5CAUA

Egfr kinase domain mutant "tmlr" with compound 41b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
323
structure length
297
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 297
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cauA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cauA01
1Q99A 4CD0A 1H07A 2QD9A 2IZRA 2X39A 5AJQA 1QL6A 5ANEA 4RIOA 4C3RA 5M44A 4M13A 3JXWA 3Q2MA 4E4NA 4DF3A 3I1AA 1KV1A 3ANQA 3NYVA 1XR1A 3E3BX 4TYHB 2Y6MA 5F20A 2C6KA 4QTDA 3IDCA 3QUDA 4JL9A 5EI6A 5HVYA 4O7LA 3BHYA 2YDJA 4FV3A 3HMOA 3DK3A 4FZDB 2CHLA 4ACDA 1ATPE 3F3TA 4O0SA 4IVDA 3GT8A 3D7TA 4FBXA 3FPMA 4J98A 4FSNA 1YOJA 3DLZA 4YJSA 3SRVA 4BIEA 3FMHA 2JDSA 2JIVA 3MFRA 4ORKA 3F61A 2QG7A 4L45A 3QRUA 4QQCA 3UOHA 3QTSA 3TN8A 2FSTX 3CY2A 5CZIA 4UMRA 5LMKC 5GZ9A 4OT5A 4FVRA 3W2SA 3O8TA 1CKPA 5EW3A 5CF6A 3N4TA 3HUBA 2RKUA 1U4DA 2ZV2A 4FV1A 5KZ0A 5T3QA 3ROCA 2PVNA 4QP9A 5CAQA 5EKNA 4WUAA 4DFNA 4FF8A 2P3GX 4D2SA 3QALE 3OC1A 3ORZA 3R02A 4GFGA 4OTHA 4RWLA 1PMVA 3EQIA 4RVTA 3Q04A 4QP1A 5EDRA 4ZSJA 3OFMA 2BPMA 3GU8A 3OWLA 3SQQA 4XP0A 4M14A 3S95A 4NIFB 3LCTA 5ANOA 4BY9E 5M08A 3SG9A 4EBWA 2IZUA 5FWKK 4ZZMA 4F7JA 2UZEA 1F5QA 3C1XA 3O2MA 4N4SA 1WMKA 4ZSAA 4F1MA 2H9VA 4EORA 3BHTA 4IX3A 4AW1A 1O9UA 3I7CA 1MRUA 2J50A 4W8DA 4FL1A 3FLQA 3PJ8A 4K0YA 2QHNA 3ATTA 3DTWA 4ASZA 5A4LA 4FKWA 4C8BA 3OZ6A 5AWMA 4RQVA 5FXRA 1OB3A 4X6QC 1O6KA 4G3GA 4C2VA 1LUFA 3KXNA 4QQ5A 4A9SA 5AA8A 3E8EA 4I21A 3QBNA 4NM7A 2JKMA 2NRUA 3TJDA 4EK4A 4EOPA 5JZNA 1S9IA 2FSOX 4L46A 2ITPA 1H4LA 4Y83A 3FL5A 3EQFA 4OR5A 2P2IA 3E88A 3NEWA 3NZ0A 4FX3A 4I92A 2JLDA 2JD5A 4W4XA 4BCFA 4NYEA 3QX2A 4FZ7A 3PVUA 4AOJA 4BWPA 3ZBFA 5EOBA 2XB7A 1MP8A 1YWRA 4PL3A 4FTRA 1SNXA 3D94A 5IEYA 4XLVA 4QTBA 1JQHA 4WUNA 3U8WA 4EONA 4FOCA 4C35A 3E5AA 5KX8A 1F3MC 1UNLA 2JFMA 1OI9A 1VEBA 4EOQA 5JT2A 3AC2A 4GT4A 4J8MA 4F99A 1OBGA 2ITUA 2ZV8A 2HXQA 2QR8A 3L9NA 2PWLA 1NXKA 3DA6A 4RIYB 4DLJA 3QWKA 5M57A 5GINE 1WBNA 2PVJA 4YJRA 2PPQA 1YXVA 1WBPA 4R78A 3SGCA 3TV4A 5B2KA 2XJ1A 4GV1A 4QMMA 4W8EA 3VJOA 4G3FA 2BFYA 1MRVA 5TF9A 4CZUA 2PHKA 1FMKA 1PMNA 1OKZA 2B1PA 2OJ9A 4G16A 4WHZA 5C9CA 4BCKA 3EQGA 4KBCA 4BKZA 4WIHA 2J6MA 4EK3A 4LV8A 5CEPA 4M66A 3EQBA 3HX4A 3ORPA 2BHHA 2OZAA 2R4BA 4FSYA 2AUHA 3V6SA 3A62A 4YC3A 1Y57A 1SVGA 1H1SA 4AN3A 2VZ6A 5BYLA 3CTJA 3QQUA 5CT0A 5DRBA 2R7IA 3R71A 2QC6A 4ALVA 3MPAA 4QMQA 3QKKA 4CKJA 1JBPE 1YVJA 2J5EA 4MX9A 4AW2A 2J0KA 5HORA 4JR7A 2IW9A 4RWIA 2AYPA 1G3NA 3I5NA 3KY2A 4LL0A 4W4VA 4KRDA 4ANOA 3E93A 3FDNA 2G2FA 1CKJA 5KBRA 5KHWA 4GSBA 4O2ZA 5E8VA 2C3JA 4Y73A 5GZAA 5LQFA 3FY0A 3V5JA 4EZ3A 3UE4A 4FKQA 5L6OA 3E8CA 4LRKA 2GU8A 4TT7A 4FNZA 2VWXA 2Y6OA 5ANIA 5M4UA 4R3PA 2H34A 4PL4A 3QXPA 4ZJVA 3ENHA 2VO0A 4HNFA 3U4UA 3TUCA 4XYFA 2QVSE 4JBQA 4FGBA 5GHVA 4F6WA 4AGDA 4MHAA 5KMOA 2JGZA 4E4XA 4F0GA 4BN1A 3TUBA 1A48A 1MUOA 3KVWA 5HBEA 2XNGA 4DE4A 1IG1A 3NUYA 3ZS5A 2H6DA 3GQIA 3HMIA 4PMPA 5CT7A 4ZK5A 1OL7A 2IW8A 3ZRMA 1URCA 4N6ZA 3VBQA 3UIUA 3KRXA 5JZJA 1AGWA 5I9UA 1J91A 4CTCA 2W4OA 1JNKA 2G2IA 4N0SA 3ZSGA 5LMKA 3CBLA 4V0GA 3P08A 4E26A 3P78A 3F69A 3KXZA 5E1EA 3EOCA 5ETIA 4XEYA 1JSTA 2X6EA 4YZBA 3DV3A 3QZIA 2Y7JA 1Y6BA 3OD6X 3C5UA 4FEQA 4J97A 4MWHA 2ZDTA 4KBAA 5TR6A 3TT0A 3LMGA 3PA3A 5FBNC 4EH9A 5HBHA 4CVAA 1QPJA 4F7NA 4R1VA 5DPVA 5AV1A 3KL8A 2QO2A 4QYHA 4BDAA 4ZXTA 4NKAA 4O1PA 2C6OA 1ZY5A 3F5UA 4PUZA 5HESA 4QOXA 4TYGA 4BDGA 3B8QA 3Q53A 2GPHA 1JPAA 4QNAA 4IB0A 5CENA 5CF5A 1OBDA 4IACA 2YCSA 4WRGA 3O0GA 4L3PA 4GG7A 3VQHA 4JG7A 3EN7A 5KNJA 2VGOA 1H08A 2V7OA 1DS5A 1WBTA 3UZRA 2O2UA 3LXNA 4CQGA 4FT5A 2YISA 2R3MA 4USDA 2WMSA 4BCQA 3C7QA 1OIYA 4BCJA 4BZDA 3HMMA 5AUTA 4E6DA 2NNWB 2WB8A 3EL8A 1ZOGA 2F2UA 1ZMVA 4DTAA 4JAJA 3RVGA 2NRYA 5EH0A 5HI2A 4FTLA 2A4LA 4IJPA 3D7ZA 4DFUA 3H30A 3Q2JA 5C01A 3EKNA 1UNGA 4E3CA 2PVRA 4XBRA 5BVDA 4O83A 1WBVA 2REIA 1GZOA 3H4JA 4IJ9A 4DGLC 5J9LA 1ZWSA 1UWHA 2YABA 4IVBA 4JBVA 4DCEA 4BCNA 1WBSA 4DEGA 2WD1A 3RPYA 4MQ2A 4XX9A 3U9NA 4AUAA 3NDMA 4L7FA 2VRXA 1T46A 2JDOA 4HZSA 5IISA 2EB3A 5EDPA 5HTBA 4R8QA 3OOGA 4RWKA 3GU6A 3VS4A 5HIBA 2C0TA 3ZO3A 2OKRA 4R5YA 1WAKA 2A27A 4O0WA 3VNTA 2PUPA 1H01A 4KIPA 5EHYA 2XBAA 3TTIA 2F57A 3T3VA 3QRKA 4FYOA 3RTPA 5BUJA 3R30A 5DMZA 3MB7A 4QPAA 2XJ2A 2ZB0A 3BRBA 4FV6A 4XV9A 3REPA 2B9HA 3FHRA 4X21A 4ZY5A 1WBWA 4B6LA 3E7VA 3FMKA 3SD0A 1MQ4A 4HW7A 3I81A 4QP7A 4MXYA 4ANSA 4BDHA 4LI5A 3L8PA 2VTNA 4JIAA 5IF1A 3SRVB 5J7BA 1K3AA 2BVAA 4EUUA 2C5OA 5AEPA 3LFAA 4IH8A 4M97A 4FYNA 2AC5A 2V5QA 3TXOA 4J71A 2PE0A 2QKRA 4IFCA 5ITAA 3CJFA 1Y6AA 3UVQA 4FEXA 4E93A 4FTKA 4LUDA 3Q32A 3V5TA 2P0CA 3QAME 5CU6A 4UZDA 3UZTA 1BI8A 2PL0A 4JAIA 4PV0A 3ORKA 1JKKA 1JAMA 2YITA 4X2JA 4V01A 2PZPA 1JSVA 2RGPA 4UY9A 3GEQA 4U43A 3WYYA 2OJIA 2Z60A 5CXZA 5IA2A 2VD5A 2XIZA 2V22A 1VZOA 4MF1A 4XOZA 3OUKA 2JKQA 2ZB1A 4A4XA 1U46A 3ZEWA 3VW6A 1VR2A 1FOTA 2JEDA 2JIUA 5K0KA 4EHEA 3MH1A 3ORTA 3L9LA 4UEUA 3VS1A 3I4BA 4RGJA 4RMZA 1BL6A 5CLPA 4O96A 3NUXA 4LMUA 4TN6A 4AZWA 5CTPA 4FSZA 3IG7A 4DFXE 4FKTA 3OUNB 4EOIA 4LUEA 5CAUA 5HTIA 3Q9ZA 4GJ2A 4YHJA 3T9TA 3DLSA 5IUIA 4O82A 3CQEA 1OKYA 1R39A 3SAYA 