5CF8A

Crystal structure of janus kinase 2 in complex with n,n-dicyclopropyl-10-ethyl-7-[(3-methoxypropyl)amino] -3-methyl-3,5,8,10-tetraazatricyclo[7.3.0.0,6] dodeca-1(9),2(6),4,7,11-pentaene-11-carboxamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
292
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of a Highly Selective JAK2 Inhibitor, BMS-911543, for the Treatment of Myeloproliferative Neoplasms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 285
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cf8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cf8A01
3PLSA 1H25A 5IQIA 3UBDA 1J1CA 4O21A 4O2PA 4FSQA 2C6LA 4KKEA 3W2QA 3HP2A 2Z7QA 2Y7JA 5L2TA 4BGQA 4FZ6A 3RZBA 3BE9A 4X2JA 5DR9A 3TI1A 2PE2A 2ESMA 2QURA 2XIZA 5A4TA 3DBQA 3P7CA 3BV3A 3R1SA 4FTCA 4KBAA 4XP3A 3ZC5A 5E4HA 3BHYA 3N9XA 4G3EA 3SKCA 4BDBA 4D9TA 3NLBA 3LAUA 3AC8A 5CU2A 2W1EA 3B2TA 5D7AA 4C34A 2EUFB 2CCHA 2GFCA 3M11A 5H2UA 3FKOA 3ORZA 4FOCA 4O0UA 3TTJA 2OSCA 4QYFA 5KMJA 3MY1A 4CRSA 3TUDA 4E26A 1PXIA 4FSNA 1UU7A 3VUMA 5LMBA 4IANA 4ZS0A 3CGOA 3EIDA 3E8EA 3ZS5A 4MXXA 4EZ5A 3U6HA 1RJBA 2V22A 3I60A 2B9JA 3KL8A 1O6YA 4WUNA 4EH3A 4DGNA 3CCNA 2RFDA 4EYJA 1MQBA 4YJSA 4S34A 4X6RA 5IQEA 2UZUE 4GFOA 5DRBA 4FEVA 3DS6A 3PIZA 4DTAA 1H1WA 1Q61A 4CV8A 1V0PA 4O86A 1VYZA 4FZ7A 4X6QC 4CYJA 4RJ4A 1GOLA 1WBOA 5KMKA 2WTKB 4ID7A 5AP6A 1W7HA 1PXKA 3F69A 4UMTA 2YABA 4DH7A 5CS6A 4G1WA 3LCTA 4X0MA 3EQGA 2Z02A 4OTQA 4F9WA 4TWCA 5AA9A 5AV2A 3VJNA 3DQXA 5KE0A 1UA2A 1OKYA 3KA0A 3P7BA 4HJOA 3CY3A 4G9RA 3LXNA 5DG5A 2PL0A 1SZMA 3V51A 4J95A 2PZ5A 3TEIA 2AC3A 4A4LA 3CEKA 3FMEA 4AGUA 5JKGA 3TN8A 4YJOA 5A54A 3BCEA 2HAKA 3QLFA 1LEZA 3QTQA 5A14A 4AE9A 3NUPA 