTA 3JUHA 3RNIA 3Q5IA 3NW6A 3PWDA 3GVUA 2J5FA 4D0WA 4IC8A 3MI9A 4NM5A 4AP7A 4ACGA 5KBQA 3NEWA 5DFPA 4YTFA 4EZ3A 2HZNA 1OUYA 1XQZA 1HCLA 5EFQA 5JGDA 3K3JA 4QTCA 4Z55A 2X2MA 3UPZA 3ZHPC 2OW3A 4AGDA 4D5HA 5DT4A 4CFXA 4RIWA 4KNBA 3TEIA 3QC9A 3PG1A 4FG8A 4J97A 4L52A 5BX0A 1BI8A 2QOQA 5KMOA 1P5EA 4KKEA 3LXPA 3O50A 4AZFA 4BCIA 1OPJA 2XIRA 1NA7A 2QOIA 1ND4A 1YOMA 2CLXA 2R9SA 3OT3A 2CGXA 4IX5A 4O2PA 5LCKA 3EHAA 3OEFX 4QP6A 5H8GA 2NNWB 1OIYA 4ITIA 3IGOA 1U5QA 3FWQA 4DCAA 4LRKA 4QP2A 3E7OA 5CENA 3EKNA 1ZYJA 3K54A 3OOGA 3V5JA 2ZDTA 3OS3A 3JY9A 3OXZA 3UZPA 5LVPA 3ZLXA 4XYFA 1ZLTA 4LOOA 3K2LA 4XRLA 5J1VA 5FLFA 3QTWA 3FZOA 4FK6A 3HX4A 4MEDA 4GJ2A 1YXSA 4CMTA 3PUPA 4QMNA 3NW7A 3PXZA 3QQKA 3HUBA 4CKJA 3PPZA 3VUTA 2PZPA 4YLJA 3DZOA 3MY0A 4BDJA 3N4TA 2ITQA 4BHZA 3N9XA 1F0QA 4PDOA 2BHEA 4JQ8A 5ETAA 3HV3A 3ZFYA 4GG7A 3DK7A 4C3RA 3D94A 3PVBA 4GMYA 4QP3A 3EL8A 2YIYA 4PNKA 2YIWA 1ZZLA 2WMUA 3HP5A 4I0RA 4W4WA 3TV4A 5KMKA 2GPHA 4M69A 4R77A 4QP9A 2I0HA 5AUTA 4UY9A 4DFNA 2QU5A 3LPBA 3WF9A 3NYNA 4XBUA 4V0GA 4LL0A 4FICA 2DUVA 2QO2A 3MFTA 3VUKA 3POOA 4OTWA 3WBLA 3WF8A 4RFMA 3S0OA 3FLZA 3DZQA 4E73A 3QAME 4ZZOA 2CSNA 2CKEA 4M14A 1I09A 2R64A 2WFYA 3UDBA 3UQCA 4P5ZA 2ERZE 2VWBA 3ACKA 4WBBB 2GNLA 2V0DA 2NRUA 2UW9A 4CG8A 4QMWA 3E92A 2WMQA 2XK6A 3UVQA 2OJ9A 2VGPA 4JT3A 3UNZA 4O21A 4FG9A 2OJFE 1WBNA 4QYHA 4GRBA 3UQFA 4QMMA 3TKUA 4JR3A 3HKOA 3HDNA 2BRHA 2QKRA 3SOCA 3D7TB 3GC8A 4IXPA 4X2JA 4IW0A 4L43A 3TV7A 1JLUE 2P3GX 1NXKA 4QPAA 3O23A 5HE1A 4DE4A 2ITYA 2IVSA 2J4ZA 3FQSA 4AN2A 2HENA 4CSVA 3ZZEA 3VF8A 3TIYA 3OW4A 2GMXA 5K9IA 3BGPA 5AV4A 4ZJJA 1ZYLA 2WTJA 3U6IA 2YN8A 3ODZX 4QO9A 3ZU7A 2CCHA 3NGAA 4MKCA 1G3NA 1J91A 4EBWA 1UKIA 2PZYA 4EHEA 1OPLA 5I3RA 4CQEA 3GI3A 3WYYA 4EOKA 5EOLA 3CKXA 4P4CA 1F5QA 3BHVA 2C3JA 3R8LA 1K9AA 4JDHA 4P7EA 3I7CA 5EM5A 4PTEA 2V55A 4AT5A 4C57A 4BB4A 5KNJA 3D14A 4ZTMA 4J1RA 5JGAA 3A8XA 4XG7A 1OECA 2QI8A 1OITA 3SW7A 4FT9A 5GZAA 3TKHA 4NL0A 2JEDA 5IQEA 2BUJA 3DKCA 3EMGA 5HG5A 3VWAA 3A7FA 3QKKA 4AZEA 4BF2A 4FV9A 3A62A 5CVFA 2GS7A 3G9LX 5HO8A 3QLFA 4FA2A 5CXZA 4XV1A 3QTQA 4A9TA 2I7QA 4XOZA 1R0EA 4WKQA 3QQGA 3LMIA 4FTUA 5M53A 5F1ZA 2WNTA 4M8TA 2ZV2A 3D5VA 4D55A 3KKVA 3ORZA 5TO8A 4BDDA 2B1PA 5E8UA 2ITVA 3UO6A 5DBXA 3CY3A 3W2CA 3QQLA 4B6LA 3DK6A 5JFWA 3QRIA 3ROCA 3PJ1A 3Q5ZA 3VBTA 4MXXA 3BBWA 3SHEA 5DYJA 4XUFA 3COHA 4FZ6A 3ZRMA 3TUBA 2REIA 4FKIA 3HP2A 3PVGA 3Q04A 4R3PA 4D4YA 4DEDA 1ERKA 5HBHA 4CFFA 3G15A 2EUFB 4YTHA 4USEA 4R5SA 3OBJA 5LJJA 4KKGA 1W8CA 3UQGA 2QR7A 2BIYA 2C5OA 2GHGA 3CTQA 3FLQA 4PUZA 3ZXTA 1BL6A 2BFYA 3CTJA 3DB6A 1U59A 3HEGA 4KA3A 4CRLA 3DBCA 4MXYA 2QO7A 4FV8A 3ZEWA 1UU9A 4ZS4A 3ZC5A 3NAYA 3E8EA 5EI6A 3E8NA 1R1WA 3OXIA 3RCJA 4D58A 3GFEA 5J7BA 4BWXA 5CSXA 3HMIA 2LGCA 5IA2A 3QFVA 4RJ5A 3F3VA 3C4WA 3CS9A 3P79A 3QU0A 5DRDA 5D41A 4LV5A 3OWLA 4QT1A 3RNYA 3ORLA 3BX5A 2J7TA 3NX8A 4YLLA 3U51A 2P2IA 4ID7A 4JG8A 5E1EA 1GIHA 3AMAA 4AW0A 1OBGA 1U5RA 2R3JA 5FTQA 3LFCA 4KRDA 2VRXA 3LCOA 2BZHB 4FTOA 4FV2A 4G3GA 3PJ3A 4IX3A 4NK9A 3BIZA 4MF0A 4I6HA 4OTRA 3VS0A 3NWWA 2CKQA 2I0YA 2GNIA 2C5XA 4RG0A 4TY1A 4RIXB 3EQHA 3QCQA 4KSQA 4WSQA 5EM8A 3ZOSA 5LOHA 4II5A 3KB7A 4WNOA 2HW6A 3AC1A 3LXNA 4ZS0A 4GU6A 2AYPA 4PNIA 5IH6A 4W9WA 3I6WA 4R1VA 2BVAA 1WVYA 4ZMFA 4EH5A 3UMXA 3MFUA 5HQ0A 2WEIA 4RJ8A 5E8SA 3E63A 2A2AA 3F7ZA 1UKHA 2YERA 2BZJA 3EKKA 3F88A 3AGMA 1DI9A 1H1SA 1XR1A 4M97A 3LCDA 3QGYA 4UALA 1TQIA 1Y6AA 2Z7SA 4EK6A 1PJKA 3HUCA 4EHZA 2RSVA 4LFIA 2ONLC 1YOLA 4IJPA 1ZYSA 2BAKA 3DAEA 3Q6UA 4UEUA 4YJPA 3CBLA 4CEGA 1M14A 5BYZA 4HGLA 2VD5A 1U54B 4DGNA 4AE9A 1W82A 2IJMA 3UYTA 5A4LA 4FZFB 3CC6A 5ETFA 1XH9A 3NPCA 3ATTA 3QX2A 3QUPA 2R3HA 4FIIA 4ERWA 2FB8A 5C03A 2W05A 4BI2A 3U4UA 4IAAA 3QA0A 5IEVA 2XEZA 3KCFA 3ZO1A 3DV3A 4Q5HA 2JAMA 3QUEA 2C5YA 3MY1A 3UJGA 3QQUA 4NU1A 4S30A 4O83A 2GHLA 3DKOA 4ACMA 2BZKB 2XK8A 4RIYA 5M4FA 4H36A 3ZRKA 4XV9A 3HV7A 4BWPA 4M0YA 1OL1A 3RHKA 3ZLYA 4C8BA 3FI8A 4FEWA 3OBGA 2UZNA 4U97A 4DBXA 3RZFA 3PSBA 4K0YA 2CNVA 3SRVA 5K5NA 5AFVA 5FRIA 3GFWA 2GS6A 3HZTA 2NRYA 4XNEA 3VULA 5HE0A 4CGAA 4APPA 2XK4A 4KBAA 3FLWA 4M12A 4G3CA 5IMEA 2PZRA 5HE2A 5ICPA 4MD8E 3F5PA 4GUBA 4IWDA 