5IDPA 3EQPA 4IX6A 4AOTA 2YIXA 4ANMA 3DB8A 3ODZX 3PXKA 3CIKA 3ZSHA 4ITJA 4I6HA 3R83A 3O71A 2C0IA 4EWQA 3LMHA 4BICA 3F7ZA 4X2NA 3TIZA 4UX9A 3Q9YA 4B0GA 5DVRA 1LEZA 5E4HA 3MI9A 4O22A 4ID7A 3ZEPA 2WU6A 5J5SA 5IQIA 2RFNA 3U6HA 3EYHA 4KKEA 4R7IA 4AACA 1LPUA 1OIUA 5CVHA 5J9YA 4TTHB 4O1OA 3AMBA 4YZNA 1Q8ZA 3HRCA 4K6ZA 2W1FA 4FC0A 3FC2A 4J96A 4PDPA 4FT3A 5D41A 4ITHA 1PKGA 2VWVA 3F3ZA 4IC7A 3G33A 1FBNA 3BYUA 2UV2A 4O0VA 2PMLX 4M69A 3VHKA 4AZTA 2HW7A 4L9IA 5DT4A 5KKRB 5HO7A 3MTLA 3LFBA 2J0LA 3NCGA 2X4ZA 4IDVA 1CM8A 5EFQA 5EHLA 4ZIMA 3VRZA 4CFNA 4KIOA 4XBUA 4YPSA 3W18A 4EHZA 5I9VA 4BI0A 1OECA 4S2ZA 4BIBA 3OWPA 3MESA 4M68A 1V0PA 4O7VA 2WQEA 4TWNA 2YIYA 3V8WA 5HO6A 3FUPA 4DEHA 5L6PA 1XKKA 2JITA 2O8YA 2ETMA 2HELA 2OZAB 3GFWA 3KC3A 3KXMA 5FXQA 1QPCA 3PWDA 3U4WA 4C36A 4MKCA 4CCBA 2FUMA 5AP4A 5AP3A 4F9YA 3IW7A 1UV5A 3AC3A 3E62A 1BL7A 3SHEA 4FMQA 4FTOA 3ZUUA 2R3FA 4F65A 2PZRA 4I6FA 3FZOA 3CD8A 4MBIA 3FYJX 5JRQA 2UZVA 4AWIA 5I4NA 4CYIA 3ORIA 4QP6A 4UBAA 3R9HA 3UBDA 4RZVA 5AR8A 3IONA 5FRIA 5JFWA 2WMWA 2X8IA 4OTFA 4FKOA 1Z5MA 3FKOA 2Z7LA 1SMHA 3II5A 2WU7A 3KGAA 3QQGA 4JS8A 4L6QA 4NCTA 1U54A 5L2QA 4CFMA 4EQUA 2GTNA 1I44A 2PZYA 2R3QA 2OZOA 5ANJA 4IX5A 3LJ1A 4GRBA 3QHWA 1WBOA 2WIPA 2IZSA 2WTWA 2Z8CA 5E8SA 3O8UA 4X3FB 5BYYA 3PP1A 1DAYA 3UG2A 3GU5A 3PG3A 4AZFA 4YNOA 2VO7A 2R3GA 4O21A 4D58A 2WTKB 1BX6A 3HYHA 2QLUA 5AMNA 4KSQA 5FD2A 3L9PA 4O27B 5H9BA 4O7ZA 1H27A 4UMQA 2QO7A 4O7SA 3A8XA 2VTRA 4C61A 3UC4A 3NYOA 3VS5A 3IOKA 2XNPA 3TL8A 2BDJA 4FUXA 3VS2A 2RF9A 3BYMA 4B99A 5K4IA 1Z57A 5CVFA 3ULIA 5BUEA 4UYNA 4E7WA 3MFUA 3U9CA 5B7VA 5EM6A 4PMMA 4Q5HA 5EI2A 3OXTA 4WKQA 3KXXA 1PMEA 3A99A 5CAPA 4RVMA 5L8JA 4MVFA 1KV2A 2XEYA 3AT3A 3BX5A 5CU2A 4FG7A 4C4IA 3C13A 5L4QA 2XK4A 4ZY6A 3ZMMA 3UP7A 2VNYA 3BHHA 1Q41A 3DT1A 5E90A 3SW4A 5DN3A 3WZUA 2X8DA 2PYWA 3G2FA 3OTVA 4G9RA 3UO6A 4RVLA 1H1RA 3F5GA 2YIRA 3KK8A 4MQ1A 4MXXA 3TI1A 3VBTA 1ND4A 2B9IA 3W8LA 4TW9A 2WEIA 3DBFA 3NUNA 4D55A 4FTNA 2I6LA 3LW0A 3LM0A 4U80A 3PJ3A 4FKIA 4GYGA 2X2MA 3FY2A 2VTLA 2VX1A 1Q8YA 3F2AA 2X7OA 1T45A 3R8PA 4RRVA 1H24A 1PXPA 3NIZA 4GL9A 1UKIA 1R78A 1M7NA 1UU9A 2HZIA 2WZJA 3AQVA 4RJ3A 3RALA 1OL6A 3AMYA 4ZLYA 2EWAA 3Q6UA 5FP5A 3UYSA 4BKJA 1ZY4A 4F9AA 4E20A 5M53A 2WMVA 4XG2A 3R04A 3OOMA 1ZAOA 5FM2A 3ZTXA 5EQYA 1OKWA 1UWJA 4BDBA 5I9ZA 5HVKA 4F6UA 3ZU7A 5AR7A 1BKXA 4Z7GA 4EWHA 3D9VA 3LCKA 1PRYA 4CG8A 4UN0C 3FZSA 2XIRA 4FK3A 3BELA 4G34A 2CDZA 3LM5A 2RSVA 3QQLA 2OF2A 4D2RA 3L8XA 4FSWA 4J7BA 4CNHA 4JT3A 4JLCA 4XRLA 1LR4A 2XIXA 5EI8A 1ZYSA 3F3UA 2O65A 3DKGA 2Y0AA 3LFEA 4P5ZA 4DCAA 3L9MA 3DZOA 2YM8A 3MH3A 4GT5A 4LGDA 3VBXA 3LOKA 5D12A 2BROA 1APME 4EH3A 1PXOA 2ETRA 5HG8A 4IWPA 4FSTA 5DIAA 4E73A 2YACA 5DGZA 3C50A 3PXZA 4PPCA 3VUGA 4X2KA 1VJYA 4CKRA 5B2MA 5I9YA 4XMOA 1OUKA 2EU9A 5AX3A 4ZLOA 1ERKA 3BIZA 3RHXA 4FZAB 4D2VA 3D5WA 4UMUA 3RJCA 3EZRA 3PY1A 3UODA 4CRLA 4O38A 4XV2A 1GNGA 2FO0A 4PY1A 3FLNC 5EK7A 5FLFA 5IA1A 2V7AA 4DT9A 1CTPE 4GEOA 2BR1A 4C4GA 2PTKA 4LG4A 2WMXA 1Q8WA 3CQUA 4XHKB 3SXSA 4BDCA 1M7QA 1H28A 4R5SA 4TNDA 2GS2A 5HHWA 4YJUA 2CGUA 4QP3A 5E8UA 2ZYBA 3OEZA 3B2WA 4S31A 2OI4X 2XH5A 5KMIA 1TQIA 2UZTA 4J99A 3A4PA 5EYKA 3BQRA 4L00A 4LOPA 4ZTNA 3H9FA 4TXCA 5KE0A 3V51A 4A7CA 4N6YA 3OY3A 2R5TA 2WEVA 3PRFA 3BU6A 2JC6A 3CXWA 3Q6WA 3EYGA 4FE2A 3FI4A 1UU8A 2BUJA 3C4WA 4IZ5A 4ZTSA 4ZTQA 4F6SA 4L44A 1IRKA 5DG5A 4CG9A 4IFGA 3R1QA 4QMTA 2HZ4A 3THBA 2Y4IC 3Q9WA 1PXMA 4GK3A 2YEXA 3KEXA 3UVPA 2J5FA 3BGZA 2BKZA 3K54A 4BTKA 3LKMA 4FODA 1Y8GA 4M12A 4FL3A 3DY7A 5L8KA 3BQCA 4CMOA 3MB6A 4LRJA 3DBQA 1OPKA 1REKA 3R1YA 2YLFA 4NT4A 5AP7A 4C4HA 3UO5A 3KXGA 1KUTA 4IZ7A 4ALUA 2VTSA 2GQRA 5AFVA 3QGYA 2HZNA 4K11A 3P1AA 5IKWA 4CQEA 4X0MA 4FKUA 5F95A 4OTDA 3FBVA 5AAGA 2JDVA 4EJ7A 5HEZA 2EXEA 1H25A 2BZJA 5AM7A 5IMXA 4L01A 3DXQA 4ERWA 3A2CA 5KMLA 2VTHA 3DKCA 2HAKA 4CZYB 4GT3A 4F1TA 1J7IA 3FI8A 4D5HA 5C4KA 2YDKA 3DK7A 2XYUA 3DJ6A 3OW3A 1YWVA 2VU3A 4APPA 3PPZA 2C1BA 2B55A 1URWA 5LMAA 4HYSA 2PMNX 3R9DA 3MVMA 5AR4A 3VUDA 3COKA 4L3JA 5EM8A 3QC4A 1M52A 4FIFA 4GKIA 4KRCA 2W5BA 5AADA 2GQGA 3PA5A 2X2KA 1FQ1B 2OG8A 2YWPA 1GZKA 4N57A 2FVDA 5BVOA 4FEWA 3DNDA 3R8MA 3NUAA 5GNKA 5CY3A 5HCXA 2XVDA 4C58A 5TE0A 4CKIA 2QOLA 3OW4A 4W4WA 2PK9A 3FMNA 4UWCA 1P14A 2FYSA 4QP4A 1Q24A 1SVEA 4QYGA 4R1YA 5E8TA 3LLAA 3UDBA 3BHUA 4YJNA 4Y5HA 2QOBA 3VBYA 4EHGA 4LOOA 3AC1A 4M69B 4XNEA 5ANDA 2G2HA 3I79A 3RWPA 2W0JA 2KULA 3O50A 1XH6A 3PJCA 3ZUTA 4BCOA 3EN6A 4FUYA 4Y8DA 2R2PA 2X6DA 3U51A 3KCKA 4RG0A 5JFVA 2CNUA 2V0DA 1DI9A 3NPCA 4CFUA 2OXDA 5KCVA 5AIRA 3HAVA 3EJ1A 1YOMA 4UV0A 4E5BA 3QQFA 5H2UA 2C68A 5F4NA 4FZ6A 2UVYA 3FLWA 4PF4A 1I09A 3KKVA 4FKVA 5DOSA 3FZTA 4BWKA 5C8KA 5IZFA 2A2AA 5CEOA 3O7LD 1R1WA 3G15A 2WGJA 4D4SA 3CPCA 1O6LA 2ITTA 3RPOA 3VAPA 1XBCA 3IGOA 4FSUA 1LP4A 3RK9A 3JPVA 2VTAA 3O96A 3R00A 4F9BA 3RPRA 4G31A 5D1JA 4KBKA 3DDQA 4IAIA 2QODA 4EZ7A 3ZLSA 2UVXA 1WVXA 5DR6A 4BTFA 4H39A 4OBQA 3G0EA 3C9WA 3I6WA 3ZBXA 5A9UA 5I9XA 4DBXA 3ZC6A 2WOUA 3Q5IA 3R7YA 4A9UA 4ITIA 5E92A 4KA3A 5FP6A 4A07A 2QONA 3FAAA 2X1NA 3OP5A 3TZ8A 4A06A 3N4VA 4YC8A 4I0SA 1Q5KA 