5CF8A

Crystal structure of janus kinase 2 in complex with n,n-dicyclopropyl-10-ethyl-7-[(3-methoxypropyl)amino] -3-methyl-3,5,8,10-tetraazatricyclo[7.3.0.0,6] dodeca-1(9),2(6),4,7,11-pentaene-11-carboxamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
292
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of a Highly Selective JAK2 Inhibitor, BMS-911543, for the Treatment of Myeloproliferative Neoplasms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 285
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cf8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cf8A01
1FGKA 5DPVA 3ANQA 2YLFA 5M4IA 3W1FA 4G9CA 5I4NA 3ANRA 5AAGA 1G8SA 5E7RA 2Y6OA 2XNBA 3QCYA 5HNGA 4M0ZA 2ZOQA 4FKWA 4GK3A 4C4IA 5JFVA 5FG8A 1YI4A 1SMHA 3QQFA 3VUIA 4C2WA 2HW7A 4W4VA 3HZTA 3QA8A 3FI4A 1PMNA 3U55A 4EYJA 3DTWA 4GFOA 3OCTA 3VQUA 2PE0A 4R6VA 3VQHA 4JXFA 2BAJA 3HUCA 1A06A 3L8XA 3BHVA 3KULB 4PNIA 3WI6A 5CAOA 3OBJA 4FK3A 3KFAA 4H1MA 4HPTE 5JGAA 2ITWA 2IW8A 5GIOE 2PMNX 4OTQA 4QO9A 4Z55A 5BPYA 1H08A 1BI8A 4IX6A 2HZNA 3KVXA 4FV0A 2NNWB 3G2FA 3PY3A 4M97A 4JDHA 3RPVA 4FKJA 5HU3A 2OK1A 4F9YA 4TXCA 4FL2A 5CI7A 4E1ZA 1ZOEA 3FMMA 1DAWA 3U6HA 4PRJA 2WO6A 3TZMA 4AZTA 4PDYA 4I5CA 3QALE 4RJ4A 4QQ5A 3QTQA 3RJCA 2YM8A 3CKXA 3VAPA 2JKMA 2XVDA 4I6QA 3O50A 5LXMA 1SYKA 2UVXA 3Q4TA 4U45A 4ACHA 5EI2A 4ZY5A 4IX3A 3QCXA 4H1JA 1F0QA 3C0HA 4LOQA 4ZMEA 1CDKA 3EQBA 1TQPA 4KBAA 4EHVA 2E9VA 4EHZA 5CXZA 5DGZA 1SVEA 2C6IA 2W7XA 3OG7A 3DOGA 4YJNA 2QKWB 2H6DA 5J1VA 5EM6A 4JOAA 5K9IA 3FQHA 3V5JA 1Q8TA 2WOTA 4U42A 1R39A 4HCTA 4BZOA 4E4MA 3KREA 1J3HA 4WRGA 5ICPA 4EQMA 4TT7A 1PKDA 1AGWA 3UJGA 5M4UA 4D9UA 3POOA 3LCKA 3NIZA 4J95A 3ROCA 3MPAA 4Z7GA 3PFQA 3QRUA 4R5YA 4QPSA 5FWKK 4BWKA 4O83A 3BYVA 4X6RA 5EI6A 3ZO1A 4O91A 1H00A 3UBDA 3VUGA 4M3QA 3KN6A 2PHKA 4P7EA 3QUDA 2R7BA 3M2WA 4CV8A 3NCGA 4GYIA 4QMLA 4AA0A 4NM5A 1R0EA 4I0SA 2AUHA 4OTWA 2H96A 3Q32A 4LM5A 2QOKA 5T3QA 2CLQA 5BUIA 2YCSA 5D1JA 4BF2A 2I40A 4I93A 5BUJA 3E92A 3IS5A 2CCHA 3QAME 4RIXB 5F95A 3FMEA 4FKVA 1XQZA 5M06A 4TYIA 5ETFA 4G31A 2R3LA 4RIXA 2BHEA 2YM4A 3GGFA 3FKLA 3P79A 4NW6A 4D58A 4UZDA 3LFSA 5AR8A 4EZ3A 4O7SA 4L68A 2CLXA 2PVJA 4UXQA 5DVRA 4IJPA 2PK9A 5CAQA 1HCLA 3I60A 4YZNA 5C8MA 2VX0A 5LVNA 3F2AA 4LYNA 4MXZA 3KB7A 4U3YA 5DOSA 2H34A 4FKUA 2Z2WA 4IFGA 4BFMA 1Z57A 4O7RA 3RBWA 3HAMA 3HLLA 2QOBA 3MJ2A 4FKTA 1OL2A 2I0VA 4ANMA 4APCA 3QL8A 2KULA 3BIZA 4C0TA 4DH1A 2HENA 4YUQA 5AM6A 4NJDA 1JKKA 3ZBFA 4G6OA 2J0KA 2VTIA 1ZOGA 3BGZA 5HO8A 5JGBA 4BZNA 4HCUA 3OC1A 4OW8A 5EYMA 4Y95A 2VUWA 3W2OA 2EU9A 4WSQA 2UVYA 5C03A 4I5HA 3KK8A 3TN8A 4R7BA 3UO5A 3A62A 3LFNA 3N4TA 2OXDA 4BTFA 5HBJA 3GU8A 5I5ZA 3E62A 3DS6A 4CMTA 5AFVA 4BHNA 5DA3A 4CNHA 4HYHA 5I9VA 3S3IA 3IDBA 2DYLA 2R4BA 5GJDA 5HLPA 2HY81 5A4QA 1SNUA 3GU7A 1W82A 1ZY4A 3L8SA 4CXAA 3PJ3A 3NR9A 2ETMA 5CANA 3HGKA 4F4PA 2VWUA 4RVLA 4CFWA 4YNOA 4AUAA 4JIKA 2C3JA 2YERA 2Z7SA 5HX6A 5EKNA 2QCSA 2J90A 3IW4A 1U5QA 2X2MA 4FV7A 4L3PA 4F9WA 3SG9A 5AP4A 4QMQA 2Y4IB 3COKA 1OIRA 4EJNA 2W5HA 4YZMA 4NEUA 2BKKA 4JBQA 4R5SA 5E8TA 2GHMA 2NPQA 4LV8A 4M66A 4O6LA 4BN1A 1H1QA 3P7AA 5AAFA 1WBTA 4I3ZA 4DEDA 3C4ZA 4PMMA 2J2IB 4DN5A 4CG8A 2GMXA 4MXOA 4S31A 4R78A 2YAKA 4EOSA 5EQEA 4AA4A 5GIPE 2PVHA 3ORKA 1P2AA 3GC9A 2OIQA 1KUTA 2PU8A 3JPVA 3IONA 3OBGA 1PRYA 2PUNA 3F5UA 2X6EA 4USFA 3PXFA 4EL9A 4IZ7A 4WHZA 2PZPA 1LR4A 2W1HA 4DGLC 4L3JA 3E8EA 4EOIA 5A4LA 4XG6A 3V5LA 2F57A 2WHBA 3DBEA 2PPQA 2W5BA 4FZ6A 5JKGA 4YLLA 2GTMA 3AMAA 5EG3A 5GNKA 5IUGA 1L3RE 2ERZE 4YJPA 2HIWA 3D4QA 4YSJA 2W4KA 4JDIA 4ZAUA 5C01A 3WARA 3VF8A 4PY1A 3DV3A 2OSCA 5DT0A 3MFRA 1XWSA 2ZV9A 3TNQB 3ZUUA 4ARKA 3KRWA 3GCQA 3LIJA 3BU6A 3EFWA 4D2TA 2UW6A 4YTIA 5CENA 3RHKA 3V3VA 2GNHA 2ITPA 3A60A 4ACDA 4F0FA 3PVWA 4RIYB 2VWVA 2JDTA 1H1WA 2VX3A 4H39A 3ALNA 3ZUTA 2VV9A 3OP5A 4W8DA 1OI9A 3F3ZA 4RIYA 3BEGA 1JKSA 2W17A 2ZV8A 3HKOA 3PP0A 3QTZA 2QO9A 2W1FA 1Q24A 3PTGA 3DBQA 2WQBA 3ENHA 3QZFA 4L42A 4XOYA 4E5BA 5IZFA 4E5AX 4B0GA 2FUMA 4LRJA 4V04A 2C1BA 3PIYA 4MTAA 4F0GA 2X9FA 3RI1A 1WBOA 5K5XA 3UOJA 5E1SA 4CLJA 3E3BX 4FL1A 2JDSA 4J52A 1NVRA 5J5TA 1OIQA 4LUEA 4D4YA 4RJ6A 3KK9A 2QG7A 1DAYA 4FTOA 1OKZA 2PMLX 2PVRA 3KXGA 3RZBA 1P14A 5C1QB 4HYUA 3MESA 5AV0A 3A8WA 4FYOA 4OTIA 4IM3A 2YJRA 4NTSA 4UWBA 1IA8A 2PE2A 3UVRA 2VWYA 2GS7A 4YJRA 3D5XA 3HEGA 3AT2A 4FV8A 4JLCA 3TTJA 5AV3A 2XM9A 3HV6A 3H9RA 4H3QA 3UVPA 5AIKA 3LXPA 1FMOE 3EL7A 3VS5A 4Y85A 5IUHA 3MI9A 5AUTA 3CPCA 1KE6A 5HE3A 3RPOA 3GENA 3HRBA 5FBNC 4O1OA 3EZRA 3HMOA 5BMSA 2YCQA 4EWHA 2PWLA 1JSVA 4AGCA 4O27B 1IAJA 1YKRA 3VUKA 4HZSA 3PSDA 3I6UA 1BI7A 4FG7A 3TEIA 4CFFA 3E64A 5CZHA 5AJQA 4BWXA 5BVDA 5FUTA 4U44A 2G2IA 3JXWA 3FMDA 2OGVA 1YOMA 4B7TA 2V22A 3TNPC 3MA3A 4NM0A 4H05A 4OTHA 2X2LA 5M4FA 2C5XA 2A1AB 1G3NA 2QQ7A 1XHAA 3NNUA 1L8TA 3W16A 5BYZA 4JG7A 5HNIX 4C4EA 4G34A 2IG7A 2WQMA 4IAKA 5F1ZA 4IVDA 2YIYA 3T3UA 3HP2A 1YXXA 2I0HA 5CF5A 3NUSA 1Q62A 1IEPA 3C4FA 3DK7A 3F5PA 3BYMA 3FZOA 3GT8A 3QTSA 4FTMA 3ROYA 3HRFA 2IVTA 2BHHA 2WXVA 4I6HA 5LVPA 4BGGA 2XYNA 5K4JA 3OHTA 5ANOA 3TWJA 4YJUA 3A7HA 2XNGA 4G5PA 4TWNA 2J4ZA 2XA4A 2YWVA 4R3PA 3HMIA 2VO3A 