2AC5A 2Y0AA 3NMUF 2C6DA 4I23A 1PXKA 4EOLA 2W1EA 1KV2A 5CEMA 2UW3A 3D7ZA 2JBOA 4IIRA 4QP1A 3UIMA 4AF3A 5DNRA 4FTNA 3E3BX 2JITA 1FQ1B 1ZY4A 4IAYA 4BCQA 3POZA 3UG2A 2VX0A 4LRMA 3VUDA 1URWA 3AC3A 4NJDA 4ZTHA 4E3CA 3HNGA 3EFLA 4B99A 4DEBA 1OL5A 3ROYA 3KMUA 4QPMA 3Q4TA 2WMVA 3BYVA 4BI0A 2BILB 4FTIA 5EI2A 1PXOA 2G01A 3I4BA 3BE9A 3IDPA 4ZTRA 4JRNA 5AV3A 5M4CA 1L3RE 3V5LA 2BTRA 3U87A 2ITOA 3UOKA 4E93A 5KO1A 4G34A 4EH3A 1MQ4A 4FSZA 4N6ZA 2FSMX 5C8MA 2PWLA 3WF6A 4BTJA 2RFNA 2G2HA 2XNEA 2YA9A 4NFNA 4E4NA 5JT2A 4ZSEA 1W98A 3LE6A 3PPJA 3QTIA 4RJ7A 3ZO3A 4G5JA 1PRYA 1SMHA 3EWHA 4FV6A 3LFSA 4GFGA 4OT5A 5D7AA 3GU5A 5AUVA 5H8EA 2VTRA 3BU3A 3LQ8A 5A6NA 4L9IA 2YDJA 4HVIA 2PVLA 1XH5A 3FI3A 2UZTA 4DH7A 5EKNA 3F7WA 1V1KA 2R7IA 4ZSGA 5BVKA 2YABA 3R9OA 2W17A 3U9CA 3WOWA 4B4LA 3TIZA 4AN3A 3R04A 4MH7A 2CKPA 3FKOA 3EQPA 3ITZA 4IAFA 3FZSA 4I4FA 1EH4A 2V7OA 4YHJA 4BHNA 4Z3VA 4I6QA 4IM2A 5AP0A 5KHWA 1WCCA 4F09A 2DWBA 1O6KA 2F9GA 5EOBA 5IMXA 2XM9A 4L3JA 3V04A 3HRCA 4DITA 2ZOQA 3D0EA 3KVWA 4I22A 3FPQA 4F9CA 4WBOA 5J9ZA 1STCE 2WMWA 1W84A 2R0UA 3FMJA 1KSWA 4L7SA 2I6LA 5HTCA 1YWNA 5FEDA 4L44A 2E2BA 2ZM4A 5A3XA 4E5BA 3W2PA 3WZDA 4NCTA 4EUTA 4XMOA 3DA6A 3DBDA 4TPTA 1GIJA 4FTRA 5HIEA 3FZTA 1RQQA 1QPJA 3ORMA 2PPQA 1MUOA 3DB8A 3HLLA 3R21A 2IZUA 2H6DA 3ZS5A 3LJ0A 5C8NA 2CJMA 1J7UA 1ZOGA 3NNWA 4G1WA 5D11A 1GJOA 4JQEA 1ZARA 2BRMA 2PE2A 2WELA 3PXYA 5HCXA 3TNIA 3DKFA 4B7TA 4BGHA 1QCFA 4BKYA 4DFUA 3PY3A 3PE2A 1CTPE 4CMOA 3G6HA 3KA0A 4MBLA 4IDTA 1P2AA 4AACA 4LYNA 2WEVA 4RJ6A 3NNXA 3CTHA 4D4SA 2F7XE 4WRGA 1YXTA 3O71A 2A27A 3OVVA 2UW4A 4F0GA 5BYLA 2EXCX 4MQ2A 5KE0A 2PZ5A 3TDVA 5DHJA 2Y6OA 3EH9A 4AUAA 2OIDA 3UOJA 5IDNA 1YW2A 2F7EE 4NZWB 4MWIA 1TKIA 4L53A 3R9DA 2C6MA 4XJ0A 2XKEA 5LMAA 5DLSA 5ACKA 3UMWA 2R3MA 5HKMA 5HTBA 3I6UA 4RWIA 5DVRA 3AMYA 2PVRA 4ANOA 2YM8A 3F2NA 3PRFA 3R2YA 3TL8A 1B6CB 3L1SA 4AT4A 1OKZA 4ZZMA 3UYSA 3JR1A 2W9FB 5HBJA 3N4UA 1R39A 1Q5KA 4QTDA 3L9PA 3VO3A 4GVAA 4YTIA 1OIQA 3CGFA 4O91A 2X9EA 2W96B 4A4XA 3HMMA 5GJGA 5L4QA 1RW8A 3QF9A 3ULIA 4C36A 4FEXA 2UZLA 2V5QA 3OY3A 4LRJA 2UZUE 4PDSA 3A60A 3A4OX 5JZNA 4D2TA 3BYSA 5K5XA 3DNDA 5IQFA 3ZSGA 3QC4A 2OH4A 4EH8A 1AGWA 4QRCA 2XM8A 1Y57A 5AX3A 5BVOA 4E6DA 1H1RA 3QCYA 2BKKA 3LMHA 3OC1A 3Q9WA 4DHFA 3H3CA 3FYJX 3QA8A 3PFQA 2XJ2A 3A2CA 3AMBA 3R1QA 3FI2A 1PXMA 4O84A 4I5HA 4RA4A 3F82A 4S33A 1OMWA 3FI4A 1SM2A 3RGFA 4FC0A 3F3UA 1KOAA 4J52A 1REJA 2C0IA 2W9ZB 3LFBA 4D2PA 3W18A 3KFAA 2XP2A 5KUPA 2YIXA 4C35A 3FPMA 5IQIA 4TYHB 4R6VA 4YO4A 1JSVA 3MVJA 1PXNA 3EOCA 3E88A 3PXQA 3ZUUA 4F9AA 5FM2A 3CJFA 3IECA 2UUEA 4EZ5A 3AC8A 4CT2A 5HZNA 3T3VA 4C2WA 3PXFA 5AM7A 5KCVA 2YACA 5TKDA 1HCKA 1QPDA 3DTWA 3FLSA 4YZ9A 2Z7RA 2E9UA 4ITJA 1R3CA 5AP3A 1Q24A 3SXSA 1GZKA 4DH1A 3PWYA 3GCUA 5EI8A 4CKIA 3BYOA 4EK8A 1XH7A 3TACA 4PTGA 3JYAA 4JRVA 5BVDA 1FPUA 1YKRA 1PXPA 4BCGA 3GCQA 3ZH8A 4F65A 1BKXA 3ZFXA 4BICA 1XO2B 5HIBA 3NVMB 4Y5QA 4ZAUA 2GS2A 2BAJA 2XBJA 4C0TA 4ZSJA 2WTDA 3BWJA 1BYGA 4YU2A 4TKSA 3O2MA 4NM3A 4NYEA 4DT9A 3WE8A 4FTQA 4IEBA 3B2TA 4K11A 4GK2A 3TNQB 2VTMA 4CMUA 4IC7A 3LXLA 4U79A 2ZV8A 4DBNA 5A6OA 3KN6A 3TJCA 5AP1A 1V0PA 3VQUA 2CMWA 2G2FA 4FSYA 4HPUE 4J71A 4BDAA 2Z7LA 4FNZA 5FTGA 4S2ZA 2GQGA 3F2AA 2W1DA 3NCGA 3E62A 4D0XA 1DI8A 3QZGA 4IX4A 5JMSA 2HY81 3BEGA 3LFNA 1A06A 2BHHA 5EW8A 3NYXA 4G9CA 1YXUA 3Q2JA 4RVLA 3TTJA 4D2SA 2JC6A 1XBCA 2WKMA 3B8RA 1RE8A 5H8BA 3FL4A 2JFLA 3CD3A 3UPXA 4EI4A 3GC9A 3CJGA 3TNWA 5JFSA 3ZEPA 3HMNA 2CNUA 3TKIA 1G8SA 4HNFA 1Q62A 4ERKA 3L8PA 3OCSA 3PXKA 1B38A 2WTCA 3D9VA 5DG5A 3LQ5A 5HLNA 4O38A 4U0IA 1ZMWA 3M2WA 4JXFA 3P0MA 4DG2E 4UMUA 3QKLA 3W33A 5HGIA 2WD1A 4U6RA 2BDFA 1K3AA 4KIOA 4WHZA 4N70A 1TQPA 3LFEA 2XCKA 2QCSA 5E8XA 2OJJA 4JLCA 2WMBA 5FDXA 3P9JA 3DOGA 4R7HA 3BLHA 4ZJVA 2UW0A 3DJ6A 4CXAA 1YWVA 5ACBC 2EXMA 4I20A 3FLYA 3O8TA 4X2KA 4FSUA 3HV5A 5F95A 3VRZA 4F0IA 4F70A 5K4JA 2EXEA 2QVSE 4UB7A 3GT8A 2CGVA 3MH3A 4RIOA 1H8FA 3BHYA 3DBEA 3ERKA 4O27B 4I1ZA 3OY1A 4DFBA 3QD4A 4QQCA 4QMSA 3NYOA 4QTEA 2OK1A 2Z7QA 1XH6A 4UX9A 4U8ZA 3LFFA 5LARA 3NYVA 2JIIA 5BVWA 2ITXA 5CVGA 2ACXA 4AGCA 3NUPA 4XEYA 4KS8A 1IAHA 4RX7A 5AP6A 2WMXA 2VNWA 4D1XA 4RT7A 