5CAUA

Egfr kinase domain mutant "tmlr" with compound 41b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
323
structure length
297
Chain Sequence
b'GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 297
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cauA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cauA01
1WVXA 4FC0A 4LFIA 4QYHA 2CDZA 2ETRA 2ETMA 2G9XA 3PIXA 4QRCA 4W4WA 3HX4A 2OBJA 3EN6A 4KB8A 4I22A 1QPEA 2Z7SA 3QQGA 2ITVA 4YSMA 4FIGA 4UMUA 1TVOA 4JLCA 1PXKA 4XMOA 5EHLA 4ACMA 2ONLC 2YIRA 3BV2A 3QRTA 4DG3E 4USFA 4DFUA 3MV5A 1U4DA 4QO9A 1OKZA 4JR3A 1JOWB 4MHAA 3BWFA 2YM5A 4IX3A 4C62A 3TNWA 4Y8DA 4P5QA 3H9OA 1PXJA 5CEPA 4AA0A 3LCDA 3GQLA 4W9XA 4TYGA 1MRVA 4XV2A 4ENYA 2HW6A 5AJQA 3GGFA 4RFYA 2HCKA 4QTBA 3T9TA 3SG9A 4NM0A 5CU6A 4F1MA 3TZMA 4DEDA 2I6LA 2VD5A 4PP9A 4M8TA 4QYGA 1BL7A 5LOHA 3PVBA 4RX5A 3KRRA 5HD4A 1Y8GA 5LVNA 1G5SA 2REIA 3R22A 4M66A 5EI6A 3SXSA 1OIUA 4TL0A 5IU2A 4PMPA 2XYNA 3AMBA 4O38A 1URCA 3UBDA 4KIKB 5I9WA 3EN5A 3FKOA 5AR3A 3GCPA 2OFVA 4RPVA 2O2UA 4KUJA 1PXOA 2WTIA 2VX0A 2VRXA 4FT3A 4P90A 4PPAA 3BWJA 4ZZNA 3QX4A 4DEGA 3SGCA 4X2FA 2VWIA 1UVRA 4GYGA 4I5CA 4F64A 1RW8A 3QTQA 4ALUA 4Q9ZA 5J8IA 5DMZA 4YO4A 4C3PA 4UWYA 5GJGA 4APPA 3N51A 4CSVA 3ZS5A 4DE4A 4R8QA 3P0MA 4IWQA 1SM2A 1OECA 2YLEA 1JKSA 2YCQA 3DNEA 4FV3A 2VTPA 3BGPA 1URWA 3GBZA 3G33A 4NEUA 3UO5A 1B38A 3C1XA 2X4ZA 3EMGA 3QAME 1QL6A 2ESMA 2ITPA 2UW8A 4QP4A 4YZCA 4FG8A 3EZRA 5CF5A 4WA9A 2J5FA 5A6NA 4N70A 1OL5A 2CCIA 3DCVA 2XZSA 3MA6A 4LG4A 1YXSA 4GL9A 4BWPA 4IM2A 5L2SA 5EK7A 3IW5A 3TV4A 3KREA 2YAKA 2F9GA 3P7AA 3QA0A 2WMRA 3GB2A 4RLLA 4WOVA 4HZRA 1H24A 2QOFA 5DN3A 3TIZA 4N57A 1NW1A 3M42A 4QMTA 5IZFA 2ACXA 3FY2A 3OW3A 2SRCA 4K2RA 4R5SA 4EH8A 2VNWA 4XG3A 2B9FA 4MBJA 5DT4A 5HOAA 4PX6A 5HIEA 3FXZA 1HOWA 3DBDA 5CSHA 5AUUA 3ATTA 4UX9A 2I0YA 3QALE 3LFEA 1ZMWA 2BZKB 4FNYA 5ETAA 3HKOA 1UNHA 3RAHA 3W2CA 5A54A 2VTRA 4J95A 1EH4A 4FV2A 5BYYA 3IDBA 2J0MB 5J7HA 1Y6AA 4F7JA 1YHVA 2GNIA 3FE3A 4G1WA 2QD9A 4G5PA 4IEBA 3EHAA 3NYXA 1RQQA 2VGPA 3A99A 4MD9E 1H1RA 3EKKA 1K3AA 4N0SA 5CI7A 3QCYA 3NIEA 4D5KA 2JD5A 1OZ1A 1BYGA 2XKEA 3V04A 2PMNX 4QOXA 3GC8A 1H1QA 5DH3A 4IMYA 4J98A 4O84A 2HK5A 4F9AA 4XG8A 3TUCA 4FTQA 3PRFA 5EDPA 2GQSA 3OUNB 4XOYA 2G1TA 3QYWA 4E4LA 4IJ9A 2RGPA 3OWJA 4EC9A 4I5HA 3MH0A 4Y5HA 3K5VA 4LOQA 2WQOA 4PL4A 3BYOA 3JXWA 4R78A 4JX7A 4ZSJA 4IDVA 4QTEA 3FPMA 4IVBA 4K8AA 3VBVA 2IPXA 4MXXA 4S31A 1UU9A 3ZO2A 2PZYA 2R5TA 4FEWA 4E5AX 2IZSA 2RF9A 4PNIA 2CGWA 3GT8A 3UQCA 3BHTA 3U6HA 4FE2A 4O21A 2C6MA 3VHKA 5CSXA 4QP7A 4EOSA 4CFMA 4NL0A 2EWAA 3WZEA 4BWXA 1QMZA 2WIPA 2C3JA 1Q3WA 1W98A 4CZTA 3TNQB 4G5JA 4CV9A 3EQPA 4P7EA 2CKPA 2C6LA 4CZUA 1PYXA 3FXWA 2X7FA 4U3YA 2OXXA 2Y0AA 2W0JA 4I6QA 3MIYA 5DGZA 1R78A 5HBJA 2YHVA 2G2FA 1SMHA 4ITIA 2VTNA 1YOJA 4TY1A 3DFCB 3VRYA 3FMJA 2X8DA 4MXCA 5M09A 4L9IA 2I40A 4IWOA 4MQ2A 4YPDA 4KRDA 4AW1A 2JDTA 3ZDUA 4ZLYA 3CSVA 2JDSA 4PTCA 5HI2A 3RAKA 1WBSA 2A4LA 3P1AA 3ZO4A 3CTHA 2GMXA 1YWVA 3TI1A 3DAEA 4FV9A 4RZWA 1U5RA 4L3JA 3ZUVA 3QQHA 2C4GA 1JSUA 2XF0A 2PHKA 5DEYA 3PXRA 1IAHA 3PXFA 5CLPA 3SA0A 3BHUA 2VO0A 3OEFX 5M55A 4CNHA 1ZARA 3T3VA 3CTJA 3U51A 1AGWA 3GVUA 4UYAA 3IGOA 4E4XA 4CFVA 2B9JA 3FYJX 4J99A 4XHKB 5HLNA 2CLQA 4JDKA 4W8DA 5IPJA 3R9RA 4WSQA 4F09A 4J71A 2V5QA 2IW8A 3OCBA 2QQ7A 3TZ9A 4IAZA 1ZOHA 3KRXA 4O0YA 3BHYA 4ARKA 4DA5A 1Q8YA 3ATSA 3IPHA 3VS0A 3ZFMA 4WRSA 4AU8A 2JEDA 2PK9A 4I92A 3MVLA 3FY0A 5FM2A 2CKEA 3TACA 4XV3A 3EN4A 3ERKA 4EBVA 1J7UA 5C8NA 4FZ7A 4XG2A 1BLXA 4TWOA 5JK3A 4NCTA 2YDJA 4TN6A 2IO6A 2QI8A 3UVPA 3HDMA 3UODA 3QHWA 4BFMA 4BTJA 3DBCA 4GV1A 3V5JA 3KB7A 2JFLA 4PRJA 1Z57A 4O22A 1OKWA 2UUEA 2CNUA 4R7HA 3HAVA 3UE4A 2GS2A 2B54A 1OB3A 1YOLA 3D7TB 4FIIA 4FSTA 3PJ1A 2BPMA 3HA8A 5LJJA 1BL6A 3AD6A 1K9AA 4C2WA 3D15A 4F7NA 5CVGA 4M12A 3OWLA 4IH8A 3NYNA 4PPBA 4TYJA 5AV2A 5E90A 3A2CA 1OUYA 3AC2A 3FMHA 2W1CA 5ANDA 4D2TA 3GOPA 4CFUA 4R7IA 3D5VA 1R39A 5GZ9A 5K9IA 2GCDA 4RT7A 3PJ2A 5KMJA 4NTSA 2JKOA 3UIBA 3UZTA 2OJJA 2V62A 3TTJA 2UZOA 3ZLYA 4PDOA 2XJ0A 2ZB0A 3D4QA 4JRVA 2JKQA 1OPLA 3BYUA 2PVNA 3DKCA 4EC8A 3VBWA 1J7LA 4YJNA 3PJCA 5E1EA 5LMKC 2ZB1A 1GNGA 3C13A 1JNKA 3KRLA 2VTJA 4DGOA 4F70A 5J9ZA 5HESA 3NUPA 3VW6A 4CT2A 4AXAA 4EH6A 5IDPA 5JT2A 5IQIA 3E93A 3KULA 4FOCA 4O0TA 3KC3A 3AMAA 4IVDA 5FEQA 3W2QA 3NSZA 3EN7A 4JOAA 4E4NA 2BR1A 2W1DA 3JY0A 5JZJA 5AUXA 4M0YA 3ZRMA 5DLSA 4D2SA 3IGGA 2H8HA 4KS8A 4FKRA 5KNJA 3CQWA 4LGHA 4EYMA 3QCSA 2O8YA 3QZIA 3F9NA 4CFWA 2WAJA 3EL8A 2FVDA 2UZUE 3ZLXA 3L9NA 2QKWB 3KK8A 3LW0A 3NIZA 4ZTNA 3UP2A 4B7TA 3F2RA 4O7SA 3G6GA 4O2ZA 4JX3A 4GJ2A 4EOIA 3LM0A 3KXHA 2RFEA 2BDJA 4ALVA 1UU8A 2PTKA 4KRCA 5HKMA 4FYOA 2C30A 2PSQA 4XJ0A 4CQGA 3COKA 2OH4A 2Q0BA 3D83A 5HCZA 3O7LD 4O82A 5HCYA 2YIYA 3ORMA 4AA4A 4EI4A 2IVVA 2QOIA 1H0WA 4BRXA 4HW7A 4XX9A 4B6LA 4M97A 3OCGA 3R2BA 3R9DA 3U6JA 2C6KA 2V22A 3ORLA 4P4CA 4O7ZA 2X8IA 1ZYCA 4JIKA 1JKKA 3HEGA 4X6RA 4C38A 5AFVA 1A9UA 1GIJA 2BFYA 3H9RA 4GT4A 4PTEA 3MJ2A 4GEOA 4HGSA 4TTHB 4AGDA 3UC4A 4AS0A 2ERZE 4EHVA 2VTIA 2VWYA 2XK3A 5CF6A 1XBBA 3MJ1A 3TNHA 1L8TA 3Q9YA 5CVHA 3QHRA 