3W2SA 4AT5A 3UQFA 5HE2A 4XNEA 5A4EA 3CP9A 2R3NA 2X6DA 3I5NA 4L53A 1YWVA 3S1HA 3EKKA 4EH3A 2R3PA 4EK4A 4O0UA 4RBLA 5BYYA 3FDNA 1PXOA 3GVUA 3C4EA 5KO1A 2J0MB 5DFPA 3RWQA 3WZEA 2Z7RA 1VYZA 2ONLC 2W1CA 4AW5A 2BVAA 3A8XA 4KSQA 3QQUA 4O7LA 3VW8A 4IAAA 3DKFA 2ZM3A 3DK6A 4BBFA 3OEZA 3N9XA 5DBXA 2EWAA 2WMVA 4BVUA 4EBWA 2HXLA 1H0WA 2YM3A 5IA2A 2WMTA 3VN9A 5EM8A 3OT8A 1R0PA 4IB3A 3MVJA 3BHUA 5CWZA 3KMWA 3TI1A 2W1DA 4YMJA 5HEZA 2VTRA 3UG2A 3PSCA 2PVFA 4FT0A 1OZ1A 2JFMA 3DJ7A 3KRLA 4JT3A 4ZJIA 2C30A 5CS6A 3GUBA 3V8SA 4RQVA 2NO3A 2OJJA 2WMQA 2WQOA 3CGOA 3OD6X 3FZRA 3NNXA 4MWIA 5IEYA 5A3XA 3ATTA 4O0RA 1W0XC 5IISA 2BFYA 3PE1A 2VTAA 3CTHA 3GP0A 3CD8A 3QYZA 1PYEA 4NM3A 1GIIA 3PSBA 4DEAA 4CG9A 3LPBA 3VNTA 1PXIA 3R7GA 4ERWA 1YXSA 4N4SA 2FO0A 2BRHA 1E1VA 4FIGA 3RAIA 2OW3A 3JVRA 3A7GA 4G3FA 4IQ6A 5CQWA 5HNBA 2CNUA 4AGWA 3KXNA 3TDVA 4DE4A 4GEOA 1UKHA 1WFCA 4EK8A 2VAGA 5DR6A 5K4IA 4AW0A 3DXPA 2BTSA 4YTHA 3WZJA 4AA5A 4DTBA 5ANJA 4H36A 3WZUA 3H0YA 5FP5A 4BCMA 2BIKB 3QYWA 5CVGA 4XCUA 1M14A 3GCVA 5FBOA 2YM7A 4YGAA 3R1SA 1YDSE 2FSTX 2GQGA 2B52A 2XCKA 3FYKX 3MIYA 3R9HA 3WE4A 4HVGA 5B7VA 2UZLA 4CGAA 4DGNA 3PLAE 4M15A 5CNNA 2EXMA 3TL8A 4C35A 3PVGA 3RWPA 3LCDA 1V0PA 2SRCA 4AW1A 3P7CA 5IA3A 4NW5A 3DFAA 1OPJA 2V0DA 2ITYA 4XHKB 3ZBXA 4U0IA 2ZAZA 4BC6A 2XEYA 3PXZA 5J5SA 3QU0A 1M17A 3Q5ZA 2R3KA 1V0OA 2YM5A 3SXFA 4BL1A 3NVKI 4FTRA 2RFEA 3FMJA 5JRQA 2J0JA 2OZAB 3L9MA 2OZAA 1WBWA 1UU7A 1OL7A 3O23A 5CU4A 4UXLA 3QCSA 4RVMA 2WTKB 5AMNA 3L9LA 5HIBA 4QMZA 4DITA 5AP3A 3GEQA 3AXWA 3FI2A 4IH8A 2PSQA 3QQLA 1Q5KA 3RTPA 5TT7A 3CE3A 4Y73A 5IH4A 5CXHA 4EH8A 4K33A 3AC1A 1UWJA 3EMGA 4DLJA 4RC3A 2W06A 4XG2A 4G16A 2XEZA 3U54A 4X6QC 3BYSA 4IWQA 3ZONA 5JGDA 4GYGA 3VUDA 3KKVA 4J8MA 3SXSA 4UEUA 2IZSA 4FT5A 4WNOA 4CVAA 4Q9ZA 1J1CA 3IOKA 3AD6A 4NJ3A 4QRCA 4AE9A 2VTJA 2XNPA 4YP8A 2JDVA 3E8NA 3F88A 4FT7A 4IAYA 4L6QA 4M84A 4MXYA 4IX4A 2VTPA 3ZC5A 3LCSA 4XV2A 4EH5A 4BTKA 5HLWA 4O81A 1PXLA 4RG0A 4EH6A 4JBOA 3QC9A 4ACCA 4C3PA 4AOIA 2R3MA 3O7LD 2PZIA 5HQ0A 4QYFA 3UC4A 4WNPA 4ORKA 3FEGA 3REPA 4R1VA 5HG5A 3GQIA 3G6HA 4WA9A 1GY3A 2YACA 4RLKA 3QX4A 3QC4A 4QMTA 4TZRA 4L45A 2ITQA 4BHZA 4D2PA 3IKAA 4PL3A 3Q6WA 3NUNA 2F7ZE 4Q5HA 4V0GB 2HK5A 3OCGA 5C26A 5M08A 1SM2A 2YFXA 1E9HA 3C4CA 2QURA 2VX1A 5ANKA 3BE2A 1KE9A 4UV0A 1Z5MA 5HD4A 2W96B 3COHA 1K3AA 1KV1A 2WMWA 3VC4A 4I21A 4AX8A 2B9HA 1BL6A 3R63A 4O0WA 2V55A 4AZFA 3ZLWA 2XNOA 4OBPA 3WYXA 2OICA 4IC8A 4N57A 1H24A 4PL4A 3CY3A 3O2MA 2OF2A 4I24A 1J91A 2ITVA 3PZHA 3CLYA 5I9ZA 4L00A 3EKNA 4QQTA 1WBVA 3HECA 5BYLA 4H3PA 2WMXA 3O8TA 1UVRA 1SNXA 2X7GA 3HP5A 2C6KA 3EQPA 5CT0A 2Y8OA 3R0TA 4A9SA 4E4NA 4MD7E 1REKA 2O2UA 2QO2A 4F7LA 4F70A 5IEVA 3MTLA 3PVUA 3CJFA 4IVAA 4UMQA 3RAHA 3WF9A 4C61A 4FTUA 2YIRA 3P7BA 4J8NA 2LAVA 5HD7A 3TT0A 4X2KA 5KMJA 2WIHA 2VRXA 4YLKA 4ASXA 4YJSA 4FSRA 4HW7A 5BX0A 4MCVA 2YZAA 3BWJA 3QHRA 2ITOA 4NCTC 3HMPA 3UE4A 2YZLA 3UMXA 2EB3A 4IB5A 5D10A 4XP3A 4W4YA 1ZZ2A 5L2WA 2BIYA 5IA5A 1OKVA 3FMLA 4KRDA 4ALVA 3H0ZA 5I9YA 1ZYDA 4FZFB 4RWLA 5AP2A 1U54A 3TCPA 1FMKA 5FDPA 3O71A 4BDGA 2X4ZA 2CGWA 2RSVA 4I23A 3TJCA 4EZ5A 2G2HA 4FG8A 3FMNA 3S4QA 3MA6A 3JR1A 2XNMA 3RAWA 1V0BA 3QQHA 4R8QA 2H8HA 4BBEA 5A6NA 2QC6A 1ZLTA 3HMNA 4LRMA 3R7YA 5B0XA 1Q8YA 2CGVA 1NT2A 2BALA 4CTBA 2QOOA 4ZLZA 4E93A 4V05A 3D94A 3FZ1A 3LCOA 4FSUA 4Y5QA 4YJOA 5KX8A 4TWCA 4RZWA 3FSKA 4FOBA 4PMSA 5HIDA 2QOIA 2ZV7A 4YJQA 4MBJA 4ZSLA 4ZP5A 3I81A 4DFYA 2CMWA 5EYCA 4DINA 1WVWA 4IACA 5IQBA 3R02A 4FSTA 5C4KA 1URCA 3I0OA 2JKKA 5L2IA 4K0YA 3LJ1A 3ULZA 3Q9XA 3QHWA 4GT3A 3UO4A 4BI1A 2VU3A 2B9IA 2XS0A 3FQSA 2FA2A 4NK9A 4BCQA 3FLNC 2F2CB 3FE3A 4DG0E 4GVJA 5HGIA 1TQMA 3QF9A 2QOCA 1F5QA 5FDXA 3JS2A 1B39A 2ACXA 3CEKA 3NEWA 4D5HA 2BAQA 4OR5A 4BDBA 3ZXTA 3O0GA 4DBXA 3QWJA 2PZYA 3SOCA 3PP1A 4A7CA 4BI2A 1B38A 5JSMA 4NCTA 4FF8A 4QNAA 4YO4A 4K77A 3TUBA 3ZFYA 1VR2A 4G6LA 4D1XA 5IF1A 3PY0A 4LFIA 3SAYA 3WILA 2J6MA 3MN3A 3VVHA 2XF0A 3ERKA 4O0XA 2P3GX 3DAEA 4D9TA 1V1KA 4NH1A 5DNRA 4O1PA 3UO6A 3SX9A 1Q99A 3NWWA 4DEEA 5BQ0A 3QTWA 3ELJA 5CLPA 2RFNA 3SGCA 3OXTA 4YNEA 5M56A 2RGPA 5IQAA 4LG4A 1ZWSA 3UG1A 3E8DA 2XK6A 2ETKA 3C7QA 4KRCA 4WG4A 4OTFA 5EKOA 4GKHA 4GFGA 2XJ2A 5KMNA 2XK4A 4Z7HA 2JITA 5GINE 1KOAA 2BCJA 5AEPA 4QMYA 1R3CA 2GNGA 4A9UA 5HESA 1PXNA 4BGQA 3OT3A 3KA0A 1OKYA 3R01A 3W55A 1RDQE 4RWKA 4EZ7A 3ORLA 4BCJA 5CF8A 1CKJA 3M11A 4ZK5A 1FBNA 2JDRA 4ZS0A 4ZTMA 3PXYA 3C4WA 3PJ2A 5CEIA 2JD5A 3BQCA 1GIJA 2ERKA 3D7ZA 1SZMA 4RGJA 5EW3A 3ORZA 5AA9A 2O65A 3ZM4A 3G5DA 4BCKA 5ITAA 2ZJWA 2PMIA 1ATPE 3RHXA 3UVQA 3VO3A 1H4LA 4XUFA 4A07A 4E5WA 5IQIA 3QLGA 4IDTA 4P5QA 5LWNA 1STCE 2Y0AA 2XCHA 4YC8A 4DAWA 2XM8A 4DG2E 3I6WA 3QUPA 4FTIA 4IFCA 1LP4A 3CD3A 4YBJA 4R3CA 4E26A 3AT4A 2HZ0A 3KULA 5L6WL 2WTJA 3Q9WA 4MBLA 3OZ6A 4KKHA 3R9DA 1KOBA 4JAIA 4APPA 4TNDA 3FXZA 4XS2A 4BKJA 4QTCA 5CU0A 4L9IA 2VO0A 4Y72A 3SHEA 4TRLA 3FMHA 2JIVA 3LFCA 4IE9A 2XKDA 4JAJA 2B9FA 5HG9A 3IW5A 1OMWA 4FG9A 2QOQA 3KMMA 1BLXA 2E9UA 4BDCA 3A7FA 3SXRA 4Z3VA 3ZSIA 4FSZA 2ETRA 5DEYA 5CEOA 2BILB 3PUPA 4RIWB 2I0EA 2WTCA 1KWPA 3PXQA 4X3FB 5DLSA 5H3QA 3W8LA 3ZU7A 3TZ7A 4CFVA 1XR1A 2BRMA 