3OZ6A 3ZBFA 5IQCA 4RVKA 3EN4A 4FKUA 5DN3A 1M52A 3NNVA 3FZRA 2O2UA 2ZYBA 1YDSE 3KXZA 3TV6A 1MRYA 1R78A 2VX3A 4YBKA 4CTCA 2X2LA 5KZIA 4PMPA 2O63A 2B7AA 4DF3A 4DFZE 3M42A 3QQFA 4C7TA 3VNTA 4BDFA 5A9UA 3E3PA 3F3ZA 5IA1A 5L3AA 2QONA 1OVEA 4O0YA 4AZWA 3PYYA 4BKJA 4ORKA 3D5XA 5AR8A 4HPTE 4R3CA 2C47A 2C6OA 3KULA 4ACHA 5FXRA 5ANGA 4U45A 5IH5A 3V5QA 3LCTA 5BQ0A 5IKWA 1OI9A 2W99B 4O6LA 4X6QC 1IAJA 1YDRE 4F0FA 4IADA 4IWPA 3F3WA 3JVRA 4BDKA 3AT4A 4M84A 5FXQA 3G33A 5AV0A 4YLKA 4DEAA 1OIUA 1J7IA 5FBNC 3S3IA 4IFCA 4RWJA 5AEPA 4GEOA 3FZPA 4CYIA 1OGUA 2H8HA 2OSCA 3ZBXA 1WBWA 1B39A 1XH4A 4BC6A 3O7LB 4FODA 4R78A 3D2IA 2UW7A 4HGEA 3NCZA 3UC4A 4F6UA 1KWPA 3FMEA 4OTQA 4E7WA 4GH2A 2JDVA 3W8QA 3UO5A 3HYHA 2VWIA 2XJ1A 2FVDA 3RWQA 4JIAA 4KINA 3VS2A 4FV7A 4CZTA 5HVKA 4PDYA 4BDEA 3H4JA 4AXAA 1Q8TA 3BPRA 3I81A 4M7IA 4EJNA 3WIGA 2WXVA 2YIQA 5C27A 4FTLA 5CEQA 2FSOX 3I0QA 2B52A 4XX9A 5E91A 5AP2A 4CTBA 5M51A 1KE6A 3Q4UA 4CFUA 4JOAA 5M56A 3GU4A 1U46A 2PSQA 2YCQA 3QXPA 2OU7A 3S4QA 3T3UA 4O1PA 4RJ4A 2FH9A 4FIJA 3G0EA 3MS9A 3G6GA 4A06A 4RLKA 2XF0A 2OZAA 4CYJA 4IZYA 1VR2A 2RFEA 4XG6A 5L8JA 4DG0E 4GFOA 4YMJA 4AGUA 5AIRA 3AC5A 5BVEA 3DPKA 4F1TA 4CVAA 4R8QA 1S9JA 3BRBA 3UGCA 4YURA 4RIWB 4H05A 5CU4A 4NEUA 2GTMA 4MYGA 5I9YA 2VTNA 5EW9A 2C6TA 4MXCA 4G3EA 3MW1A 4DLIA 3PLAE 2JIUA 4FZAB 2ZVAA 4MNEA 5AAGA 3R8MA 4UWCA 1OKYA 4I0TA 5A46A 4IM3A 2YCRA 5J5SA 4L68A 4WD5A 3MH0A 4FKRA 2VV9A 3SKCA 3VUMA 4MXZA 3PVUA 3UP7A 2BCJA 3AD6A 3LXKA 3R01A 4RRVA 1IG1A 1E9HA 3CCNA 5ANKA 4EK4A 3FXXA 3NNUA 3R7UA 3CQUA 2ZAZA 2CN8A 3PJ2A 2P0CA 4K2RA 1FVTA 3HAVA 3DQXA 3EN6A 5F4NA 4JBPA 2CPKE 3VUIA 5CT7A 5AWMA 4PTCA 4F1OA 3BQCA 3REPA 4IB5A 4D2VA 3R30A 2CGWA 4F9WA 5AR7A 3VAPA 1Q8YA 3BV2A 3R22A 4QYEA 4BCOA 5BUIA 2YLEA 3W1FA 2VTPA 3GCSA 1M17A 4BKZA 4KKHA 1XBBA 3VW6A 4XV3A 1YHWA 4M69B 4ZIMA 2FA2A 1IASA 2W4OA 4LGGA 4WIHA 4U3YA 5IU2A 3O8UA 1FBNA 3R8ZA 2BKZA 4W8EA 3B8QA 4HYIA 1Q41A 5CQWA 1GAGA 5FEEA 4V0GB 2R2PA 5AX9A 3VBYA 3VUGA 4XG4A 4I94A 3D83A 4RMZA 1Q3DA 5L8LA 4FT0A 5FTOA 4UWBA 5L2TA 1NVQA 2HXLA 2YCFA 5EH0A 2Z02A 1TVOA 2EB2A 2YIRA 3P23A 4O0UA 4BIDA 5HESA 2PUUA 4IAZA 4OBPA 5EKOA 3FEGA 1SVGA 3LMGA 1S9IA 3OOMA 5ANOA 3VS5A 3I1AA 4TYGA 4IZ7A 3GUBA 1JNKA 4BCNA 3PIZA 4LMNA 2HIWA 1Q8UA 4KIKA 2A0CX 2VTTA 3S95A 2J6MA 4ANSA 3HDMA 4QQTA 3VHKA 5CX9A 3SVVA 2X2KA 1UWJA 5CASA 2UZDA 4Z7GA 4DH5A 4YJTA 3O0GA 1NVRA 3L8VA 1H0WA 2DYLA 3LJ1A 2EB3A 4E4MA 3RK5A 4XRJA 3ZSIA 2PUNA 1Q8ZA 3R1NA 4IBMA 4FOCA 4JG6A 4O81A 4Q5EA 4KWPA 3W16A 1WZYA 4JNWA 2G1TA 4IVCA 3EFJA 5D9HA 5J95A 4FTMA 3F69A 3OCGA 2HAKA 3R0TA 3MYGA 2C6EA 2PE1A 3H9OA 5BMMA 4UN0C 2JKQA 1MQBA 4GU9A 4QMZA 4D1ZA 4DT8A 3RAWA 4LOPA 3C4FA 4YZCA 2X4FA 5FG8A 3ZUTA 5EQEA 1IEPA 4UMTA 3RALA 1U4DA 2XYNA 4LOQA 3G9NA 1WVWA 5JQ5A 4L67A 4LUEA 4O7LA 1V0BA 2HW7A 3AC2A 1YI4A 3H10A 4I93A 2XK7A 2J5EA 3JY0A 4IAIA 4YSJA 5HNIX 2XS0A 1QL6A 2RFSA 4J8NA 3F5XA 3TWJA 3V5TA 5GIOE 5FXSA 4AQCA 1E1XA 5AADA 3QRJA 5HICA 4IFGA 3PPKA 1H1WA 3II5A 4YNEA 4I6FA 4BL1A 2QD9A 3MTLA 3GC0A 5HOAA 4ENYA 4EC8A 4UXQA 3KK8A 4AOIA 4QNAA 3WZKA 2GU8A 2NPQA 2JLDA 3MJ1A 3NRMA 2V7AA 1OPKA 2J50A 5DR9A 3O17A 2OG8A 4JAJA 4EUUA 4O0VA 3V01A 3ZYAA 2R5TA 3BHTA 4XH6A 5KMNA 2YDKA 4C4FA 2PVKA 3R8PA 4ZMEA 3G51A 3FMLA 2OFVA 3KXXA 3H0YA 4GVJA 3RP9A 4YC8A 5HG7A 2XH5A 4APCA 2HY0A 2XEYA 3OWPA 5EHLA 1OUKA 4ZY5A 5F20A 5I9UA 1XJDA 4D4RA 4E6QA 4CRSA 4A9UA 3QTRA 3GOKA 4KB8A 2W1FA 3IDBA 5G6VA 5EK7A 3ORNA 2A1AB 4M67A 5GHVA 2J9MA 2HELA 5E7RA 2VWWA 4EOJA 2R0IA 3BHUA 4FSMA 4QYGA 4F6WA 2Y9QA 5I9WA 3L9LA 3R83A 3KXNA 2QHMA 4GK3A 2BMCA 4DEGA 3L9NA 3W2RA 4EWHA 4UYNA 1ZOEA 4FIHA 4P5QA 4IMYA 5KMJA 1OBDA 5T68A 2G2IA 3FMHA 4AE6A 3V5PA 1J7LA 3IW8A 4ZY4A 2HZ0A 4RX9A 4C4EA 4ASDA 4BCJA 5JSMA 3LW0A 4W4XA 4FSRA 4FVQA 4D5KA 2YJRA 3OWJA 4XP3A 2PYWA 4FYNA 2YISA 3D5WA 4O7SA 4GYGA 1FVRA 5DWRA 2W06A 4RFYA 5IEXA 2W4JA 4QMXA 4EBVA 4O7TA 2GDOA 3NUNA 1JKLA 3M1SA 4TWPA 1GZNA 4B9DA 3PE1A 1RJBA 3TN8A 4DH8A 4FZDB 4K6ZA 3KMWA 2C6KA 4XLIA 1ZYCA 2Y4PA 4A9RA 3I5NA 3KL8A 4X2FA 4HVSA 4I5PA 1J3HA 3HAMA 2QO9A 4FEUA 3PP0A 5HO7A 2QR8A 4TL0A 4CQGA 2J51A 3WZUA 5I9ZA 3KXGA 5C01A 2ONLA 5FEQA 5M57A 2YEXA 5FWKK 