1YW2A 5E8SA 4XNEA 3Q52A 2YJRA 3R7UA 2QR7A 4QMWA 5F9EA 4YNOA 3FKLA 1YOLA 3HP5A 4YJUA 3I6WA 5JEBA 3DKOA 5D10A 3TZ9A 4YJPA 3BHUA 3FKNA 3QCSA 2OI4X 4D2SA 4TT7A 5HOAA 3CTHA 4O0YA 4JL9A 3II5A 2FSLX 3GC9A 4DEGA 4A9UA 2J0JA 4GT3A 3UVQA 5JFWA 2RGPA 1P14A 3O7LB 2WMVA 4AS0A 2B52A 4EHVA 2R4BA 2OO8X 4M66A 5CVFA 3QRKA 2JDVA 4F6UA 4DA5A 3OROA 4YZ9A 3V5LA 2WTDA 3RNIA 3SHEA 5HZNA 4XV1A 3D2IA 3R01A 3I1AA 2W9FB 3AT2A 1XH4A 1ZAOA 5G1XA 5GHVA 3R8UA 5J9YA 5CWZA 1OECA 2CSNA 3BPRA 3TUBA 2JAVA 2OJIA 3KXHA 4WUAA 2C5YA 3FSKA 3LMGA 3OXTA 3E8NA 2WQOA 3W2PA 5ANKA 2HOGA 4BHNA 3EN6A 4MKCA 2WELA 5FLFA 4ZTMA 3FEGA 3SAYA 3TACA 5IMEA 3U87A 1UKIA 1K3AA 1ZYSA 4B6LA 4DEAA 3H9OA 2VWYA 2WTWA 3LCOA 3NYOA 5LWMA 5KKRB 5HICA 4FG8A 3FQSA 2BRNA 2WNTA 4TW9A 4YLJA 1J1BA 4BFMA 4FKJA 1DAYA 5LOHA 2XNEA 4TWPA 4FT5A 3F7ZA 4MF0A 3R30A 1U54A 2BAQA 4FTIA 4U42A 1EH4A 2NP8A 2UZOA 3Q04A 1A48A 1H0WA 4FVQA 2JDTA 5CEOA 4C3PA 3QCXA 5HLWA 2A19B 2R0IA 3LFEA 1TKIA 3MVMA 3QQUA 4RIWA 3HKOA 1H1QA 4NUSA 3OT8A 2BPMA 4IHPA 2XEYA 3CS9A 3ERKA 2ERZE 2QLUA 2X6DA 4IQ6A 4E5WA 3BKBA 4V05A 1NVRA 3N51A 3ORTA 2PTKA 2DQ7X 3E7OA 4Y73A 4BCIA 5A46A 4FMQA 3EN9A 4LV8A 2ITPA 2YIYA 1H08A 2CDZA 5D11A 4F65A 5A6OA 5E8WA 5TT7A 2I0EA 2QNJA 2YCSA 3F88A 3BBTB 4FUYA 4YTIA 3V8WA 4D2PA 4EOQA 3FMNA 2QG7A 4F9CA 3C0HA 1JBPE 2BZHB 3NDMA 4P90A 5JGDA 4ZMFA 4ONAA 3PPJA 5EG3A 2OJJA 4R6VA 4AF3A 2J50A 4BDCA 3W2RA 4BVUA 3DA6A 2CN8A 3F5XA 2EXMA 5C8KA 3QYWA 2BCJA 4ZJJA 4NL0A 4O96A 5AP5A 3BIZA 4MVFA 4XCUA 3L8XA 2WEVA 5M51A 2XBJA 5FQDC 2OFUA 3EFJA 3NRMA 3HNGA 4R3CA 5GZAA 3ID6C 4EOJA 4RFMA 3HUBA 3CPCA 4W4WA 1YXXA 3VQUA 3G51A 4QO9A 4FTUA 1MRYA 3OZ6A 4AOTA 4JG6A 4HPUE 4O6LA 3VUKA 4AZWA 2VN9A 4I6FA 2X4ZA 3BRBA 4PMPA 1JKSA 