2GNHA 1J3HA 1GY3A 1XH8A 3R00A 1LR4A 5CX9A 1NA7A 2OZOA 1XH6A 3FLSA 3NW6A 4TPTA 5D1JA 3WZJA 3PE2A 2Z02A 5EQEA 3FMNA 1GIHA 3OC1A 4GYIA 3U9CA 2YJRA 3GC9A 3UMWA 3RAIA 3RKBA 4FI1A 3CBLA 5I9XA 2W9ZB 3R73A 2WQBA 3IW7A 4MBLA 5L6OA 1TKIA 4W4YA 4YTCA 4BDAA 4QMQA 4X3FC 4NM7A 2QOCA 3F3WA 5LMBA 3T8OA 3DB6A 4ANOA 3WZUA 3RP9A 1U5QA 3SOAA 3V8WA 3RPRA 2GNFA 4UALA 3T9IA 3GC7A 5EFQA 2J0IA 2UW7A 3QUEA 4Q9SA 3M11A 4FV0A 3VS3A 4R3CA 5F9EA 4UV0A 4BCIA 4I4FA 5F20A 4NFNA 4QP6A 4ZMEA 4BR3A 3OW4A 3PZHA 1P4FA 3WYYA 4RQKA 4J97A 1XO2B 5JQ8A 4UMTA 2PVFA 4G9CA 3P9JA 1MRUA 4YLJA 4C4JA 1GZOA 1M2QA 2HIWA 3QGYA 3ORNA 3QKMA 1ZMUA 4FTIA 4JR7A 4GU6A 3ORZA 4H58A 4LMUA 3Q6UA 4I21A 5IA5A 4OTGA 4DFNA 4PP7A 4J96A 2Y4IC 4FODA 3FZSA 5IG1A 1G3NA 2C69A 4L00A 2B9HA 2QOHA 4HVGA 3LJ2A 3PLSA 3MVMA 3VS1A 5BVOA 4DCAA 2VTOA 3JPVA 5AP5A 4L7FA 4GMYA 4IWPA 3D5UA 4ZTRA 3UVQA 5BUJA 3HMMA 3ORXA 3TUDA 2BUJA 3DZOA 4S2ZA 4ZLZA 3MFTA 4QMUA 3VC4A 4AZTA 3CQEA 5HBHA 2J90A 3ZXZA 4AE9A 5KX8A 4LRMA 3UIMA 4AQCA 4E8AA 5I9VA 5K0KA 3AQVA 5TT7A 5I9ZA 3UQGA 2Z7QA 4F6SA 3TV6A 3LLTA 2J2IB 3CC6A 4E6AA 3OUKA 4LI5A 3RM6A 5CAUA 3NUAA 2R0UA 4FT0A 4MEDA 4QYEA 3RPYA 4NM3A 1Q8WA 4PTGA 4H1MA 4EZ7A 4F63A 4KKEA 4FGBA 5E8UA 3SXFA 3ULZA 4B99A 1DM2A 5HORA 5KMMA 2R3GA 3F69A 1DAWA 1YWRA 3DU8A 4FV6A 4QMWA 1Q3DA 2O64A 5ETFA 5EYMA 4BGHA 1W82A 4ZTLA 2FUMA 3QXPA 4HGEA 4II5A 3L8PA 5ANKA 3IW4A 3QTWA 4WNMA 4LRKA 5CAPA 5KKRC 4ZTQA 4YLLA 1UKIA 3Q2MA 3G6HA 3M2WA 3R04A 4P5ZA 5GINE 1YHSA 4AN9A 3AC8A 2CNQA 3VF8A 2H6DA 4S32A 3MTLA 4AA5A 2GFSA 2GHLA 5JH6A 3RK7A 4K1BA 2JFMA 4U44A 3FPQA 3FLZA 4RGJA 3G2FA 3V5QA 5E92A 3OY3A 4OTQA 5C03A 4JNWA 3IG7A 4C4FA 4G31A 5LWMA 3O50A 1VYZA 1L3RE 3KKVA 4C59A 5K5XA 3LQ3A 3NMUF 3KQ7A 4EKLA 3ULIA 2W06A 2W9FB 3QTIA 3GQIA 3Q04A 4I6FA 2VWXA 4XS2A 2B0QA 2WMBA 2EB3A 3FKLA 2XYUA 3RALA 3LM5A 4ASXA 3E8EA 4YUQA 1TQIA 2LGCA 3DNDA 3TEIA 1V1KA 2C6EA 3FC1X 4TYIA 1H1WA 2WQEA 3GXLA 3TNIA 3AMYA 3DTCA 3P7BA 3QQJA 4I93A 5EQPA 4U8ZA 2P4IA 4ACGA 4D4YA 3ODZX 2IW6A 3RHXA 2W1HA 4IW0A 4R77A 1PW2A 3EQFA 4A4XA 3LFNA 2EB2A 4JDHA 4FV8A 3A7HA 2P33A 4S34A 5LMAA 4OTPA 2YCFA 1CKIA 3DDQA 1WZYA 5EKNA 2BTRA 2RFSA 4W4XA 5L2TA 4UXLA 3I79A 3C4WA 4C57A 3E7OA 4EH3A 3PY3A 2X8EA 1T46A 4L7SA 2KTYA 4R3RA 4EL9A 4QP2A 4GS6A 3C4CA 5DT3A 5FQDC 3MSSA 4TKSA 4YC6A 4YURA 2C1AA 2VWBA 4FKSA 1Q8TA 1WVYA 5DVRA 1VZOA 1DAYA 4YPSA 2J51A 1YXTA 4YGAA 5B2LA 4MNEB 5D7VA 2E9PA 3EWHA 4BF2A 4BKJA 4RIWA 5IA4A 5DOSA 3EFLA 3PIYA 2WMXA 4JG7A 5HX8A 3HMNA 3FZ1A 5HG7A 3V8TA 3QUPA 4D2PA 2GHMA 4HVSA 4YJRA 4ASDA 2PVRA 4G3EA 3R9NA 5JGDA 3E5AA 4W8EA 4F99A 5E8YA 3MESA 4B8MA 5HEZA 2ZMDA 2QC6A 3VF9A 3EKNA 5C1QB 5JEBA 1Q99A 3IOKA 2O63A 3MYGA 2YIWA 3UG1A 1Q97A 4IC7A 2OIDA 1OGUA 2OWBA 4YJOA 4EQUA 3CQUA 4QP3A 4QMPA 4BVUA 4RWKA 1BX6A 4JXFA 5D10A 4EK8A 4XCUA 4N4SA 4CYIA 4XP3A 3L9MA 1Q5KA 3UYTA 5IH6A 5KMKA 4FKVA 3R1YA 2WTVA 4TYHA 3PTGA 3POZA 5DRBA 1P4OA 4DFXE 1PXMA 1FPUA 3QFVA 3ALNA 3ROYA 3SV0A 2WO6A 3V3VA 5GJFA 4KNBA 2UW9A 5AP4A 3ZEWA 4B0GA 1R0EA 3UOHA 4EJNA 3PWDA 4RFMA 4F1OA 5F95A 3ZZEA 4RJ7A 3OHTA 3LZBA 5T3QA 3THBA 5EM6A 2Y6OA 2UZNA 4O7VA 1IAJA 4KABA 4M13A 2C5OA 2VWUA 4AZEA 2V55A 4H36A 3UIUA 3H30A 5I5ZA 5IA0A 2BMCA 2OG8A 4X2KA 3CKXA 4BGQA 3IQ7A 3FI8A 2NO3A 5CSVA 4BHNA 2DYLA 5ACKA 4C36A 1S9IA 2WB8A 2PUUA 3F82A 3GEQA 3IK3A 3K3IA 3UG2A 2BKZA 5AA9A 4ZXTA 3DGKA 4FK3A 3KXXA 2UVYA 4QPMA 4WD5A 2BRMA 3SAYA 2B4SB 3VS4A 3Q32A 4KWPA 4EQMA 1OIRA 4AW0A 1OIYA 4EBWA 1SYKA 2QO2A 2XK7A 1YOMA 5JFWA 2QHMA 1BI7A 2XBJA 5JZNA 3C0HA 4YBKA 4Z55A 2YEXA 4QQ5A 3FZOA 4D0WA 3COIA 3ACJA 4O7TA 2C5VA 3EQCA 3BZ3A 4XRLA 4XG9A 4IC8A 5EM8A 3R8UA 4EH4A 2I1MA 4U79A 3OY1A 3MY0A 4DG0E 4E20A 4I1ZA 5K5NA 3RBWA 4L8MA 4E6QA 3HDNA 3PPZA 4ZLOA 5EOLA 2JKKA 2QOKA 4G16A 3VJNA 3TXOA 4F9YA 2V7AA 4HPTE 4E5WA 4FK6A 2PE2A 3LXKA 3I81A 4ACCA 4F65A 5FEDA 1JKLA 4LUEA 4FTRA 4OT6A 1YDTE 4YLKA 4CFXA 2CGVA 5AV3A 2F7XE 1KE5A 5LVOA 3NVMB 4FIFA 4A9YA 2O3PA 5JFSA 2EU9A 3MTFA 1I44A 2W4JA 3QCQA 4AP7A 3GUBA 4YZBA 5BUIA 4J1RA 3VN9A 3BEGA 2YWPA 3F3UA 4ORKA 4NU1A 2XUUA 3FLQA 3Q4ZA 5IUHA 3E8DA 3R7IA 3W2SA 5H8BA 5BPYA 1SZMA 4QMOA 4QQJA 3PLAE 4O7WA 5DE2A 5EQYA 2A19B 2ZJWA 3HNGA 5HIDA 2VX1A 4ONAA 4BY9E 5JGAA 5A14A 2H34A 2BIYA 3FL5A 2XRUA 3PZEA 4L01A 4C61A 5DFPA 5ACBC 2ITQA 5JFVA 2C6TA 3HRFA 3LFAA 2C1BA 3QTZA 1YDRE 3JVSA 1OBDA 3VJOA 3GP0A 3PSDA 4OW8A 3I7CA 4ERWA 1IA8A 4IE9A 5DR9A 2WTKB 4IWDA 2R3FA 4U97A 5TOZA 3WBLA 2Y9QA 5KMOA 2QHNA 4FKTA 3LOKA 1W84A 2E2BA 4BI2A 3HV4A 4ZJIA 4OTDA 2PZIA 4C58A 4FX3A 4N6YA 1Q4LA 2W1IA 3OBGA 4D2WA 2W1GA 2GSFA 3PXKA 2ZMCA 4BCNA 4AOJA 3WIGA 3UO6A 3E62A 2WD1A 4FTKA 2OJIA 4S30A 4GVAA 4WNPA 5BNJA 4I4EA 3BHVA 3FYKX 4KSQA 5E7RA 4ANMA 5KO1A 4FV1A 3W8LA 2IVTA 1UKHA 2PVLA 1H1PA 5KZ0A 5AAGA 3CGOA 2R7IA 4W9WA 2JDOA 1YXVA 3OF0A 3Q4CA 2VTHA 3V01A 3RJCA 4HNIA 5FTQA 5BYZA 3E3PA 4C4GA 4RIOA 4UYNA 5BVKA 3V6RA 3P4KA 2XNPA 4FEVA 4NWMA 3DK6A 4JBVA 1J1CA 1NVQA 2GNJA 2R9SA 2F4JA 4OR5A 5D12A 5E8WA 3U4UA 5HTIA 3FHIA 3VBXA 2HOGA 3NUXA 2ZM3A 3DXPA 1GOLA 5IKWA 3R8ZA 4L3LA 1J91A 1NT2A 5FXRA 3MVHA 3LQ5A 3MPTA 3MIAA 5HVKA 3G9LX 4L3PA 1FOTA 5FD2A 3R9OA 