3ORIA 4KUJA 3O17A 5CY3A 2HXQA 4GFMA 2VTTA 2C5YA 2QR7A 4RA4A 3O8UA 4EBVA 3DB6A 3WF6A 4FEQA 4IW0A 2B53A 3EYGA 2C5VA 4NT4A 4DFLA 3QQKA 3RALA 5IUIA 4RJ3A 3P08A 3ORXA 5C8KA 2R0IA 4M7IA 3RCJA 3VWAA 5FM3A 4C57A 4C4FA 2HY0A 5HE0A 4GG7A 5EHYA 5AR7A 2PZ5A 2Q0NA 3F7WA 4BGHA 3LHJA 5DMZA 5M44A 2VWXA 1BL7A 4OT6A 3AC8A 3HNGA 5I9UA 3VULA 4WIHA 3ORTA 2J9MA 5KKRB 3V6RA 2QONA 3OW3A 5DR9A 4B99A 4RT7A 2VTLA 4ITHA 3P5KA 3RP9A 4CZTA 3NNVA 2P0CA 4MWHA 2CNQA 2HZ4A 3AQVA 2PTKA 4FE2A 2Y4IC 4BICA 3DLSA 2WGJA 3ZCLA 4C2VA 1YXUA 3NRMA 3U87A 4PMPA 3DA6A 2KTYA 2Y6MA 4GK2A 5LMAA 2F7EE 4QP4A 4FV3A 5AUZA 1BX6A 1O6YA 5DYJA 3S2PA 1XBBA 4G3CA 4ENYA 2I6LA 4FTTA 4O21A 4LRKA 1XBCA 2WEIA 4F1TA 4DF3A 4DFXE 3SRVB 5JFXA 5CNOA 4OBQA 3FJQE 4FBXA 3KGAA 3TUDA 2P55A 2YDKA 3S0OA 2BROA 3R1YA 4HGSA 3K3JA 2W9FB 4BYJA 4C62A 1YQJA 4IAIA 3ZZEA 5CEMA 3AD5A 2JGZA 2XK9A 1G8AA 4RVTA 1T46A 4O7ZA 3QA0A 3UZPA 4J98A 3PPKA 2YIWA 2XRUA 3FXWA 1YHSA 3D2KA 2JIIA 3ZS5A 4MXCA 3TG1A 4DEBA 4F09A 2OXYA 1YOJA 4QMSA 5G1XA 4AXAA 2F4JA 3HX4A 4FOCA 4JQEA 3UNKA 4GG5A 3G0FA 4QPMA 3G9LX 4AGDA 4E7WA 2V7OA 4M12A 5M09A 1OL6A 4I5PA 4JBPA 5AR3A 1ZOHA 4EK6A 4PTCA 4S2ZA 4JBVA 1U59A 4A9YA 4XG3A 4HOKA 3JYAA 5HBEA 3D9VA 4FYNA 5LCKA 3WOWA 1WBPA 3BE9A 3VBYA 3CQWA 4CTCA 4XV9A 5M57A 1U4DA 4WO5A 4EQCA 3K5UA 4O7VA 3QWKA 3I1AA 4GUBA 1PW2A 4IWDA 3QKMA 1QMZA 1MQ4A 3SA0A 2ESMA 5FTOA 4E6QA 4OTPA 2YABA 4BDHA 5IMEA 4FNZA 3DDQA 3FI3A 2B55A 5EYDA 3HV5A 4NKAA 4RQKA 2CKQA 1JPAA 2OWBA 4RMZA 2OKRA 2C0IA 4J96A 1CKIA 5HO7A 1FGIA 2GS2A 4IANA 4WNKA 3K2LA 1ERKA 2C47A 3BZ3A 4EOLA 3I0QA 4J99A 4MXAA 3I4BA 3AT3A 3MFSA 3R2BA 4KAOA 3R7IA 4AN2A 2NP8A 4TL0A 1YWNA 3BLQA 3NAXA 3OTVA 4PV0A 3WIKA 1JSTA 4TKSA 2QD9A 5J7HA 2Q83A 3KN5A 3LZBA 2CN5A 3BI6A 2PVNA 3DJ6A 4YHJA 4GH2A 1JVPP 3D5VA 4BBMA 3ZZWA 3DU8A 2W0JA 2GFSA 3KRRA 3PA4A 4CYIA 4F9AA 2ITXA 4O82A 5CAVA 1M2QA 4H3BA 5I9XA 3NSZA 3NAYA 3TNHA 4HPUE 2BPMA 5KBRA 3GU6A 3VS0A 1RJBA 4LGHA 4YBKA 3TKIA 3VS1A 3QQJA 4XBRA 3GFEA 3II5A 2IVVA 5AUVA 5AUXA 3RM6A 4ITIA 4JR7A 4DCEA 2F7XE 2RG5A 3ZH8A 2Z60A 4QMWA 4S30A 1OBGA 3C13A 4O22A 4QYEA 4J7BA 4BDIA 1ND4A 3ZDIA 2OXXA 2QNJA 4HVHA 2ZDUA 4C4GA 3U9NA 2Z7QA 4JI9A 4MAOA 4N70A 4KBCA 5IH5A 3KF4A 1H28A 4CZUA 3R1NA 1ZZLA 4N0SA 4FSYA 4BYIA 4F99A 3DNDA 3DNEA 1NY3A 3MH0A 3V8TA 4JR3A 2UW3A 4DGMA 4U80A 1Y6BA 4KIPA 5A9UA 5CVHA 1QPEA 2ITUA 3P86A 5DN3A 5KNJA 4RC4A 3KVWA 4USEA 4DT8A 4GMYA 2UZVA 4HNIA 3P78A 4YSMA 5HKMA 4EK5A 4CKIA 4R1YA 2VTMA 2C1AA 3DZQA 5FD2A 5HG8A 2EUFB 4EH9A 1H26A 5DT4A 4UX9A 3IECA 2QI8A 2UW5A 4XG9A 4UMUA 3IDPA 4RRVA 4WUNA 5L3AA 4AOJA 5D7VA 3SC1A 4F6WA 5DH3A 4EKLA 4ALUA 3NS9A 2IZRA 3QZGA 2WELA 3H9FA 4ANNA 4W4XA 1PMUA 4IB0A 5FRIA 3MH2A 5DG5A 2ZB1A 4YLJA 4AFJA 3ENMA 5CEKA 3QGYA 2QHMA 5EK7A 4M13A 1KV2A 2X8DA 4AOTA 2A19B 3HDNA 2UVZA 5JK3A 3Q60A 4BY9E 3JY9A 5DI1A 5EI8A 3LFAA 4MEDA 5FXSA 5M07A 3SG8A 3R7UA 3Q53A 5AP6A 5IU2A 2RFSA 3DJ5A 4FUYA 3BWFA 4F6SA 1RE8A 4XG7A 5KHWA 3H9OA 4CFMA 5J1WA 4FSWA 4FZDB 3IO7A 3OROA 3EB0A 5H8GA 2A2AA 3ODYX 5AV1A 4EYMA 4XJ0A 2JC6A 4L46A 3AC2A 3DDPA 4ANOA 3QCQA 3EHAA 3PZEA 1HOWA 4P2KA 4DFUA 3C51A 5EDPA 1F3MC 2YM6A 5GHVA 4L7FA 3BGPA 4YZCA 5D9HA 3TV6A 2QVSE 3RK7A 3E3PA 4U3ZA 4D28A 2CKEA 2J50A 4QMVA 2UW9A 4ANLA 3DBCA 2FVDA 1YHWA 2XUUA 1MRVA 4O6EA 4ZSEA 3ZSHA 3LFEA 3D7TB 2WNTA 1UA2A 2OLCA 4X7QA 4LOOA 2RFDA 3HV3A 1BYGA 1MP8A 3QD4A 2YIXA 4DH8A 1MRUA 4YTFA 4QP7A 3OXZA 3NGAA 4A4XA 2YCFA 4NUSA 3COIA 2IJMA 3FSFA 5CI6A 4HCVA 5I0BA 2ZV2A 3Q3BA 4BCGA 5JQ5A 3TKUA 4CT1A 1ZXEA 3R83A 1LPUA 3ZO2A 1WVXA 2G2FA 4GS6A 3RNIA 2PY3A 1MQBA 4CT2A 4E6CA 5CAPA 4NL0A 2OZOA 4I4EA 2VGOA 3F3WA 1PXPA 3EN9A 4I1ZA 4DLIA 2XYUA 2EVAA 2UZUE 3H10A 2UZBA 4LUDA 5AV4A 4UYAA 3CY2A 2WMSA 4X2GA 3BBTB 4M69B 2ITZA 2UZDA 4NIFB 3BX5A 3I7CA 2V5QA 4GU6A 4M69A 4IX5A 3RAKA 4TW9A 2OU7A 3NUYA 2XKCA 2X7OA 3EIDA 2WTKC 3OXIA 4D0WA 1W83A 2ZM1A 4ZTHA 5C27A 4YHFA 3WZKA 4IZ5A 4QP2A 1WZYA 2BZIB 3MIAA 2QR8A 5AUUA 2IN6A 4EH4A 3KCKA 3MPMA 3D83A 1YDRE 4X2JA 2OIDA 4M67A 2C6DA 4FEVA 5JEBA 2BDJA 4O7NA 4JS8A 3ZTXA 3W2RA 3F6XA 4FA2A 4QTDA 3PIXA 4AACA 2H9VA 3FQEA 4PL5A 3UYTA 1H1SA 2WZJA 4FV1A 3UP7A 3PWYA 4O2PA 4F63A 3DKCA 3VBWA 4F7SA 1PXMA 3R1QA 4EHEA 3V8WA 3D0EA 2REIA 4RIOA 3UYSA 1BKXA 2X1NA 5FEEA 4MD8E 4I20A 3RZFA 4BDEA 3RPSA 4QYYA 5J87A 5JH6A 4AN3A 1UU8A 3L8VA 4E6DA 3VS3A 4II5A 1YDTE 1RW8A 3Q4UA 4DEHA 1WBNA 3R9NA 1TQIA 5B2KA 1UV5A 3FLQA 3JUHA 3NYVA 4FKLA 3A61A 2PUPA 4FV5A 2IO6A 3FY0A 2HWOA 3OEFX 5D7AA 4EK3A 5TF9A 3C5IA 3CXWA 2Y4PA 4JJRA 2HZIA 4S32A 2UW4A 4OLIA 4EOOA 2R5TA 1UWHA 2C5NA 2WU6A 4GJ2A 5HOAA 5TO8A 3AC4A 2QU5A 4JG6A 1X8BA 2B7AA 4CQGA 2YLEA 3OW4A 3QLFA 3ITZA 4RC2A 3V01A 4DH3A 2E9NA 2C3LA 4ZZMA 4DA5A 1XJDA 3POZA 3VF9A 2VO7A 3LMGA 2Q0BA 3H30A 3T3VA 4B8LA 2UW0A 4Q9SA 3ZEPA 3P23A 2QOHA 2CHLA 3BPRA 1JKLA 2F2UA 1UNGA 3RM7A 2RIOA 4TYGA 3KRJA 3BHTA 4XH6A 1BUHA 3KL8A 4ZZNA 1OGUA 2VNYA 5AX3A 5IA4A 2GSFA 3DXNA 3R8VA 5IQFA 5AM7A 3ET7A 3NIEA 2O0UA 4QMOA 2OJ9A 3E63A 2O5KA 5FQDC 4IMYA 2FYSA 1GAGA 1AD5A 3QD3A 3H4JA 5EW9A 3EQDA 4BZDA 4EQUA 5E4HA 4AU8A 1ZY5A 4CRSA 1OM1A 2CJMA 1GIHA 2UW7A 4IVBA 4UMRA 4FIFA 4O0TA 4D0XA 3QUEA 5BVFA 4FV6A 3MVHA 