2VTOA 2W06A 3NCZA 5LARA 2IN6A 3AT2A 1E1VA 2ETKA 5HE2A 3V5QA 2O64A 4YSMA 4R7BA 3D5UA 5AP1A 3BU3A 2J0JA 3VW8A 5L2WA 4DEIA 4FNWA 4C3FA 5LCKA 3W1FA 4JR3A 3OBJA 5AR5A 3OVVA 2R3NA 1KE6A 4D0XA 4F08A 4NCTC 5A54A 2WHBA 1PMUA 3ETAA 4BL1A 4QTEA 3PG1A 2BRHA 4FICA 4P2KA 4EH6A 2OLCA 4O0TA 3P5KA 4AXAA 2BILB 2WMAA 1IA8A 4Y72A 5HX6A 2Y9QA 2W5AA 2W1HA 4FV7A 3GC9A 5BVEA 4QMUA 4BDFA 5HCZA 4EK5A 1HCKA 3NWWA 3G9NA 4DEDA 2R3IA 5CANA 3IW6A 4GFMA 4FT0A 4PDSA 4NUSA 3DAEA 5AUUA 1FVTA 4ZSEA 5DEWA 3ACJA 5CQUA 4YMJA 5M4IA 4RA5A 4EK6A 4OTIA 2WO6A 3FLSA 3QQKA 2XS0A 4LMNA 4O81A 2ZAZA 3PFQA 4JDKA 3VS3A 4MBLA 5FQDC 4A9RA 2B7AA 3T3UA 4DH8A 2XKFA 1W83A 3R8ZA 3U6IA 5TKDA 1WVYA 3D5XA 3WI6A 3W10A 1OITA 2F7EE 4Z16A 2JIIA 3PIYA 5IUHA 1Y8YA 3GP0A 3PRIA 4D2TA 3DKOA 5BVKA 1NVRA 3SDJA 3VHEA 1XO2B 4RQKA 4PX6A 1U5QA 1YI3A 4KINA 3QWJA 3SKCA 1GZ8A 3ZONA 3MVHA 4HJOA 4EH2A 3GC0A 4UYAA 2E9NA 2GMXA 4PL5A 2ITXA 3HDMA 3SXFA 1YKRA 2NO3A 3TZ7A 3GCPA 3WZKA 4V05A 3EFLA 3PSCA 3FQHA 3BKBA 2YM5A 3U55A 2UZOA 2VTQA 4PDYA 3LCSA 3LLTA 4MCVA 4P5QA 5FDPA 2Y8OA 4MK0A 5EKOA 4YO6A 1NA7A 4RIWB 1ZARA 1Q62A 3LE6A 3V6RA 4WNOA 5JSMA 3COHA 4KKHA 2W7XA 2PUIA 3EKKA 5M09A 4ANLA 1PY5A 4JDHA 2PUUA 4DEBA 1ZMUA 1PXJA 5CAVA 4YJQA 5M06A 4S32A 4TYJA 2WFYA 3O23A 2PSQA 2GNHA 3C4EA 4DFBA 1G5SA 3MVLA 5CEQA 3VUMA 5IQEA 3OY1A 2YDIA 5EW9A 1FMOE 3QCQA 2Z2WA 2QU6A 4OTPA 2RG6A 4FSQA 4G1WA 1RJBA 2NP8A 3DDPA 3ORLA 4X3JA 4ACHA 3A4OX 4RPVA 5HO8A 1Q4LA 3WF7A 3PE1A 3E8NA 3FLYA 3TUDA 5I5ZA 3G51A 4FNYA 3HMPA 3RM7A 4GMYA 4NEUA 3O7LB 3O51A 5ETAA 4LL5A 3VRYA 3EIDA 3EN9A 3QQHA 3UG1A 3QKLA 4RJ8A 2YERA 1R0EA 4HPTE 1BI7A 4AP7A 4DFLA 4FV8A 4IZYA 2CPKE 4ONAA 3A7HA 3ERKA 2CNVA 2JKKA 1YHSA 5AV2A 4FEUA 4BYJA 3HV5A 2O3PA 3MDYA 4ZMEA 3ZFYA 4KS7A 4G5PA 5F94A 5FUTA 4MD7E 5FTQA 3UYTA 1BUHA 1XH8A 4AX8A 5J95A 1OKVA 2VV9A 3DBDA 4AG8A 2EXMA 2HYYA 3UOLA 3OXIA 4IAZA 2BDWA 2E9VA 3R8UA 2Z7SA 2BTSA 5J79A 2I7QA 1FVRA 3QRIA 3RNIA 4KNBA 5GIPE 3UMXA 3W2OA 2W99B 3FQEA 2YM7A 3DGKA 4EYMA 4J52A 5L2IA 4J1RA 2BRGA 3IDPA 1MRYA 5J87A 5GIOE 2F7XE 4D0WA 2GFCA 4I4FA 2XCHA 3A7FA 4XG8A 3TNPC 2GHMA 4RFMA 3AOXA 3BPRA 4UMTA 4NM3A 4V0GB 4CMUA 1SNUA 2VTTA 3C4CA 1H1QA 3MY1A 5CS6A 5K9IA 4KAOA 4O7TA 3VBWA 4JQ7A 4PP7A 4Q9SA 4YBJA 4IZAA 5BVNA 4W9WA 2G1TA 2PVMA 1ZYCA 4ZJIA 2VN9A 3RI1A 5KBQA 2X0GA 2Z7QA 4M84A 4FTTA 3HKOA 3VUHA 2ACXA 2HW6A 2UUEA 5FM3A 4MEDA 3HVCA 2XK8A 4H3PA 4FT7A 3QQJA 1PYXA 2OXYA 3MH2A 4FTQA 4AF3A 4CRSA 5IPJA 1HOWA 3Q60A 4QNYA 3TKIA 3GGFA 4I0RA 4HVIA 3HV6A 3DOGA 3EQHA 3AC5A 4JXFA 5IQBA 1CSNA 3RAKA 2YLEA 3NVMB 3U6JA 5JGBA 3QRTA 1Q3DA 3HV3A 4E6QA 3F2NA 4DGMA 3ORXA 3S3IA 3KA0A 4OTWA 3ZC5A 3FMDA 1LEWA 3A61A 3GCQA 2I0VA 5HG7A 3UTOA 1Q8TA 5AP2A 2BMCA 2YM6A 4MXAA 3MN3A 4CGAA 2VTMA 3FKLA 5HG9A 5HE0A 5KMNA 3DAKA 5IEXA 2QQ7A 4WT6A 3WIKA 4QT1A 3BYVA 3FJQE 4G6OA 3S0OA 4WSQA 3HDNA 3DPKA 3OHTA 5K3YA 3I0OA 1YRPA 3D7TB 4BBFA 3E7OA 4XV3A 5EYMA 3EN5A 3R9OA 1DI8A 5AUYA 4AE9A 3H0ZA 2GSFA 5M55A 1IEPA 2BCJA 1PF8A 4KIKA 4YO4A 3K2LA 4ZZNA 4ARKA 2W9ZB 2WTDA 2HK5A 3L8SA 3OROA 4RT7A 1GIHA 3NNUA 4UALA 4U0IA 4G2FA 4FV5A 4ZTLA 4QD6A 4RFYA 2QLQA 3H10A 4IVCA 3TEIA 3MV5A 2R9SA 1RDQE 4L7SA 4PMTA 4KIQA 2RFSA 4F9CA 5M4FA 3PSDA 5AR3A 4YSJA 4NWMA 4BCHA 2BZIB 3LCOA 2BAQA 2QOOA 1KOAA 2C47A 5A6NA 1IAJA 1P2AA 3UQFA 1QPDA 2C30A 2YM4A 3QTZA 4G3EA 3A60A 3T9IA 3GCSA 2CSNA 4YTIA 2XKDA 3FI3A 2IJMA 3MSSA 3P7BA 4FL2A 1OM1A 2VWIA 3R1SA 4I0TA 4GFOA 4BKYA 3PVWA 4IAFA 1OPJA 4M0ZA 4BDJA 4QMVA 2YJSA 5IQCA 3FZPA 2HWOA 5EM7A 3FMJA 5CF4A 3TNIA 5HE3A 3QUPA 4QP8A 1TVOA 3B2TA 4S34A 5A3XA 3TKHA 3CJGA 3DBCA 4GG5A 1H1WA 2ZM3A 4QPSA 4O0UA 4UZHA 4BDEA 3CSVA 5EDQA 2OBJA 3MVJA 4EH8A 2BRBA 2RG5A 3ACKA 3DZQA 3QD3A 1AD5A 1J1BA 3NUPA 4F64A 1WZYA 2ZV7A 1K9AA 5JGAA 3MH0A 4FIGA 5K5XA 4ENYA 5FXSA 2J7TA 5AP5A 5HBJA 4WSYA 3WIGA 4FIJA 5HZNA 1V0OA 2YAKA 4DBNA 4YNEA 5IA4A 5DT0A 3AD5A 3NNVA 3PZEA 4FV0A 2VX3A 1YXUA 5H3QA 3DXNA 2GNJA 4AOIA 3MWUA 2BRNA 4KB8A 4OW8A 3RINA 2ZMCA 4CT1A 2PULA 3KULA 5L6WL 5D7VA 2IW6A 4QYEA 4BGHA 2X9FA 2C1AA 4ZY4A 1YXTA 1KE5A 3SA0A 1X8BA 3OXZA 3GC8A 2XM9A 3MPMA 3QTQA 4Y46A 4XUFA 4YTCA 4HZRA 5CI6A 1DM2A 3KREA 3ORMA 3DJ7A 4AZSA 4ZP5A 4YHTA 3CGOA 4I22A 3ZOSA 2R3HA 4O7WA 3ALNA 5D11A 4C57A 4E6CA 4GH2A 5HTCA 3V3VA 3PUPA 3R2YA 2J0IA 2WNTA 4TYHA 3RPVA 3NYXA 3MJ1A 2BZHB 4BDDA 5CAOA 4O7RA 2OIQA 2R3JA 3BEGA 4II5A 4WNKA 4BZOA 5DA3A 1JWHA 4C02A 5CEKA 3EZVA 4JG8A 4EH5A 3C4XA 4F70A 3HMNA 1RW8A 2J9MA 3O17A 3R21A 4BDKA 4HYHA 4HCTA 5BYZA 3VS7A 4MWIA 4DGNA 3QD0A 4G5JA 5EM5A 2DYLA 4FV9A 3Q52A 1U5RA 2UZDA 3P23A 4YP8A 3PZHA 5HLNA 4C2WA 5JGDA 4YTHA 2CNQA 2C3IB 3TCPA 3PXQA 5CSWA 3HV4A 5LVLA 4U5JA 3NIEA 2R3RA 2CJMA 3ORNA 3V04A 3K5UA 3PLSA 4G17A 4M3QA 5D9HA 4QMNA 2PVYA 4UMPA 4EUTA 2VAGA 4EOOA 5CYIA 4D2PA 4NIFA 4IVAA 4QYYA 3QA8A 3WZEA 5FEEA 4B7TA 4EH7A 2ZOQA 2UW0A 4M8TA 5EQEA 3KN5A 3LFFA 2XKEA 3MA6A 4GVJA 5G6VA 4FV4A 2RFEA 4RLLA 5BMMA 3TWJA 4F9WA 1ZMWA 4KWPA 3DNEA 5AV3A 5BNJA 3VIDA 5A14A 2ITOA 1GAGA 4FV2A 4EKKA 1CDKA 4YR8A 5HU3A 3EFWA 2WTJA 4LGGA 4BI2A 4EOJA 4NTSA 4C4FA 3MA3A 5M51A 4BGGA 4AS0A 2SRCA 5K4JA 2OJGA 4UXLA 3QKMA 5CQWA 