4FVRA 2ZM1A 1Y8YA 2YZLA 2XIYA 2JDRA 1LUFA 3KULB 3IW8A 3QCXA 4M84A 4PV0A 4DH1A 4BTFA 2R64A 4USDA 3KN5A 2X7OA 5H3QA 4RMZA 5L8KA 5CT0A 4YC8A 4TWNA 4PMSA 4XG7A 4BHZA 3SVVA 4MNEA 4BYIA 4EOJA 4F1TA 2BAKA 3HRBA 3V8SA 2XNOA 4YR8A 3GNIB 3BLRA 3DQXA 2RL5A 2QG7A 5DNRA 2IW9A 4TXCA 2JLDA 3G9NA 4A7CA 2A1AB 4RJ5A 4Y83A 3COHA 3S00A 3HL7A 3P5KA 3KMMA 3KFAA 2FA2A 3WOWA 3I4BA 2VNYA 2HW7A 3FBVA 4YZMA 5IA1A 3JVRA 4U43A 2VN9A 5HHWA 3A7IA 3ZRKA 2QLUA 4G6OA 2WFYA 3PG3A 4FL1A 4JT3A 5L2WA 4FSZA 4ASZA 1APME 3QZHA 2IN6A 3QBNA 2FSMX 4KIOA 1G8AA 4EOMA 4IAFA 3QD4A 2B53A 2JDVA 3G15A 4BCPA 1SVGA 1YKRA 1MRYA 1JKTA 3OTUA 4ANLA 3R1SA 3VIDA 1XH5A 4HYSA 4AZWA 3Q53A 4O0SA 2GQGA 2RFNA 2BRNA 3LLAA 5A4CA 2Z8CA 2GPHA 4M14A 4IAIA 4G34A 3F2AA 3RNYA 4GJ3A 2PVJA 2UW3A 2IWIA 2W05A 4M68A 5J95A 3KCKA 3CPCA 4K77A 3GOKA 5I4NA 3RHKA 5BMSA 4I0TA 4DFBA 4R3PA 5AX9A 4FSYA 4GFGA 4UMRA 3NVKI 3F3ZA 3KGAA 5CTPA 3DBFA 4DG2E 3RWQA 2X7GA 5IEXA 4FBXA 4RJ6A 4FNWA 2R7BA 3MY5A 3HP5A 3Q4TA 2W4KA 4C35A 3A8XA 3BU6A 3PXQA 4OUCA 3C0IA 2WIHA 2QU6A 2Z7RA 2VV9A 2XIZA 4NFMA 1Y6BA 1IASA 2QONA 3KA0A 5CQWA 1FMOE 1U59A 3KXZA 4YHJA 4FKOA 3I60A 1UWHA 4CFNA 2PVMA 5HNGA 5J5SA 2PUNA 4CMUA 2WMTA 2XCHA 4AT5A 2PUIA 1WFCA 2ITTA 3VBYA 4FVQA 5FGKA 4D4RA 1PMVA 4RJ3A 4QMNA 5A4EA 3O2MA 3OZ6A 1E9HA 3L9PA 3KXMA 4NYEA 1AQ1A 3EYHA 2VZ6A 3WF9A 1H8FA 5IA2A 3MPAA 4RVTA 4DINA 3BBWA 3ZUTA 4MH7A 5C26A 4WBOA 4K9YA 1KE6A 4CRSA 4E4MA 3UPXA 3PDTA 3GU6A 3PSCA 3DK7A 5E9EA 3TN8A 4EUUA 5CYIA 3U55A 5TE0A 5AUZA 5CQUA 4IANA 3ZO3A 4BCMA 5J79A 4CKIA 1MUOA 5GNKA 1XBCA 3OEZA 4AGUA 4ZZOA 4F9BA 5M4IA 4B9DA 3Q9WA 4MYGA 4U41A 1HCKA 3ZXTA 2FYSA 4G3GA 4EOPA 3LFQA 3HZTA 2QNJA 3I6WA 4FEUA 1OPJA 1ZAOA 2I0HA 3ZC5A 3LCTA 4TW9A 4AOTA 3MFUA 1LEZA 4U81A 4E5BA 5H2UA 4BDJA 3OBJA 1DI9A 1TQMA 4BCJA 3LCOA 3D7ZA 4ZSLA 4NZWB 2R0IA 3FAAA 4EH2A 3HYHA 3UNZA 3ZRLA 2DUVA 3CS9A 3GCSA 3DV3A 2ITNA 3BGZA 5CZIA 4QPAA 4CTBA 4UXQA 3R7UA 2QODA 4D4VA 4QQTA 4O7YA 3I0OA 4IHPA 4BTKA 4EHEA 4C7TA 1Q61A 3O7LB 3RPVA 4IQ6A 4AN3A 2VTMA 3UYSA 5ETIA 3DBEA 5GIOE 2ETKA 4ZS0A 2WMVA 5IQDA 4XG6A 3AD4A 5AP1A 3PPKA 4U9AA 3MFRA 5L6WL 1KE7A 4M7IA 2PVKA 4DT8A 4USEA 2NNWB 3REPA 3NUUA 2HELA 3VAPA 3TDWA 4E73A 3V5WA 3P7CA 5KUPA 3DKGA 3PXZA 2YISA 3QGWA 2H96A 1DI8A 1KV1A 2HWOA 3HV3A 4YHFA 4QPSA 2DS1A 4MXYA 5L2QA 5L3AA 3DQWA 1PYEA 4LQMA 1KE8A 2I7QA 1H25A 3Q52A 4HGLA 4XLIA 2XEZA 3MGYA 3FQEA 2YM4A 2YFXA 1YXUA 5IQEA 4XH6A 2QOQA 3BELA 4K18A 4GK4A 3BKBA 3GI3A 5I9UA 3VUGA 4BCKA 4TZRA 2ITXA 4V05A 4E6CA 5JN2A 4O0WA 4BDDA 5CNNA 3LKMA 5DPVA 3A7GA 1MQBA 4X0MA 3PA3A 5F4NA 4FOBA 4KBCA 1JLUE 3QRKA 5HCXA 5AA8A 5L8LA 4I6BA 2UW4A 4GUBA 2Y6MA 5L8JA 3FUPA 1OPKA 2Y4PA 2PZPA 3NYVA 1YQJA 2JIVA 3DS6A 5HLPA 3MPMA 3HV5A 2AC5A 2CPKE 4MKCA 4BZDA 3OT3A 3PA4A 3F5XA 5EYCA 3DZQA 5GJDA 5KHWA 5CASA 2VTSA 3FJQE 3HGKA 4BDBA 1XWSA 2ITOA 2BHHA 2R3NA 4X2JA 1SVHA 5HG5A 4C3FA 5TKDA 1OIQA 4D4SA 3LFSA 3R8LA 2YITA 1OBGA 3LHJA 1ATPE 4CXAA 4ZJJA 3PVWA 4NIFA 2HYYA 2G15A 5KZIA 3EQRA 4LL0A 4O7RA 3CJFA 4BZOA 3QQKA 3AC4A 4IZ5A 1PXIA 4BZNA 3O0GA 3QA8A 1H0VA 2J0KA 1YI4A 3V5LA 1W83A 4IX4A 2W5AA 4GT5A 3BHHA 5E8SA 2VUWA 4RIWB 1H26A 2F2CB 4I94A 4GFOA 5C8KA 1PMUA 3W2PA 3R71A 4C4EA 4EKKA 4EOQA 2VTAA 4WKQA 3WF6A 4UBAA 2JKMA 1IA9A 2WGJA 3PRIA 4CMOA 4QP9A 4F7LA 2CMWA 4O0RA 3WF5A 2GTNA 3L8SA 3VW8A 3PVGA 5K3YA 1Q24A 5AIRA 4L46A 2YIXA 3FMKA 4FKQA 4A9TA 2QLQA 3PP1A 1JWHA 4FGRA 4FKGA 3IW6A 4DBNA 4FTMA 3ITZA 2CKQA 4UMPA 2C5XA 1M14A 2OO8X 3M1SA 4YHTA 3Q2JA 5BUEA 3RNIA 2ZV7A 2C0OA 4AT3A 3C5IA 3R1QA 4ZP5A 4TYHB 3NNWA 3FKNA 4FSWA 4F6UA 2YACA 2BROA 1ND4A 3UMXA 3ZSGA 5GIPE 3ZZWA 2XK9A 1AD5A 4EJ7A 3QLGA 3ENMA 3IDCA 3GU4A 3Q9ZA 3RGFA 1BKXA 4R6VA 4NSTA 1B6CB 1UNGA 3AT3A 3RMFA 4H05A 2OICA 2UW5A 4OAVB 3MB7A 5FEEA 1YWNA 3JYAA 4NK9A 1ZYLA 1FVTA 3C4EA 3GC0A 2XNMA 3BU3A 1U46A 1BMKA 1XH9A 2HY0A 4H3BA 3QX2A 5FRIA 3FSKA 5T6KA 2GNLA 4FKUA 3NNXA 4V0GA 3QD2B 3W32A 4AW5A 3Q4UA 4DCEA 4RFZA 2C0TA 4AZVA 3UOJA 3N4VA 2OLCA 4MD8E 3OP5A 3LMIA 4GK2A 4QMVA 4ERKA 5AV0A 4RSSA 4DYMA 3PIZA 1SVEA 2HWPA 2QO9A 2W4OA 1ZOEA 2YABA 3IDPA 4HCTA 4QTCA 5A9UA 5M56A 4QMSA 5A6OA 2XNGA 3RZBA 4M0ZA 4HVDA 3VBQA 4YJTA 5HTCA 3DXQA 2XM8A 2X1NA 2XKDA 3MBLA 1FGIA 4FNXA 5FP5A 5HE2A 4JRNA 1WBNA 3CIKA 3TKUA 4AGCA 2XBAA 4FZFB 3CJGA 5IUIA 4AF3A 4PNKA 4RLKA 5IA3A 5IH5A 5JMSA 2OSCA 5DEWA 2XIKA 5CVFA 4F4PA 1IEPA 2R3KA 3MH3A 1QPDA 4BDGA 3F5UA 1FVRA 4JQ7A 1PXNA 3C0GA 4AX8A 4BIEA 5L2IA 3PP0A 4FUYA 4U40A 3L8VA 2X2LA 3GU8A 2PMOX 3LCSA 4MXOA 3DJ7A 4EK6A 1W8CA 2J6MA 2PU8A 1QPJA 3PFQA 4MNFA 4OLIA 3SXRA 5C01A 3FI3A 5DYJA 2ZAZA 3CR0A 3NYOA 3ORTA 2WXVA 4QTDA 3ODYX 4YNOA 4BN1A 3OT8A 5AX3A 3SW4A 4I0RA 3UTOA 4LMNA 5LMKA 5HVYA 3FZRA 1JQHA 1NVSA 4PUZA 3VUHA 3GFWA 3PJ3A 2Q0NA 3RK5A 4CCBA 4YMJA 2BFXA 1W0XC 3LXPA 4QMLA 1M52A 5CI6A 4RIYA 5HICA 4EK5A 4Y5QA 4Q5EA 4C34A 1XH4A 2OJ9A 2YM6A 4FSRA 4HCUA 3R7OA 3W8QA 3TZ7A 1WBPA 3D14A 3LXLA 2Z2WA 3H0YA 3OCSA 3PG1A 5AP2A 3H0ZA 5C27A 4XP2A 5M07A 1GIIA 4CQEA 1S9JA 2P3GX 2XVDA 3Q5ZA 3W2RA 4DN5A 2YN8A 3LMHA 1B39A 4I6HA 4OGRA 4F08A 4DTKA 3R02A 2Z7LA 2C5YA 2JC6A 4LV8A 4ASEA 3U6IA 4GK3A 3U4WA 5AAEA 