3R73A 2R2PA 3D2IA 4X2FA 3Q52A 1FVVA 3CQEA 1GZ8A 3IQ7A 4IZYA 4D4RA 3DLZA 5L6PA 2J51A 4USDA 3O96A 4A9TA 5JMSA 3HV7A 4UBAA 5BUEA 3TUCA 1P4FA 2IZTA 3W8QA 4IWOA 4ZTSA 5KMIA 4MNEB 1WMKA 3GB2A 5M53A 4HGLA 4EWQA 4FKSA 2JDOA 3VUHA 4XP2A 3A7IA 1U5RA 4ZZOA 4I94A 1Y6AA 4I22A 2C3KA 4BIBA 5JZJA 5ETIA 5DEWA 3FHRA 4MNFA 5J95A 2VD5A 1CKPA 2W9ZB 3CTJA 3GNIB 3LFQA 4L8MA 4I4FA 1PKGA 3UZTA 2R3JA 2FB8A 4YU2A 3ODZX 5CSVA 4D55A 2ZYBA 5J7BA 4WOVA 3PWDA 2IVUA 5IQDA 3NVMB 3TKHA 2UV2A 4ZY4A 4V0GA 1OVEA 3UDBA 2X2KA 4NYEA 3A2CA 5EQPA 3NYOA 4OTDA 4ASEA 3LE6A 1P5EA 3LXNA 3W10A 4LMUA 3CKWA 4FV2A 4OAUC 4EOMA 5IDNA 2FSOX 3FLSA 2G01A 3QRTA 4HNFA 4FKIA 3QGWA 2XK7A 4U9AA 2GNFA 3PE2A 3BYOA 4PDSA 4JDKA 4KKGA 4ERKA 5E8ZA 2VWWA 3QXPA 3VJNA 5HVKA 3ETAA 3F82A 5HVJA 5I3OA 3MS9A 1MUOA 1ZRZA 1QPDA 4TYJA 5A4CA 2P2IA 4FEWA 4W8EA 2VTOA 4KWPA 4RA5A 5F4NA 4AAAA 4D2RA 4TN6A 3V5PA 5LCJA 2ITNA 4Q2AA 4QTEA 5JN2A 3LMHA 3BHHA 3NYXA 4MXXA 1JOWB 5E90A 4PQNA 4YURA 5F9EA 3E8CA 4PTEA 3LQ3A 2OFUA 5AP7A 2YISA 3EN7A 4U81A 4RLLA 3TZ9A 4HYIA 4I6FA 4F6UA 5J9ZA 1J7UA 3R04A 4YO6A 2C0OA 4TWPA 3FUPA 3U51A 5AADA 5FXQA 5H8BA 5HVYA 2R7IA 2W99B 1OKWA 4C02A 2B0QA 3GC7A 3R9RA 3D14A 2O8YA 4ZTRA 2OBJA 3TV4A 2OFVA 3O51A 2J5EA 3RNYA 3W18A 2CCIA 4GVAA 4HVSA 4FL3A 2OJIA 3CSVA 4FSQA 3G33A 4XLVA 3LKMA 4R77A 4ZEGA 4OT5A 2E2BA 4W9XA 2FGIA 5EHOA 1LEWA 4XEYA 2WD1A 3R8MA 3OY1A 5CQUA 4UY9A 3VS4A 5CASA 2QU6A 3QTXA 3HUBA 3SVVA 3U9CA 4R3RA 2R9SA 4PPCA 4AG8A 4EH7A 1ZMVA 4PTGA 5ETCA 5ACBC 3P9JA 3ZO3A 3C50A 5TKDA 3ZDUA 3S00A 4RFYA 1OITA 1YI6A 5KMLA 5AR4A 1UKIA 2C4GA 3GU4A 3QQGA 3VRYA 5IA0A 4NWMA 3Q6UA 4F08A 3RMFA 2W1GA 4R7IA 3E87A 3G90X 1J7LA 2YDJA 3DCVA 3KXXA 4UYNA 4BCPA 1PMVA 4M68A 1Y8GA 2HYYA 4C3FA 2XJ0A 3DZOA 3FAAA 2P4IA 3GFWA 3KRXA 3QX2A 4LL0A 3RGFA 1O9UA 3DKOA 4EKKA 4FTNA 4XBUA 2R3GA 1GZKA 3FL4A 2XZSA 2J0IA 1H1PA 3PXKA 3U4WA 3ZSGA 4QTBA 3ULIA 3R22A 3BV2A 4ZOGA 4MQ1A 3L9NA 2XJ1A 3CBLA 4FVRA 5ANIA 3R8PA 3TV7A 4FEXA 1JLUE 3IDCA 4BDDA 4HZRA 3KCFA 5H8EA 5L2SA 4Y8DA 3VHKA 2J7TA 4BCFA 5I9WA 1OUYA 2B4SB 3LW0A 4YC6A 3DQXA 5CX9A 4IDVA 4C3RA 1R1WA 2PVMA 3FYJX 3QRIA 1NVQA 3DY7A 4X2NA 1XH8A 4RX8A 5JZNA 2BAKA 2UZNA 2X4FA 4JIAA 3UQGA 3VS6A 4EUTA 4WBOA 1JNKA 3ZC6A 3COMA 1XH7A 3ACJA 3CTQA 2VTNA 1DI8A 3A7JA 3GXLA 3NZ0A 4FICA 4FTQA 4JRVA 4ZTNA 3RPYA 2GCDA 4BCNA 4YTCA 2F9GA 2JBPA 4QP3A 3IGGA 4AFEA 2JBOA 4D1ZA 1GZOA 2YWPA 4QP6A 5LMKC 4JVGA 1M7QA 4BKZA 4QQCA 3ID6C 4I6BA 5HG7A 5J79A 2BMCA 3SKCA 2YEXA 4A9RA 1XO2B 2JIUA 3Q4CA 4NSTA 1M7NA 3IW7A 3PA5A 4DG3E 4UMPA 4EONA 3TDWA 4QP8A 4FT9A 4GSBA 3UOKA 4G3EA 4D2VA 3DGKA 4FIHA 3FMKA 4GRBA 4CD0A 5A6OA 5LVOA 4C58A 4ZLOA 2PVYA 4CEGA 5BVWA 4LQMA 5CU2A 4J97A 3R7VA 3Q04A 3PPZA 1U46A 4QP1A 5CU6A 5E8SA 5AWMA 4WSYA 1ZYLA 3RK9A 5D12A 3QD2B 1CMKE 5GZ9A 5CTPA 4K9YA 5K5NA 3E5AA 4IM0A 2QLUA 2I0YA 2XNNA 5EDQA 4EH2A 3MBLA 3VRZA 5IKWA 2XBAA 3ORMA 4FKGA 3NW7A 2XMYA 3IGOA 4XOZA 5CSWA 4FV9A 5IDPA 3KF7A 1DM2A 4DHFA 3CR0A 1A9UA 1OECA 5BMMA 1NVSA 3EQFA 3F3VA 3SV0A 4ZTLA 4TNBA 3N51A 3PG3A 2A4LA 2FSMX 4KABA 4K11A 4PNKA 4E4LA 3EJ1A 1KSWA 4W9WA 1A48A 4MF0A 5HHWA 3CC6A 5AX9A 2CGUA 4KB8A 4YHTA 2XRWA 3OWKA 3TTIA 4K2RA 4D4SA 3KQ7A 3K3IA 4ZSAA 3F7ZA 4EOPA 4CMOA 3U6JA 1K9AA 1REJA 1DI9A 4WG5A 3D5WA 2O3PA 4CCBA 3DTCA 3OUKA 4DH5A 3BU5A 4YZ9A 5GZAA 4D2WA 3EOCA 3VBTA 5CEPA 4O0SA 4OTGA 5LMKA 4RIWA 5KZIA 4X3FA 3OY3A 4ASDA 4G9RA 2RKUA 4ENXA 3S95A 5B2LA 5DRDA 2HELA 4L67A 4GT5A 4FI1A 4BRXA 3OMVA 4OTRA 3UPZA 5LMBA 3MY5A 4N6ZA 4QQJA 1PF8A 3U6IA 1QPCA 1Y91A 3M1SA 2B1PA 1KE7A 4CYJA 3Q96A 2JLDA 2Y7JA 2YN8A 5J9YA 3E7VA 4G2FA 5IEXA 5KCVA 5KMMA 4DC2A 2GFCA 5HZNA 2WMAA 2O64A 4U41A 4GT4A 5KHXA 2IPXA 4H58A 4E73A 4B8MA 3F69A 2FSLX 3OVVA 4FTKA 3TNWA 4XP0A 3QRKA 3BRBA 1ZAOA 1XH5A 1AQ1A 4FNXA 1EH4A 4WG3A 4ANBA 4AP7A 5L8KA 1NW1A 3MB7A 4F65A 2VZ6A 4MHAA 4U7ZA 3MJ1A 2X9EA 1QPJA 4Y83A 3VS2A 4F64A 2ITTA 4BKYA 4DTAA 4EOQA 4EOJA 5FM2A 3G51A 5FTGA 4AT3A 2R3RA 3BBWA 2G15A 2OIBA 1ZYJA 4M8TA 2R64A 2WMUA 3V6SA 4DFZE 3P1AA 5EDRA 5AA8A 2QO7A 2G1TA 3ZHPC 4A06A 4X3JA 5L6OA 3A4OX 2GHGA 3AGLA 3L9PA 4FKOA 1Q3WA 4QMPA 3DT1A 4FZ7A 1W7HA 2BRBA 3EQIA 2XP2A 4DH7A 2PVLA 5ANGA 3CCNA 3OS3A 4BDKA 5IQCA 4FTLA 5IQEA 1JWHA 2XKEA 3FLZA 2DS1A 2W1ZA 3GCUA 4O2ZA 5K0XA 2YIQA 1ZMWA 4ZIMA 3F5GA 4I0RA 1PY5A 5EM5A 2NRUA 3NCZA 3R7EA 3FL5A 4O0YA 3K54A 4XYFA 4PP9A 2R3QA 5ACKA 3SRVA 2XK3A 4W4WA 3B8QA 1QL6A 4ANSA 2UZWE 4FIJA 2NRYA 4XV3A 4RX7A 4U43A 3KXHA 3O8PA 4IBMA 4D4VA 4BIEA 5M51A 4QP9A 3BCEA 4ID7A 3RINA 3LLTA 4CKRA 3VUTA 3UODA 5FLFA 1GOLA 5IQGA 4PDPA 1W8CA 1PMEA 2RF9A 3B2TA 4IVCA 3NLBA 4FTJA 5E1EA 3R7OA 4BI0A 4FKRA 1ZMUA 2C6LA 3QTUA 3W2CA 3FHIA 5FEDA 1GJOA 5EM7A 1IASA 2YITA 3T9TA 3ZFMA 3P4KA 4A4LA 4UMTA 3MSSA 4P4CA 4QMXA 4RFMA 4AZEA 2V62A 5E9EA 2R3IA 1LUFA 1VYWA 2O63A 4F1MA 2VN9A 5AUWA 3UMWA 2C6TA 1YHVA 4MKCA 1H27A 3ZFXA 1B6CB 4BCIA 3DXQA 5K0KA 1JQHA 2IW6A 5HTBA 5M4CA 4J1RA 2P33A 5DHJA 5HE1A 5C9CA 4HYSA 3SD0A 1O6KA 3N4UA 3HL7A 1DS5A 5CF4A 4I0TA 4RPVA 4TYHB 2OI4X 3C9WA 2HW6A 4FKQA 2XK8A 4RVKA 4YJTA 2WMRA 2VO6A 3R71A 4MBIA 3FC2A 4TYHA 5I3RA 4G17A 5HU9A 3B8RA 3PLSA 4L3LA 3VIDA 3BELA 3ZXZA 2HAKA 4KD1A 4XG4A 4YR8A 