3LMIA 4MD8E 2FGIA 4XS2A 5EI8A 1XKKA 2YM6A 3G9NA 5FTGA 2WMWA 2PE1A 3OMVA 4NEUA 5HNIX 3EYHA 3IKAA 4FKUA 5H8EA 1GY3A 4JJRA 2XK3A 1WBTA 5EHLA 2YM3A 1A9UA 3GCSA 3NNXA 3QQLA 1FPUA 4F70A 2XUUA 5G6VA 3FLWA 5CYIA 3TNQB 4EYMA 2FSMX 4P7EA 4IAKA 2WMQA 5CQUA 3BU6A 2PVRA 3ITZA 3JPVA 3HX4A 3LJ0A 1U4DA 1W84A 4R5SA 5CEQA 5FXQA 1OIQA 3JXWA 4I5HA 5C4LA 3DT1A 3HMIA 4EH5A 2WTCA 5BX0A 5KZIA 1E1VA 5HVJA 5IA5A 4O6EA 3BWJA 4FVPA 4RIYB 1RW8A 3UOJA 3MPMA 4YTFA 1XH6A 3FL5A 3O0GA 5AR7A 3VBXA 5KMIA 3VJOA 5E7RA 4BCPA 1PMVA 5H8BA 2XA4A 4U81A 5GNKA 2HENA 4GS6A 2ZJWA 3R2BA 4J1RA 2XYUA 3OUKA 4EH4A 1IA9A 1KOBA 4D0WA 1GAGA 2CGUA 4I6BA 4KSQA 4RVMA 3EZVA 3WF5A 1SVGA 3MVHA 2JIVA 2ZM4A 3ZYAA 3GOPA 5ANJA 5FTOA 1ZWSA 3F5GA 4M14A 2YLEA 3C4ZA 3HV6A 3MBLA 4S31A 5HCYA 2JDRA 2ITTA 4UWYA 2V0DA 5I0BA 2A0CX 2C5OA 2JIIA 2R64A 3MA3A 2VGOA 4BDAA 4EOKA 5J5SA 1CKJA 4H1MA 5HBJA 4UMUA 4QMZA 3PJ2A 2BKKA 3WE4A 4CZYB 2EVAA 5DI1A 3ATTA 4KUJA 3GCVA 5LVNA 3EL8A 2R3JA 3NIEA 3NUUA 3PZEA 5A4QA 3VAPA 3BYOA 2VX1A 3F3TA 1YXSA 3DJ7A 3FZOA 1YHWA 2VWBA 3DQWA 3MA6A 1WCCA 4NZWB 4RGJA 3C4CA 4R7HA 3GVUA 4XG7A 4G9CA 5E90A 4ZY6A 5F95A 3UC3A 4D2TA 1W82A 4FSRA 3D2KA 4ZP5A 2C6DA 5AV1A 4I4FA 4FICA 5HIEA 5DT4A 3R6XA 4CG8A 3HVCA 3NUXA 4LOPA 4FA2A 5CSWA 4AW1A 4S32A 4X3JA 4QP1A 5BPYA 4WT6A 3DKCA 4Y8DA 4C4IA 3GOKA 2R9SA 2F2CB 3PVGA 4ZEGA 1YI3A 4P5QA 2R3OA 4FV3A 3UJGA 4QTCA 4IWDA 1OKZA 5M4FA 4MBJA 5DMZA 2PVKA 4ANMA 4L44A 5JZJA 3TG1A 4X3FC 1KSWA 3GP0A 4PQNA 2GNHA 5D41A 1TQMA 2GCDA 3BYVA 3PJ8A 2C1BA 2JKMA 3QLGA 4IZAA 4USDA 1SM2A 1OKWA 3RCJA 3UO6A 4CMTA 4JI9A 3ALNA 3HL7A 4OT5A 4U5JA 2F57A 5AAGA 3VO3A 2YAAA 1RQQA 4D2RA 4ZOGA 3R04A 3QTUA 5DFPA 5E91A 1PHKA 4IH8A 4W4YA 5CENA 4BDJA 5M06A 2C5NA 