1E1XA 1GZNA 2C6IA 2QOFA 3QXOA 3LVPA 5DHJA 5HVJA 3TNQB 3R0TA 2UZNA 4JQEA 4U41A 3MYGA 3WZJA 2I1MA 2C6MA 4OTGA 4FR4A 3V5LA 4Q2AA 3V01A 2W05A 3HEGA 3L8VA 3RK7A 3FKNA 4YC6A 2R3LA 3NR9A 2X4FA 4TZRA 4IMYA 5FGKA 4EBVA 3WARA 3H3CA 2OK1A 2FSLX 2XNOA 3DS6A 3CR0A 5ANGA 4OAUC 2GS6A 2YIQA 3JY9A 3LJ0A 1YXXA 3LJ2A 4O0RA 4RIYA 4RSSA 2IWIA 4AGUA 2Z02A 3N4UA 1BYGA 3NW5A 3VN9A 3P7AA 3Q4ZA 2I40A 3VF9A 1F0QA 4FSRA 3WF8A 4FA2A 2OFVA 1H00A 4ZS4A 2YN8A 3IW8A 2F49A 1ZOEA 4GK4A 5H8BA 4RA4A 3HL7A 3S00A 3BYOA 5DLSA 5ETFA 3FL4A 3R8LA 2Y4PA 2BZKB 3NYNA 1JLUE 4EC9A 1FVVA 3SW7A 2CLQA 4YJPA 1H0VA 2ZJWA 4F0FA 1XHAA 2BALA 1JKSA 4PDOA 4CFWA 3VC4A 2PVFA 5JRSA 4I5HA 4IWDA 1PXNA 5BUIA 4I93A 2VO3A 5I9WA 2PVKA 2C3LA 4AA4A 4JBOA 3ZFXA 4CMTA 3QGWA 4D4RA 5JFXA 4QMZA 1GY3A 2CGVA 5ANKA 3AC8A 4EQCA 5CASA 5HX8A 5AUXA 3SOCA 3CY3A 4AQCA 4C62A 5JQ5A 2IO6A 3AD6A 3ZM9A 3AD4A 3QTXA 2ITZA 5LVNA 3Q4CA 4U44A 4BVUA 2H96A 2WMQA 3PVBA 4Q9ZA 1Z9XA 3EQRA 4FG8A 3IKAA 2A19B 4RFZA 4A4LA 3DQWA 1SYKA 4NM0A 5A6OA 1ZYDA 4DYMA 2ZV9A 3PP0A 4ENXA 5HLPA 1PXLA 3K3JA 3ZXTA 3D14A 3TDVA 3KMWA 4QMPA 1TQMA 4HYIA 3HP2A 3CCNA 1UKHA 5CU3A 3KRJA 4U40A 5C4LA 4L42A 1OZ1A 2GNFA 1A9UA 2UZWE 3D2KA 4NM5A 4AU8A 2ZMDA 5HOAA 3W2PA 1XH4A 4NSTA 3CS9A 2XEZA 3ZH8A 3DKFA 1REJA 4GU6A 3C4ZA 2UZBA 2YCRA 3CQWA 3I5ZA 1OL5A 3MJ2A 4K2RA 4I24A 4TY1A 3LFNA 5HD7A 3Q4UA 1JSUA 3I60A 2I0YA 4WRSA 3ATSA 2EB2A 3GBZA 4YBKA 5A4EA 4YZDA 5E8ZA 1NT2A 2JFLA 1P5EA 3H9RA 4I5CA 2VWBA 4RJ7A 3D5VA 5C27A 4J53A 1KWPA 2ZM1A 3BV3A 2FGIA 3OWKA 4O2PA 3SXRA 3W8QA 4DG2E 5IEVA 4RX9A 2Y4IB 2R64A 4C0TA 3DXPA 5AIKA 3NNWA 4J95A 5L8LA 4MAOA 4D4YA 4KIKB 2WAJA 3WE8A 2OICA 2DQ7X 2ITYA 2UZUE 3I7BA 4Z9LA 4MXOA 4CT2A 3A7IA 3VF8A 1IA9A 3ZZWA 4FKRA 3LIJA 5A4TA 2UW4A 3LXPA 2VX0A 5LVPA 2JAMA 5JKGA 3KRRA 3P4KA 5HKMA 3ZUVA 3W33A 2F2CB 4GKHA 1GIIA 1FINA 2QOKA 3LFDA 3PE2A 5IQGA 2JBPA 3NAYA 3OCBA 1L3RE 2HXLA 3C0GA 3EL7A 5CNOA 3ZM4A 2ITNA 2XF0A 2J90A 4KABA 4P7EA 5DBXA 5IA5A 2DUVA 5CX9A 2ONLC 3P86A 3MIYA 4AZEA 1W7HA 4YUQA 5BPYA 3ID6C 4DH7A 3LCDA 1YOLA 3VJNA 5KMMA 3F7WA 4O7YA 5E9EA 2B53A 4IAAA 3E87A 4BRXA 4IB5A 5JQ8A 3HRBA 5HIEA 4DH5A 5BMSA 1P4FA 2R3PA 2XNMA 3QCYA 4K8AA 4D2WA 3FSFA 2XNBA 4IWOA 4D9UA 3CP9A 2XKCA 1O6YA 4FG9A 4DH3A 3SOAA 4UWBA 3LHJA 1JKLA 4K9YA 2QI8A 3JVRA 2YCQA 3N9XA 4G6LA 3PY0A 3KRWA 3T8OA 2XP2A 4XP3A 5DT3A 1YQJA 2X7GA 1W98A 4X6RA 3UNJA 2WPAA 4K18A 3LQ3A 4PNKA 3M42A 3OCGA 4F63A 3BHVA 4D4VA 4ZZOA 3RMFA 2NPQA 2W5HA 3OG7A 2WOTA 3K3IA 2ERKA 2YHVA 3KVXA 3EQDA 2GHGA 5AUZA 3FQSA 3TDWA 3PLAE 5CSHA 5K0XA 4MTAA 3VO3A 1YXSA 2W17A 3DK6A 3VVHA 4AGWA 3ULZA 5CF8A 1WCCA 3PYYA 4BC6A 2CCIA 3U54A 1SM2A 1OUYA 5T68A 3RZFA 2C5NA 2FA2A 2DWBA 4IWQA 4EJNA 4FKLA 2XZSA 4FEVA 4ASDA 4AA0A 5LOHA 3TNHA 2PY3A 3DFCB 3NS9A 1Y91A 3COMA 3KULB 3KMUA 4QMXA 3BGPA 3AMAA 4JOAA 3F3VA 3JR1A 3KU2A 5HNGA 5C8MA 4O0XA 5D10A 4RC4A 1YI4A 2OJFE 3F5XA 3IW5A 4PWNA 4EOKA 2O63A 4TWPA 3UO4A 4GUEA 3AGLA 1NVQA 2B9FA 4MNEA 3MW1A 1JOWB 3KMMA 4ZS0A 4IB1A 3BYSA 3OEFX 4GJ3A 5HQ0A 3PXRA 4ERKA 4EKLA 3FPQA 4IC8A 4IM2A 2VO6A 4ALWA 3V5PA 4ZTHA 2BIKB 3JY0A 1YDTE 1H8FA 1M2QA 4NH1A 4WBOA 4EOMA 4GYIA 2UW8A 4FKSA 4IDTA 4MD9E 4I5PA 4EL9A 4BHZA 4DA5A 3P7CA 2UW5A 1V1KA 3WYXA 3ZZEA 4M0YA 4C38A 2WQNA 4NFMA 3LXLA 5BQ0A 3PVGA 4HVGA 3OCTA 4BWXA 3F2RA 5J7HA 4X2FA 3S1HA 4TYEA 3QZHA 3VBVA 4BCPA 3C0IA 3AGMA 4NFNA 3ZXZA 5EW8A 5TOZA 4ASXA 2QURA 4G3DA 3R7UA 4ZLZA 1W0XC 4D1ZA 4ZSGA 2B9JA 1RE8A 5CSVA 2ZDUA 1FGKA 3SLSA 2GHLA 4XOYA 4H36A 3OT3A 4AGCA 4DGOA 2XA4A 4D28A 5IDNA 3FSKA 5CNNA 3CLYA 3QLGA 4BGQA 3RAHA 2JDTA 3BZ3A 3LMIA 3AC4A 4DG0E 4JX3A 1U54B 3GENA 4OTQA 4J8NA 3FE3A 4O91A 1SVHA 2XK7A 5J1WA 3UC3A 4CV8A 4TNBA 4MF0A 5KO1A 2XK9A 3OS3A 2V55A 3CTHA 2WELA 3IW4A 3WF5A 4QQTA 4FTJA 4R77A 2CMWA 3VUTA 3ZLYA 2W1EA 3HRFA 3KN6A 4QO9A 4RVKA 5HE1A 4YZ9A 3BEAA 4QMSA 4O0YA 4OAVB 4QMWA 2ERZE 5B0XA 2CKOA 3PXYA 2WKMA 4DEEA 5FEQA 3HA8A 2HOGA 1Q97A 4QMYA 2PUNA 2XIYA 1M14A 2ITQA 4E4LA 4E5WA 4AA5A 5GZ8A 1TKIA 2BIYA 3HA6A 5IQDA 2X7FA 2WQOA 3RHKA 4RX8A 2W4JA 1NW1A 4TL0A 2YCFA 3D83A 5H8GA 4F1OA 4U97A 5CVGA 1CKIA 2UW3A 3ZHPC 5IQAA 2YWVA 2CN8A 4RJ4A 4XH6A 5E7RA 3RBWA 4LM5A 4XG4A 3JUHA 3ANRA 4EC8A 5DYJA 5DH3A 4I23A 4H1JA 2UW9A 4EK8A 5DFPA 2WXVA 3KF4A 4PPBA 3D15A 2OJJA 4KD1A 5L3AA 3UMWA 2CKPA 3EN4A 4IM3A 4HNIA 3KRLA 4FTAA 3TM0A 2VWWA 3LAUA 4GUBA 3CEKA 1OIQA 1UNHA 3C4FA 5F1ZA 3RCJA 3UPXA 4YTFA 1J7UA 1M2PA 3QD4A 3QYZA 3R7IA 2UW7A 4W9XA 1YHWA 2C5YA 2QU5A 3G9LX 4RIXA 3IS5A 2Q83A 4QTCA 3IK3A 4QMLA 4RZWA 3V8TA 4AT4A 4BTJA 3ITZA 1XBAA 3P0MA 1OIRA 2F4JA 2XK3A 3CTQA 1Q3WA 2XIKA 3BLRA 2JBOA 3GXLA 5JK3A 3LFQA 4PNIA 1IASA 2ZVAA 3V5WA 4BBEA 4GVAA 3TG1A 2EXCX 3FV8A 4AZVA 3ENMA 4Y85A 2IZTA 2XRUA 5DR9A 3MIAA 4DINA 1CMKE 3ROYA 4ZEGA 4AW5A 2HZ0A 1YW2A 1W84A 4R3CA 3CE3A 3PIZA 4S30A 4BCMA 5M56A 4BR3A 5IH5A 4H58A 5EYCA 4MBJA 5C03A 4V04A 3BBTB 3NUSA 5FDXA 3M11A 5ACBC 5HCYA 5KMJA 3MFSA 1E9HA 3F88A 5HNIX 3HP5A 4CFFA 2YM3A 3UGCA 2CLXA 4U9AA 4AT3A 5LVMA 4HCVA 2BRMA 2WMBA 2GNGA 2AC3A 2PZ5A 5AUWA 5M07A 1U59A 4X3FA 4E4MA 2RIOA 4QP2A 3R7OA 1UVRA 4C37A 1P4OA 1YWNA 1ZOHA 5AAEA 5HIDA 4EOSA 2Q0NA 