5CVFA 2WTIA 5L8LA 4FK6A 4IB1A 4ASZA 2VGPA 1PYXA 2RG6A 2E9OA 4WUAA 4NTTA 2C68A 4XRLA 4FIEA 4O96A 1OPLA 2QKRA 4HGEA 4C4JA 3CPBA 3KXMA 3LFBA 3AMBA 4NU1A 4KIOA 3WF7A 1M2PA 4QMMA 4A4OA 4YPSA 2WTVA 3FC1X 5AP5A 3NYNA 3TJDA 3GCSA 5HX8A 4BB4A 2Z02A 5HTIA 2YJSA 5CALA 3HV4A 1VJYA 4K6ZA 4BR3A 4Y46A 2ZM4A 2XIXA 3R6XA 4AQCA 2GDOA 3L1SA 3O7LB 3TNIA 1GZNA 3AOXA 3MWUA 1VZOA 4OGRA 4XG8A 1Q8ZA 2BZJA 1IRKA 5AP1A 1H0VA 3GU5A 4U40A 4ZSJA 4XRJA 3NUAA 5CSHA 3LCTA 3NUUA 3DAKA 5JQ8A 1FVTA 4O7YA 1Q8WA 3PPJA 5IG1A 3BYUA 4FR4A 4JRNA 2OO8X 3TZ8A 3BKBA 4FVPA 3N4VA 5E92A 2A0CX 1KE8A 4FIIA 1G5SA 4JX7A 5EFQA 4BCHA 4RJ8A 4UN0C 1TKIA 3LM0A 1JAMA 2GQSA 2CKOA 2CPKE 4BDFA 4IZAA 4KSPA 3V51A 1JBPE 4MYGA 3EQGA 3PJ8A 5KMKA 4G3GA 3MFUA 3TXOA 4G1WA 2OJFE 2QHNA 2WFYA 4FEUA 3LQ5A 5GJGA 2G9XA 2C5OA 4RWJA 3FY2A 1UU9A 1VEBA 3F3UA 2PVKA 1YRPA 2F49A 2WMBA 3OFMA 4FC0A 4J53A 4YZDA 4AE6A 2XIRA 3GI3A 2C69A 2J5FA 4TY1A 3AD4A 2XIZA 3MFTA 2UZOA 2VWIA 1FOTA 3UIMA 3I79A 4ACGA 4CQEA 4E20A 2LGCA 5HCZA 5IA1A 5EH0A 3F2RA 5E8XA 3UZRA 3EL8A 3MDYA 1I44A 5EOBA 4HVIA 2AC3A 2IW9A 4DEGA 4B6LA 2GTNA 3EN4A 3KC3A 3QZHA 5L2QA 2C3IB 4CMUA 4TTHB 4S34A 3EWHA 5AR2A 5E8UA 3E93A 5ANEA 4QMUA 4ACMA 3C4XA 2W1IA 2IWIA 3RVGA 4UZHA 4QOXA 3UPXA 3FLWA 3GCPA 5LARA 3LOKA 4ONAA 2AYPA 3CGFA 1FPUA 4QYGA 3AGMA 3DQWA 4O38A 3WBLA 3F61A 5A4TA 5CF6A 1OL1A 1M52A 4KIQA 3V5QA 2ZMDA 4R7HA 3EFLA 3GBZA 5F94A 3LM5A 5K3YA 2A27A 4PPAA 1PHKA 2X7FA 4IIRA 3UQCA 4B9DA 3OUNB 3NW6A 3AC5A 3QZIA 1WCCA 4CV9A 3FZTA 2BFXA 4K18A 4E4XA 5JFWA 3MGYA 5L8JA 3PA3A 1Q8UA 5AR5A 3Q5IA 3WYYA 1Y8YA 3EZVA 2ZMCA 3QXOA 4EORA 5BVOA 4IXPA 4AF3A 2UZTA 2WQEA 5FTQA 4CFNA 4FMQA 4D2SA 4EEVA 4X21A 3OF0A 3C5UA 3LJ0A 3AG9A 2XB7A 4GIHA 4GKIA 1NXKA 4N6YA 3OCSA 4F9CA 1YVJA 3ZRLA 2BUJA 2BRGA 3RCDA 1S9IA 3GC8A 4G6NA 3IW8A 3PY1A 2W4OA 3LQ8A 4O84A 5DIAA 1Q41A 2YHVA 4CFUA 4BTJA 4L7SA 2PULA 4PX6A 5HCYA 4Z16A 3DPKA 4FSMA 4PMTA 4AS0A 2OF4A 2CDZA 5BNJA 3FKOA 3D7TA 3PRFA 4DFBA 2X8IA 4QYHA 2ZDTA 3MH3A 5L4QA 2IVSA 5A46A 3BV3A 4XV1A 4M0YA 2UZEA 3R8UA 5LOHA 2WAJA 4JG8A 4QD6A 3I7BA 5T68A 2I1MA 2W1EA 3ZM9A 3LJ2A 5EOLA 4C37A 1SVGA 3KU2A 3NDMA 4AZVA 3LXLA 4NZWB 2E9PA 3FI8A 2EXEA 2R3FA 4DYMA 4C4HA 1OL5A 4JX3A 3TACA 3ZLSA 3UGCA 1Q97A 4GJ3A 2YDIA 3ZUVA 3ORPA 4RZVA 4CRLA 2WIPA 4FTAA 3CJGA 3ALOA 5BVEA 3Q9YA 4RX5A 1IR3A 3C0GA 5AIRA 2PL0A 3DAJA 4O86A 3R21A 3LVPA 4WNMA 3TIYA 4FGRA 3F2NA 3KY2A 4NIFA 5T6KA 5EW8A 4BTMA 4EC8A 3WF5A 2YCRA 4YJVA 3PVBA 4XLIA 1CSNA 1ZYCA 2GHLA 3OCBA 4LV5A 3GC0A 1W84A 2CN8A 3UIUA 4AGUA 4F9BA 3E88A 3NPCA 4IJ9A 3QD0A 3FBVA 3L8PA 4HJOA 4LL5A 4KBKA 5TE0A 5JT2A 5HICA 2J0LA 2PYWA 3AC3A 4WT6A 5BVNA 1OUKA 1QCFA 5TR6A 5A14A 3ZO4A 4FVQA 5D41A 4WRSA 4FSNA 2EB2A 3WZDA 3IK3A 2WQNA 2JEDA 2XBJA 3ZOSA 3MPTA 5B2MA 2BDFA 5LVMA 4L44A 1Y57A 4AWIA 3IW6A 2Z8CA 2C0TA 3ZRKA 2QOFA 3OTUA 4AZWA 4RX9A 4EC9A 4TWOA 3HVCA 4ZTQA 5EQYA 2GNLA 4PF4A 3EQHA 4BCOA 2X39A 4KS8A 2WKMA 4U79A 3UTOA 1H25A 2GU8A 2B54A 4OUCA 1YXTA 3CIKA 3PXRA 3QKLA 1M2RA 2BZHB 4MF1A 1UNHA 1ZARA 4U8ZA 3V5WA 4CSVA 5KBQA 4GW8A 4EUUA 4LOPA 1UNLA 5LJJA 3F9NA 4OAVB 2JAVA 3MTFA 3GOPA 5CAUA 3W2QA 3QKKA 3NMUF 2OH0E 4MK0A 3Q2JA 4X0MA 3R30A 3UOHA 4U5JA 5ETAA 4IWPA 3MY1A 4TYEA 5DT3A 1OIYA 2CKPA 3QFVA 3BLHA 3UP2A 2PMOX 3VBVA 3PRIA 2CGXA 4BIDA 1Q3DA 5H2UA 1H07A 3VUMA 2Y9QA 4NFNA 5IMXA 4FNYA 4GCJA 5CSXA 3KEXA 5DWRA 5LWMA 5FP6A 4YC3A 5GJFA 5CEQA 3DBDA 4I5MA 1MRYA 4KS7A 4BDJA 2XNEA 4O7TA 3MVMA 4CKJA 4PPBA 4ZS4A 2OH4A 4B4LA 2ONLA 2GNIA 4FNWA 4U97A 5CT7A 3ZRMA 4WBBB 5CZIA 3WF8A 3VS7A 5J8IA 5HORA 4Z9LA 2XH5A 1R78A 4FV4A 5GZ8A 4LMNA 1J1BA 1H8FA 4I92A 4RWIA 5LQFA 3ZYAA 3SLSA 3R8ZA 2VWBA 1YW2A 3DK3A 4ALWA 1YOLA 3MB6A 5DR2A 5E91A 3T9IA 5KMOA 4GU9A 4KNBA 4QPAA 4ZY6A 3G6GA 4FUXA 4D1SA 3E7OA 3EN5A 3LAUA 2VTQA 3NNWA 3QRJA 2R0UA 4O7WA 3R28A 3K5VA 4ZLYA 5JFSA 4IAFA 1BMKA 3WE8A 4GL9A 2GS6A 3BU3A 4XX9A 5AP0A 1APME 2CNVA 1JSUA 4IM2A 4DFNA 1Q4LA 3V04A 3KXZA 4YZBA 2C6OA 4MNEA 3SQQA 3FPQA 3VBXA 1IA9A 2BRNA 4E6AA 4QMNA 3VJOA 3JVSA 5KZ0A 1PXKA 4IC7A 2ZVAA 4EHGA 1I09A 4JQ7A 4CFXA 4DGOA 1RQQA 5IH6A 5KUPA 4MX9A 4AW2A 4P5ZA 4L43A 5C4LA 3MV5A 4DTKA 1WAKA 1SVHA 3W2PA 4IEBA 1FINA 4QTAA 5D11A 3T8OA 3Q4ZA 3VBQA 5E8VA 3ZEWA 1FQ1B 5G6VA 5L2TA 4C59A 4D5KA 4GV1A 1YWRA 5FEQA 4ZJJA 4DGGA 2B9JA 4XMOA 4KIKB 5CU3A 4KA3A 1Z9XA 3MYGA 2WTWA 3R00A 3TIZA 5HO6A 4KIKA 4MD9E 1JKTA 1FVRA 4AN9A 2PUIA 5DE2A 2WU7A 3QTRA 2Z7LA 4G5JA 1H1RA 4NKSA 4QNYA 4CLIA 3D5UA 1HCKA 2HOGA 3F5XA 5LVLA 4CCUA 3F66A 4M14A 5E8WA 3ZLYA 4GK4A 1ZYSA 2UW8A 3EN6A 4JDJA 1WVYA 4E8AA 3MW1A 2PE1A 3LMIA 4PWNA 3AMYA 4ZXTA 3UNZA 4RJ7A 3BLRA 3H3CA 3OOGA 2BR1A 5AV2A 4K8AA 3SW4A 2XIYA 3IPHA 3ZLXA 1XH9A 3OWLA 3Q2MA 2OG8A 3I5ZA 4L01A 5HIEA 4F0IA 1Q61A 4FZAB 3G9NA 3NUPA 4YPDA 3ZMMA 3GOKA 2R3OA 2WEVA 4MQ2A 4J71A 4C38A 2CSNA 4ZSGA 4ZMFA 3V5TA 5FGKA 3W32A 5IQHA 3OOMA 5EYKA 4C8BA 4EI4A 4C34A 1S9JA 1O6LA 1YI3A 5KE0A 4C33A 4ZJVA 2WB8A 3ORNA 4IHPA 3RKBA 4PDOA 3EQRA 3VW6A 3KMUA 4AT4A 3HA8A 3JY0A 4FGBA 4GUEA 3BHYA 3QBNA 5DRBA 4KKEA 2V7AA 4C36A 1OIUA 5EHLA 2YAAA 1GNGA 3VHEA 3A4PA 2C6MA 2JFLA 2XKFA 3HDMA 3MVLA 4F1OA 4S33A 3G15A 1IAHA 5H9BA 3UNJA 2WOUA 3G0EA 