5ANGA 3R1YA 3ROCA 3IONA 3MH0A 3TKUA 4E4MA 4MNFA 3R83A 5CQWA 1QPJA 4PPCA 1Y8GA 3SRVA 2XCHA 4FT3A 2E9PA 3OD6X 4E6QA 1YKRA 2YCQA 4E73A 2QO9A 4FT9A 3DKFA 3U54A 2XRWA 3OXZA 4YHJA 4AOIA 3QXPA 3R2YA 3ZO4A 3IW5A 3LQ3A 4D2VA 1H1SA 2WPAA 4FIEA 4MYGA 4ZZMA 5FXRA 4IVAA 1PXMA 1Q8YA 4O1PA 5KBRA 2WTJA 2F2UA 2UW4A 4B4LA 3L9MA 3QD0A 3PDTA 1OL2A 3NEWA 3P23A 4B8MA 1JSUA 5BMMA 4EHGA 3PP1A 2B7AA 4GK2A 2XM9A 3CE3A 4LOOA 4U8ZA 1I44A 3UYTA 4OTIA 4JX7A 4XOYA 5I3OA 3EKNA 3VVHA 4FNZA 3PY0A 4U7ZA 1VYWA 4II5A 3H9RA 4AG8A 3CTQA 3WOWA 2CNUA 5EW3A 2Z2WA 5JK3A 3FJQE 3O23A 2RFEA 5IISA 4AT3A 4NTTA 2IZRA 3HGKA 3EFLA 3AT4A 3AOXA 4APPA 3GFWA 3BZ3A 1G5SA 5AUVA 5FM2A 3TNWA 4FZAB 5JH6A 2C6TA 4YJTA 2XNNA 2YM7A 3BU5A 3TZ8A 5EI2A 5J7HA 5IQCA 3NUNA 4QMTA 4RJ7A 5EM6A 2ITQA 3D7TA 3MWUA 4C4JA 5ANOA 5CAVA 3TUCA 1K2PA 5K0KA 4TYHB 4UALA 3CLYA 4FSMA 2JAMA 4DINA 3FYJX 3TKHA 4HZRA 3MY5A 3GQIA 3WZKA 2IZTA 2WMBA 2JEDA 2CHLA 5K5XA 4O7VA 4CG9A 5FUTA 5AUXA 2VNYA 3UQGA 3U8WA 2HK5A 4CV9A 3WF7A 3S0OA 2UZNA 3NW7A 5EYDA 4A06A 4DE4A 4J96A 3VHEA 1H24A 3C4FA 4LGHA 2OBJA 5DHJA 3R8MA 2CKQA 1CTPE 2DS1A 3CXWA 3OWKA 3A7JA 3IPHA 4K33A 4XUFA 3K54A 3R9OA 3W8QA 1E9HA 2G01A 3R8VA 5ETCA 2HW6A 1O9UA 2YITA 4IZ5A 4RA4A 4DHFA 4ZSGA 4MNEA 4FGBA 2HZIA 3A7IA 2OKRA 4MTAA 3ZDIA 4C7TA 2YZLA 4FKQA 4BWPA 3UPXA 2SRCA 5K4IA 5AM6A 3K3JA 5LVPA 2F7EE 4FK6A 3ULZA 1HCLA 2WOTA 3KRJA 3QQFA 2C3LA 1OL5A 4FR4A 3T9IA 2VUWA 5EYKA 4X21A 4OAUC 2XZSA 3E63A 4QP3A 3LXPA 3NZ0A 3U6JA 3ZU7A 1ZYLA 3VNTA 3NW6A 4E93A 3MSSA 2XCKA 3OOGA 4BDGA 3AGLA 2WIPA 2ZB1A 4NW6A 3UG1A 3UYSA 4QP7A 3VS3A 4QP6A 3GU8A 4EOIA 4KKHA 5HCXA 4UMQA 4BCMA 4PNKA 3MB6A 1WBSA 5IA3A 2C3JA 3BQCA 2EXEA 2R3GA 2YWVA 2BFYA 5CSHA 2GQGA 3E87A 3EN4A 4M7IA 