3EFKA 3EFWA 3L8SA 1H1PA 5AJQA 5KHXA 3PY1A 2ETRA 4Y73A 3WILA 2I40A 4EH9A 5FUTA 1YWRA 3E5AA 5AP5A 3ZM9A 3RK7A 3UVPA 2VWYA 3FV8A 3TZ7A 4FTAA 4F7LA 5BVFA 4I5CA 2R3NA 4P90A 2F2UA 3RVGA 4FKJA 3A7JA 3A99A 2OFUA 3IG7A 4RFZA 4EQUA 4ZLZA 4XP2A 1AD5A 1O9UA 3KCKA 3FQHA 1SNXA 3F66A 3W32A 3BGZA 4O22A 4JR7A 1Q61A 3MVHA 3D4QA 4DH3A 3QD2B 3H0ZA 5CAQA 5CF5A 3MB6A 4JDIA 4FE2A 4RIYB 2HZ4A 4N6YA 4RQVA 2XBAA 1FGIA 4CT1A 1UU7A 5EDRA 2QG5A 4MX9A 4C38A 4YZDA 2JKOA 2F7ZE 4TWOA 2RGPA 1H07A 2XUUA 4V04A 4BIEA 3V8SA 2PL0A 3SRVB 4MD7E 4QMQA 4F7JA 4GK4A 4XG8A 3EB0A 3RINA 4M66A 3VUHA 4F63A 3R00A 5EDPA 2C6LA 5B2MA 5HU3A 2HYYA 1GY3A 5KBRA 4EH7A 2WU7A 3RCDA 4HCUA 4RZVA 3UVRA 5IA4A 5K0KA 4E4XA 1YVJA 1VYWA 4EJ7A 4DFLA 4OT6A 3BKBA 4FT3A 2PU8A 4YSMA 4DN5A 3NDMA 3BU6A 3VHEA 4E5AX 5B7VA 2CKOA 3LAUA 5GINE 2ESMA 3HRBA 4JBQA 4O1OA 2HK5A 2YHVA 4PL5A 3PJCA 5I4NA 2DQ7X 2X6EA 1AQ1A 2ITPA 2WQEA 3FBVA 2UZVA 4Q9SA 4YUQA 1NW1A 2O65A 3FE3A 5JFXA 4PF4A 2WMAA 2EWAA 3FY2A 2IVUA 1HOWA 5L6WL 1YHVA 4TWNA 1G5SA 1UV5A 4TNBA 4NSTA 3RAHA 2UV2A 1PKDA 3OFMA 1OL2A 2BRBA 3DNEA 3FXZA 5IEYA 5M08A 4FSNA 4CFNA 4AW5A 2WPAA 5IQGA 4EYJA 5LXMA 1PMVA 3DFCB 4GSBA 4ANMA 2EU9A 2W1ZA 4NCTC 2PK9A 5BYYA 2CNQA 3MPTA 4JDJA 4O86A 3W2QA 5IG1A 3N4VA 3VQHA 3Q53A 2QC6A 2XA4A 3TZ9A 2PVHA 1Y6BA 4ZK5A 3ZC6A 3RTPA 5AIKA 4BBFA 4EEVA 2ZDUA 3LKMA 4J95A 2JDSA 3RM7A 3VC4A 1WAKA 3MBLA 4FSWA 1XBAA 4JBOA 4YJVA 3CE3A 3SAYA 1JAMA 3CEKA 3GU7A 4LUDA 2WQNA 4XG9A 3MVMA 2RIOA 2JDTA 3OW3A 2GNFA 5E8VA 3VBXA 2VTHA 5HLPA 5BNJA 5LQFA 3E87A 3R8VA 3E7VA 3W2SA 4ASEA 2P33A 3D2KA 2XNOA 3VBQA 4B8MA 3FQEA 3TUDA 2VX1A 4YJUA 3U4WA 5A14A 5IQDA 5HO6A 2FSTX 5FM3A 3FUPA 2VTAA 4EOQA 4Q9ZA 1GOLA 2C0OA 2ZV7A 4BBMA 3U6JA 1CM8A 4NUSA 4M0ZA 5HTIA 4JVGA 5CEOA 4D9TA 1KUTA 3JPVA 4E4LA 3BLQA 4FYOA 4O7ZA 1OKWA 4PX6A 1O6YA 3IOPA 3C0IA 5TE0A 3C9WA 3R8UA 4JX3A 4IACA 1JKKA 3QUDA 4RZWA 4EC9A 3P4KA 1M7QA 2YM6A 4CZUA 2C5NA 5HLWA 4BVUA 4FX3A 3C50A 5EM6A 2OF4A 4L7FA 2JFMA 1GNGA 4FKPA 4QMUA 5J5TA 3WZEA 3R7GA 5CLPA 3FMKA 2ZJWA 3EQFA 4W9XA 4CD0A 4YR8A 2PMIA 3RMFA 4O0TA 4W4YA 5CAVA 5HG9A 5AA9A 5ITAA 5FP5A 2R7BA 3IOKA 2OXYA 3HA8A 5J79A 4ANNA 3TI1A 3DAKA 2JKKA 3WZJA 4J8MA 2R3KA 3DLZA 4IX6A 2XYUA 2YM3A 1H24A 3QZIA 4UYAA 2YITA 3OWKA 3SQQA 4ONAA 3QWKA 4EH6A 1PMUA 2J0KA 4GT5A 4PP7A 1BUHA 3BQRA 5CAOA 1CMKE 2BTSA 3F9NA 3GNIB 5BMSA 5KMMA 1MRVA 4FEQA 1ZY5A 4FIFA 5KMIA 3OP5A 4DEEA 4EOMA 5JEBA 3A8WA 5IF1A 2JGZA 2Z2WA 5CI7A 3JVSA 3CP9A 2O8YA 3CY2A 3MFRA 5D1JA 4JDKA 4AU8A 3ORTA 3AT2A 2YAAA 4EH4A 3TDWA 3EYGA 3N51A 5LMKA 4L3PA 5D10A 4MTAA 5AV2A 1IA9A 4I0SA 3F3TA 3DDPA 3IK3A 4YZNA 4H3PA 2X8IA 4L45A 5GJDA 3R7IA 4Y46A 5EM7A 5HVYA 3VN9A 5CAUA 2PUIA 4ARKA 4F99A 5CWZA 3SA0A 2X7OA 5I3OA 4FKOA 3ATSA 4A9YA 3KEXA 3KF4A 4IHPA 5DEYA 5TF9A 3BELA 2ITWA 2QOBA 4R1YA 5CEKA 2OF2A 3LIJA 4OTIA 4MBIA 5CAPA 3KVXA 1H25A 4ZJIA 3VS1A 3GP0A 3MWUA 4BBEA 1OL6A 3O7LD 3UE4A 3ALNA 1DM2A 2QOHA 3S00A 2GSFA 3R1YA 4F7NA 3WI6A 2V22A 5DT3A 3CQWA 2GFCA 2IN6A 2IW8A 3QGWA 3V51A 3LM0A 4EHVA 3F2RA 3ZFMA 4AZTA 2OBJA 4WG3A 3IS5A 2C3LA 4O7VA 4CNHA 3P7BA 4YPDA 2CDZA 2NP8A 3SGCA 1P14A 3BI6A 5HORA 4KIQA 1MRUA 1Y8YA 3FXWA 3IDCA 2X8EA 4GL9A 4Z9LA 3ZM4A 4YJNA 3OCBA 4I92A 4EWQA 4ZY6A 2ZMCA 4Z16A 1PMEA 4FI1A 4K8AA 5HEZA 4WNPA 5TR6A 3SD0A 4A9SA 1UNGA 4QMLA 2X0GA 1PW2A 4FVPA 4Y72A 5CSHA 1PYEA 3MIAA 5BVNA 1OL7A 2C69A 2WQOA 3EIDA 1VJYA 2B9IA 2XMYA 2ZB0A 4FIEA 4IDVA 3KRWA 4L01A 3WE4A 4UMRA 5HX8A 4PPCA 3DDQA 2GQRA 1VEBA 1PXLA 4U3ZA 2C68A 3T9TA 3ZMMA 4U42A 3V6SA 4FTKA 4C59A 4R7BA 3R9HA 3IW6A 5CSVA 3W2OA 4N57A 3QTUA 5GZ9A 4DGMA 2R4BA 4LGHA 5DOSA 3FSFA 5BUJA 1JBPE 4ZSLA 1GZOA 3PG3A 1BX6A 3QWJA 5E92A 4HCVA 4FTJA 3W10A 4EK3A 3KXMA 4FL3A 4FUXA 2B54A 2Z60A 4L00A 3RPOA 5CEPA 4MAOA 4Q2AA 3WIKA 5LVMA 5HCZA 4QMVA 3UIXA 4D9UA 1I44A 2IVVA 4EKLA 2OWBA 2XKCA 3CLYA 3NLBA 4YPSA 2YCSA 3R6XA 5IA3A 5M44A 4FK3A 2XNGA 1XWSA 2UVZA 1ZMVA 3O96A 3JXWA 3W8LA 3D15A 2HWOA 3UNJA 3CKWA 5DR6A 2QOFA 2UW8A 2XNPA 5IDPA 3AGLA 4KAOA 3VS7A 3MY5A 4X6RA 3TUCA 3K3IA 4BIBA 3IKAA 1CKPA 4UZDA 3R2BA 2UW5A 3ZO4A 5C26A 1WMKA 2XIKA 4X3FA 2R3FA 3ORPA 5LCJA 1FMKA 4L3LA 3VJNA 4EL9A 5E90A 3RPRA 3NUAA 3UODA 2O0UA 