3RZBA 3W55A 4CFXA 2ESMA 2C6DA 3UIXA 1M17A 3HZTA 4NL0A 4LFIA 4MD8E 4LV5A 3QTRA 3EFKA 3FLZA 4K33A 4P4CA 4W4YA 5AA9A 4XCUA 4BHNA 2C5VA 2XUUA 2VNWA 3B8RA 5DE2A 3VULA 4ZTMA 3DAJA 3PJ2A 4RX5A 3QD2B 5A4CA 3DTCA 1YDSE 2P2HA 3Q5ZA 4NK9A 4C59A 4DTKA 3S2PA 2IPXA 4IHPA 4DTBA 4TWCA 4EI4A 5IH6A 3QRJA 1Q61A 2O5KA 4FNXA 4WOVA 3WILA 4DAWA 5IQFA 4G3CA 2F9GA 4PTEA 3W16A 4A9TA 2P55A 4OUCA 4O86A 3R9RA 5FTGA 2CGWA 4USFA 3MBLA 1GOLA 5CU4A 4AFJA 1PXKA 4XG3A 1W82A 4C3PA 1J7LA 4FGRA 4AE6A 4L3LA 3KFAA 4I3ZA 2OU7A 4H3QA 3Q9XA 4QQJA 3RCDA 4B9DA 3PPKA 4XP2A 3ZYAA 2XK6A 2F7ZE 5GJFA 5CXHA 2I0HA 4O6LA 1B38A 3ZFMA 2XNNA 3W2RA 3UIMA 2X2LA 2WIHA 3ALOA 2XCKA 4I5MA 5A46A 4RLKA 5KUPA 3DQXA 2J0MB 4LQMA 4U3ZA 4WG5A 5GJGA 5CEMA 3E64A 4LGHA 3NW6A 4BYIA 2QHMA 5BVWA 3JYAA 4ANNA 1G8SA 3EH9A 3SX9A 3UZPA 5ETCA 3RAIA 2BAKA 4NTTA 4U81A 4GCJA 4IADA 1EH4A 1VYZA 4IAYA 4BI1A 2W1GA 2QOIA 3JVSA 4XG6A 4HCUA 1UA2A 1L8TA 2B52A 2JKOA 4OTRA 4XV1A 3TJCA 1KOBA 3BBWA 2G15A 2XRWA 1WFCA 5IU2A 5JFSA 3UOKA 4B4LA 3AXWA 5JH6A 3FMMA 4HPUE 3I0QA 4NKSA 4QMOA 5T6KA 1ZZLA 3UIBA 5J1VA 4C34A 4PTGA 3SG8A 1UU3A 4I6QA 1OMWA 4RJ5A 5E91A 2HCKA 3SC1A 4BBMA 1J1CA 4L8MA 1K2PA 3NMUF 3R8VA 4C33A 5HLWA 3R73A 3AG9A 2QOQA 3I6UA 3QA0A 3HGKA 3POZA 3UP2A 5CALA 4TRLA 1V0BA 3D0EA 1KSWA 3GB2A 4C4EA 4DC2A 5AM6A 3PPJA 1YI6A 4U6RA 4CTBA 1PHKA 4MNEB 4S33A 3CGFA 2CKEA 2YFXA 5H8EA 3QF9A 4IAKA 5FBOA 4L68A 2ONLA 4LOQA 1W8CA 3EB0A 4YPDA 3ZDIA 2BAJA 2FSMX 3BLHA 3F5PA 3MY0A 1A06A 3UNKA 5IUGA 4YLLA 2OWBA 3QCXA 4YLJA 4FVQA 3M1SA 1FPUA 2GCDA 1UU7A 1JKTA 2FB8A 2XMYA 2QR7A 3MY5A 2GTMA 3DU8A 3Q4TA 1J3HA 1H26A 2PVLA 4A4OA 5IQHA 4OBOA 3PJ1A 3E92A 1S9JA 3FC1X 2JAVA 4P90A 3BLQA 3R7VA 4CZTA 4FI1A 4U79A 3C51A 4CLJA 2WTIA 4IW0A 3ZRKA 2UW6A 3MGYA 4B8LA 3HNGA 5CI7A 4RWJA 2PU8A 3FWQA 3GOPA 4HYUA 4EQMA 2WMTA 3R22A 2J2IB 5DWRA 3U87A 3W2CA 4K77A 2CKQA 4ZTRA 5IG1A 3IGGA 3NRMA 5DRDA 4IB3A 3TZ9A 4Z55A 2VWYA 4F0IA 2QO9A 3BCEA 4ACGA 5AV4A 5IMEA 2C4GA 2I0EA 3F9NA 5DI1A 3RKBA 4NZWB 1QMZA 4FTMA 2C3KA 4IXPA 3F66A 3ZRLA 5HD4A 4FK6A 3WE4A 3PXFA 4JBPA 3OMVA 2QOCA 3GQLA 4EZ5A 3OT8A 5M4CA 3RNYA 4AN2A 2QOHA 4FTUA 2GNIA 3FHIA 4I20A 1OGUA 2XM8A 3QTUA 5G1XA 3ZLWA 4DFZE 2OO8X 4E1ZA 3IOPA 2YAAA 1XBBA 3E8DA 2VUWA 3GFEA 4FIHA 4JIKA 4U45A 2E2BA 4FZFB 1QPEA 2OF4A 3QTWA 4YZMA 4YGAA 5CSPA 3ZCLA 3LFCA 4EOLA 3C0HA 4XLIA 5K5NA 5TO8A 2ITVA 4FTIA 2GFSA 3G6GA 3GC7A 4HOKA 3UVRA 3FXXA 2CGXA 2VTPA 2W4KA 3PIXA 3PSBA 3DB6A 4NW6A 4RJ6A 3IECA 1STCE 3LQ8A 4HGTA 5LCJA 1ZYJA 4K1BA 4DGGA 3EFJA 3DBEA 1PXIA 3OCSA 3ZSIA 4I1ZA 1B39A 3R2BA 3UPZA 4DHFA 4GIIA 4O84A 5LVOA 4GS6A 1R0PA 3QX4A 3QL8A 3GU7A 4BDIA 2Q0BA 3ET7A 4R6VA 2X81A 3GOKA 5IA0A 4L67A 2WTVA 4WG4A 4A9YA 4CV9A 5JN2A 4APCA 5EYDA 2OIDA 1OL2A 2WTCA 3VQUA 1OPLA 3KCFA 4FT9A 3VUIA 2EVAA 4DH1A 2VGPA 4PTCA 4RC2A 2C0OA 3H0YA 4E8AA 1ZXEA 2DS1A 2C6LA 1ZRZA 4MNFA 5C1QB 1JVPP 4U3YA 5FG8A 3UQCA 2C69A 4IE9A 3N51A 2QNJA 3BWJA 1ZYLA 3FYKX 2PMIA 4WO5A 5FTOA 4HVDA 4AAAA 3IDBA 4PQNA 3D2IA 4GU9A 3TZMA 4EEVA 3RK5A 3LZBA 4MXCA 5AUVA 4DN5A 4B8MA 5KKRC 4AN9A 5A4QA 3GCUA 4TWOA 3GCVA 3G6HA 5KMKA 3QHRA 4DFYA 2KTYA 3CPBA 4ANQA 5LWMA 2HWPA 4RIXB 5I3RA 4QYFA 3TTJA 5ICPA 2V62A 3QFVA 2QKWB 5C26A 4ZMFA 4F7LA 1VYWA 4NW5A 2PVHA 3BWFA 3Q96A 3NX8A 4HGLA 4M67A 2C5XA 2PZIA 4JRVA 4ACMA 5JMSA 2OGVA 5I3OA 4XS2A 1PKDA 4R3RA 3NSZA 3G90X 2W1ZA 4G9CA 3A7GA 4CLIA 5HNBA 4PMSA 4WNMA 4WG3A 1RQQA 4XG7A 5DR2A 5B2LA 4N70A 2UZLA 4D1SA 4ZOGA 2O0UA 3GI3A 2W96B 4IX4A 4I94A 3A8WA 4Y5QA 5CWZA 4QTAA 4FVPA 5LMBA 2VTIA 1PJKA 4UWYA 4UB7A 2P33A 3FMEA 4IQ6A 4JI9A 4UXQA 4IANA 4X2GA 3RPSA 2IVSA 3H9OA 5F9EA 2J4ZA 3COIA 2ZM4A 4BIDA 4OLIA 1B6CB 1H1PA 2G01A 3HLLA 1XH9A 3BI6A 1Q8UA 2A0CX 2W1DA 2YIWA 3BGQA 3PTGA 5ACKA 3FI2A 4C4JA 2XNEA 5E8WA 4JJRA 2PE1A 4F7SA 2IVTA 4HVHA 1OL1A 2WQBA 2J51A 3EHAA 3FZ1A 3CD3A 4Q5EA 3F3WA 5BX0A 4O6EA 5CU0A 4BFMA 1G8AA 5E8YA 5HG5A 5HGIA 4HGEA 4Y95A 4O7NA 3ZO1A 4X3FC 4JG6A 3BU5A 5D7AA 2GDOA 4Z3VA 3W2QA 4H05A 3EQCA 2JDRA 1IR3A 2UVZA 3WZDA 1KE8A 4OBPA 2E9UA 2WTKC 1OVEA 2G9XA 5HICA 2OH4A 4JQ8A 4LRMA 3EWHA 3TIYA 2X9EA 4JX7A 2GQSA 4HGSA 4FKJA 5CSXA 3QTIA 4YJVA 3GU4A 2VWUA 3WOWA 3SVVA 3LFSA 2BKKA 2WMUA 3NAXA 2BHEA 3D4QA 3FZRA 4FKPA 2LAVA 3W32A 3TKUA 1NVSA 3QYWA 4FKGA 4RC3A 2LGCA 4I6BA 3QU0A 4BCIA 3TV6A 2OW3A 4U7ZA 2CN5A 2H8HA 5HU9A 1YDRE 4QRCA 4EH4A 1KE7A 2OSCA 4JDJA 3BV2A 1WVWA 4MXZA 2E9OA 3ZO2A 2OH0E 5LJJA 4NU1A 3NNXA 3CKWA 3KXHA 4NJDA 4BZNA 3G0FA 1TQPA 3DJ5A 2BFXA 4MYGA 4YJOA 3R9NA 3JS2A 2XBJA 2B4SB 4FSMA 2RFDA 2OIBA 3R7GA 3OWJA 3L1SA 3FEGA 4H1MA 5L2SA 4CSVA 3OTUA 3P79A 4FIIA 5AV0A 3NLBA 2X8EA 3K5VA 3R7EA 2WQMA 3O8PA 3OBGA 4G6NA 3RM6A 4IBMA 4DLIA 4E5AX 3QCSA 1XH5A 3A7JA 2YZAA 4DT8A 4KS8A 4JNWA 5C8NA 4RIWA 3KB7A 5J9ZA 2ITWA 3HECA 3NGAA 2HY0A 2P4IA 5DEYA 4DG3E 2R0IA 3QLFA 4U42A 4XJ0A 2R3KA 3AT4A 2WMRA 5J8IA 1KE9A 3PA4A 5AP0A 4D1XA 4RX7A 2QG5A 4L53A 2IG7A 3VUKA 3GNIB 2R0UA 4E6AA 3GVUA 3MTFA 3IPHA 3ZDUA 4R7HA 4F09A 4CCUA 1QCFA 1R3CA 5IA3A 3EMGA 2B0QA 5AAFA 4OT6A 4IM0A 2C6TA 3NW7A 3QC9A 2IVVA 3P9JA 4USEA 1GIJA 1NY3A 3C5IA 1BLXA 2OXXA 3R01A 3IQ7A 3Q3BA 4L52A 4EYJA 3TNWA 