4UWCA 4UALA 4UB7A 2OJGA 5F20A 4F7JA 3MY0A 4HGTA 4IAZA 3FXXA 5C8NA 1XH4A 1XH6A 4U6RA 3NW5A 3MH1A 3LXKA 2IZUA 3B2WA 3PJ1A 2BKZA 3PG1A 2X8EA 4QT1A 2FH9A 2EXCX 3FWQA 3TM0A 3NX8A 3QTIA 3LFFA 3R2YA 4JQ8A 4DCAA 5HLNA 2P2HA 1K2PA 3A99A 1U54B 2WPAA 3UIBA 3FV8A 1TVOA 1URWA 3FKNA 4LGDA 4HVDA 3M42A 3OWJA 3DFCB 2W4JA 1PJKA 2X0GA 3BEAA 2I7QA 3RK5A 3SOAA 4FTCA 2WTDA 3FZSA 2ZB0A 4AZSA 2JKOA 2VNWA 3Q9ZA 3CS9A 2GPHA 4BWPA 1XBAA 2DUVA 3C0IA 1NA7A 3IOPA 3LLAA 4RFZA 4BDAA 5TOZA 3F3TA 1PXJA 2HWPA 2QG5A 4G3DA 1UU3A 2W05A 2R3HA 2XIKA 3THBA 2PUUA 4WKQA 3R8LA 4K1BA 4Q5EA 1H01A 3EFJA 4EJ7A 3R9OA 1OPKA 4ITJA 3RPRA 4JL9A 4FKPA 3P0MA 3C1XA 4F7NA 4DT9A 2JKQA 1YXVA 2HCKA 2DQ7X 2X81A 3HMMA 3UC3A 3SW7A 4GIIA 2VTSA 1XKKA 5HBHA 1KE5A 3WIGA 4TPTA 1OB3A 1T45A 3PYYA 3DKGA 3U8WA 2C6EA 2BTRA 4NM7A 2JAMA 1W98A 5ANDA 2GQRA 3EQCA 1LEZA 3FPMA 2QLQA 4Y5HA 1E1XA 4RJ5A 1CTPE 3HAVA 2BZKB 3DBFA 5CYIA 3EYHA 1P4OA 5AUYA 3ACKA 3UOLA 4P90A 4V01A 3FZPA 4MVFA 1WBSA 2AC5A 3HRCA 4LGGA 2RL5A 4PUZA 4PP7A 3ATSA 1OBDA 2PZRA 4KINA 2UUEA 2YA9A 4ANQA 4X3FC 5HCXA 2W5AA 5HI2A 4FODA 5A54A 3PJCA 4JNWA 4O0VA 4LI5A 2QODA 3BGQA 3DB8A 2VTHA 5CSPA 1J7IA 3NUXA 4I41A 3EFKA 3HA6A 3U4UA 2BDWA 3GQLA 4OBOA 3W33A 5AAEA 3LFDA 5M55A 3OWPA 5IPJA 5FXRA 4L52A 4FT3A 3SDJA 4EOKA 3UIXA 4FX3A 4DBNA 5HTCA 4E3CA 4DEIA 4IADA 4MH7A 3IG7A 3PDTA 3BQRA 5J9LA 5JRSA 3FLYA 5E8YA 4NFMA 1IG1A 3CQUA 2GNJA 4C7TA 2DWBA 4WD5A 1CM8A 3HYHA 2QOLA 3PIZA 5BVKA 4RSSA 3D15A 2VWZA 4UWYA 5KKRC 3EH9A 4CZYB
chains in the Genus database with same CATH superfamily
1FGKA 5DPVA 3ANQA 2YLFA 5M4IA 3W1FA 4G9CA 5I4NA 3ANRA 5AAGA 1G8SA 5E7RA 2Y6OA 2XNBA 3QCYA 5HNGA 4M0ZA 2ZOQA 4FKWA 4GK3A 4C4IA 5JFVA 5FG8A 1YI4A 1SMHA 3QQFA 3VUIA 4C2WA 2HW7A 4W4VA 3HZTA 3QA8A 3FI4A 1PMNA 3U55A 4EYJA 3DTWA 4GFOA 3OCTA 3VQUA 2PE0A 4R6VA 3VQHA 4JXFA 2BAJA 3HUCA 1A06A 3L8XA 3BHVA 3KULB 4PNIA 3WI6A 5CAOA 3OBJA 4FK3A 3KFAA 4H1MA 4HPTE 5JGAA 2ITWA 2IW8A 5GIOE 2PMNX 4OTQA 4QO9A 4Z55A 1W2DA 5BPYA 3TYKA 1H08A 1BI8A 4IX6A 2HZNA 3KVXA 4FV0A 2A98A 2NNWB 3G2FA 3PY3A 4M97A 4JDHA 3RPVA 4FKJA 5HU3A 2OK1A 4F9YA 4TXCA 4FL2A 5CI7A 4E1ZA 1ZOEA 3FMMA 1DAWA 3U6HA 3W0OA 4PRJA 2WO6A 3TZMA 4AZTA 4PDYA 4I5CA 3QALE 4RJ4A 4QQ5A 3QTQA 3RJCA 2YM8A 3CKXA 3VAPA 2JKMA 2XVDA 4I6QA 3O50A 5LXMA 1SYKA 2UVXA 3Q4TA 4U45A 4ACHA 5EI2A 4ZY5A 4IX3A 3QCXA 4H1JA 1F0QA 3C0HA 4LOQA 2AEGA 1CDKA 4ZMEA 3EQBA 1TQPA 4KBAA 4EHVA 2E9VA 4EHZA 5CXZA 5DGZA 1SVEA 2C6IA 2W7XA 3OG7A 3DOGA 4YJNA 2QKWB 2H6DA 5J1VA 5EM6A 4JOAA 5K9IA 3FQHA 3V5JA 1Q8TA 2WOTA 4U42A 1R39A 4HCTA 4BZOA 4E4MA 3KREA 1J3HA 4WRGA 5ICPA 4EQMA 4TT7A 1PKDA 1AGWA 3UJGA 5M4UA 4D9UA 3POOA 3LCKA 3NIZA 4J95A 3ROCA 3MPAA 4Z7GA 3PFQA 3QRUA 4R5YA 4QPSA 5FWKK 4BWKA 4O83A 3BYVA 4X6RA 5EI6A 3ZO1A 4O91A 1H00A 3UBDA 3VUGA 4M3QA 3KN6A 2PHKA 4P7EA 3QUDA 2R7BA 3M2WA 4CV8A 3NCGA 4GYIA 4QMLA 4AA0A 4NM5A 1R0EA 4I0SA 2AUHA 4OTWA 2H96A 3Q32A 4LM5A 2QOKA 5T3QA 2CLQA 5BUIA 2YCSA 5D1JA 4BF2A 2I40A 4I93A 5BUJA 3E92A 3IS5A 2CCHA 3QAME 4RIXB 5F95A 3FMEA 4FKVA 1XQZA 5M06A 4TYIA 5ETFA 4G31A 3PFYA 2R3LA 4RIXA 2BHEA 2YM4A 3GGFA 3FKLA 3P79A 4NW6A 4D58A 4UZDA 3LFSA 5AR8A 4EZ3A 4O7SA 4L68A 2CLXA 2PVJA 4UXQA 5DVRA 4IJPA 2PK9A 5CAQA 1HCLA 3I60A 4YZNA 5C8MA 2VX0A 5LVNA 3F2AA 4LYNA 4MXZA 3KB7A 4U3YA 5DOSA 2H34A 4FKUA 2Z2WA 4IFGA 4BFMA 1Z57A 4O7RA 3RBWA 3HAMA 3HLLA 2QOBA 3MJ2A 4FKTA 1OL2A 2I0VA 4ANMA 4APCA 3QL8A 2KULA 3BIZA 4C0TA 4DH1A 2HENA 4YUQA 5AM6A 4NJDA 1JKKA 3ZBFA 4G6OA 2J0KA 2VTIA 1ZOGA 3BGZA 5HO8A 5JGBA 4BZNA 4HCUA 3OC1A 4OW8A 5EYMA 4Y95A 2VUWA 3W2OA 2EU9A 4WSQA 2UVYA 5C03A 4I5HA 3KK8A 3TN8A 4R7BA 3UO5A 3A62A 3LFNA 3N4TA 2OXDA 4BTFA 5HBJA 3GU8A 5I5ZA 3E62A 3DS6A 4CMTA 5AFVA 4BHNA 5DA3A 4CNHA 4HYHA 5I9VA 3S3IA 2NYAA 3IDBA 2DYLA 2R4BA 5GJDA 5HLPA 2HY81 5A4QA 1SNUA 3GU7A 1W82A 1ZY4A 3L8SA 4CXAA 3PJ3A 3NR9A 2ETMA 5CANA 3HGKA 4F4PA 2VWUA 4RVLA 4CFWA 4YNOA 4AUAA 4JIKA 2C3JA 2YERA 2Z7SA 5HX6A 5EKNA 2QCSA 2J90A 3IW4A 1U5QA 2X2MA 4FV7A 4L3PA 4F9WA 3SG9A 5AP4A 4QMQA 2Y4IB 3COKA 1OIRA 4EJNA 2W5HA 4YZMA 4NEUA 2BKKA 4JBQA 4R5SA 5E8TA 2GHMA 2NPQA 4LV8A 4M66A 4O6LA 4BN1A 1H1QA 3P7AA 5AAFA 1WBTA 4I3ZA 4DEDA 3C4ZA 4PMMA 2J2IB 4DN5A 4CG8A 2GMXA 4MXOA 4S31A 4R78A 2YAKA 4EOSA 5EQEA 4AA4A 5GIPE 2PVHA 3ORKA 1P2AA 3GC9A 2OIQA 1KUTA 2PU8A 3JPVA 3IONA 3OBGA 1PRYA 2PUNA 3F5UA 2X6EA 4USFA 3PXFA 4EL9A 4IZ7A 4WHZA 2PZPA 1LR4A 2W1HA 4DGLC 4L3JA 3E8EA 4EOIA 5A4LA 4XG6A 3V5LA 2F57A 2WHBA 3DBEA 2PPQA 2W5BA 4FZ6A 5JKGA 2XARA 4YLLA 2GTMA 3AMAA 5EG3A 5GNKA 5IUGA 1L3RE 2ERZE 4YJPA 2HIWA 3D4QA 4YSJA 2W4KA 4JDIA 4ZAUA 5C01A 3WARA 3VF8A 4PY1A 3DV3A 2OSCA 5DT0A 3MFRA 1XWSA 2ZV9A 3TNQB 3ZUUA 4ARKA 3KRWA 3GCQA 3LIJA 3BU6A 3EFWA 4D2TA 2UW6A 4YTIA 5CENA 3RHKA 3V3VA 2GNHA 2ITPA 3A60A 4ACDA 4F0FA 3PVWA 4RIYB 2VWVA 2JDTA 1H1WA 2VX3A 4H39A 3ALNA 3ZUTA 2VV9A 3OP5A 4W8DA 1OI9A 3F3ZA 4RIYA 3BEGA 1JKSA 2W17A 2ZV8A 3HKOA 3PP0A 3QTZA 2QO9A 2W1FA 1Q24A 3PTGA 3DBQA 2WQBA 3ENHA 3QZFA 4L42A 4XOYA 4E5BA 5IZFA 4E5AX 4B0GA 2FUMA 4LRJA 4V04A 2C1BA 3PIYA 4MTAA 4F0GA 2X9FA 3RI1A 1WBOA 1TFFA 5K5XA 3UOJA 5E1SA 4CLJA 3E3BX 4FL1A 2JDSA 4J52A 1NVRA 5J5TA 1OIQA 4LUEA 4D4YA 