4PDPA 4PPAA 4Y83A 5KKRC 1QPCA 3C0GA 2P55A 3U9NA 4OUCA 4NTSA 1ZZ2A 5M4UA 4TXCA 4FNXA 1WBSA 4NM0A 4A4LA 4PV0A 5AV1A 3LZBA 4NIFA 3DU8A 2FGIA 4H3BA 4FZ7A 4KUJA 2UZEA 3EZRA 2W1IA 4W8DA 2OIBA 4U40A 2IPXA 4IWOA 4HW7A 4FGBA 5IQAA 2WGJA 4O7RA 5AUXA 4NW5A 1OIRA 3LVPA 4BRXA 3EQIA 4DINA 4AN9A 5JKGA 3G90X 5A4EA 3LCSA 1FGKA 3KC3A 3FHRA 3QLGA 1H08A 2GNHA 2ZV9A 4G3DA 1WVXA 4WT6A 3VS3A 5TOZA 4KSPA 3TZ8A 3RAIA 4FL2A 4KIPA 3P08A 1BMKA 4EKKA 4ZZNA 2W5AA 2PMLX 2GQSA 5CSPA 2PTKA 4FGRA 3NVKI 5DRBA 2XNMA 2PZIA 1OM1A 2IW9A 2VO6A 3SC1A 1RDQE 5HU9A 4QMTA 1YI3A 3DQWA 1M2QA 5L6PA 3DT1A 3Q32A 3EL7A 2XRUA 2CN5A 2PHKA 4WRSA 3ZLSA 4C58A 4CKRA 3QTSA 4FOBA 2PMNX 4YZMA 4QMYA 5KKRB 3S1HA 3NZ0A 4PRJA 2X81A 4X7QA 3OD6X 3MGYA 5CT0A 4D4VA 5EQPA 4USDA 3MB7A 3FYKX 3C4XA 2OO8X 4FV3A 3ZDUA 4X3JA 2ITUA 3OCTA 5AR4A 3UOHA 4BTKA 1FMOE 4WO5A 4AZSA 3UZRA 1H1QA 1REKA 2VWUA 1Z5MA 3MTFA 4G2FA 4Y8DA 4RQKA 3R9RA 1ATPE 1M2RA 3SG9A 2YWVA 3RI1A 4ALVA 3NIEA 2QURA 5HD7A 5FQDC 4DTKA 3PA4A 1JKSA 1Q99A 3G5DA 2B9HA 4FSTA 4FKWA 4X21A 2B4SB 5KMLA 4I3ZA 3E93A 1R0PA 5AAEA 4QMPA 3MA3A 4MCVA 1URCA 5DMZA 2WTKC 4BWKA 3R71A 5CU2A 3RPSA 4EYMA 1T45A 4WA9A 1SNUA 4LG4A 4HGTA 3OUKA 3FC2A 5CALA 2OGVA 2QOCA 4QP4A 2WQMA 3FLNC 4XV2A 3DFAA 4YP8A 1KV1A 5DH3A 4JAIA 4RX8A 3CQEA 1M7NA 3EQRA 4BDGA 2HXQA 4I24A 4NH1A 2BRNA 2QG7A 3OXTA 2J0JA 4FSQA 3VBWA 1GZ8A 4LMUA 2WO6A 4G3FA 1CKJA 3A7GA 2GNJA 5AP4A 2WMRA 5JQ8A 2KTYA 4J96A 2WQBA 3KULB 2W5BA 5ANDA 1W83A 2QODA 4U81A 4E26A 5JK3A 1NT2A 3A7IA 3HV4A 4FT5A 2BFXA 2YLFA 4C37A 2XK9A 2IG7A 2BAQA 4AOJA 1JPAA 5EYDA 3A7HA 3MH1A 3QD3A 4ZTQA 3E8DA 3F61A 4HYUA 2YM7A 4C4GA 5CNNA 3ZRLA 4Y5HA 1KE7A 4ZXTA 3O51A 3TTIA 2H9VA 3BU5A 3KMMA 3MPAA 4PMTA 5EYMA 4IM0A 4I4EA 4ZTNA 4BCHA 4YZBA 5L6OA 5IQHA 2VWZA 3R1SA 4FUYA 4NW6A 3HA6A 3TXOA 4UMPA 5E8WA 4O0RA 4IQ6A 3MESA 1OKVA 3FJQE 4H1JA 2B9FA 5DE2A 2YWPA 4I41A 1Z57A 4DTBA 2X9FA 2HCKA 3HL7A 3UZTA 4FV5A 2PVJA 3FMDA 3PVWA 4N0SA 3D7TA 5A4TA 3KU2A 4IB1A 2WTKB 2ZB1A 4KD1A 3CXWA 1SVEA 2V62A 3R7EA 3ANQA 3EJ1A 5CXHA 3VIDA 3FAAA 4U9AA 4WSYA 1Q97A 4UWYA 4CFMA 4ZP5A 1H01A 1H26A 2OZAB 3LFQA 4HYHA 2X7FA 4KRCA 2AC3A 3OF0A 2FUMA 4J53A 3ZXZA 4XLVA 4PWNA 3IW5A 3C0HA 4FF8A 1YI6A 5HE3A 2Q83A 4WUNA 3LQ3A 3NUUA 2X7GA 3QHRA 5HHWA 4H3QA 3V8WA 5LWMA 3QALE 5GNKA 4DA5A 2UVXA 3R28A 2VWXA 5CANA 4WG4A 4HYSA 5CEIA 2OI4X 4FKGA 4AA0A 1PXIA 4MNEB 3EN5A 4QQJA 3PZHA 4CZYB 4GIIA 2P4IA 4AW1A 4YC3A 3SLSA 4HVHA 1NVSA 3BBTB 3E64A 3UNKA 3ENHA 3QKMA 3CD8A 1ZOHA 3BYUA 1H00A 3DS6A 3MH2A 4TT7A 4V05A 2JDOA 4GS6A 3WYXA 3ET7A 4LM5A 4BY9E 1BL7A 3RM6A 3ZTXA 4XG2A 4DFYA 3RZBA 4CFVA 3AQVA 3IPHA 3BYMA 3DXPA 2VTIA 3KY2A 4MXAA 1JKTA 5ETIA 2JD5A 4FKSA 5ANEA 4BYJA 3EQCA 4K9YA 4C2VA 4HZSA 5E8ZA
chains in the Genus database with same CATH superfamily
4TYEA 2R3PA 3MVLA 3AC4A 2IVTA 1IR3A 3KN5A 4DHJA 4DGGA 4USFA 5L2IA 2R3IA 3QBNA 2GFSA 5CQUA 3WF7A 4ALWA 3QHWA 4EORA 1TQMA 2OXXA 4GUEA 5EG3A 4BJJA 2J0LA 2ZM3A 3GOPA 3L9MA 4RLLA 5AUWA 5CF4A 3O8PA 3I7BA 4JL9A 2AEGA 2BR1A 1LR4A 1YOJA 2R3GA 4X2GA 4MXOA 3UTOA 2QHNA 4K1BA 3Q9YA 2QQ7A 4LI5A 5IZFA 5JN2A 2WOTA 1OZ1A 4O96A 2OZOA 3K5UA 5AR3A 3TG1A 4D2RA 4MD9E 3Q3BA 4DG3E 2ZM1A 5FP6A 3LLTA 5CYIA 5I0BA 4EQCA 4K33A 5GZ8A 5HBEA 4E6CA 1PKGA 4QQ5A 4RWKA 2HOGA 3TZMA 3KF7A 2C1BA 4TNDA 4E8AA 3UC3A 2QKWB 2WTVA 3BLRA 3ELJA 2XZSA 4FTTA 4D28A 4O7NA 2JIVA 4I5MA 5H9BA 3U8WA 2BDJA 3OG7A 4LV8A 3QX4A 2PMOX 4Y95A 4RC3A 1P4OA 3Q52A 4GG5A 2FO0A 4YO6A 2Y7JA 3SOAA 4AFEA 5L2WA 2PUPA 2XARA 4BR3A 2OJGA 5LVLA 1W0XC 5IISA 3RAKA 1ZXEA 4KIKB 4O6EA 5M09A 4W4VA 5IPJA 4KBKA 4CLIA 5EW3A 2VNYA 2FSLX 4U41A 4I21A 5IUIA 4HNIA 4RBLA 2JDRA 4G6NA 4NKAA 4OGRA 4RIXA 4AOTA 4O0WA 3R7VA 3CR0A 4HOKA 2JKMA 4ACCA 4QNYA 3I60A 3R9NA 4ENXA 1BI7A 3EZVA 3QZHA 3ANRA 1QMZA 4NFMA 1UU8A 3DCVA 4TWCA 4NWMA 3OROA 3EQBA 1UU3A 4M68A 4PP9A 3A61A 3C13A 3DBQA 4S34A 3SV0A 3FDNA 4HVDA 5IQBA 2SRCA 3AT3A 4RGJA 5J8IA 5HX6A 3FHIA 3ACJA 2R3OA 4FV1A 2YFXA 4UBAA 3W55A 4D2WA 2RG5A 5E8TA 4AW2A 4AFJA 1KE5A 3R63A 5DGZA 3HMPA 4OTGA 3QYZA 2J90A 4QP7A 1Q3WA 4O82A 3EN7A 5M06A 3RK9A 1XHAA 2OXDA 1U54A 2Q0NA 4JG7A 4JI9A 4OTDA 2WTWA 5CF8A 5L8KA 4GW8A 4U7ZA 1VYZA 4U80A 3ZO2A 