5JEBA 3R28A 3PDTA 1H0WA 2R3OA 3LXKA 5KZIA 5LXMA 2QCSA 4GK2A 4WA9A 3FXZA 4AFEA 3DCVA 2FH9A 3FMLA 3QZFA 3R1NA 3UOJA 5KHXA 3MPTA 4I41A 3UNZA 4GIHA 3LQ5A 3BE2A 4TPTA 4BB4A 4D9TA 4WD5A 5EG3A 3POOA 3WBLA 4KUJA 2PE2A 3OF0A 1ZLTA 3UJGA 3S4QA 1XWSA 5CEIA 1DAWA 1XH7A 2OFUA 3F6XA 2A1AB 3MFTA 3R63A 4CFVA 1IAHA 4CEGA 2YA9A 4PPAA 4GW8A 4YZCA 3NUUA 4ACCA 2IVUA 2W1IA 5J5TA 2BTRA 3RAWA 3PY3A 2GNLA 5E8XA 3SV0A 5FEDA 2BDFA 5EHOA 4XG9A 2XJ0A 1HCLA 3G5DA 2RL5A 5IH4A 4AW0A 3LPBA 2YZLA 2HENA 3IO7A 4DEAA 3QUEA 5I0BA 4I4EA 4CXAA 4Z7HA 3F82A 4RBLA 4PRJA 4YJTA 1MQBA 5GJDA 4CYJA 4OGRA 3PWYA 3DFAA 3WF6A 4YURA 3ELJA 4JDIA 4DITA 5EOLA 2W9FB 1AQ1A 3RGFA 1XQZA 2W1CA 3M2WA 2CCHA 4ZJJA 3GUBA 2HY81 2Z7RA 4ANBA 4IEBA 2YJRA 3UQGA 3VWAA 3CC6A 2GS7A 4FIEA 2HIWA 1YHVA 2VWZA 4FOBA 4KSPA 1M2RA 4M15A 4MH7A 1GJOA 4EHVA 5CZHA 4HVSA 1SZMA 4JRNA 3RWQA 4BCGA 4IIRA 2PMOX 4ASEA 4ZAUA 3V8SA 3CKXA 4JVGA 4WBBB 3RP9A 3NVKI 3E3PA 4TKSA 4C7TA 4WNPA 4PP9A 3HAMA 3VS0A 3HUCA 3TACA 4NJ3A 3ODYX 5AX9A 4M7IA 4D5KA 3R6XA 1PW2A 4LYNA 3WF9A 3ZLXA 1XJDA 2C6EA 2E9PA 4AT5A 5AR2A 3HV7A 4XRJA 3VS6A 3E63A 5EQPA 2B54A 4L43A 5BVFA 2VTJA 3KQ7A 4ZSLA 2EUFB 4BTMA 4YHFA 3FXWA 3QZGA 4U8ZA 3ZO4A 4H3BA 5DNRA 3BE9A 4F4PA 5LWNA 1FGIA 5E1SA 1ZZ2A 3KK9A 5TT7A 4BF2A 4YLKA 3TV7A 3KF7A 4YU2A 5L2TA 2R7BA 2XYNA 4X7QA 3MS9A 5AP6A 4TYIA 4FTCA 4KKGA 1PYEA 4QPMA 1BMKA
chains in the Genus database with same CATH superfamily
1Q99A 4CD0A 1H07A 2QD9A 2IZRA 2X39A 5AJQA 1QL6A 5ANEA 4RIOA 4C3RA 5M44A 4M13A 3JXWA 3Q2MA 4E4NA 4DF3A 3I1AA 1KV1A 3ANQA 3NYVA 1XR1A 3E3BX 4TYHB 2Y6MA 5F20A 2C6KA 4QTDA 4LDTA 3IDCA 3QUDA 4JL9A 5EI6A 5HVYA 4O7LA 3BHYA 2YDJA 4FV3A 3HMOA 3DK3A 4FZDB 2CHLA 4ACDA 1ATPE 3F3TA 4O0SA 4IVDA 3GT8A 3D7TA 4FBXA 3FPMA 4J98A 4FSNA 1YOJA 3DLZA 4YJSA 3SRVA 4BIEA 3FMHA 2JDSA 2JIVA 3MFRA 4ORKA 3F61A 2QG7A 4L45A 3QRUA 4QQCA 3UOHA 3QTSA 3TN8A 2FSTX 3CY2A 5CZIA 4UMRA 5LMKC 5GZ9A 4OT5A 4FVRA 3W2SA 3O8TA 1CKPA 5EW3A 5CF6A 3N4TA 3HUBA 2RKUA 1U4DA 2ZV2A 4FV1A 5KZ0A 5T3QA 3ROCA 2PVNA 4QP9A 5CAQA 5EKNA 4WUAA 4DFNA 4FF8A 2P3GX 4D2SA 3QALE 3OC1A 3ORZA 3R02A 4GFGA 4OTHA 4RWLA 1PMVA 3EQIA 4RVTA 3Q04A 4QP1A 5EDRA 4ZSJA 3OFMA 2BPMA 3GU8A 3W0RA 3OWLA 3SQQA 4XP0A 4M14A 3S95A 4NIFB 3LCTA 5ANOA 4BY9E 5M08A 3SG9A 4EBWA 2IZUA 5FWKK 4ZZMA 4F7JA 2UZEA 1F5QA 3C1XA 3O2MA 4N4SA 1WMKA 4ZSAA 4F1MA 2H9VA 4EORA 3BHTA 3W0MA 4IX3A 4AW1A 1O9UA 3I7CA 1MRUA 2J50A 4W8DA 4FL1A 3FLQA 3PJ8A 4K0YA 2QHNA 3ATTA 3DTWA 4ASZA 5A4LA 4FKWA 4C8BA 3OZ6A 5AWMA 4RQVA 5FXRA 1OB3A 4X6QC 1O6KA 4G3GA 4C2VA 1LUFA 3KXNA 4QQ5A 4A9SA 5AA8A 3E8EA 4I21A 3QBNA 4NM7A 2JKMA 2NRUA 3TJDA 4EK4A 4EOPA 5JZNA 1S9IA 2FSOX 4L46A 2ITPA 1H4LA 4Y83A 3FL5A 3EQFA 4OR5A 2P2IA 3E88A 3NEWA 3NZ0A 4FX3A 4I92A 2JLDA 2JD5A 4W4XA 4BCFA 4NYEA 3TMOA 3QX2A 4FZ7A 3PVUA 4AOJA 4BWPA 3ZBFA 5EOBA 2XB7A 1MP8A 1YWRA 4PL3A 4FTRA 1SNXA 3D94A 5IEYA 4XLVA 4QTBA 1JQHA 4WUNA 3U8WA 4EONA 4FOCA 4C35A 3E5AA 5KX8A 1F3MC 1UNLA 2JFMA 1OI9A 1VEBA 4EOQA 5JT2A 3AC2A 4GT4A 4J8MA 4F99A 1OBGA 2ITUA 2ZV8A 2HXQA 2QR8A 3L9NA 2PWLA 1NXKA 3DA6A 4RIYB 4DLJA 3QWKA 5M57A 5GINE 1WBNA 2PVJA 4YJRA 2PPQA 1YXVA 1WBPA 4R78A 3SGCA 3TV4A 5B2KA 2XJ1A 4GV1A 4QMMA 4W8EA 3VJOA 4G3FA 2BFYA 1MRVA 5TF9A 4CZUA 2PHKA 1FMKA 1PMNA 1OKZA 2B1PA 2OJ9A 4G16A 4WHZA 5C9CA 4BCKA 3EQGA 4KBCA 4BKZA 4WIHA 2J6MA 4EK3A 4LV8A 5CEPA 4M66A 3EQBA 3HX4A 3ORPA 2BHHA 2OZAA 2R4BA 4FSYA 2AUHA 3V6SA 3A62A 4YC3A 1Y57A 1SVGA 1H1SA 4AN3A 2VZ6A 5BYLA 3CTJA 3QQUA 5CT0A 5DRBA 2R7IA 3R71A 2QC6A 4ALVA 3MPAA 4QMQA 3QKKA 4CKJA 1JBPE 1YVJA 2J5EA 4MX9A 4AW2A 2J0KA 5HORA 4JR7A 2IW9A 4RWIA 1G8KA 2AYPA 1G3NA 3I5NA 3KY2A 4LL0A 4W4VA 4KRDA 4ANOA 3E93A 3FDNA 2G2FA 1CKJA 5KBRA 5KHWA 4GSBA 4O2ZA 5E8VA 2C3JA 4Y73A 5GZAA 5LQFA 3FY0A 3V5JA 4EZ3A 3UE4A 4FKQA 5L6OA 3E8CA 4LRKA 2GU8A 4TT7A 4FNZA 2VWXA 2XANA 2Y6OA 5ANIA 5M4UA 4R3PA 2H34A 4PL4A 3QXPA 4ZJVA 4BJJA 3ENHA 2VO0A 4HNFA 3U4UA 3TUCA 4XYFA 2QVSE 4JBQA 4DDIA 4FGBA 5GHVA 4F6WA 4AGDA 4MHAA 5KMOA 2JGZA 4E4XA 4F0GA 4BN1A 3TUBA 1A48A 1MUOA 3KVWA 5HBEA 2XNGA 4DE4A 1IG1A 3NUYA 3ZS5A 2H6DA 3GQIA 3HMIA 4PMPA 5CT7A 4ZK5A 1OL7A 2IW8A 3ZRMA 1URCA 4N6ZA 3VBQA 3UIUA 3KRXA 5JZJA 1AGWA 5I9UA 1J91A 4CTCA 2W4OA 1JNKA 2G2IA 4N0SA 3ZSGA 5LMKA 3CBLA 4V0GA 3P08A 4E26A 3ML1A 3P78A 3F69A 2X0QA 3KXZA 3EOCA 5E1EA 4XEYA 5ETIA 1JSTA 2X6EA 4YZBA 3DV3A 3QZIA 2Y7JA 1Y6BA 3OD6X 3C5UA 4FEQA 4J97A 4DHIB 4MWHA 2ZDTA 4KBAA 5TR6A 3TT0A 3LMGA 3PA3A 5FBNC 4EH9A 5HBHA 4CVAA 1QPJA 4F7NA 4R1VA 5DPVA 5AV1A 3KL8A 2QO2A 4QYHA 4BDAA 4ZXTA 4NKAA 4O1PA 2C6OA 1ZY5A 3F5UA 4PUZA 5HESA 4QOXA 4TYGA 4BDGA 3B8QA 3Q53A 2GPHA 1JPAA 4QNAA 4IB0A 5CENA 5CF5A 1OBDA 4IACA 2YCSA 4WRGA 3O0GA 4L3PA 4GG7A 3VQHA 4JG7A 3EN7A 5KNJA 2VGOA 1H08A 2V7OA 1DS5A 1WBTA 3UZRA 2O2UA 3LXNA 4CQGA 4FT5A 2YISA 2R3MA 4USDA 2WMSA 4BCQA 3C7QA 1OIYA 4BCJA 4BZDA 3HMMA 5AUTA 4E6DA 2NNWB 2WB8A 3EL8A 1ZOGA 2F2UA 1ZMVA 4DTAA 4JAJA 3RVGA 2NRYA 5EH0A 5HI2A 4FTLA 2A4LA 4IJPA 3D7ZA 4DFUA 3H30A 3Q2JA 5C01A 3EKNA 1UNGA 4E3CA 2PVRA 4XBRA 5BVDA 4O83A 1WBVA 2REIA 1GZOA 3H4JA 4IJ9A 4DGLC 5J9LA 1ZWSA 1UWHA 2YABA 4IVBA 4JBVA 4DCEA 