3RK9A 1YDTE 2YFXA 3NWWA 5IMXA 2OGVA 4K18A 3V8SA 3QD4A 4RIXB 4ZTRA 2RKUA 4BN1A 2KTYA 4M3QA 1L3RE 3O2MA 4ZTLA 4YBKA 4O7YA 4N0SA 3CKWA 1WBVA 2RG5A 3QA0A 3Q4ZA 2ZAZA 1V0OA 1KE7A 4L9IA 3SXFA 3H10A 3Q4UA 1H07A 4MBIA 1ZOEA 2PVFA 2UW5A 1LPUA 3DB8A 3OG7A 4GK3A 1LP4A 5EW9A 1XBAA 3KMWA 4QMOA 1PXJA 5DIAA 3OP5A 4EUUA 2EWAA 4BTKA 3RINA 1V0BA 3HECA 3CC6A 3FLZA 3GCPA 2OXYA 3PVBA 1U5RA 3VBTA 4CT1A 1BL7A 4IB0A 4M69B 4GV1A 2GNLA 5FGKA 3HAMA 3QGWA 4Z7GA 3LM0A 4AW0A 4F63A 4KRCA 4U44A 5DVRA 2OICA 3RAKA 4FE2A 5FBOA 2C6OA 5CASA 2JFLA 3QTIA 1ZY5A 2YIRA 5DA3A 5D9HA 1ZOGA 4RX9A 3T9TA 4BBMA 1Y57A 4LUDA 5J8IA 3ZXZA 3FI2A 4WNMA 3RPOA 3SOCA 4EORA 2XJ2A 4GU6A 4QD6A 4PL5A 4NM5A 4X7QA 3QRIA 3HDMA 5FDPA 5L6OA 3IW6A 2QOOA 2X2MA 4FT7A 2PVJA 4C57A 3PZHA 3ZOSA 3VIDA 1JKLA 4RWKA 4LL5A 1UNGA 4BYJA 3FMLA 3B8QA 4AU8A 2J6MA 3QAME 4R5YA 1M17A 3V5WA 2UVYA 4QP9A 3TWJA 2Y0AA 4WOVA 3EQDA 4I20A 3C13A 1JWHA 3PSCA 3HEGA 1YWRA 2V62A 4IAYA 3G33A 3A8XA 3ORXA 5AIRA 5FRIA 1Q8UA 4EC8A 2BALA 3QQGA 5EDQA 4U3YA 5E8XA 4PPAA 3JYAA 3BGPA 4YP8A 5J7BA 4TWOA 2QOCA 1KOAA 4BC6A 1XH9A 3V5JA 4AN9A 2HYYA 4O0TA 2CGVA 4QMQA 4JVGA 4BY9E 3P9JA 3PWDA 3MW1A 4IVDA 3IOKA 3MPTA 2VTTA 4UBAA 3ZTXA 3C1XA 3ZZEA 2IVSA 4GFGA 1FMOE 3KRXA 3W2SA 4F0GA 5L8KA 4EBWA 3HYHA 4XX9A 1FOTA 4UXLA 1WVXA 4NT4A 2PHKA 2P2HA 3FLYA 4HVIA 4X3FA 4LQMA 3BX5A 4U41A 4YSMA 4IFGA 3FI4A 3DB6A 1UU9A 2V7AA 3ODZX 3JS2A 4QPAA 3G9LX 2RIOA 1YHSA 5CF8A 3LCKA 2BTSA 3LFFA 3O7LD 1Q3WA 3UTOA 4ZSEA 3PVWA 3D15A 4CLIA 3QU0A 4QQ5A 5GJGA 5J5TA 2PZRA 4R3RA 3EKKA 3NVKI 2GNFA 5HD7A 3E88A 3LXKA 4OLIA 2G2IA 3DBCA 3EMGA 2ZM1A 4FC0A 4UY9A 5M4IA 4FTJA 4C61A 4IWQA 5CF6A 2JBOA 2O5KA 3E93A 3I79A 2PZIA 3FLSA 2XK4A 3A61A 2OW3A 3MV5A 4GG5A 