4RJ6A 3KK9A 2QG7A 1DAYA 4FTOA 1OKZA 2PMLX 1XMLA 2PVRA 3KXGA 3RZBA 1P14A 5C1QB 4HYUA 3W0RA 4AXEA 3MESA 5AV0A 3A8WA 4FYOA 4OTIA 4IM3A 2YJRA 4NTSA 4UWBA 1IA8A 2PE2A 3UVRA 2VWYA 2GS7A 4YJRA 3D5XA 4DDGA 3HEGA 3AT2A 4FV8A 4JLCA 3TTJA 5AV3A 3UDTA 2XM9A 3HV6A 3H9RA 4H3QA 3UVPA 5AIKA 3LXPA 1FMOE 3EL7A 3VS5A 4Y85A 5IUHA 3MI9A 5AUTA 3CPCA 1KE6A 5HE3A 3RPOA 3GENA 3HRBA 5FBNC 4DHJA 4O1OA 3EZRA 3HMOA 5BMSA 2YCQA 4EWHA 2PWLA 1JSVA 4I6LA 4AGCA 4O27B 1IAJA 1YKRA 3VUKA 4HZSA 3PSDA 3I6UA 1BI7A 4FG7A 3TEIA 4CFFA 3E64A 3BLAA 5CZHA 5AJQA 4BWXA 5BVDA 5FUTA 4U44A 2G2IA 3JXWA 3FMDA 2OGVA 1YOMA 4B7TA 2V22A 3TNPC 3MA3A 4NM0A 4H05A 4OTHA 2X2LA 5M4FA 2C5XA 2A1AB 1G3NA 2QQ7A 1XHAA 3NNUA 1L8TA 3W16A 5BYZA 4JG7A 5HNIX 2X0OA 4C4EA 4G34A 2IG7A 2WQMA 3W0NA 4IAKA 5F1ZA 4IVDA 2YIYA 3T3UA 3HP2A 1YXXA 2I0HA 5CF5A 3NUSA 1Q62A 1IEPA 3C4FA 3DK7A 3F5PA 3BYMA 3FZOA 3GT8A 3QTSA 4FTMA 3ROYA 3HRFA 2IVTA 2BHHA 2WXVA 4I6HA 5LVPA 4BGGA 2XYNA 5K4JA 3OHTA 5ANOA 3TWJA 4O4FA 4YJUA 3A7HA 2XNGA 4G5PA 4TWNA 2J4ZA 2XA4A 2YWVA 4R3PA 3HMIA 2VO3A 3W2SA 4AT5A 3UQFA 5HE2A 4XNEA 5A4EA 3CP9A 2R3NA 2X6DA 3I5NA 4L53A 1YWVA 3S1HA 3EKKA 4EH3A 2R3PA 4EK4A 4O0UA 4RBLA 5BYYA 3FDNA 1PXOA 3GVUA 3C4EA 5KO1A 2J0MB 5DFPA 3RWQA 3WZEA 2Z7RA 1VYZA 2ONLC 2W1CA 4AW5A 2BVAA 3A8XA 4KSQA 3QQUA 4O7LA 3VW8A 4IAAA 3DKFA 2ZM3A 3DK6A 4BBFA 3OEZA 3N9XA 5DBXA 2EWAA 2WMVA 4BVUA 4EBWA 2HXLA 1H0WA 2YM3A 5IA2A 2WMTA 3VN9A 5EM8A 3OT8A 1R0PA 4IB3A 3MVJA 3BHUA 5CWZA 3KMWA 3TI1A 2W1DA 4YMJA 5HEZA 2VTRA 3UG2A 3PSCA 2PVFA 5BV3A 4FT0A 1OZ1A 2JFMA 3DJ7A 3KRLA 4JT3A 4ZJIA 2C30A 5CS6A 3GUBA 3V8SA 4RQVA 2NO3A 2OJJA 2WMQA 2WQOA 3CGOA 3OD6X 3FZRA 3NNXA 4MWIA 5IEYA 5A3XA 3ATTA 4O0RA 1W0XC 5IISA 2BFYA 3PE1A 2VTAA 3CTHA 3GP0A 3CD8A 3QYZA 1PYEA 4NM3A 1GIIA 3PSBA 4DEAA 4CG9A 3LPBA 3VNTA 1PXIA 3R7GA 4ERWA 1YXSA 4N4SA 3AKLA 2FO0A 2BRHA 1E1VA 4FIGA 3RAIA 2OW3A 3JVRA 3A7GA 4G3FA 4IQ6A 5CQWA 5HNBA 2CNUA 4AGWA 3KXNA 3TDVA 4DE4A 4GEOA 1UKHA 1WFCA 4EK8A 2VAGA 5DR6A 5K4IA 4AW0A 3DXPA 2BTSA 4YTHA 3WZJA 4AA5A 4DTBA 5ANJA 4H36A 3WZUA 3H0YA 5FP5A 4BCMA 2BIKB 3QYWA 5CVGA 4XCUA 1M14A 3GCVA 5FBOA 2YM7A 4YGAA 3R1SA 1YDSE 2FSTX 2GQGA 2B52A 2XCKA 3FYKX 3MIYA 3R9HA 3WE4A 4HVGA 5B7VA 2UZLA 4CGAA 4DGNA 3PLAE 4M15A 5CNNA 2EXMA 3TL8A 4C35A 3PVGA 3RWPA 3LCDA 1V0PA 2SRCA 4AW1A 3P7CA 5IA3A 4NW5A 3DFAA 1OPJA 2V0DA 2ITYA 4XHKB 3ZBXA 4U0IA 2ZAZA 4BC6A 2XEYA 3PXZA 5J5SA 3QU0A 1M17A 3Q5ZA 2R3KA 1V0OA 2YM5A 3SXFA 1G8JA 4BL1A 3NVKI 4FTRA 2RFEA 3FMJA 5JRQA 2J0JA 2OZAB 3L9MA 2OZAA 1WBWA 1UU7A 1OL7A 3O23A 5CU4A 4UXLA 3QCSA 4RVMA 2WTKB 5AMNA 3L9LA 5HIBA 4QMZA 4DITA 5AP3A 3GEQA 3AXWA 3FI2A 4IH8A 2PSQA 3QQLA 1Q5KA 3RTPA 5TT7A 3CE3A 4Y73A 5IH4A 5CXHA 4EH8A 4K33A 3AC1A 1UWJA 3EMGA 4DLJA 4RC3A 2W06A 4XG2A 4G16A 2XEZA 3U54A 2X0PA 4X6QC 3BYSA 4IWQA 3ZONA 5JGDA 4GYGA 3VUDA 3KKVA 4J8MA 3SXSA 4UEUA 2IZSA 4FT5A 4WNOA 4CVAA 4Q9ZA 1J1CA 3IOKA 3AD6A 4NJ3A 4QRCA 4AE9A 2VTJA 2XNPA 4YP8A 2JDVA 3E8NA 3F88A 4FT7A 4IAYA 4L6QA 4M84A 4MXYA 4IX4A 2VTPA 3ZC5A 3LCSA 4XV2A 4EH5A 4BTKA 5HLWA 4O81A 1PXLA 4RG0A 4EH6A 4JBOA 3QC9A 4ACCA 4C3PA 4AOIA 2R3MA 3O7LD 2PZIA 5HQ0A 4DHIB 4QYFA 3UC4A 4WNPA 4ORKA 3FEGA 3REPA 4R1VA 5HG5A 3GQIA 3G6HA 4WA9A 1GY3A 2YACA 4RLKA 3QX4A 3QC4A 4QMTA 4TZRA 4L45A 2ITQA 4BHZA 4D2PA 3IKAA 4PL3A 3Q6WA 3NUNA 2F7ZE 4Q5HA 4V0GB 2HK5A 3OCGA 5C26A 5M08A 1SM2A 2YFXA 1E9HA 3C4CA 2QURA 2VX1A 5ANKA 3BE2A 1KE9A 4UV0A 1Z5MA 5HD4A 2W96B 3COHA 1K3AA 1KV1A 2WMWA 3VC4A 4I21A 4AX8A 2B9HA 1BL6A 3R63A 4O0WA 2V55A 4AZFA 3ZLWA 2XNOA 4OBPA 3WYXA 2OICA 4IC8A 4N57A 1H24A 4PL4A 3CY3A 3O2MA 2OF2A 4I24A 1J91A 2ITVA 3PZHA 3CLYA 5I9ZA 4L00A 3EKNA 4QQTA 1WBVA 3HECA 5BYLA 4H3PA 2WMXA 3O8TA 1UVRA 1SNXA 2X7GA 3HP5A 2C6KA 3EQPA 5CT0A 2Y8OA 3R0TA 4A9SA 4QDVA 4E4NA 4MD7E 1REKA 2O2UA 2QO2A 4F7LA 4F70A 5IEVA 3MTLA 3PVUA 3CJFA 4IVAA 4UMQA 3RAHA 3WF9A 4C61A 4FTUA 2YIRA 3P7BA 4J8NA 2LAVA 5HD7A 3TT0A 4X2KA 5KMJA 2WIHA 2VRXA 4YLKA 4ASXA 4YJSA 4FSRA 4HW7A 5BX0A 4MCVA 2YZAA 3BWJA 3QHRA 2ITOA 4NCTC 3HMPA 3UE4A 2YZLA 3UMXA 2EB3A 4IB5A 5D10A 4XP3A 4W4YA 1ZZ2A 5L2WA 2BIYA 5IA5A 1OKVA 3FMLA 4KRDA 4ALVA 3H0ZA 5I9YA 1ZYDA 4FZFB 4RWLA 5AP2A 1U54A 3TCPA 1FMKA 5FDPA 2XANA 3O71A 4BDGA 2X4ZA 2CGWA 2RSVA 4I23A 3TJCA 4EZ5A 2G2HA 4FG8A 3FMNA 3S4QA 3MA6A 3JR1A 2XNMA 3RAWA 1V0BA 3QQHA 4R8QA 2H8HA 4BBEA 5A6NA 2QC6A 1ZLTA 3HMNA 4LRMA 3R7YA 5B0XA 1Q8YA 2CGVA 3P5JC 1NT2A 2BALA 4CTBA 2QOOA 4ZLZA 4E93A 4V05A 3D94A 3FZ1A 3LCOA 4FSUA 4Y5QA 4YJOA 5KX8A 4TWCA 4RZWA 3FSKA 4FOBA 4PMSA 5HIDA 2QOIA 2ZV7A 4YJQA 4MBJA 4ZSLA 4ZP5A 3I81A 4DFYA 2CMWA 5EYCA 4DINA 1WVWA 4IACA 5IQBA 3R02A 4FSTA 5C4KA 1URCA 3I0OA 2JKKA 5L2IA 4K0YA 3LJ1A 3ULZA 3Q9XA 3QHWA 4GT3A 3UO4A 4BI1A 2VU3A 2B9IA 2XS0A 3FQSA 2FA2A 4NK9A 1TZDA 4BCQA 3FLNC 3AKJA 2F2CB 3FE3A 4DG0E 4GVJA 5HGIA 1TQMA 3QF9A 2QOCA 1F5QA 5FDXA 3JS2A 1B39A 2ACXA 3W0MA 3CEKA 3NEWA 4D5HA 2BAQA 4OR5A 4BDBA 3ZXTA 3O0GA 4DBXA 3QWJA 2PZYA 3SOCA 3PP1A 4A7CA 4BI2A 1B38A 5JSMA 4NCTA 4FF8A 4QNAA 4YO4A 4K77A 3TUBA 3ZFYA 1VR2A 4G6LA 4D1XA 5IF1A 3PY0A 4LFIA 3SAYA 3WILA 2J6MA 3MN3A 3VVHA 2XF0A 3ERKA 4O0XA 2P3GX 3DAEA 4D9TA 1V1KA 4NH1A 5DNRA 