2IWIA 1LPUA 3NSZA 3EQGA 2W1CA 3RBWA 3LFDA 1PMNA 3P5KA 3HV6A 2PE0A 5HNGA 5HVJA 4O4FA 4CFWA 4UMQA 1IA8A 2UZOA 1APME 1UA2A 2ERKA 4IVDA 5LMBA 3LM5A 2B0QA 1KOBA 4L6QA 5CVHA 4BYIA 2J0MB 4BZDA 3DAJA 4OBQA 4ZEGA 5M4IA 3AKKA 1SYKA 4NKSA 2F49A 2JBPA 3KXHA 4F9BA 2QOLA 3AXWA 3Q96A 3FKNA 3TCPA 4BGGA 1XH8A 3COMA 4MVFA 2X6DA 2B55A 2XIXA 5J9LA 4JIKA 4QTBA 5HNBA 5EYKA 4DYMA 2VTQA 2XKDA 1ZAOA 4AAAA 3NS9A 5DIAA 2OIQA 1H28A 4FR4A 4RC4A 4YGAA 3AD5A 4YBJA 1GIIA 2R3QA 4QMOA 4R5YA 4C4IA 4C3FA 4DHIB 2JAVA 3OTUA 2XRWA 1JQHA 1JSUA 2E9VA 5A4CA 1ST4A 1YQJA 2I0EA 3F5UA 4MBJA 3UOLA 4IE9A 3ZUVA 5E9EA 2WIHA 5FBOA 4O0XA 3AD4A 4Z7HA 2QOKA 4PMSA 3C4ZA 4BDBA 4DC2A 5C8KA 4FTCA 4QP8A 1Y91A 3UP2A 4DTAA 3DBFA 4F64A 4QPSA 3TNHA 3PIYA 5GJFA 3MN3A 4DEIA 3V8TA 1KE9A 5A54A 5HIDA 1MP8A 4A7CA 4S31A 3IW7A 2X1NA 4NTTA 3IO7A 3OUNB 5JH6A 3GEQA 3VF9A 3NAXA 2X0QA 3C5IA 3B2WA 5H3QA 4ANBA 2X39A 2Z8CA 3GCPA 3PSCA 4ASZA 4PY1A 2UW6A 4WOVA 5IA5A 5KZ0A 3FMNA 5CF6A 2Y8OA 2B53A 3AOXA 4U43A 4CCUA 3SG8A 2RG6A 3T9IA 3RKBA 1Y8GA 2O3PA 3QYWA 4FBXA 4ASXA 4GCJA 4RPVA 3PDTA 4GT3A 4R7IA 5AUYA 3V3VA 2NO3A 4EH2A 3CPBA 5H2UA 3QTXA 5CNOA 3QQHA 4HJOA 1LP4A 3QRKA 4XBRA 5JGBA 3G0FA 1UVRA 4IB3A 4DAWA 1YXXA 2FYSA 1WBOA 2VAGA 4HVGA 2UZWE 2YM4A 3DJ5A 4C3PA 3GENA 5JRSA 3PA5A 2XIYA 3GBZA 4J99A 3OT8A 3QRTA 3BGQA 4EHGA 4IANA 3L8XA 3HGKA 3ORIA 4G17A 4BDCA 4JQ7A 3FSKA 2RKUA 2C5VA 4TYJA 3ALOA 3H9RA 5AR5A 2C1AA 3TT0A 4QYFA 5JZJA 4GFMA 5C4KA 4V01A 2B9JA 4GJ3A 2XCHA 3HVCA 4E6AA 3GXLA 2RFDA 4AA4A 1F3MC 4XHKB 4D1SA 5CS6A 4QYYA 4RC2A 3OMVA 2I1MA 4O4BB 4CLJA 3V5WA 3MPMA 2VO7A 3DGKA 3DJ7A 4O4CA 3KQ7A 4G31A 2WOUA 3I0OA 3ZSHA 3H9FA 2IW6A 3CSVA 4JS8A 5I9VA 1IRKA 3KGAA 2HZIA 1OGYA 1H27A 3KRJA 5IUHA 1H4LA 4QDEA 1JSTA 1V0OA 1NY3A 3ENMA 5DEWA 4BDIA 4M13A 2VTLA 4OTFA 3GU8A 3LHJA 5LVNA 4EOPA 2OJIA 3PRIA 5DR2A 3QD0A 3QXOA 3R7OA 4BCMA 4DEHA 3HMOA 4G5PA 5FD2A 2VGOA 4AT3A 5T3QA 4C02A 1YHSA 4K18A 2GHMA 3MFSA 4HZRA 3HECA 4TYIA 2YM5A 4OAVB 4X2NA 4N4SA 3I5ZA 3PY0A 4OW8A 2VUWA 4KS7A 5DA3A 1Z9XA 3GGFA 4TW9A 4ZLOA 4C33A 5EDQA 3IGGA 4IJ9A 1CDKA 3UBDA 2VTOA 3BEAA 3RWPA 4FVRA 4OR5A 3QQJA 3ZZWA 5C1QB 4JJRA 3AG9A 4CV9A 1Q4LA 2BROA 1A48A 2XAMA 3C7QA 2G9XA 3R02A 4P2KA 3PLSA 4UXLA 1W7HA 5K3YA 5B0XA 3NIZA 4B8LA 3ZCLA 5FDPA 3LLAA 1LEZA 1UNHA 1Q8WA 2CGUA 3KRRA 5M55A 2XNNA 3ZLWA 4F08A 4YTCA 2GNGA 5LVOA 3PA3A 3UIUA 4LQMA 3PXRA 3MA6A 4G9RA 2VO0A 1K2PA 5AP7A 3Q6WA 2ETKA 3P1AA 4AZVA 3VJOA 4G6LA 4YJSA 2PULA 5DT0A 4ALUA 2IZRA 3AKJA 4WNKA 3CGOA 2ITTA 5ANIA 3DLSA 5J9YA 1QPEA 3DKGA 4O2ZA 4FV4A 3ZONA 5AUUA 3F6XA 3VVHA 4O7YA 5LWNA 1JWHA 2YAKA 4X0MA 4O0SA 2OICA 1JVPP 4UV0A 1WBPA 4ANQA 4WNMA 3RJCA 2WZJA 2XB7A 4LGDA 4E20A 1T46A 2J2IB 5CU0A 2C3KA 5G1XA 4ZSAA 3BL9A 4CCBA 3KK9A 1J1CA 1SVHA 3VS6A 1PHKA 4C4HA 4ZLYA 3GC7A 5M07A 3FZ1A 4FIGA 2YZAA 3SXRA 2EVAA 3BCEA 4JBVA 2VN9A 4BTMA 4LL5A 3MIYA 1WBVA 2E9OA 1FVVA 4I6BA 4J7BA 5LMKC 3BZ3A 3MDYA 4XP0A 1W2FA 1YRPA 5J87A 2AUHA 1DAWA 5AAFA 1XKKA 2C0TA 2VO3A 5EYCA 2XK3A 1YXVA 2WTIA 3NW5A 4NJ3A 3NUXA 3Q4CA 3QTZA 1P4FA 2OKRA 1WFCA 4IAKA 4IZAA 4JX7A 5D12A 5D7VA 4ZTLA 4H39A 1CKIA 1E1VA 4C4JA 4RA5A 3FC1X 4AGWA 4OLIA 4Y85A 2VTSA 5GIPE 3LJ2A 4RVTA 2OLCA 4OAUC 4FL1A 4FKTA 3WARA 4FEVA 3MJ2A 3MSSA 2X4ZA 1VZOA 3PSDA 4AWIA 2YDIA 4H58A 2X8DA 4YHFA 2R3LA 3BHHA 4ZOGA 4RX5A 4TYHA 2RF9A 3FKLA 2CCIA 1ZYDA 2IZTA 2WU6A 3Q4ZA 4RSSA 2BZIB 3BE2A 3Q9ZA 5DI1A 4PQNA 4QTAA 5B2KA 4AS0A 4F7SA 4OTPA 2PVNA 5C4LA 3Q60A 1PF8A 4R3RA 4EOSA 2C3IB 3GQIA 4DGOA 4TTHB 2VU3A 4OBOA 2C30A 5FGKA 3V6RA 4CV8A 1CSNA 4MNFA 3NUSA 2C4GA 5CY3A 4GKHA 3EQDA 3ID6C 2AQXA 4DCEA 3U54A 4KABA 2QU6A 3H30A 4RWLA 1X8BA 1PXJA 3VS4A 4MF1A 4O7WA 3TM0A 3COIA 2WMSA 5CSWA 2I0VA 4L42A 4QOXA 3KREA 4MQ1A 2UVYA 5BPYA 2Q0BA 3P86A 4IVAA 2BIKB 3NUYA 5E4HA 3R7YA 4EZ7A 1LEWA 2XVDA 5C9CA 5AMNA 5EHYA 5L2QA 4F1MA 3JS2A 4EK5A 3BWFA 5J1WA 3U55A 4DLJA 2PVFA 4QDVA 3TNPC 2H34A 4XG3A 2UZBA 2VZ6A 4FNWA 4MHAA 3PP1A 4RJ3A 1M2PA 5AM6A 2ETMA 3CIKA 4TN6A 5F9EA 4ANLA 2NYAA 1G8AA 5DPVA 3LOKA 3D5UA 3HRFA 3T8OA 2E9NA 3C1XA 3OHTA 5T6KA 3PFYA 1ZMUA 3THBA 3SX9A 3S2PA 5K4IA 3OTVA 5I9XA 2W1GA 2CHLA 3E8CA 3G2FA 5AA8A 5HD4A 4HCTA 2Y4IC 4RVMA 2YZLA 5HCYA 