4BCNA 1WBSA 4DEGA 2WD1A 3RPYA 4MQ2A 4XX9A 3U9NA 4AUAA 3NDMA 4L7FA 2VRXA 1T46A 2JDOA 4HZSA 5IISA 2EB3A 5EDPA 5HTBA 4R8QA 3OOGA 4RWKA 3GU6A 3VS4A 5HIBA 2C0TA 3ZO3A 2OKRA 4R5YA 1WAKA 2A27A 4O0WA 3VNTA 2PUPA 1H01A 4KIPA 5EHYA 2XBAA 3TTIA 2F57A 3T3VA 3QRKA 4FYOA 3RTPA 5BUJA 3R30A 5DMZA 3MB7A 4QPAA 2XJ2A 2ZB0A 3BRBA 4FV6A 4XV9A 3REPA 2B9HA 3FHRA 4X21A 4ZY5A 1WBWA 4B6LA 3E7VA 3FMKA 3SD0A 1MQ4A 4HW7A 3I81A 4QP7A 4MXYA 4ANSA 4BDHA 1W2DA 4LI5A 3L8PA 2VTNA 4JIAA 5IF1A 3SRVB 5J7BA 1K3AA 2BVAA 4EUUA 2C5OA 5AEPA 3LFAA 4IH8A 4M97A 4FYNA 2AC5A 2V5QA 3TXOA 4J71A 2PE0A 2QKRA 4IFCA 5ITAA 4AXFA 3CJFA 1Y6AA 3UVQA 4FEXA 4E93A 4FTKA 4LUDA 3Q32A 3V5TA 2P0CA 3QAME 5CU6A 4UZDA 3UZTA 1BI8A 2PL0A 4JAIA 4PV0A 3ORKA 1JKKA 1JAMA 2YITA 4X2JA 4V01A 2PZPA 1JSVA 2RGPA 4UY9A 3GEQA 4U43A 3WYYA 2OJIA 2Z60A 5CXZA 5IA2A 2VD5A 2XIZA 2V22A 1VZOA 4MF1A 4XOZA 3OUKA 2JKQA 2ZB1A 4A4XA 1U46A 3ZEWA 3VW6A 1VR2A 1FOTA 2JEDA 2JIUA 5K0KA 4EHEA 3MH1A 3ORTA 3L9LA 4UEUA 3VS1A 3I4BA 4RGJA 4RMZA 1BL6A 5CLPA 4O96A 3NUXA 4LMUA 4TN6A 4AZWA 5CTPA 4FSZA 3IG7A 4DFXE 4FKTA 3OUNB 4EOIA 4LUEA 5CAUA 5HTIA 3Q9ZA 4GJ2A 4AQKA 4YHJA 3T9TA 3DLSA 5IUIA 4O82A 3CQEA 1OKYA 1R39A 3SAYA 5IDPA 3EQPA 4IX6A 4AOTA 2YIXA 4ANMA 3DB8A 3ODZX 3PXKA 3CIKA 3ZSHA 4ITJA 4I6HA 3R83A 3O71A 2C0IA 4EWQA 3LMHA 4BICA 3F7ZA 4X2NA 3TIZA 4UX9A 3Q9YA 4B0GA 5DVRA 1LEZA 5E4HA 3MI9A 4O22A 4ID7A 3ZEPA 2WU6A 5J5SA 5IQIA 2RFNA 3U6HA 3EYHA 4KKEA 4R7IA 4AACA 1LPUA 1OIUA 5CVHA 5J9YA 4TTHB 4O1OA 3AMBA 3O5AA 4YZNA 1Q8ZA 3HRCA 4K6ZA 2W1FA 4FC0A 3FC2A 4J96A 4PDPA 4FT3A 5D41A 4ITHA 1PKGA 2VWVA 3F3ZA 4IC7A 3G33A 1FBNA 3BYUA 2UV2A 4O0VA 2PMLX 4M69A 3VHKA 4AZTA 2HW7A 4L9IA 5DT4A 5KKRB 5HO7A 3MTLA 3LFBA 2J0LA 3NCGA 2X4ZA 4IDVA 1CM8A 5EFQA 5EHLA 4ZIMA 3VRZA 4CFNA 4KIOA 4XBUA 4YPSA 3W18A 4EHZA 5I9VA 4BI0A 1OECA 4S2ZA 4BIBA 3OWPA 3MESA 4M68A 1V0PA 4O7VA 2WQEA 4TWNA 2YIYA 3V8WA 5HO6A 3FUPA 4DEHA 5L6PA 1XKKA 2JITA 2O8YA 2ETMA 2HELA 2OZAB 3GFWA 3KC3A 3KXMA 5FXQA 1QPCA 3PWDA 3U4WA 4C36A 4MKCA 4CCBA 2FUMA 5AP4A 5AP3A 4F9YA 3IW7A 1UV5A 3AC3A 3E62A 1BL7A 3SHEA 4FMQA 4FTOA 3ZUUA 2R3FA 4F65A 2PZRA 4I6FA 3FZOA 3CD8A 4MBIA 3FYJX 3BL9A 5JRQA 2UZVA 4AWIA 5I4NA 4CYIA 3ORIA 4QP6A 4UBAA 3R9HA 3UBDA 4RZVA 5AR8A 3IONA 5FRIA 5JFWA 2WMWA 2X8IA 4OTFA 4FKOA 1Z5MA 3FKOA 2Z7LA 1SMHA 3II5A 2WU7A 3KGAA 3QQGA 4JS8A 4L6QA 4NCTA 1U54A 5L2QA 4CFMA 4EQUA 2GTNA 1I44A 2PZYA 2R3QA 2OZOA 5ANJA 4IX5A 3LJ1A 4GRBA 3QHWA 1WBOA 2WIPA 2IZSA 2WTWA 2Z8CA 5E8SA 3O8UA 4X3FB 5BYYA 3PP1A 1DAYA 3UG2A 3GU5A 3PG3A 4BJJB 4AZFA 4YNOA 2VO7A 2R3GA 4O21A 4D58A 2WTKB 1BX6A 3HYHA 2QLUA 5AMNA 4KSQA 5FD2A 3L9PA 4O27B 5H9BA 4O7ZA 1H27A 4UMQA 2QO7A 4O7SA 3A8XA 2VTRA 4C61A 3UC4A 3NYOA 3VS5A 3IOKA 2XNPA 3TL8A 3AKJA 2BDJA 4FUXA 3VS2A 2RF9A 3BYMA 4B99A 5K4IA 1Z57A 5CVFA 3ULIA 5BUEA 4UYNA 4E7WA 3MFUA 3U9CA 5B7VA 1TFFA 5EM6A 4PMMA 2X0OA 4Q5HA 5EI2A 3OXTA 4WKQA 3KXXA 1PMEA 3A99A 5CAPA 4RVMA 5L8JA 4MVFA 1KV2A 2XEYA 3AT3A 3BX5A 5CU2A 4FG7A 4C4IA 3C13A 5L4QA 2XK4A 4ZY6A 3ZMMA 3UP7A 2VNYA 3BHHA 1Q41A 3DT1A 5E90A 3SW4A 5DN3A 3WZUA 2X8DA 2PYWA 3G2FA 3OTVA 4G9RA 3UO6A 4RVLA 1H1RA 3F5GA 2YIRA 3KK8A 4MQ1A 4MXXA 3TI1A 3VBTA 1ND4A 2B9IA 3W8LA 4TW9A 2WEIA 3DBFA 3NUNA 4D55A 4FTNA 2I6LA 3LW0A 3LM0A 4U80A 3PJ3A 4FKIA 4GYGA 2X2MA 3FY2A 2VTLA 2VX1A 1Q8YA 3F2AA 2X7OA 1T45A 3R8PA 4RRVA 1H24A 1PXPA 3NIZA 4GL9A 1UKIA 1R78A 1M7NA 1UU9A 2HZIA 2WZJA 3AQVA 4RJ3A 3RALA 1OL6A 3AMYA 4ZLYA 2EWAA 3Q6UA 5FP5A 3UYSA 4BKJA 1ZY4A 4F9AA 4E20A 5M53A 2WMVA 4XG2A 3R04A 3OOMA 1ZAOA 5FM2A 3ZTXA 5EQYA 1OKWA 1UWJA 4BDBA 5I9ZA 5HVKA 4F6UA 3ZU7A 5AR7A 1BKXA 4Z7GA 4EWHA 3D9VA 3LCKA 1PRYA 4CG8A 4UN0C 3FZSA 2XIRA 4FK3A 3BELA 4G34A 2CDZA 3LM5A 2RSVA 3QQLA 2OF2A 4D2RA 3L8XA 4FSWA 4J7BA 4CNHA 4JT3A 4JLCA 4XRLA 1LR4A 2XIXA 5EI8A 1ZYSA 3F3UA 2O65A 3DKGA 2Y0AA 3LFEA 4P5ZA 4DCAA 3L9MA 3DZOA 2YM8A 3MH3A 4GT5A 4LGDA 4O4EA 3VBXA 3LOKA 5D12A 2BROA 1APME 4EH3A 1PXOA 2ETRA 5HG8A 4IWPA 4FSTA 5DIAA 4E73A 2YACA 5DGZA 3C50A 3PXZA 4PPCA 3VUGA 4X2KA 1VJYA 4CKRA 5B2MA 5I9YA 4XMOA 1OUKA 2EU9A 5AX3A 4ZLOA 1ERKA 3BIZA 3RHXA 4FZAB 4D2VA 3D5WA 4UMUA 3RJCA 3EZRA 3PY1A 3UODA 4I6LA 4CRLA 4O38A 4XV2A 1GNGA 2FO0A 4PY1A 3FLNC 5EK7A 5FLFA 5IA1A 2V7AA 4DT9A 1CTPE 4GEOA 2BR1A 4C4GA 2PTKA 4LG4A 2WMXA 1Q8WA 3CQUA 4XHKB 3SXSA 4BDCA 1M7QA 1H28A 4R5SA 4TNDA 2GS2A 5HHWA 4YJUA 2CGUA 4QP3A 5E8UA 2ZYBA 3OEZA 3B2WA 4S31A 2OI4X 2XH5A 5KMIA 1TQIA 2UZTA 4J99A 3A4PA 5EYKA 3BQRA 4L00A 4LOPA 4ZTNA 3H9FA 4TXCA 5KE0A 3V51A 4A7CA 4N6YA 3OY3A 2R5TA 2WEVA 3PRFA 3BU6A 3UDTA 2JC6A 3CXWA 3Q6WA 3EYGA 4FE2A 3FI4A 1UU8A 2BUJA 3C4WA 4IZ5A 4ZTSA 4ZTQA 4F6SA 4L44A 1IRKA 5DG5A 4CG9A 4IFGA 3R1QA 4QMTA 2HZ4A 3THBA 2Y4IC 3Q9WA 1PXMA 4GK3A 2YEXA 3KEXA 3UVPA 2J5FA 3BGZA 2BKZA 3K54A 4BTKA 3LKMA 4FODA 1Y8GA 4M12A 4FL3A 3DY7A 5L8KA 3BQCA 4CMOA 3MB6A 3W0SA 4LRJA 3DBQA 1OPKA 1REKA 3R1YA 2YLFA 4NT4A 5AP7A 4C4HA 3UO5A 3KXGA 1KUTA 4IZ7A 4ALUA 2VTSA 2GQRA 5AFVA 3QGYA 2HZNA 4K11A 3P1AA 5IKWA 4CQEA 4X0MA 4FKUA 5F95A 4OTDA 3FBVA 5AAGA 1OGYA 2JDVA 4EJ7A 5HEZA 2EXEA 2XALA 1H25A 2BZJA 5AM7A 5IMXA 4L01A 3DXQA 4ERWA 3A2CA 