2PVYA 4FICA 2OGVA 4AWIA 2E9VA 4R1YA 2HENA 3R01A 3NR9A 3VQUA 4BDFA 3G5DA 4L52A 3VUMA 2GU8A 5FDXA 3SHEA 2WU6A 3ZOSA 1RE8A 1WBTA 4YO6A 5JRQA 4IZ7A 4UEUA 4IB0A 4Y72A 5HU9A 1R0PA 3VUKA 3A4PA 2YA9A 2ZV8A 4R1VA 4PDPA 2ITZA 2OH0E 2F2UA 2WEIA 2WHBA 3LFCA 3OROA 4HGTA 2DQ7X 4O2PA 3R8PA 3LFBA 4F7SA 4RIXB 3GCVA 3OD6X 3ORPA 3W18A 5AR4A 3VUDA 2B55A 3OXTA 5C4KA 4ZEGA 5H8EA 5AUWA 5HD7A 3D5XA 2V0DA 3E8NA 4TNBA 2WTDA 4KBKA 3FL4A 3JR1A 4X2NA 5JSMA 4ENXA 4F9CA 4N6ZA 4FZDB 4BWKA 4RWIA 3BIZA 5C9CA 4RQVA 2WMSA 5J7BA 4G17A 2O0UA 3D94A 2ZVAA 5AR5A 4RG0A 2RSVA 3E92A 2CGUA 4Y85A 1O9UA 2XJ2A 3KF4A 3VRZA 5DBXA 3HUCA 4M3QA 4OTFA 4UY9A 5A4LA 2E9UA 3WARA 2XH5A 1BI8A 3K2LA 2W1FA 4WUAA 2WTCA 5AP7A 5FUTA 2J50A 3C50A 3QZGA 1QPCA 1PY5A 3TKIA 2XEYA 3BQCA 3D9VA 3LCKA 4CTCA 4DITA 4MAOA 3FQHA 1T45A 4FF8A 3ZMMA 2UV2A 4J8MA 3EIDA 3FXXA 3F6XA 2OZAB 1CMKE 2IZRA 1WAKA 4X3FA 1QCFA 4E26A 4NJ3A 1ZMVA 3EOCA 3H10A 4S33A 4BC6A 1ZRZA 3F3VA 2JAMA 2J7TA 3E63A 4KKHA 3UZRA 3FC2A 4MX9A 3Q96A 3ENHA 2YLFA 3ZUUA 2BZIB 2QOBA 2WNTA 1M7NA 1IR3A 1P5EA 4BBFA 1XJDA 2BDWA 1KOAA 4JBPA 4QD6A 4YSJA 2PYWA 4NKAA 4CV8A 5EDRA 5M4CA 2PMIA 2XIXA 3BRBA 4G6LA 4EHGA 1FMKA 2WTJA 4TWCA 2VO3A 5CU3A 2YCSA 4YNEA 4ZK5A 3BYSA 3QKKA 3K3JA 4V04A 3NNUA 4FL2A 4MVFA 4IAYA 5K4IA 3R21A 2C3LA 2W96B 3VS2A 3F88A 3FMEA 3FI4A 4RVLA 3NW5A 2PL0A 2RG5A 4MK0A 2HZ4A 3UGCA 5CEMA 4C33A 4U7ZA 2WZJA 2IVSA 3DKOA 3H3CA 3JY9A 3ZLSA 4IAKA 5IMEA 1PRYA 2NPQA 4PPCA 3KY2A 2YWVA 4PF4A 5A46A 1Q8UA 3BX5A 2Z60A 3QQFA 5LVPA 4O6LA 4RA5A 3A7JA 4NUSA 4RJ4A 5EH0A 2IJMA 1WBVA 3CD3A 3C7QA 3D2IA 3F3TA 2B7AA 4UWBA 5ANJA 3L8XA 3ELJA 3W1FA 2VWVA 3DLSA 2YIQA 3HP2A 3NAXA 5H8GA 3IECA 3HVCA 2OFUA 2G2IA 3OCTA 5CU4A 4HNFA 5BX0A 3GU5A 3HLLA 3UJGA 4O7LA 2XK8A 3DT1A 3KMUA 3TM0A 2QR8A 4IX5A 5M4UA 4EOLA 3EJ1A 5EOBA 3GU7A 4AUAA 4ZSAA 2UW0A 3ORKA 3PUPA 5D9HA 4AACA 5KCVA 3AGLA 1KE9A 3OXIA 1REJA 3RINA 4J8NA 3NWWA 4EOOA 5HNIX 1XQZA 3G0FA 4G2FA 3MH2A 2UZEA 4MWIA 4RVMA 4YZNA 3EFJA 4FEQA 3ZM9A 3KRWA 5D41A 3QRIA 5J87A 1UWJA 2F57A 3SRVB 3V6SA 2UZDA 2EXEA 3WE8A 4BICA 3WZKA 3O17A 2XJ1A 5I0BA 5I9YA 1KUTA 4G3FA 4NH1A 3PWYA 4QMMA 4QMXA 1LPUA 3F7WA 4M67A 4YJVA 4CRLA 5M57A 4TNDA 5HNBA 4TRLA 5D7AA 3NUYA 5LCJA 2VO6A 2GQRA 4GKHA 4IVCA 3S2PA 1XR1A 3SKCA 4GRBA 1ZY5A 5F94A 2RFDA 3PSBA 4C4IA 3Q60A 4HVHA 3LQ8A 1KWPA 2W5BA 5ANEA 4DEAA 2QOOA 3AT4A 3GENA 4YBJA 2VU3A 4TWPA 4GT3A 3RK9A 3FQSA 5HGIA 1PXPA 1MP8A 1P2AA 4YC3A 3S0OA 4H1JA 4M69A 2B52A 3E88A 4EEVA 4ITHA 3GFEA 2HZ0A 1ZZLA 4A4OA 3FMLA 4GUEA 2VX3A 2XM9A 5EYKA 4LM5A 3MDYA 3PY1A 5JQ5A 2YDIA 3TWJA 3DY7A 3W10A 3ID6C 3TJDA 3COMA 3QTRA 1CKPA 4FNZA 2C3IB 2X0GA 5CU2A 4I20A 5EM5A 2F7EE 3TJCA 5AADA 2EXCX 4FTOA 2RIOA 4RC3A 5HBEA 4DBXA 4KS7A 3RWPA 3R7YA 3FWQA 2C0IA 4IADA 2WU7A 5FP6A 4C3RA 3CGFA 3NPCA 4FVPA 4FMQA 5DHJA 4NW6A 4K6ZA 5AWMA 3E87A 3QZFA 4XRJA 4YJSA 5HO7A 2X6EA 4FTTA 4AZFA 3P23A 4BBEA 2CSNA 4AFJA 3NS9A 3VNTA 4EH9A 1FINA 4KBAA 3K54A 5E8ZA 4WIHA 4BDCA 4W4VA 4CGAA 3QQUA 2BRGA 4WO5A 1Z5MA 3OOGA 1RJBA 3UIXA 3R30A 4PL3A 4UMQA 4BI1A 4Z7HA 4ALWA 4O1PA 3D2KA 4O83A 4DT9A 2WQMA 5CSPA 4L68A 1YI3A 5CXZA 4IVAA 4RBLA 4FKLA 3KN6A 4D9UA 4ANBA 4F0IA 1ZOGA 2BILB 5GZAA 4CYJA 2PE1A 3ET7A 3HMOA 2WMAA 4GH2A 4O91A 4RIXA 3R8VA 2CKOA 2W99B 4BIDA 3HAMA 2GS7A 4NTTA 2CJMA 2BDFA 3RCDA 5AIKA 3I1AA 4RX7A 3BYVA 1UU3A 3QTUA 1M2PA 4Z16A 2P2IA 5CZHA 3MB6A 5CXHA 4RZVA 1OL6A 5B2MA 3DFAA 2R3RA 2WKMA 3NDMA 2EVAA 2CCHA 2QKRA 3Q5IA 4FSNA 4DTAA 2JBPA 4D5HA 2WOTA 1Q41A 4KINA 2HAKA 3NNVA 3K5UA 1GZ8A 4Q2AA 3CTQA 5GHVA 5HE1A 3DXNA 4BCOA 4YP8A 4C37A 4X7QA 1VR2A 4J7BA 4HZSA 3B2TA 5ANGA 3WYXA 4BKZA 3VWAA 5EG3A 4BDHA 4AOIA 3SG8A 3AD5A 2A27A 2J5EA 2JIIA 2OZAA 3LE6A 4DEIA 2ZM4A 5LARA 5G1XA 1NVRA 3BBTB 4IJPA 5CF8A 4MWHA 2FH9A 4RC2A 4NIFB 4O86A 4GFMA 1DS5A 1YI6A 3LJ1A 4B8LA 4EZ5A 3EFKA 3DAJA 4ACHA 3O8TA 3ZFXA 5FM3A 4IB3A 4AW2A 4ANSA 2PVHA 4FYNA 4D1ZA 2BKKA 3T3UA 4BCQA 2VGOA 4LRJA 4BCHA 5CAQA 5LXMA 4ZTHA 2FO0A 2XNEA 5AV1A 5BVFA 3AG9A 2W5HA 2C6IA 3R0TA 2YERA 4QTAA 4ZY6A 4XOZA 1PXLA 3N4UA 3MN3A 5EI2A 4GW8A 3HUBA 3SW7A 3ZHPC 4C4HA 3CD8A 1OMWA 4JBQA 4KD1A 1G8SA 4H3QA 4MCVA 2XP2A 3GCUA 2IVUA 3R7EA 3NAYA 1YDSE 3P79A 4NCTC 2GS6A 2R3MA 4APCA 2QU5A 3QD0A 4IB1A 2WPAA 3AOXA 3LPBA 2WTKC 4MF1A 4FTCA 2A0CX 4YJQA 4RX9A 4UWCA 5M53A 4DEEA 3C4ZA 5CALA 3E3BX 1Y57A 1H01A 1RDQE 2HXLA 3PJ8A 3PA5A 4BYJA 2WEVA 2R3LA 4JAJA 1A06A 3KU2A 4U80A 5AUVA 3QKLA 1E1XA 4FTLA 3TZ8A 4JIAA 2YDKA 1I09A 4CMTA 4BI0A 4YZDA 2V7OA 2XIRA 4XBUA 4QT1A 4QNYA 5AP3A 5EHYA 5CT7A 1VEBA 3S1HA 5F1ZA 4ZTMA 3C9WA 1PJKA 1KV2A 2OXDA 3EZVA 1FBNA 5B0XA 4H3PA 1H1SA 2FB8A 1R1WA 5M06A 1XH7A 3ZBXA 2OKRA 4I24A 5EW3A 2BRBA 3BE2A 3P86A 5I3RA 4R7BA 4JQEA 5HZNA 1CKJA 2VWWA 5J9YA 2R3JA 1Z9XA 1JSTA 4IIRA 3FHRA 1OL7A 1ZLTA 4WBBB 4JDIA 4XG4A 1FVVA 1Q62A 3F61A 4NKSA 4V0GB 3SRVA 1J1BA 1XKKA 2ONLA 4D1XA 5A4TA 3ZDIA 1H4LA 5DA3A 1A48A 3ETAA 2ZV2A 4FG7A 1UU7A 2R3OA 4WT6A 4E93A 4DLIA 2AC3A 2OK1A 5CENA 3L9LA 2IZTA 3LAUA 4FR4A 3WZDA 3ZSIA 4K11A 1UA2A 4FT9A 4QNAA 5TR6A 3D0EA 3FEGA 3I5NA 5IQGA 3DOGA 4O0UA 3ALOA 5FTOA 4CKRA 5GZ8A 3UNKA 1OL2A 2WELA 4PMMA 3AC1A 3RZFA 