3RPVA 1FINA 4U44A 5EHOA 4IVBA 2H96A 4BDHA 3SDJA 4DGLC 4K77A 5BUEA 2BALA 5CTPA 2W5HA 3SW4A 4YJQA 1H0VA 3U6HA 3PIXA 4ZTSA 4M15A 2WIPA 5HI2A 2C6IA 3F5GA 4E5WA 5JFVA 5IH4A 4HGSA 4BTFA 2A4LA 4A07A 4EOIA 2W7XA 4GYIA 5JRQA 5CU6A 2P2HA 3ZDIA 4U5JA 2IO6A 3W0NA 4X3FC 2E9PA 5AR2A 3CPCA 4IB0A 4FKQA 2ITNA 4AA5A 4YHTA 4FKLA 4BZOA 2XNBA 2HWPA 4GIHA 4BFMA 4AG8A 1JOWB 2WB8A 1SZMA 4G16A 4PPBA 2A19B 1ZWSA 2Y6MA 2O5KA 3P78A 2QLQA 1UNLA 3P7AA 4J98A 3VW8A 4NM7A 3C5UA 3I79A 4L46A 4TZRA 1KE8A 3P7CA 1A9UA 3ULZA 3GCVA 4YC6A 2GTNA 5L2SA 2XKFA 3LFAA 4KBCA 4BCFA 4FG7A 3Q2MA 1WBTA 1BLXA 2BDWA 2XJ0A 1PYXA 2ZMDA 3IW4A 4FNYA 1TFFA 5IA0A 2W4KA 3Q9XA 1OB3A 5E1SA 2PVMA 3NR9A 2F2CB 2W0JA 3KRXA 3RHXA 4OTHA 3QCXA 3LCKA 2W1HA 2DS1A 2YJSA 3IONA 3MV5A 4GT4A 4PMMA 5KX8A 1LUFA 4EQMA 2WAJA 4EOOA 4F6SA 2LAVA 2F57A 4FMQA 4NT4A 2QOOA 4A4OA 4IWQA 5ANJA 3TJDA 4ACDA 4TRLA 3VBVA 1UWHA 2RL5A 3QZFA 2Y4IB 3FY0A 4ITHA 4F78A 4C61A 3PJ8A 4MWHA 1O6LA 2PY3A 3BV3A 4FKVA 2KULA 4IH8A 4BGQA 1ZRZA 3DXQA 4MK0A 5CZIA 2BRGA 4UZHA 5EQYA 3PZEA 3EN9A 2F4JA 1YDTE 2PVYA 3VRYA 4C62A 4F9YA 5J7HA 2VTJA 2O64A 2WHBA 4YJOA 2CLQA 3M11A 4QD6A 4YNOA 4DFXE 2G15A 4G6OA 4IZ5A 4X3FB 1L8TA 3COKA 4BN1A 2VWVA 3C4CA 2ITZA 1DS5A 2BPMA 2QNJA 4WUAA 3QRUA 5E8YA 2OH0E 5F94A 2GCDA 5AUZA 4S32A 5CI6A 4BCKA 4F4PA 3SXFA 1DAYA 4EONA 4BI1A 3QCSA 3UDZA 4H1MA 2IZSA 5B2LA 4M3QA 3WF5A 3GB2A 4C34A 3RPYA 3PTGA 3QL8A 4L8MA 3FMMA 4NIFB 3KRLA 5I5ZA 4CG9A 2XIZA 4B0GA 1PY5A 3K5VA 5HG8A 5ETCA 4AX8A 3C51A 2J0IA 3A4PA 4XS2A 4GV1A 3UO4A 4FV0A 5CU3A 3FL5A 2R3RA 3GU6A 3R73A 4WG5A 5TT7A 5A4QA 3DXNA 5IUGA 1J1BA 3EYHA 4GKIA 3DTCA 4BZNA 3ORXA 3UIBA 3ETAA 4FT7A 3ODYX 4XCUA 3GQLA 4YJRA 4BCPA 1FOTA 2QLUA 3IQ7A 3C4EA 3ORKA 4E1ZA 5K0XA 4PL3A 3OEZA 4PL4A 4XOYA 3DY7A 3UG1A 3DK3A 5CZHA 2WMTA 3JUHA 3RNIA 3Q5IA 3NW6A 3PWDA 3GVUA 2J5FA 4D0WA 4IC8A 3MI9A 4NM5A 4AP7A 4ACGA 5KBQA 3NEWA 5DFPA 4YTFA 4EZ3A 2HZNA 1OUYA 1XQZA 1HCLA 5EFQA 5JGDA 3K3JA 4QTCA 4Z55A 2X2MA 3UPZA 3ZHPC 2OW3A 4AGDA 4D5HA 5DT4A 4CFXA 4RIWA 4KNBA 3TEIA 3QC9A 3PG1A 4FG8A 4J97A 4L52A 5BX0A 1BI8A 2QOQA 5KMOA 1P5EA 4KKEA 3LXPA 3O50A 4AZFA 4BCIA 1OPJA 2XIRA 1NA7A 2QOIA 1ND4A 1YOMA 2CLXA 2R9SA 3OT3A 2CGXA 4IX5A 4O2PA 5LCKA 3EHAA 3OEFX 4QP6A 5H8GA 2NNWB 1OIYA 4ITIA 3IGOA 1U5QA 3FWQA 4DCAA 4LRKA 4QP2A 3E7OA 5CENA 3EKNA 1ZYJA 3K54A 3OOGA 3V5JA 2ZDTA 3OS3A 3JY9A 3OXZA 3UZPA 5LVPA 3ZLXA 4XYFA 1ZLTA 4LOOA 3K2LA 4XRLA 5J1VA 5FLFA 3QTWA 3FZOA 4FK6A 3HX4A 4MEDA 4GJ2A 1YXSA 4CMTA 3PUPA 4QMNA 3NW7A 3PXZA 3QQKA 3HUBA 4CKJA 3PPZA 3VUTA 2PZPA 4YLJA 3DZOA 3MY0A 4BDJA 3N4TA 2ITQA 4BHZA 3N9XA 1F0QA 4PDOA 2BHEA 4JQ8A 5ETAA 3HV3A 3ZFYA 4GG7A 3DK7A 4C3RA 3D94A 3PVBA 4GMYA 4QP3A 3EL8A 2YIYA 4PNKA 2YIWA 1ZZLA 2WMUA 3HP5A 4I0RA 4W4WA 3TV4A 5KMKA 2GPHA 4M69A 4R77A 4QP9A 2I0HA 5AUTA 4UY9A 4DFNA 2QU5A 3LPBA 3WF9A 3NYNA 4XBUA 4V0GA 4LL0A 4FICA 2DUVA 2QO2A 3MFTA 3VUKA 3POOA 4OTWA 3WBLA 3WF8A 4RFMA 3S0OA 3FLZA 3DZQA 4E73A 3QAME 4ZZOA 1ST0A 2CSNA 2CKEA 4M14A 1I09A 2R64A 2WFYA 3UDBA 3UQCA 4P5ZA 2ERZE 2VWBA 3ACKA 4WBBB 2GNLA 2V0DA 2NRUA 2UW9A 4CG8A 4QMWA 3E92A 2WMQA 2XK6A 3UVQA 2OJ9A 2VGPA 4JT3A 3UNZA 4O21A 4FG9A 2OJFE 1WBNA 4QYHA 4GRBA 3UQFA 4QMMA 3TKUA 4JR3A 3HKOA 3HDNA 2BRHA 2QKRA 3SOCA 3D7TB 3GC8A 4IXPA 4X2JA 4IW0A 4L43A 3TV7A 1JLUE 2P3GX 1NXKA 4QPAA 3O23A 5HE1A 4DE4A 2ITYA 2IVSA 2J4ZA 3FQSA 4AN2A 2HENA 4CSVA 3ZZEA 3VF8A 3TIYA 3OW4A 2GMXA 5K9IA 3BGPA 5AV4A 4ZJJA 1ZYLA 2WTJA 3U6IA 2YN8A 3ODZX 4QO9A 3ZU7A 2CCHA 3NGAA 4MKCA 1G3NA 1J91A 4EBWA 3KIOC 1UKIA 2PZYA 4EHEA 1OPLA 5I3RA 4CQEA 3GI3A 3WYYA 4EOKA 5EOLA 3CKXA 4P4CA 1F5QA 3BHVA 2C3JA 3R8LA 1K9AA 4JDHA 4P7EA 3I7CA 5EM5A 4PTEA 2V55A 4AT5A 4C57A 4BB4A 5KNJA 3D14A 4ZTMA 4J1RA 5JGAA 3A8XA 4XG7A 1OECA 2QI8A 1OITA 3SW7A 4FT9A 5GZAA 3TKHA 4NL0A 2JEDA 3W0MA 5IQEA 2BUJA 3DKCA 3EMGA 4O4DA 5HG5A 3A7FA 3QKKA 3VWAA 4AZEA 4BF2A 4FV9A 3A62A 5CVFA 2GS7A 3G9LX 5HO8A 3QLFA 4FA2A 5CXZA 3AKLA 3ML1A 4XV1A 4FRFA 3QTQA 4A9TA 2I7QA 4XOZA 1R0EA 4WKQA 3QQGA 3LMIA 4FTUA 5M53A 5F1ZA 2WNTA 4M8TA 2ZV2A 3D5VA 4D55A 3KKVA 3PUFC 3ORZA 5TO8A 4BDDA 2B1PA 5E8UA 2ITVA 3UO6A 5DBXA 3CY3A 3W2CA 3QQLA 4B6LA 3DK6A 5JFWA 3QRIA 3ROCA 