2FH9A 2VV9A 4XG9A 4DFXE 3GUBA 4IXPA 3EOCA 4YLKA 4PP9A 1P5EA 3HV4A 4I21A 3TJCA 4AZVA 5EQYA 2P0CA 5A4CA 2ETMA 5BNJA 4DG2E 3LXLA 4X2FA 2J9MA 5GINE 4IWPA 1ND4A 3CQEA 5M08A 2PE0A 4BCKA 4EBVA 2WEIA 5K9IA 3CBLA 5KMMA 4YSJA 4BCQA 3MVLA 1GZNA 3DJ5A 3TNIA 4F0FA 1PYXA 3ANRA 4K11A 4GMYA 3ZUUA 4YJVA 4EOOA 3P4KA 4AXAA 4F0IA 1M52A 2BZIB 2FB8A 2YA9A 4NW5A 4EOMA 1AQ1A 2E2BA 3DLZA 2J0MB 3ORMA 4JIAA 2XBAA 3U4WA 3DBDA 4BCFA 1R3CA 2BAKA 2FSOX 3WYYA 3ZFXA 3DBFA 5TOZA 4I0RA 3DTWA 4YR8A 4LRMA 4OT6A 4UB7A 3MIYA 4YZBA 3TJDA 3IO7A 4DCEA 2Q83A 4FEXA 5FEDA 3O71A 3R8ZA 3LOKA 2XNGA 2R3KA 3ACJA 4M97A 3ORLA 3SGCA 4ZMEA 1OI9A 4N4SA 4FSUA 4LRKA 4RIWB 3QCYA 5CNOA 3C4EA 3FMJA 3ZRKA 3TM0A 5E8ZA 5AR4A 4UV0A 4BBFA 4PDOA 2IWIA 5HU3A 5DNRA 3D5WA 3AC4A 4M69A 4O7SA 2JDSA 1G8AA 3BU3A 3NCZA 5AP0A 2X9FA 3IW8A 2QLQA 4XG2A 5FXSA 5KO1A 4W9XA 4FSZA 5F94A 2XK7A 3R9DA 4QT1A 4PWNA 2BVAA 2J2IB 4GRBA 4GYIA 3VW8A 4EKLA 4EWQA 2ZV7A 2B55A 2QI8A 4PP7A 3MN3A 4M8TA 3M42A 4KS7A 2XKDA 3U55A 4AGDA 3NVMB 3CJFA 5CT7A 2XNOA 2CKOA 4BHZA 2X2LA 3BI6A 3EQIA 2J0LA 2X81A 5IUGA 2V55A 4AGWA 5E92A 2QU6A 4BDIA 4RVTA 3F5UA 4TYEA 4CLJA 3ZDUA 3R1NA 4WSYA 3IGGA 3VUDA 3R63A 4EQCA 2H34A 2VTAA 4XBRA 3OWJA 5TKDA 3V5PA 5CEKA 2VNWA 2VTSA 1P4FA 4R78A 4ALUA 4IACA 1PMNA 1JKTA 3MFUA 3I7CA 2R3LA 4H58A 3NNWA 2JITA 4RWLA 2B0QA 2CLXA 3JVSA 3PPZA 1UKHA 1W0XC 2VTNA 5J87A 5M4UA 2JGZA 5M55A 2I7QA 3W18A 1KE9A 3FHIA 3K3IA 5EHOA 4JQEA 2FUMA 3KF7A 4GJ2A 2WMXA 2ITOA 3D5UA 5D7VA 3LLAA 3GNIB 3BLHA 2XIYA 4FVRA 1SYKA 4O84A 4Y85A 4MQ2A 1QPDA 4FBXA 3VS6A 3KGAA 2G1TA 3VHKA 3O51A 3BHHA 5KX8A 2B54A 5HLPA 4FKSA 3RWPA 4AZEA 4O0SA 4CFUA 1PXNA 3FMHA 3L8SA 2OIQA 4EH9A 4C36A 3N4UA 1YOMA 1OUKA 1Q5KA 2I0VA 2W4OA 4CFVA 1NW1A 