4Z3VA 2XCKA 3A4OX 3LJ0A 2UZVA 4LOPA 3KF7A 4HYIA 3MFSA 2PUPA 1E1VA 2VAGA 2J4ZA 3Q3BA 2QCSA 4OBPA 3AGMA 4ZOGA 4RA4A 4FT5A 3FI2A 1TQPA 3LFFA 4DFYA 2I0EA 2J0JA 2I0VA 3ANRA 4FUXA 4JG6A 2VWZA 1KOBA 3EYGA 3QD3A 4E1ZA 3VHEA 5KMNA 1ERKA 4DLJA 1GAGA 4FIJA 5HE3A 5BMMA 1J7IA 2GDOA 4IZAA 2Q83A 3R2YA 2JITA 4L67A 3EQBA 3BEAA 3N9XA 4G3CA 2X9FA 4QQCA 3MVJA 5DI1A 3FLNC 4XV9A 4AFEA 2W1EA 1O6LA 2QR7A 3DB8A 4FKWA 1V0OA 3C5UA 5B2KA 3O51A 3ZC6A 1WBOA 4XNEA 4AG8A 3TCPA 4F0GA 4NM5A 1H07A 4UB7A 5CNOA 5FLFA 2WMUA 4DH5A 2CN5A 5AR2A 1U54B 4FV5A 4RIYB 4Q5HA 1WVWA 3IONA 1OM1A 4ZTSA 1IG1A 4WNKA 5EM7A 4IAAA 3BCEA 5JGBA 4DGLC 4KSPA 4RRVA 4D2VA 3QTSA 1JBPE 4AN2A 3GCQA 4AZSA 2BZJA 3B8RA 3C51A 4FIHA 3F2NA 4JVGA 5LVLA 2FSTX 3Q9XA 5CAVA 3KVWA 3OG7A 4JAIA 3UZPA 4BGGA 4EHZA 3VQHA 4IZYA 4J53A 2JIUA 4JDJA 3NX8A 1ZYDA 5AMNA 5E8XA 4ACDA 3R1NA 4EWHA 4F0FA 4QYFA 4U42A 3V5TA 3WF8A 3ACKA 3MS9A 3QF9A 3EQIA 4QYYA 4RWLA 5IDNA 2X2MA 3EB0A 5LVMA 4LGGA 5CAOA 4FSMA 5CY3A 3PPJA 4CD0A 2PZRA 4YZ9A 1GZKA 4U3ZA 5HG8A 4L42A 1F0QA 5LQFA 2PULA 2OF2A 4BIBA 5K0XA 2O5KA 5ANIA 2XNBA 5LCKA 3B2WA 3G51A 5ANOA 5EI8A 5E4HA 4I0SA 3CY3A 3I5ZA 4U0IA 3ZFYA 4IDTA 2AYPA 1K2PA 4EQCA 3O8PA 3CY2A 2WQNA 4IM3A 1MQ4A 3W55A 2PZ5A 1M17A 3I7BA 4C0TA 4HPUE 3WILA 4A9UA 3LXNA 5J1VA 3BYMA 4DGMA 1P14A 4X3JA 2WMQA 5AV4A 1Q8ZA 4BKYA 5CU0A 2E9NA 3QWJA 4Y95A 5HX6A 5HG9A 2OJGA 4JJRA 4FTAA 2IZUA 3DTWA 2EUFB 4KIKA 5DRDA 3TKHA 2OW3A 5DG5A 2XA4A 3ZO1A 1CM8A 1VYWA 2G01A 5AM6A 2ZOQA 4FZAB 4KIQA 3PVUA 4AAAA 3TT0A 2BALA 2X9EA 3KK9A 3MWUA 4EK3A 2XS0A 2B9IA 3R7GA 5IUGA 4CZYB 3II5A 3ZONA 2J9MA 3PY0A 4WRGA 5FBNC 4CCUA 3LMGA 2QURA 2R3QA 4MQ1A 4X3FB 4EH5A 5JFXA 4QMYA 4GVJA 3UP7A 4BDKA 5K4JA 1OL1A 4K33A 4HVIA 4YTHA 3OXZA 5CWZA 4EORA 3UO4A 4A4LA 4OTHA 3BI6A 4Y46A 3S95A 4Z9LA 3WIKA 5AUTA 4L45A 4HYHA 2UVXA 3AT2A 5KHXA 1H28A 4BDIA 3ZSHA 2XMYA 4O0VA 5A4QA 2XKCA 3DJ6A 4HCVA 3RPSA 3SOCA 3W16A 3VUIA 4FL3A 3P78A 1OI9A 3R28A 4FSQA 1ZZ2A 4HOKA 4U5JA 3SDJA 3ZBFA 3OOMA 5IH4A 2FGIA 3IS5A 3VS5A 1Y91A 3DPKA 4BB4A 3VUTA 5L4QA 2BCJA 4BL1A 3R8MA 2E9OA 3QQLA 2Y4IB 1V0PA 3R7VA 3R63A 2HZNA 5BYLA 4H39A 2BVAA 4DF3A 3O96A 4TT7A 5BVEA 2CNVA 4CG8A 5FG8A 2Y7JA 2ITYA 3NW7A 2CLXA 4UN0C 1CTPE 3VS6A 4YJPA 1OKVA 4Z7GA 4XBRA 4DH3A 2UW6A 3ANQA 5IQCA 5CEQA 5IEVA 1OKYA 3O23A 4DTBA 2LAVA 4GG5A 3NUNA 4AE6A 5AP6A 3QLFA 3ZH8A 4FV7A 1PHKA 4UZHA 3G90X 4I23A 2C6OA 3UDBA 2ITUA 1ZY4A 4ZSGA 4GCJA 3QC9A 2QOLA 4CG9A 4I3ZA 2WOUA 2PPQA 1STCE 1R3CA 3R9HA 2XK4A 3QWKA 4UZDA 3E7VA 2PY3A 4X6QC 3VVHA 1PKDA 4WUNA 3MY1A 1FGKA 4FG9A 3EQGA 2QG5A 4IBMA 4O6EA 4V01A 2BIKB 3DKFA 1JAMA 3TNPC 2GFCA 2R4BA 3BV3A 4E7WA 3BGQA 5HLWA 4ZS4A 1WBWA 2VTTA 4IM0A 3PYYA 5KKRB 4YJUA 4O81A 1JSVA 2BAQA 5BVNA 2W1ZA 2OF4A 4JG8A 3NZ0A 3I0QA 2JGZA 3OWPA 4ITJA 3EFWA 4EONA 2YJSA 4P2KA 3TIYA 4C2VA 4G9RA 4O27B 2Y8OA 1X8BA 3F5GA 4PL5A 4EYJA 4A9SA 5CEOA 5FTGA 3HA6A 3KVXA 3Q6WA 5HQ0A 1UNLA 3NEWA 3MH1A 4BDEA 4FA2A 1LEWA 4OTRA 3FDNA 4DFLA 4FKJA 2QVSE 5J9LA 5LWNA 3R6XA 1F3MC 4XV1A 1WCCA 2FSLX 4EOKA 3A7FA 4NJDA 4IFCA 5CANA 3RI1A 4WNOA 5HU3A 4XEYA 4ZJVA 5EDQA 4M15A 3EH9A 3BU5A 4U45A 1LP4A 3A8WA 2NRUA 5KBQA 2HZIA 1UV5A 2BHEA 4ZMFA 4RX8A 4M69B 4I5MA 3ZLWA 3WE4A 1JVPP 2O65A 2P0CA 4HYUA 3OS3A 5CS6A 4L6QA 5E8VA 5EYDA 3IKAA 5JKGA 5ICPA 1YW2A 2JBOA 2UVZA 2VTQA 2VTLA 4CFFA 2XRWA 4ANNA 4ZAUA 3E8CA 4G3DA 1U54A 2OIBA 1O6YA 2ZDTA 3BQRA 3FMDA 3TTIA 5M51A 4KKGA 3QU0A 4MBIA 5KMIA 3S4QA 2C6DA 4EZ3A 3C4FA 3U54A 3RCJA 4D58A 3N4TA 3POOA 4DH8A 5L6PA 3HMIA 3MA3A 3VBTA 2KULA 5E8TA 5C8MA 2OJFE 2C5NA 4I5PA 1ZYJA 4NW5A 4I41A 2ITWA 2YM3A 1REKA 2IG7A 3W33A 3NGAA 4OBOA 2BTSA 4XYFA 3JS2A 3SC1A 3RAWA 3KEXA 2NRYA 4JL9A 4CVAA 3QL8A 3A60A 5J1WA 2PMLX 3KL8A 3QXOA 3NRMA 1VJYA 3QYZA 4FKIA 5CEKA 4XP0A 4D55A 2X81A 4ZY4A 2GHGA 5IQAA 3ZU7A 1BUHA 1M7QA 2H9VA 3BPRA 4D9TA 4MTAA 5ITAA 2P55A 2YZAA 4JI9A 4LL5A 3QRUA 3QTXA 3H4JA 3S3IA 4BTMA 4LGDA 3FZPA 5DIAA 3CLYA 3R83A 3NCGA 5B7VA 3FMMA 3RPOA 5M08A 3TL8A 4DC2A 2OXYA 2YM7A 1OITA 1XHAA 3BE9A 4O1OA 5AR7A 5I3OA 4O7NA 4BCGA 3DLZA 3F7ZA 4KAOA 4KIPA 4QP8A 4Y73A 3UPZA 3UC3A 2HY81 3A61A 3LIJA 2UZWE 2YCRA 3ROCA 2UZTA 5KBRA 2ERKA 2XB7A 4GG7A 3BLQA 5M4FA 3KXNA 2EXMA 2WMWA 3FLYA 4GIHA 4O96A 3D7TA 4DHFA 4ZY5A 1NXKA 5HVJA 3NLBA 4NT4A 4MF0A 2X6DA 5M44A 4R5YA 4CT1A 3RM7A 1PMNA 5FBOA 5FWKK 4D28A 3W2OA 3DK3A 5TF9A 4PDSA 3U87A 2RG6A 4DEBA 1NY3A 3E64A 2YM8A 4FIEA 2PWLA 2HXQA 3F5PA 5DWRA 5JRSA 4IACA 4EK4A 2BRHA 3HMPA 4GKIA 4FTNA 1CDKA 4DEHA 4FSUA 5DR6A 4BCFA 5KMLA 3UQFA 1V0BA 4OBQA 4XLVA 2OU7A 2XKFA 5E1SA 3I6UA 3NCZA 3UOKA 5IEYA 2CGXA 3A62A 2CN8A 3CEKA 3ZM4A 2BAJA 3EL7A 5AAFA 3AXWA 3OMVA 3OWKA 4C02A 4E3CA 3UOLA 2ZDUA 3NUSA 1F5QA 1YRPA 3H9FA 4LYNA 5BQ0A 4F9WA 4WG5A 1H27A 2W7XA 4D1SA 4DFZE 3CCNA 3OVVA 4B4LA 4GU9A 4AGWA 2XK6A 3JUHA 3DDPA 4LOOA 4CEGA 1JPAA 5IQHA 5AEPA 4YTIA 4OAUC 3RVGA 1GZNA 2VO7A 1SNXA 3FV8A 3KXGA 4U6RA 2X4FA 4ZIMA 4L43A 5EW9A 3LVPA 4A9RA 2C3KA 1O6KA 4KA3A 3AC3A 4XUFA 4PDYA 4PY1A 1ZYSA 4FTUA 4MD7E 4D2RA 2QO7A 5C4LA 4WSYA 5AR8A 4IXPA 4JBOA 2R3HA 2YAAA 2R2PA 5AP0A 4L53A 1H00A 3SQQA 4PWNA 1ZWSA 4CLJA 3G0EA 4HJOA 3LFDA 4QMZA 