5KMLA 2VTHA 3DKCA 2HAKA 4CZYB 4GT3A 4F1TA 1J7IA 3FI8A 4D5HA 5C4KA 2YDKA 3DK7A 3UDZA 2XYUA 3DJ6A 3OW3A 1YWVA 2VU3A 4APPA 3PPZA 2C1BA 2B55A 1URWA 5LMAA 4HYSA 2PMNX 3R9DA 3W0PA 3MVMA 5AR4A 3VUDA 3COKA 4L3JA 5EM8A 3QC4A 1M52A 4FIFA 4GKIA 4KRCA 2W5BA 5AADA 2GQGA 3PA5A 2X2KA 1FQ1B 2OG8A 2YWPA 1GZKA 4N57A 2FVDA 5BVOA 4FEWA 3DNDA 3R8MA 3NUAA 5GNKA 5CY3A 5HCXA 2XVDA 4C58A 5TE0A 4CKIA 2QOLA 3OW4A 4W4WA 2PK9A 3FMNA 4UWCA 1P14A 2FYSA 4QP4A 1Q24A 1SVEA 4QYGA 4R1YA 5E8TA 3LLAA 3UDBA 3BHUA 4YJNA 4Y5HA 2QOBA 3VBYA 4EHGA 4LOOA 3AC1A 4M69B 4XNEA 5ANDA 2G2HA 3I79A 3RWPA 2W0JA 2KULA 3O50A 1XH6A 3PJCA 3ZUTA 4BCOA 3EN6A 4FUYA 4Y8DA 2R2PA 2X6DA 3U51A 3KCKA 4RG0A 5JFVA 2CNUA 2V0DA 1DI9A 3NPCA 4CFUA 2OXDA 5KCVA 5AIRA 3HAVA 3EJ1A 1YOMA 4UV0A 4E5BA 3QQFA 5H2UA 2C68A 5F4NA 4FZ6A 2UVYA 3FLWA 4PF4A 1I09A 3KKVA 4FKVA 5DOSA 3FZTA 4BWKA 5C8KA 5IZFA 2A2AA 5CEOA 3O7LD 1R1WA 3G15A 2WGJA 4D4SA 3CPCA 1O6LA 2ITTA 3RPOA 3VAPA 1XBCA 3IGOA 4FSUA 1LP4A 3RK9A 3JPVA 3W0NA 2VTAA 3O96A 3R00A 4F9BA 3RPRA 4G31A 5D1JA 4KBKA 3DDQA 4IAIA 2QODA 4EZ7A 3ZLSA 2UVXA 1WVXA 5DR6A 4BTFA 4H39A 4OBQA 3G0EA 3C9WA 3I6WA 3ZBXA 5A9UA 5I9XA 4DBXA 3ZC6A 2WOUA 3Q5IA 3R7YA 4A9UA 4ITIA 5E92A 4KA3A 5FP6A 4A07A 2QONA 3FAAA 2X1NA 3OP5A 3TZ8A 4A06A 3N4VA 4YC8A 4I0SA 1Q5KA 2VTOA 2W06A 3NCZA 5LARA 2IN6A 3AT2A 1E1VA 2ETKA 5HE2A 3V5QA 2O64A 5BV3A 4YSMA 4R7BA 3D5UA 3UDSA 5AP1A 3BU3A 2J0JA 3VW8A 5L2WA 4DEIA 4FNWA 4C3FA 5LCKA 3W1FA 4JR3A 3OBJA 5AR5A 3OVVA 2R3NA 1KE6A 4D0XA 4F08A 4NCTC 5A54A 2WHBA 1PMUA 3ETAA 4BL1A 4QTEA 4AXDA 3PG1A 2BRHA 4FICA 4P2KA 4EH6A 2OLCA 4O0TA 3P5KA 4AXAA 2BILB 2WMAA 1IA8A 4Y72A 5HX6A 2Y9QA 2W5AA 2W1HA 4FV7A 3GC9A 5BVEA 4QMUA 4BDFA 5HCZA 4EK5A 1HCKA 3TYKA 3NWWA 3G9NA 4DEDA 2R3IA 5CANA 3IW6A 4GFMA 4FT0A 4PDSA 4NUSA 3DAEA 5AUUA 1FVTA 4ZSEA 5DEWA 3ACJA 5CQUA 4YMJA 5M4IA 4RA5A 4EK6A 4OTIA 2WO6A 3FLSA 3QQKA 2XS0A 4LMNA 4O81A 2ZAZA 3PFQA 4JDKA 3VS3A 4MBLA 5FQDC 4A9RA 2B7AA 3T3UA 4DH8A 2XKFA 1W83A 3R8ZA 3U6IA 5TKDA 1WVYA 3D5XA 3WI6A 3W10A 1OITA 2F7EE 4Z16A 2JIIA 3PIYA 5IUHA 1Y8YA 3GP0A 3PRIA 4D2TA 3DKOA 5BVKA 1NVRA 3SDJA 3VHEA 1XO2B 4RQKA 4PX6A 1U5QA 1YI3A 4KINA 3QWJA 3SKCA 1GZ8A 3ZONA 3MVHA 4HJOA 4EH2A 3GC0A 4UYAA 2E9NA 2GMXA 4PL5A 2ITXA 3HDMA 3SXFA 1YKRA 2NO3A 3TZ7A 3GCPA 3WZKA 4V05A 3EFLA 3PSCA 3FQHA 3BKBA 2YM5A 3U55A 2UZOA 2VTQA 4PDYA 3LCSA 3LLTA 4MCVA 4P5QA 5FDPA 2Y8OA 4MK0A 5EKOA 4YO6A 1NA7A 4RIWB 1ZARA 1Q62A 3LE6A 3V6RA 4WNOA 5JSMA 3COHA 4KKHA 2W7XA 2PUIA 3EKKA 5M09A 4ANLA 1PY5A 4JDHA 2PUUA 4DEBA 1ZMUA 1PXJA 5CAVA 4YJQA 5M06A 4S32A 4TYJA 2WFYA 3O23A 2PSQA 2GNHA 3C4EA 4DFBA 1G5SA 3MVLA 4O4BB 5CEQA 3VUMA 5IQEA 3OY1A 2YDIA 5EW9A 1FMOE 3QCQA 2Z2WA 2QU6A 4OTPA 2RG6A 4FSQA 4G1WA 1RJBA 2NP8A 3DDPA 3ORLA 4X3JA 4ACHA 3A4OX 4RPVA 5HO8A 1Q4LA 3WF7A 3PE1A 3E8NA 3FLYA 3TUDA 5I5ZA 3G51A 4FNYA 3HMPA 3RM7A 4GMYA 4NEUA 3O7LB 3O51A 5ETAA 4LL5A 2XARA 3VRYA 3EIDA 3EN9A 3QQHA 3UG1A 3QKLA 4RJ8A 2YERA 1R0EA 4HPTE 1BI7A 4AP7A 4DFLA 4FV8A 4IZYA 2CPKE 4ONAA 3A7HA 3ERKA 2CNVA 2JKKA 1YHSA 5AV2A 4FEUA 4BYJA 3HV5A 2O3PA 3MDYA 4ZMEA 3ZFYA 4KS7A 4G5PA 5F94A 5FUTA 4MD7E 5FTQA 3UYTA 1BUHA 1XH8A 4AX8A 5J95A 1OKVA 2VV9A 3DBDA 4AG8A 2EXMA 2HYYA 3UOLA 3OXIA 4IAZA 2BDWA 2E9VA 3R8UA 2Z7SA 2BTSA 5J79A 2I7QA 1FVRA 3QRIA 3RNIA 4KNBA 5GIPE 3UMXA 3W2OA 2W99B 3FQEA 2YM7A 3DGKA 4EYMA 4J52A 5L2IA 4J1RA 2BRGA 3IDPA 1MRYA 5J87A 5GIOE 2F7XE 4D0WA 2GFCA 4I4FA 2XCHA 3A7FA 4XG8A 3TNPC 2GHMA 4RFMA 3AOXA 3BPRA 4UMTA 4NM3A 4V0GB 4CMUA 1SNUA 2VTTA 3C4CA 1H1QA 3MY1A 5CS6A 5K9IA 4KAOA 4O7TA 3VBWA 4JQ7A 4PP7A 4Q9SA 4YBJA 4IZAA 5BVNA 4W9WA 2G1TA 2PVMA 1ZYCA 4ZJIA 2VN9A 3RI1A 5KBQA 2X0GA 2Z7QA 4M84A 4FTTA 3HKOA 3VUHA 2ACXA 2HW6A 2UUEA 5FM3A 4MEDA 3HVCA 2XK8A 4H3PA 4FT7A 3QQJA 1PYXA 2OXYA 3MH2A 4FTQA 4AF3A 4CRSA 5IPJA 1HOWA 3Q60A 4QNYA 3TKIA 3GGFA 4I0RA 4HVIA 3HV6A 3DOGA 3EQHA 3AC5A 4JXFA 5IQBA 1CSNA 3RAKA 2YLEA 3NVMB 3U6JA 5JGBA 3QRTA 1Q3DA 3HV3A 4E6QA 3F2NA 4DGMA 3ORXA 3S3IA 3KA0A 4OTWA 3ZC5A 3FMDA 1LEWA 3A61A 3GCQA 2I0VA 5HG7A 3UTOA 1Q8TA 5AP2A 2BMCA 2YM6A 4MXAA 3MN3A 4CGAA 2VTMA 3FKLA 5HG9A 5HE0A 5KMNA 3DAKA 5IEXA 2QQ7A 4WT6A 3WIKA 4QT1A 3BYVA 3FJQE 4G6OA 3S0OA 4WSQA 3HDNA 3DPKA 3OHTA 5K3YA 3I0OA 1YRPA 3D7TB 4BBFA 3E7OA 4XV3A 5EYMA 3EN5A 3R9OA 1DI8A 5AUYA 4AE9A 3H0ZA 2GSFA 5M55A 1IEPA 2BCJA 1PF8A 4KIKA 4YO4A 3K2LA 4ZZNA 4ARKA 2W9ZB 2WTDA 3BLAA 2HK5A 3L8SA 3OROA 4RT7A 1GIHA 3NNUA 4UALA 4U0IA 4G2FA 4FV5A 4ZTLA 4QD6A 4RFYA 2QLQA 3H10A 4IVCA 3TEIA 3MV5A 2R9SA 1RDQE 4L7SA 4PMTA 4KIQA 2RFSA 4F9CA 5M4FA 3PSDA 5AR3A 4YSJA 4NWMA 4BCHA 2BZIB 3LCOA 2BAQA 2QOOA 1KOAA 2C47A 5A6NA 1IAJA 1P2AA 3UQFA 1QPDA 2C30A 2YM4A 3QTZA 4G3EA 3A60A 3T9IA 1W2CA 3GCSA 2CSNA 4YTIA 2XKDA 3FI3A 2IJMA 3MSSA 3P7BA 4FL2A 1OM1A 2VWIA 3R1SA 4I0TA 4GFOA 4BKYA 3PVWA 4IAFA 1OPJA 4M0ZA 4BDJA 4QMVA 2YJSA 5IQCA 3FZPA 2HWOA 5EM7A 3FMJA 5CF4A 3TNIA 5HE3A 3QUPA 4QP8A 1TVOA 3B2TA 4S34A 5A3XA 3TKHA 3CJGA 3DBCA 4GG5A 1H1WA 2ZM3A 4QPSA 4O0UA 4UZHA 4BDEA 3CSVA 5EDQA 2OBJA 3MVJA 4EH8A 2BRBA 4F78A 2RG5A 3ACKA 3DZQA 3QD3A 1AD5A 1J1BA 3NUPA 4F64A 1WZYA 2ZV7A 1K9AA 5JGAA 3MH0A 4FIGA