4O1PA 3UO6A 3SX9A 1Q99A 3NWWA 4DEEA 5BQ0A 3QTWA 3ELJA 5CLPA 2RFNA 3SGCA 3OXTA 4YNEA 5M56A 2RGPA 5IQAA 4LG4A 1ZWSA 3UG1A 3E8DA 2XK6A 2ETKA 3C7QA 4KRCA 4WG4A 4OTFA 5EKOA 4GKHA 4GFGA 2XJ2A 5KMNA 2XK4A 4Z7HA 2JITA 5GINE 1KOAA 2BCJA 5AEPA 4QMYA 1R3CA 2GNGA 4A9UA 5HESA 1PXNA 4BGQA 3OT3A 3KA0A 1OKYA 3R01A 3W55A 1RDQE 4RWKA 4EZ7A 3ORLA 4BCJA 5CF8A 1CKJA 3M11A 4ZK5A 1FBNA 2JDRA 4ZS0A 4ZTMA 3PXYA 3C4WA 3PJ2A 5CEIA 2JD5A 3BQCA 1GIJA 2ERKA 3D7ZA 1SZMA 4RGJA 5EW3A 3ORZA 5AA9A 2O65A 3ZM4A 3G5DA 4BCKA 5ITAA 2ZJWA 2PMIA 1ATPE 3RHXA 3UVQA 3VO3A 1H4LA 4XUFA 4A07A 4E5WA 5IQIA 3QLGA 4IDTA 4P5QA 5LWNA 1STCE 2Y0AA 2XCHA 4YC8A 4DAWA 2XM8A 4DG2E 3I6WA 3QUPA 4FTIA 4IFCA 1LP4A 3CD3A 4YBJA 4R3CA 4E26A 3AT4A 2HZ0A 3KULA 5L6WL 2WTJA 3Q9WA 4MBLA 3OZ6A 3PUFC 4KKHA 3R9DA 1KOBA 4JAIA 4APPA 4TNDA 3FXZA 4XS2A 4BKJA 4QTCA 5CU0A 4L9IA 2VO0A 4Y72A 3SHEA 4TRLA 3FMHA 2JIVA 3LFCA 4IE9A 2XKDA 4JAJA 2B9FA 5HG9A 3IW5A 1OMWA 4FG9A 2QOQA 3KMMA 1BLXA 2E9UA 4BDCA 3A7FA 3SXRA 4Z3VA 3ZSIA 4FSZA 2ETRA 5DEYA 5CEOA 2BILB 3PUPA 4RIWB 2I0EA 2WTCA 1KWPA 3PXQA 4X3FB 5DLSA 5H3QA 3W8LA 3ZU7A 3TZ7A 4CFVA 3AKKA 1XR1A 2BRMA 3ORIA 4KUJA 3O17A 5CY3A 2HXQA 4GFMA 2VTTA 2C5YA 2QR7A 4RA4A 3O8UA 4EBVA 3DB6A 3WF6A 4FEQA 4IW0A 2B53A 3EYGA 2C5VA 4NT4A 4DFLA 3QQKA 3RALA 5IUIA 4RJ3A 1OGYA 3P08A 3ORXA 5C8KA 2R0IA 4M7IA 3RCJA 3VWAA 5FM3A 4C57A 4C4FA 2HY0A 5HE0A 4GG7A 5EHYA 5AR7A 2PZ5A 2Q0NA 3F7WA 4BGHA 3LHJA 5DMZA 5M44A 2VWXA 1BL7A 4OT6A 3AC8A 3HNGA 5I9UA 3VULA 4WIHA 3ORTA 2J9MA 5KKRB 2AQXA 3V6RA 2QONA 3OW3A 5DR9A 4B99A 4AXCA 4RT7A 2VTLA 4ITHA 3P5KA 3RP9A 4CZTA 3NNVA 2P0CA 4MWHA 2CNQA 2HZ4A 3AQVA 2PTKA 4FE2A 2Y4IC 4BICA 3DLSA 2WGJA 3ZCLA 4C2VA 1YXUA 3NRMA 3U87A 4PMPA 3DA6A 2KTYA 2Y6MA 4GK2A 5LMAA 2F7EE 4QP4A 4FV3A 5AUZA 1BX6A 1O6YA 5DYJA 3S2PA 1XBBA 4G3CA 4ENYA 2I6LA 2XAMA 4FTTA 4O21A 4LRKA 1XBCA 2WEIA 4F1TA 4DF3A 4DFXE 3SRVB 5JFXA 5CNOA 4OBQA 3FJQE 4FBXA 3KGAA 3TUDA 2P55A 2YDKA 3S0OA 2BROA 3R1YA 4HGSA 3K3JA 2W9FB 4BYJA 4C62A 1YQJA 4IAIA 3ZZEA 5CEMA 3AD5A 2JGZA 4DDIA 2XK9A 1G8AA 4RVTA 1T46A 4O7ZA 3QA0A 3UZPA 4J98A 3PPKA 2YIWA 2XRUA 3FXWA 1YHSA 3D2KA 2JIIA 3ZS5A 4MXCA 3TG1A 4DEBA 4F09A 2OXYA 1YOJA 4QMSA 5G1XA 4AXAA 2F4JA 3HX4A 4FOCA 4JQEA 3UNKA 4GG5A 4O4DA 3G0FA 4QPMA 3G9LX 4AGDA 4E7WA 2V7OA 4M12A 5M09A 1OL6A 4I5PA 4JBPA 5AR3A 1ZOHA 4EK6A 4PTCA 4S2ZA 4JBVA 1U59A 4A9YA 4XG3A 4HOKA 3JYAA 5HBEA 3D9VA 4FYNA 5LCKA 3WOWA 1WBPA 3BE9A 3VBYA 3CQWA 4CTCA 4XV9A 5M57A 1U4DA 4WO5A 4EQCA 3K5UA 1ST4A 4O7VA 3QWKA 3I1AA 4GUBA 1PW2A 4IWDA 3QKMA 1QMZA 1MQ4A 3SA0A 2ESMA 5FTOA 4E6QA 4OTPA 2YABA 4BDHA 5IMEA 4FNZA 3DDQA 3FI3A 2B55A 5EYDA 3HV5A 4NKAA 4RQKA 2CKQA 1JPAA 2OWBA 4RMZA 2OKRA 2C0IA 4J96A 1CKIA 5HO7A 1FGIA 2GS2A 4IANA 4WNKA 3K2LA 1ERKA 2C47A 3BZ3A 4EOLA 3I0QA 4J99A 4MXAA 3I4BA 3AT3A 3MFSA 3R2BA 4KAOA 3R7IA 4AN2A 2NP8A 4TL0A 1YWNA 3BLQA 3NAXA 3OTVA 4PV0A 3WIKA 1JSTA 4O4CA 4TKSA 2QD9A 5J7HA 2Q83A 3KN5A 3LZBA 2CN5A 3BI6A 2PVNA 3DJ6A 4YHJA 4GH2A 1JVPP 3D5VA 4BBMA 3ZZWA 3DU8A 2W0JA 2GFSA 3KRRA 3PA4A 4CYIA 4F9AA 2ITXA 4O82A 5CAVA 1M2QA 4H3BA 5I9XA 3NSZA 3NAYA 3TNHA 4HPUE 2BPMA 5KBRA 3GU6A 3VS0A 1RJBA 4LGHA 4YBKA 3TKIA 3VS1A 3QQJA 4XBRA 3GFEA 3II5A 2IVVA 5AUVA 5AUXA 3RM6A 4ITIA 4JR7A 4DCEA 2F7XE 2RG5A 3ZH8A 2Z60A 4QMWA 4S30A 1OBGA 3C13A 4O22A 4QYEA 4J7BA 4BDIA 1ND4A 3ZDIA 2OXXA 2QNJA 4HVHA 2ZDUA 4C4GA 3U9NA 2Z7QA 4JI9A 4MAOA 4N70A 4KBCA 5IH5A 3KF4A 1H28A 4CZUA 3R1NA 1ZZLA 4N0SA 4FSYA 4BYIA 4F99A 3DNDA 3DNEA 1NY3A 3MH0A 3V8TA 4JR3A 2UW3A 4DGMA 4U80A 1Y6BA 4KIPA 5A9UA 5CVHA 1QPEA 2ITUA 3P86A 5DN3A 5KNJA 4RC4A 3KVWA 4USEA 4DT8A 4GMYA 2UZVA 4HNIA 3P78A 4YSMA 5HKMA 4EK5A 4CKIA 4R1YA 2VTMA 2C1AA 3DZQA 5FD2A 5HG8A 2EUFB 4EH9A 1H26A 5DT4A 4UX9A 3IECA 2QI8A 2UW5A 4XG9A 4UMUA 3IDPA 4RRVA 4WUNA 5L3AA 4AOJA 5D7VA 3SC1A 4F6WA 5DH3A 4EKLA 4ALUA 3NS9A 2IZRA 3QZGA 2WELA 3H9FA 4ANNA 4W4XA 1PMUA 4IB0A 5FRIA 3MH2A 5DG5A 2ZB1A 4YLJA 4AFJA 3ENMA 5CEKA 3QGYA 2QHMA 4AXFA 5EK7A 4M13A 1KV2A 2X8DA 4AOTA 2A19B 3HDNA 2UVZA 5JK3A 3Q60A 4BY9E 3JY9A 5DI1A 5EI8A 3LFAA 4MEDA 5FXSA 5M07A 3SG8A 3R7UA 3Q53A 5AP6A 5IU2A 2RFSA 3DJ5A 4O4BB 4FUYA 3BWFA 4F6SA 1RE8A 4XG7A 5KHWA 3H9OA 4CFMA 5J1WA 4FSWA 4FZDB 3IO7A 3OROA 3EB0A 5H8GA 2A2AA 3ODYX 5AV1A 4EYMA 4XJ0A 2JC6A 4L46A 3AC2A 3DDPA 4ANOA 3QCQA 3EHAA 3PZEA 1HOWA 4P2KA 4DFUA 3C51A 5EDPA 1F3MC 2YM6A 5GHVA 4L7FA 3BGPA 4YZCA 5D9HA 3TV6A 2QVSE 3RK7A 3E3PA 4U3ZA 4D28A 2CKEA 2J50A 4QMVA 2UW9A 4ANLA 3DBCA 2FVDA 1YHWA 2XUUA 1MRVA 4O6EA 4ZSEA 3ZSHA 3LFEA 3D7TB 2WNTA 1UA2A 2OLCA 4X7QA 4LOOA 2RFDA 3HV3A 1BYGA 1MP8A 3QD4A 2YIXA 4DH8A 1MRUA 4YTFA 4QP7A 3OXZA 3NGAA 4A4XA 2YCFA 4NUSA 3COIA 2IJMA 3FSFA 5CI6A 4FRFA 4HCVA 5I0BA 2ZV2A 3Q3BA 4BCGA 5JQ5A 3TKUA 4CT1A 1ZXEA 3R83A 1LPUA 3ZO2A 1WVXA 2G2FA 4GS6A 3RNIA 2PY3A 1MQBA 4CT2A 4E6CA 5CAPA 4NL0A 2OZOA 4I4EA 2VGOA 3F3WA 1PXPA 3EN9A 4I1ZA 4DLIA 2XYUA 2EVAA 2UZUE 3H10A 2UZBA 4LUDA 5AV4A 4UYAA 3CY2A 2WMSA 4X2GA 3BBTB 4M69B 2ITZA 2UZDA 4NIFB 3BX5A 3I7CA 2V5QA 4GU6A 4M69A 4IX5A 3RAKA 4TW9A 2OU7A 3NUYA 2XKCA 2X7OA 3EIDA 2WTKC 3OXIA 4D0WA 1W83A 2ZM1A 4ZTHA 5C27A 4YHFA 3WZKA 4IZ5A 4QP2A 1WZYA 2BZIB 3MIAA