4YTFA 4X2GA 3QRJA 1HCLA 2R3IA 3PE1A 3ZCLA 3V5PA 3IO7A 4E6DA 3ZEPA 4DAWA 3L1SA 4FTJA 4JS8A 5ETCA 5TO8A 3UVRA 5IQFA 1PKGA 4IX6A 3ZYAA 4ANQA 3V51A 4MXAA 3VO3A 4WG4A 4DGNA 3QUDA 2FSOX 3DA6A 3CXWA 5EW8A 5DR2A 3HV7A 4WHZA 4ZZMA 1KSWA 4RWJA 5FDPA 1CSNA 4J52A 4JQ8A 1PF8A 4FEXA 5HO8A 2JAVA 1M2RA 3EQDA 4RVKA 5BVDA 5IF1A 1ZXEA 3EN9A 4OT5A 1GJOA 3SD0A 3VS7A 3MW1A 3WI6A 3HV6A 3ZTXA 3FLWA 1IRKA 4RC4A 2UZBA 3C4XA 5T68A 5HTBA 3CE3A 4EWQA 4CKJA 1XBAA 2F7ZE 2P2HA 5CSWA 2C68A 1YXXA 2DWBA 3KMWA 2BZHB 2C47A 3EQHA 2WTWA 2UZLA 5AM7A 1PMEA 4ID7A 1OVEA 3OFMA 2OIQA 2RKUA 3IOPA 4G6NA 4C8BA 5CF4A 5HE0A 2XNNA 5H9BA 3DBQA 2NP8A 4PMTA 3KCFA 3BLHA 2W17A 2CHLA 2ZV9A 4TYEA 5HO6A 5CEIA 1YHWA 4YU2A 2R3PA 5KE0A 3TUBA 3OTVA 2F49A 4K0YA 4PQNA 2PE0A 3CKWA 3TG1A 3HECA 5D11A 5EHOA 3O71A 4CLIA 3WF7A 2B1PA 2X2KA 3CPBA 3O8UA 4O0XA 5DT0A 4AT4A 4L44A 1FQ1B 4EH7A 4FV4A 5HIBA 4BBMA 1OUKA 2J0LA 4QP1A 4DGGA 3QC4A 3FZTA 3MI9A 3VULA 3P08A 4IFGA 4X21A 3RTPA 3HRCA 5E91A 3U9NA 5IQBA 3AC5A 4GIIA 5IISA 4OTIA 2GTMA 3F66A 4WG3A 1WMKA 4DH7A 3KRJA 3FSFA 5EKOA 5AUYA 1SNUA 4FZ6A 3CP9A 2ZYBA 4ZSEA 5G6VA 4D0XA 4GSBA 3PXYA 4RJ8A 3DJ5A 4LUDA 4A07A 5A3XA 5BVWA 1YVJA 1W7HA 5J5TA 5IMXA 3TV7A 4LV5A 2AUHA 3ORIA 5FXQA 3D5WA 1H08A 3DAKA 4EUTA 3TDVA 4FKPA 2GNGA 3B8QA 2X39A 5FXSA 2A2AA 2OI4X 3UNJA 4FT7A 3SLSA 3U8WA 3SX9A 2G2HA 4MXZA 4A06A 4F6WA 4OTWA 4IB5A
chains in the Genus database with same CATH superfamily
1WVXA 4FC0A 4LFIA 4QYHA 2CDZA 2ETRA 2ETMA 2G9XA 3PIXA 4QRCA 4W4WA 3HX4A 2OBJA 3EN6A 4KB8A 4I22A 1QPEA 2Z7SA 4AXCA 3QQGA 2ITVA 4YSMA 4FIGA 4UMUA 1TVOA 4JLCA 1PXKA 4XMOA 5EHLA 4ACMA 2ONLC 2YIRA 3BV2A 3QRTA 4DG3E 4USFA 4DFUA 4AXFA 3MV5A 1U4DA 4QO9A 1OKZA 4JR3A 1JOWB 4MHAA 3BWFA 2YM5A 4IX3A 4C62A 3TNWA 4Y8DA 4P5QA 3H9OA 1PXJA 5CEPA 4AA0A 3LCDA 3VONA 3GQLA 4W9XA 4TYGA 1MRVA 4XV2A 4ENYA 2HW6A 5AJQA 3BL9A 3GGFA 4RFYA 2HCKA 4QTBA 3T9TA 3SG9A 4NM0A 5CU6A 4F1MA 3TZMA 4DEDA 2I6LA 2VD5A 4PP9A 4M8TA 4QYGA 1BL7A 5LOHA 3PVBA 4RX5A 3KRRA 5HD4A 1Y8GA 5LVNA 1G5SA 2REIA 3R22A 4M66A 5EI6A 3SXSA 1OIUA 4TL0A 5IU2A 4PMPA 2XYNA 3AMBA 4O38A 1URCA 3UBDA 4KIKB 5I9WA 3EN5A 3FKOA 5AR3A 3GCPA 2OFVA 4RPVA 2O2UA 4KUJA 1PXOA 2WTIA 2VX0A 2VRXA 4FT3A 4P90A 4PPAA 3BWJA 4ZZNA 3QX4A 4DEGA 3SGCA 4X2FA 2VWIA 1UVRA 4GYGA 4I5CA 4F64A 1RW8A 3QTQA 4ALUA 4Q9ZA 5J8IA 5DMZA 4YO4A 4C3PA 4UWYA 5GJGA 4APPA 3N51A 4CSVA 3ZS5A 4DE4A 4R8QA 3P0MA 4IWQA 1SM2A 1OECA 2YLEA 1JKSA 2YCQA 3DNEA 4FV3A 2VTPA 3BGPA 1URWA 3GBZA 3G33A 4NEUA 3UO5A 1B38A 3C1XA 2X4ZA 3EMGA 3QAME 1QL6A 2ESMA 2ITPA 2UW8A 4QP4A 4YZCA 4FG8A 3EZRA 5CF5A 4WA9A 2J5FA 5A6NA 4N70A 1OL5A 2CCIA 3DCVA 2XZSA 3MA6A 4LG4A 1YXSA 4GL9A 4BWPA 4IM2A 5L2SA 5EK7A 3IW5A 3TV4A 3KREA 2YAKA 2F9GA 3P7AA 3QA0A 2WMRA 3GB2A 4RLLA 4WOVA 4HZRA 1H24A 2QOFA 5DN3A 3TIZA 4N57A 1NW1A 3M42A 4QMTA 5IZFA 2ACXA 3FY2A 3OW3A 2SRCA 4K2RA 4R5SA 4EH8A 2VNWA 4XG3A 2B9FA 4MBJA 5DT4A 5HOAA 4PX6A 5HIEA 3FXZA 1HOWA 3DBDA 5CSHA 5AUUA 3ATTA 4UX9A 2I0YA 3QALE 3LFEA 1ZMWA 2BZKB 4FNYA 5ETAA 3HKOA 1UNHA 3RAHA 3W2CA 5A54A 2VTRA 4J95A 1EH4A 4FV2A 5BYYA 3IDBA 2J0MB 5J7HA 3NFGB 1Y6AA 4F7JA 1YHVA 2GNIA 3FE3A 4G1WA 2QD9A 4G5PA 4IEBA 3EHAA 3NYXA 1RQQA 2VGPA 3A99A 4MD9E 1H1RA 3EKKA 1K3AA 4N0SA 5CI7A 3QCYA 3NIEA 4D5KA 2JD5A 1OZ1A 1BYGA 2XKEA 3V04A 2PMNX 4QOXA 3GC8A 1H1QA 5DH3A 4IMYA 4J98A 4O84A 2HK5A 4F9AA 4XG8A 3TUCA 4FTQA 3PRFA 5EDPA 2GQSA 3OUNB 4XOYA 2G1TA 3QYWA 4E4LA 4IJ9A 2RGPA 3OWJA 3UDTA 4EC9A 4I5HA 3MH0A 4Y5HA 3K5VA 4LOQA 2WQOA 4PL4A 3BYOA 3JXWA 4R78A 4JX7A 4ZSJA 4IDVA 4QTEA 3FPMA 4IVBA 4K8AA 3VBVA 2IPXA 4MXXA 4S31A 1UU9A 3ZO2A 2PZYA 2R5TA 4FEWA 4E5AX 2IZSA 2RF9A 4PNIA 2CGWA 3GT8A 3UQCA 3BHTA 3U6HA 4FE2A 4O21A 2C6MA 3VHKA 5CSXA 4QP7A 4EOSA 4CFMA 4NL0A 2EWAA 3WZEA 4BWXA 1QMZA 2WIPA 2C3JA 2IF8A 1Q3WA 1W98A 4CZTA 3TNQB 4G5JA 4CV9A 3EQPA 4P7EA 2CKPA 2C6LA 4CZUA 1PYXA 3FXWA 2X7FA 4U3YA 2OXXA 2Y0AA 2W0JA 4I6QA 3MIYA 5DGZA 1R78A 5HBJA 2YHVA 2G2FA 1SMHA 4ITIA 2VTNA 1YOJA 4TY1A 3DFCB 3VRYA 3FMJA 2X8DA 4MXCA 5M09A 4L9IA 2I40A 4IWOA 4MQ2A 4YPDA 4KRDA 4AW1A 2JDTA 3ZDUA 4ZLYA 3CSVA 3W0PA 2JDSA 4PTCA 5HI2A 3RAKA 1WBSA 2A4LA 3P1AA 3ZO4A 3CTHA 2GMXA 1YWVA 3TI1A 3DAEA 1TZDA 4FV9A 4RZWA 1U5RA 4L3JA 3ZUVA 3QQHA 2C4GA 4DDIA 1JSUA 2XF0A 2PHKA 5DEYA 3PXRA 1IAHA 3PXFA 5CLPA 3SA0A 3BHUA 2VO0A 3OEFX 5M55A 4CNHA 1ZARA 3T3VA 3CTJA 3U51A 1AGWA 3GVUA 4UYAA 3IGOA 4E4XA 4CFVA 2B9JA 3FYJX 4J99A 4XHKB 5HLNA 2CLQA 4JDKA 4W8DA 5IPJA 3R9RA 4WSQA 4F09A 4J71A 2V5QA 2IW8A 3OCBA 2QQ7A 3TZ9A 4IAZA 1ZOHA 3KRXA 4O0YA 3BHYA 4ARKA 4DA5A 1Q8YA 3ATSA 3IPHA 3VS0A 3ZFMA 4WRSA 4AU8A 2JEDA 2PK9A 4I92A 3MVLA 3FY0A 5FM2A 2CKEA 3TACA 4XV3A 3EN4A 3ERKA 4EBVA 1J7UA 5C8NA 4FZ7A 4XG2A 1BLXA 4TWOA 5JK3A 4NCTA 2YDJA 4TN6A 2IO6A 2QI8A 3UVPA 3HDMA 3UODA 3QHWA 4BFMA 4BTJA 3DBCA 4GV1A 3V5JA 3KB7A 2JFLA 4PRJA 1Z57A 4O22A 1OKWA 2UUEA 2CNUA 4R7HA 3HAVA 3UE4A 2GS2A 2B54A 1OB3A 1YOLA 3D7TB 4FIIA 4FSTA 3PJ1A 2BPMA 3HA8A 5LJJA 1BL6A 3AD6A 1K9AA 4C2WA 3D15A 4F7NA 5CVGA 4M12A 3OWLA 4IH8A 3NYNA 4PPBA 4TYJA 5AV2A 5E90A 3A2CA 1OUYA 3AC2A 3FMHA 2W1CA 5ANDA 4D2TA 3GOPA 4CFUA 4R7IA 3D5VA 1R39A 