3PJ1A 3Q5ZA 3VBTA 4MXXA 3BBWA 3SHEA 5DYJA 4XUFA 3COHA 4FZ6A 3ZRMA 4BJJB 3TUBA 2REIA 4FKIA 3HP2A 3PVGA 3Q04A 4R3PA 4D4YA 4DEDA 1ERKA 5HBHA 4CFFA 3G15A 2EUFB 4YTHA 4USEA 4R5SA 3OBJA 5LJJA 4KKGA 1W8CA 3UQGA 2QR7A 2BIYA 2C5OA 2GHGA 3CTQA 3FLQA 4PUZA 3ZXTA 1BL6A 2BFYA 3CTJA 3DB6A 1U59A 3HEGA 4KA3A 4CRLA 3DBCA 4MXYA 2QO7A 4FV8A 3ZEWA 1UU9A 4ZS4A 3ZC5A 3NAYA 3E8EA 5EI6A 3E8NA 1R1WA 3OXIA 3RCJA 4D58A 3GFEA 5J7BA 4BWXA 5CSXA 3HMIA 2LGCA 5IA2A 3QFVA 4RJ5A 4AXEA 3F3VA 3C4WA 3CS9A 3P79A 3QU0A 5DRDA 5D41A 4LV5A 3OWLA 4QT1A 3RNYA 3ORLA 3BX5A 2J7TA 3NX8A 4YLLA 3U51A 2P2IA 4ID7A 4JG8A 5E1EA 1GIHA 3AMAA 4AW0A 1OBGA 1U5RA 2R3JA 5FTQA 3LFCA 4KRDA 2VRXA 3LCOA 2BZHB 4FTOA 4FV2A 4G3GA 3PJ3A 4IX3A 4NK9A 3BIZA 4MF0A 4I6HA 4OTRA 3VS0A 3NWWA 2CKQA 2I0YA 2GNIA 2C5XA 4RG0A 4TY1A 4RIXB 3EQHA 3QCQA 4KSQA 4WSQA 5EM8A 3ZOSA 5LOHA 4II5A 3KB7A 4WNOA 2HW6A 3AC1A 3LXNA 4ZS0A 4GU6A 2AYPA 4PNIA 5IH6A 4W9WA 3I6WA 4R1VA 2BVAA 1WVYA 4ZMFA 4EH5A 3UMXA 3MFUA 5HQ0A 2WEIA 4RJ8A 5E8SA 3E63A 2A2AA 3F7ZA 1UKHA 2YERA 2BZJA 3EKKA 3F88A 3AGMA 1DI9A 1H1SA 1XR1A 4M97A 3LCDA 3QGYA 4UALA 1TQIA 1Y6AA 2Z7SA 4EK6A 1PJKA 3HUCA 4EHZA 2RSVA 4LFIA 2ONLC 1YOLA 4IJPA 1ZYSA 2BAKA 3DAEA 3Q6UA 4UEUA 4YJPA 3CBLA 4CEGA 1M14A 5BYZA 4HGLA 2VD5A 1U54B 4DGNA 4AE9A 1W82A 2IJMA 3UYTA 5A4LA 4FZFB 3CC6A 5ETFA 1XH9A 3NPCA 3ATTA 3QX2A 3QUPA 2R3HA 4FIIA 4ERWA 2FB8A 5C03A 2W05A 4BI2A 3U4UA 4IAAA 3QA0A 5IEVA 2XEZA 3KCFA 3ZO1A 3DV3A 4Q5HA 2JAMA 3QUEA 2C5YA 3MY1A 3UJGA 3QQUA 4AXCA 4NU1A 4S30A 4O83A 2GHLA 3DKOA 4ACMA 2BZKB 2XK8A 4RIYA 5M4FA 4H36A 3ZRKA 4XV9A 3HV7A 4BWPA 4M0YA 1OL1A 3RHKA 3ZLYA 4C8BA 3FI8A 4FEWA 3OBGA 2UZNA 4U97A 4DBXA 3RZFA 3PSBA 4K0YA 2CNVA 3SRVA 5K5NA 5AFVA 5FRIA 3GFWA 2GS6A 3HZTA 2NRYA 4XNEA 3VULA 5HE0A 4CGAA 4APPA 2XK4A 4KBAA 3FLWA 4M12A 4G3CA 5IMEA 2PZRA 5HE2A 5ICPA 2X0PA 4MD8E 3F5PA 4GUBA 4IWDA 2AC5A 2Y0AA 3NMUF 2C6DA 4I23A 1PXKA 4EOLA 4QEBA 2W1EA 1KV2A 5CEMA 2UW3A 3D7ZA 2JBOA 4IIRA 4QP1A 3UIMA 4AF3A 5DNRA 4FTNA 3E3BX 2JITA 1FQ1B 1ZY4A 4IAYA 4BCQA 3POZA 3UG2A 2VX0A 4LRMA 3VUDA 1URWA 3AC3A 4NJDA 4ZTHA 4E3CA 3HNGA 3EFLA 4B99A 4DEBA 1OL5A 3ROYA 3KMUA 4QPMA 3Q4TA 3W0SA 2WMVA 3BYVA 4BI0A 2BILB 4FTIA 5EI2A 1G8JA 1PXOA 2G01A 3I4BA 3BE9A 3IDPA 4ZTRA 4JRNA 5AV3A 5M4CA 1L3RE 3V5LA 2BTRA 3U87A 2ITOA 3UOKA 4E93A 5KO1A 4G34A 4EH3A 1MQ4A 4FSZA 4N6ZA 2FSMX 5C8MA 2PWLA 4DDGA 3WF6A 4BTJA 2RFNA 2G2HA 2XNEA 2YA9A 4NFNA 4E4NA 5JT2A 4ZSEA 1W98A 3LE6A 3PPJA 3QTIA 4RJ7A 3ZO3A 4G5JA 1PRYA 1SMHA 3EWHA 4FV6A 3LFSA 4GFGA 4OT5A 5D7AA 3GU5A 5AUVA 5H8EA 2VTRA 3BU3A 3LQ8A 5A6NA 4L9IA 2YDJA 4HVIA 2PVLA 1XH5A 3FI3A 2UZTA 4DH7A 5EKNA 3F7WA 1V1KA 2R7IA 4ZSGA 5BVKA 2YABA 3R9OA 2W17A 3U9CA 3WOWA 4B4LA 3BLAA 3TIZA 4AN3A 3R04A 4MH7A 2CKPA 3FKOA 3EQPA 3ITZA 4IAFA 3FZSA 4I4FA 1EH4A 2V7OA 4YHJA 4BHNA 4Z3VA 4I6QA 4IM2A 5AP0A 5KHWA 1WCCA 4F09A 2DWBA 1O6KA 2F9GA 5EOBA 5IMXA 2XM9A 4L3JA 3V04A 3HRCA 4DITA 2ZOQA 3D0EA 3KVWA 4I22A 3FPQA 4F9CA 4WBOA 5J9ZA 1STCE 2WMWA 1W84A 2R0UA 3FMJA 1KSWA 4L7SA 2I6LA 5HTCA 1YWNA 5FEDA 4L44A 2E2BA 2ZM4A 5A3XA 4E5BA 3W2PA 3WZDA 4NCTA 4EUTA 4XMOA 3DA6A 3DBDA 4TPTA 1GIJA 4FTRA 5HIEA 3FZTA 1RQQA 1QPJA 3ORMA 2PPQA 1MUOA 3DB8A 3HLLA 3R21A 2IZUA 2H6DA 3ZS5A 3LJ0A 5C8NA 2CJMA 1J7UA 1ZOGA 3NNWA 4G1WA 5D11A 1GJOA 4JQEA 1ZARA 2BRMA 2PE2A 2WELA 3PXYA 5HCXA 3TNIA 3DKFA 4B7TA 4BGHA 1QCFA 4BKYA 4DFUA 3PY3A 3PE2A 1CTPE 4CMOA 3G6HA 3KA0A 4MBLA 4IDTA 1P2AA 4AACA 4LYNA 2WEVA 4RJ6A 3NNXA 3CTHA 4D4SA 2F7XE 4WRGA 1YXTA 3O71A 2A27A 3OVVA 2UW4A 4F0GA 5BYLA 2EXCX 4MQ2A 5KE0A 2PZ5A 3TDVA 5DHJA 2Y6OA 3EH9A 4AUAA 2OIDA 3UOJA 5IDNA 1YW2A 2F7EE 4NZWB 4MWIA 1TKIA 4L53A 3R9DA 2C6MA 4XJ0A 2XKEA 5LMAA 5DLSA 5ACKA 3UMWA 2R3MA 5HKMA 5HTBA 3I6UA 4RWIA 5DVRA 3AMYA 2PVRA 4ANOA 2YM8A 3F2NA 3PRFA 3R2YA 3TL8A 1B6CB 3L1SA 4AT4A 1OKZA 3TYKA 4ZZMA 3UYSA 4LV7A 3JR1A 2W9FB 5HBJA 3N4UA 1R39A 1Q5KA 4QTDA 3L9PA 3VO3A 4GVAA 4YTIA 1OIQA 3CGFA 4O91A 2X9EA 2W96B 4A4XA 3HMMA 5GJGA 5L4QA 1RW8A 3QF9A 3ULIA 4C36A 4FEXA 2UZLA 2V5QA 3OY3A 4LRJA 2UZUE 4PDSA 3A60A 3A4OX 5JZNA 4D2TA 3BYSA 5K5XA 3DNDA 5IQFA 3ZSGA 3QC4A 2OH4A 4EH8A 1AGWA 4QRCA 2XM8A 1Y57A 5AX3A 5BVOA 4E6DA 1H1RA <