4O4CA 5GZ9A 2GCDA 4RT7A 3PJ2A 5K9IA 5KMJA 4NTSA 2JKOA 3UIBA 3UZTA 2OJJA 2V62A 3TTJA 2UZOA 3ZLYA 4PDOA 2XJ0A 2ZB0A 3D4QA 4JRVA 2JKQA 1OPLA 4F78A 3BYUA 2PVNA 3DKCA 4EC8A 3VBWA 1J7LA 4YJNA 3PJCA 5E1EA 5LMKC 2ZB1A 1GNGA 3C13A 1JNKA 3KRLA 2VTJA 4DGOA 4F70A 5J9ZA 4O4FA 3NUPA 5HESA 3VW6A 4CT2A 4AXAA 4EH6A 5IDPA 5JT2A 5IQIA 1W2FA 3E93A 3KULA 4FOCA 3KC3A 3AMAA 4IVDA 4O0TA 5FEQA 3NSZA 3EN7A 4JOAA 3W2QA 4E4NA 2BR1A 2W1DA 3JY0A 5JZJA 5AUXA 4M0YA 3ZRMA 5DLSA 4D2SA 3IGGA 2H8HA 4KS8A 4FKRA 5KNJA 3CQWA 4LGHA 4EYMA 3QCSA 2O8YA 3QZIA 3F9NA 4CFWA 2WAJA 3EL8A 2FVDA 2UZUE 3ZLXA 3L9NA 2QKWB 3KK8A 3LW0A 3NIZA 4ZTNA 3UP2A 4B7TA 3F2RA 4O7SA 3G6GA 4O2ZA 4JX3A 4GJ2A 4EOIA 3LM0A 3KXHA 2RFEA 2BDJA 4ALVA 1UU8A 2PTKA 4KRCA 5HKMA 4FYOA 2C30A 2PSQA 4XJ0A 4CQGA 3COKA 2OH4A 2Q0BA 3D83A 5HCZA 3O7LD 4O82A 5HCYA 2YIYA 3ORMA 4AA4A 4EI4A 2IVVA 2QOIA 1H0WA 4BRXA 4HW7A 4XX9A 4B6LA 4M97A 3OCGA 3R2BA 3R9DA 3U6JA 2C6KA 2V22A 3ORLA 4P4CA 4O7ZA 2X8IA 1ZYCA 4JIKA 1JKKA 3HEGA 4X6RA 4C38A 5AFVA 1A9UA 1GIJA 2BFYA 3H9RA 4GT4A 4PTEA 3MJ2A 4GEOA 4HGSA 4TTHB 4AGDA 3UC4A 4AS0A 2ERZE 4EHVA 2VTIA 2VWYA 2XK3A 5CF6A 1XBBA 3MJ1A 3TNHA 1L8TA 3Q9YA 5CVHA 3QHRA 2GNHA 1J3HA 1GY3A 1G8KA 1XH8A 3R00A 1LR4A 5CX9A 1NA7A 2OZOA 1XH6A 3FLSA 3NW6A 4TPTA 5D1JA 3WZJA 3PE2A 2XAMA 2Z02A 5EQEA 3FMNA 1GIHA 3OC1A 4GYIA 3U9CA 2YJRA 3GC9A 3UMWA 3RAIA 3RKBA 4FI1A 3CBLA 5I9XA 2W9ZB 3R73A 2WQBA 3IW7A 4MBLA 5L6OA 1TKIA 4W4YA 4YTCA 4BDAA 4QMQA 4X3FC 4NM7A 2QOCA 3F3WA 5LMBA 3T8OA 3DB6A 4ANOA 3WZUA 3RP9A 1U5QA 3SOAA 3V8WA 3RPRA 2GNFA 4UALA 3T9IA 3GC7A 5EFQA 2J0IA 2UW7A 3QUEA 4Q9SA 3M11A 4FV0A 3VS3A 4R3CA 5F9EA 4UV0A 4BCIA 4I4FA 5F20A 2XANA 4NFNA 4QP6A 4ZMEA 4BR3A 3OW4A 3PZHA 1P4FA 3WYYA 4RQKA 4J97A 1XO2B 5JQ8A 4UMTA 2PVFA 4G9CA 3P9JA 1MRUA 4YLJA 4C4JA 1GZOA 1M2QA 2HIWA 3QGYA 3ORNA 3QKMA 1ZMUA 4FTIA 4JR7A 4GU6A 3ORZA 4H58A 4LMUA 3Q6UA 4I21A 5IA5A 4OTGA 4DFNA 4PP7A 4J96A 2Y4IC 4FODA 3FZSA 5IG1A 1G3NA 2C69A 4L00A 2B9HA 2QOHA 4HVGA 3LJ2A 3PLSA 3MVMA 3VS1A 5BVOA 4DCAA 2VTOA 3JPVA 5AP5A 4L7FA 4GMYA 4IWPA 3D5UA 4ZTRA 3UVQA 5BUJA 3HMMA 3ORXA 3TUDA 2BUJA 3DZOA 4S2ZA 4ZLZA 3MFTA 4QMUA 3VC4A 4AZTA 3CQEA 5HBHA 2J90A 3ZXZA 4AE9A 5KX8A 4LRMA 3UIMA 4AQCA 4E8AA 5I9VA 5K0KA 3AQVA 5TT7A 5I9ZA 3UQGA 2Z7QA 4F6SA 3TV6A 3LLTA 2J2IB 3CC6A 4E6AA 3OUKA 4LI5A 3RM6A 5CAUA 3NUAA 2R0UA 4FT0A 4MEDA 4QYEA 3RPYA 4NM3A 1Q8WA 4PTGA 4H1MA 4EZ7A 4F63A 4KKEA 4FGBA 5E8UA 3SXFA 3ULZA 4B99A 1DM2A 5HORA 5KMMA 2R3GA 3F69A 1DAWA 1YWRA 3DU8A 4FV6A 4QMWA 1Q3DA 2O64A 5ETFA 5EYMA 4BGHA 4LDTA 1W82A 4ZTLA 2FUMA 3QXPA 4HGEA 4II5A 3L8PA 5ANKA 3IW4A 3QTWA 4WNMA 4LRKA 5CAPA 5KKRC 4ZTQA 4YLLA 1UKIA 3Q2MA 3G6HA 3M2WA 3R04A 4P5ZA 5GINE 1YHSA 4AN9A 3AC8A 2CNQA 3VF8A 2H6DA 4S32A 3MTLA 4AA5A 2GFSA 2GHLA 5JH6A 3RK7A 4K1BA 2JFMA 4U44A 3FPQA 3FLZA 4RGJA 3G2FA 3V5QA 5E92A 3OY3A 4OTQA 5C03A 4JNWA 3IG7A 4C4FA 4G31A 5LWMA 3O50A 1VYZA 1L3RE 3KKVA 4C59A 5K5XA 3LQ3A 3NMUF 3KQ7A 4EKLA 3ULIA 2W06A 2W9FB 3QTIA 3GQIA 3Q04A 4I6FA 2VWXA 4XS2A 2B0QA 2WMBA 4O4EA 2EB3A 3FKLA 2XYUA 3RALA 3LM5A 4ASXA 3E8EA 4YUQA 1TQIA 2LGCA 3DNDA 3TEIA 1V1KA 2C6EA 3FC1X 4TYIA 1H1WA 2WQEA 3GXLA 3TNIA 3AMYA 3DTCA 3P7BA 3QQJA 4I93A 5EQPA 4U8ZA 2P4IA 4ACGA 4D4YA 3ODZX 2IW6A 3RHXA 2W1HA 4IW0A 4R77A 1PW2A 3EQFA 4A4XA 3LFNA 2EB2A 4JDHA 4FV8A 3A7HA 2P33A 4S34A 5LMAA 4OTPA 2YCFA 1CKIA 3DDQA 1WZYA 5EKNA 2BTRA 2RFSA 4W4XA 5L2TA 4UXLA 3I79A 3C4WA 4C57A 3E7OA 4EH3A 3PY3A 2X8EA 1T46A 4L7SA 2KTYA 4R3RA 4EL9A 4QP2A 4GS6A 3C4CA 5DT3A 5FQDC 3MSSA 4TKSA 4YC6A 4YURA 2C1AA 2VWBA 4FKSA 1Q8TA 1WVYA 5DVRA 1VZOA 1DAYA 4YPSA 2J51A 1YXTA 4YGAA 5B2LA 4MNEB 5D7VA 2E9PA 3EWHA 2AEGA 4BF2A 4BKJA 4RIWA 5IA4A 2XAOA 5DOSA 3EFLA 3PIYA 2WMXA 4JG7A 5HX8A 3HMNA 3FZ1A 5HG7A 3V8TA 3QUPA 4D2PA 2GHMA 4HVSA 4YJRA 4ASDA 2PVRA 4G3EA 3R9NA 4JMQA 5JGDA 3E5AA 4W8EA 4F99A 5E8YA 3MESA 4B8MA 5HEZA 2ZMDA 2QC6A 3VF9A 3EKNA 5C1QB 5JEBA 1Q99A 3IOKA 2O63A 3MYGA 2YIWA 3UG1A 1Q97A 4FRFA 2OIDA 1OGUA 2OWBA 4IC7A 4YJOA 4EQUA 3CQUA 4QP3A 4QMPA 4BVUA 4RWKA 1BX6A 4JXFA 5D10A 4EK8A 4XCUA 4N4SA 4CYIA 4XP3A 3L9MA 1Q5KA 3UYTA 5IH6A 5KMKA 4FKVA 3R1YA 2WTVA 4TYHA 3PTGA 3POZA 5DRBA 1P4OA 4DFXE 1PXMA 1FPUA 3QFVA 3ALNA 3ROYA 3SV0A 2WO6A 3V3VA 5GJFA 4KNBA 2UW9A 5AP4A 3ZEWA 4B0GA 1R0EA 3UOHA 4EJNA 3PWDA 4RFMA 4F1OA 5F95A 3ZZEA 4RJ7A 3OHTA 3LZBA 5T3QA 3THBA 5EM6A 2Y6OA 2UZNA 4O7VA 1IAJA 4KABA 4M13A 2C5OA 2VWUA 4AZEA 2V55A 4H36A 3UIUA 3H30A 5I5ZA 5IA0A 2BMCA 2OG8A 4X2KA 3CKXA 4BGQA 3IQ7A 3FI8A 2NO3A 5CSVA 4BHNA 2DYLA 5ACKA 4C36A 1S9IA 2WB8A 2PUUA 3F82A 3GEQA 3IK3A 3K3IA 3UG2A 2BKZA 5AA9A 4ZXTA 3DGKA 4FK3A 3KXXA 2UVYA 4QPMA 4WD5A 2BRMA 3SAYA 2B4SB 3VS4A 3Q32A 4KWPA 4EQMA 1OIRA 4AW0A 1OIYA 4EBWA 1SYKA 2QO2A 2XK7A 1YOMA 5JFWA 2QHMA 1BI7A 2XBJA 5JZNA 3C0HA 4YBKA 4Z55A 2YEXA 4QQ5A 3FZOA 4D0WA 3COIA 3ACJA 4O7TA 2C5VA 3EQCA 3BZ3A 4XRLA 4XG9A 4IC8A 5EM8A 3R8UA 4EH4A 2I1MA 4U79A 3OY1A 3MY0A 4DG0E 4E20A 4I1ZA 5K5NA 3RBWA 4L8MA 4E6QA 3HDNA 3PPZA 4ZLOA 5EOLA 2JKKA 2QOKA 2X0QA 4G16A 3TXOA 3VJNA 4F9YA 2V7AA 4HPTE 4E5WA 4FK6A 2PE2A 3LXKA 3I81A 4ACCA 4F65A 5FEDA 1JKLA 4LUEA 4FTRA 4OT6A 1YDTE 4YLKA 4CFXA 2CGVA 5AV3A 2F7XE 1KE5A 5LVOA 3NVMB 4FIFA 4LV7A 4A9YA 2O3PA 5JFSA 2EU9A 3MTFA 1I44A 2W4JA 3QCQA 4AP7A 3GUBA 4YZBA 5BUIA 4J1RA 3VN9A 3BEGA 2YWPA 3F3UA 4ORKA 4NU1A 2XUUA 3FLQA 3Q4ZA 5IUHA 3E8DA 3R7IA 3W2SA 5H8BA 5BPYA 1SZMA 4QMOA 4QQJA 3PLAE 4O7WA 5DE2A 5EQYA 2A19B 2ZJWA 3HNGA 5HIDA 2VX1A 4ONAA 4BY9E 5JGAA 5A14A 2H34A 2BIYA 3FL5A 2XRUA 3PZEA 4L01A 4C61A 5DFPA 3TYKA 5ACBC 2ITQA 5JFVA 2C6TA 3HRFA 3LFAA 2C1BA 3QTZA 1YDRE 3JVSA 1OBDA 3VJOA 3GP0A 3PSDA 4OW8A 3I7CA 4ERWA 1IA8A 4IE9A 5DR9A 2WTKB 4IWDA 2R3FA 4U97A 5TOZA 3WBLA 2Y9QA 5KMOA 2QHNA 4FKTA 3LOKA 1W84A 2E2BA 4BI2A 3HV4A 4ZJIA 4OTDA 2PZIA 4C58A 4FX3A 4N6YA 1Q4LA 2W1IA 3OBGA 4D2WA 2W1GA 2GSFA 3PXKA 2ZMCA 4BCNA 4AOJA 3WIGA 3UO6A 3E62A 2WD1A 4FTKA 2OJIA 4S30A 4GVAA 4WNPA 5BNJA 4I4EA 3BHVA 3FYKX 4KSQA 5E7RA 4ANMA 5KO1A 4FV1A 3W8LA 2IVTA 1UKHA 2PVLA 1H1PA 5KZ0A 5AAGA 3CGOA 2R7IA 4W9WA 2JDOA 1YXVA 3OF0A 3Q4CA 2VTHA 3V01A 3RJCA 4HNIA 5FTQA 5BYZA 3E3PA 4C4GA 4RIOA 4UYNA 5BVKA 3V6RA 3P4KA 2XNPA 4FEVA 4NWMA 3DK6A 4JBVA 1J1CA 1NVQA 2GNJA 2R9SA 2F4JA 4OR5A 5D12A 5E8WA 3U4UA 1ST0A 5HTIA 3FHIA 3VBXA 2HOGA 3NUXA 2ZM3A 3DXPA 1GOLA 5IKWA 3R8ZA 4L3LA 1J91A 1NT2A 5FXRA 3MVHA 3LQ5A 3MPTA 3MIAA 5HVKA 3G9LX 4L3PA 1FOTA 5FD2A 3R9OA 4FVRA 2ZM1A 1Y8YA 2YZLA 2XIYA 2JDRA 1LUFA 3KULB 3IW8A 3QCXA 4M84A 4PV0A 4DH1A 4BTFA 2R64A 4USDA 3KN5A 2X7OA 5H3QA 4RMZA 5L8KA 5CT0A 4YC8A 4TWNA 4PMSA 4XG7A 4BHZA 3SVVA 4MNEA 4BYIA 4EOJA 4F1TA 2BAKA 3HRBA 3V8SA 2XNOA 4YR8A 3GNIB 3BLRA 3DQXA 2RL5A 2QG7A 5DNRA 2IW9A 4TXCA 2JLDA 3G9NA 4A7CA 2A1AB 4RJ5A 4Y83A 3COHA 3UDZA 3S00A 3HL7A 3P5KA 3KMMA 3KFAA 2FA2A 3WOWA 3I4BA 2VNYA 2HW7A 3FBVA 4YZMA 5IA1A 3JVRA 4U43A 2VN9A 5HHWA 3A7IA 3ZRKA 2QLUA 4G6OA 2WFYA 3PG3A 4FL1A 4JT3A 5L2WA 4FSZA 4ASZA 1APME 3QZHA 2IN6A 3QBNA 2FSMX 4KIOA 1G8AA 4EOMA 4IAFA 3QD4A 2B53A 2JDVA 3G15A 4BCPA 1SVGA 1YKRA 1MRYA 1JKTA 3OTUA 4ANLA 3R1SA 3VIDA 1XH5A 4HYSA 4AZWA 3Q53A 4O0SA 2GQGA 2RFNA 2BRNA 3LLAA 5A4CA 2Z8CA 2GPHA 4AQKA 4M14A 4AAYA 4IAIA 4G34A 3F2AA 3RNYA 4GJ3A 2PVJA 3KIOC 2UW3A 2IWIA 2W05A 4M68A 5J95A 3KCKA 3CPCA 4K77A 3GOKA 5I4NA 3RHKA 5BMSA 4I0TA 4DFBA 4R3PA 5AX9A 4FSYA 4GFGA 4UMRA 3W0OA 3NVKI 3F3ZA 3KGAA 5CTPA 3DBFA 4DG2E 3RWQA 2X7GA 5IEXA 4FBXA 4RJ6A 4FNWA 2R7BA 3MY5A 3HP5A 3Q4TA 2W4KA 4C35A 3A8XA 3BU6A 3PXQA 4OUCA 4MUQA 3C0IA 2WIHA 2QU6A 2Z7RA 2VV9A 2XIZA 4NFMA 1Y6BA 1IASA 2QONA 3KA0A 5CQWA 1FMOE 1U59A 3KXZA 4YHJA 4FKOA 3I60A 1UWHA 4CFNA 2PVMA 5HNGA 5J5SA 2PUNA 4CMUA 2WMTA 2XCHA 4AT5A 2PUIA 1WFCA 2ITTA 3VBYA 4FVQA 5FGKA 4D4RA 1PMVA 4RJ3A 4QMNA 5A4EA 3W0MA 3O2MA 3OZ6A 1E9HA 3L9PA 3KXMA 4NYEA 1AQ1A 3EYHA 2VZ6A 3WF9A 1H8FA 5IA2A 3MPAA 4RVTA 4DINA 3BBWA 3ZUTA 4MH7A 5C26A 4WBOA 4K9YA 1KE6A 4CRSA 4E4MA 3UPXA 3PDTA 3GU6A 3PSCA 3DK7A 5E9EA 3TN8A 4EUUA 5CYIA 3U55A 5TE0A 5AUZA 5CQUA 4IANA 3ZO3A 4BCMA 5J79A 4CKIA 1MUOA 5GNKA 4QDEA 1XBCA 3OEZA 4AGUA 4ZZOA 4F9BA 5M4IA 4B9DA 3Q9WA 4DDGA 4MYGA 4U41A 1HCKA 3ZXTA 2FYSA 4G3GA 4EOPA 3LFQA 3HZTA 2QNJA 3I6WA 4FEUA 1OPJA 1ZAOA 2I0HA 3ZC5A 3LCTA 4TW9A 4AOTA 3MFUA 1LEZA 4U81A 4E5BA 5H2UA 4BDJA 3OBJA 1DI9A 1TQMA 4BCJA 3LCOA 3D7ZA 3W0NA 4ZSLA 4NZWB 2R0IA 3FAAA 4EH2A 3HYHA 3UNZA 3ZRLA 2DUVA 3CS9A 3GCSA 3DV3A 2ITNA 3BGZA 5CZIA 4QPAA 4CTBA 4UXQA 3R7UA 2QODA 4D4VA 4QQTA 4O7YA 3I0OA 4IHPA 4BTKA 4EHEA 4C7TA 1Q61A 3O7LB 3RPVA 4IQ6A 4AN3A 2VTMA 3UYSA 5ETIA 3DBEA 5GIOE 2ETKA 4ZS0A 2WMVA 5IQDA 4XG6A 3AD4A 5AP1A 3PPKA 4U9AA 3AKJA 3MFRA 5L6WL 1KE7A 4M7IA 2PVKA 4DT8A 4USEA 2NNWB 3REPA 3NUUA 2HELA 3VAPA 3TDWA 4E73A 3V5WA 3P7CA 5KUPA 3DKGA 3PXZA 2YISA 3QGWA 2H96A 1DI8A 1KV1A 2HWOA 3HV3A 4YHFA 4QPSA 2DS1A 4MXYA 5L2QA 5L3AA 3DQWA 1PYEA 4LQMA 1KE8A 4FJVA 2I7QA 1OGYA 1H25A 3Q52A 4HGLA 4XLIA 2XEZA 3MGYA 3FQEA 4I6LA 2YM4A 2YFXA 1YXUA 5IQEA 4XH6A 2QOQA 3BELA 4K18A 4GK4A 3BKBA 3GI3A 5I9UA 3VUGA 4BCKA 4TZRA 2ITXA 4V05A 4E6CA 5JN2A 4O0WA 4BDDA 5CNNA 3LKMA 5DPVA 3A7GA 1MQBA 4X0MA 3PA3A 5F4NA 4FOBA 4KBCA 1JLUE 3QRKA 5HCXA 5AA8A 5L8LA 4I6BA 2UW4A 4GUBA 2Y6MA 5L8JA 3FUPA 1OPKA 2Y4PA 2PZPA 3NYVA 1YQJA 2JIVA 3DS6A 5HLPA 3MPMA 3HV5A 2AC5A 2CPKE 4MKCA 4BZDA 3OT3A 3PA4A 3F5XA 5EYCA 3DZQA 5GJDA 5KHWA 5CASA 2VTSA 3FJQE 3HGKA 4BDBA 1XWSA 2ITOA 2BHHA 2R3NA 4X2JA 1SVHA 5HG5A 4C3FA 5TKDA 1OIQA 4D4SA 3LFSA 3R8LA 2YITA 1OBGA 3LHJA 1ATPE 4CXAA 4ZJJA 3PVWA 4NIFA 2HYYA 2G15A 5KZIA 3EQRA 4LL0A 4O7RA 3CJFA 4BZOA 3QQKA 3AC4A 4IZ5A 1PXIA 4BZNA 3O0GA 3QA8A 1H0VA 2J0KA 1YI4A 3V5LA 1W83A 4IX4A 2W5AA 4GT5A 3BHHA 5E8SA 2VUWA 4RIWB 1H26A 2F2CB 4I94A 4GFOA 5C8KA 1PMUA 3ML1A 3W2PA 3R71A 4C4EA 4EKKA 4EOQA 2VTAA 4WKQA 3WF6A 4UBAA 2JKMA 1IA9A 2WGJA 3PRIA 4CMOA 4QP9A 4F7LA 2CMWA 4O0RA 3WF5A 2GTNA 3L8SA 3VW8A 3PVGA 5K3YA 1Q24A 5AIRA 4L46A 2YIXA 3FMKA 4FKQA 4A9TA 2QLQA 3PP1A 1JWHA 4FGRA 4FKGA 3IW6A 4DBNA 4FTMA 3ITZA 2CKQA 4UMPA 2C5XA 1M14A 2OO8X 3M1SA 4YHTA 2XARA 3Q2JA 5BUEA 3RNIA 2ZV7A 2C0OA 4AT3A 3C5IA 3R1QA 4ZP5A 4TYHB 3NNWA 3BL7A 3FKNA 3TMOA 4FSWA 4F6UA 2YACA 2BROA 1ND4A 3UMXA 3ZSGA 5GIPE 3ZZWA 2XK9A 1AD5A 4EJ7A 3QLGA 3ENMA 3IDCA 3GU4A 4AXDA 3Q9ZA 3RGFA 1BKXA 4R6VA 4NSTA 1B6CB 1UNGA 3AT3A 3RMFA 4H05A