4FL3A 2XEZA 4BDKA 4CRLA 4LI5A 3TZ7A 2W4KA 3GFEA 2JC6A 3KULB 3ZM4A 3VS5A 4O27B 1E1XA 3A7HA 1ZZ2A 3AQVA 4GIHA 3REPA 5I9ZA 4K2RA 2J7TA 5EDRA 4B9DA 3R7OA 4C4EA 5IA0A 2R7BA 5LXMA 3RTPA 5EI6A 2BRHA 4U6RA 2W5AA 4RBLA 1I09A 4ZLOA 3FHRA 4KA3A 5E1EA 3TKIA 4E6DA 3A99A 3T8OA 3ZSHA 4X2KA 4PY1A 4XP2A 2ZM3A 5CEIA 2BHEA 2WAJA 4M12A 5I9UA 4FTLA 2Y9QA 2YEXA 3FBVA 4RFZA 2UW3A 1Q99A 5CSPA 2GTMA 3PSBA 2XK8A 4O83A 4HCTA 1M7QA 1NVSA 1JKKA 1FINA 2F4JA 1MP8A 2IZUA 4JR7A 4OTHA 5HIDA 4ZAUA 3T3UA 3BELA 2JKOA 4LGDA 2YCFA 2C6EA 5FDXA 2WMRA 2VTJA 3SX9A 3HRFA 4LG4A 1ZMVA 2DUVA 2WMUA 3LJ2A 3OW3A 4YC3A 4FNYA 3O8PA 3RWQA 4KKGA 4ASXA 2VO0A 1S9IA 3QGYA 4TXCA 3WI6A 4EK3A 5HTBA 4V04A 5IH4A 3CJGA 4PDSA 1ZLTA 4MXAA 1PXPA 5CLPA 2QU5A 2X9EA 3KC3A 4EJNA 5I9YA 4PMMA 4GJ3A 4ASEA 4L67A 2BUJA 2E9OA 2F49A 3EQBA 4LM5A 2A27A 4FKOA 4DEDA 5CF4A 5IF1A 4XG8A 2YIWA 4CQGA 1ZMUA 2Z7SA 3VW6A 2R5TA 2YLFA 3DU8A 3DDPA 4FNXA 3WZDA 3Q4CA 3KN5A 4FIFA 4RZVA 3V6RA 4BCGA 5A4LA 2B9FA 3COMA 3OFMA 4AA4A 4XH6A 2FA2A 4ACDA 3U4UA 3TXOA 4ITJA 4MXOA 2PYWA 1UU8A 1OMWA 4QTBA 5EDPA 4C02A 3N4VA 3ORNA 3MDYA 3WIGA 5IEYA 2X7OA 1OPLA 3G6GA 2HXQA 3FV8A 2C3IB 5C01A 5AP1A 3S95A 2XH5A 1UWHA 2J0IA 4D2WA 1U46A 2DYLA 4CKJA 1M2QA 2C6IA 3RPSA 2C3KA 3W16A 4B8LA 2OH4A 4DEIA 5LWNA 3C0IA 4JDIA 3OXIA 2OWBA 1OUYA 1RE8A 2XIKA 5D12A 4ANQA 1OBDA 5HHWA 2O8YA 4FKRA 3MGYA 5JN2A 4A9RA 3QZFA 1FVTA 3WF9A 4IX5A 3PUPA 4C38A 2PVLA 3OF0A 3Q9YA 3FE3A 2DWBA 3AMYA 4GK4A 5DR2A 4PV0A 2VX3A 3KREA 2ZDTA 3PRIA 3A60A 2QCSA 4FUXA 5EM5A 4OBPA 2YHVA 4TYJA 4CFXA 1ZYCA 4ENXA 2PK9A 5DEYA 3SRVB 3UIXA 2W5BA 3DZQA 3R9HA 4TPTA 3NGAA 2YDJA 4CNHA 4Q5EA 2WIHA 4KIKB 4IVBA 1YQJA 3CKXA 3EH9A 1JPAA 1ZY4A 4RRVA 1YXUA 4KIPA 5H3QA 1U5QA 4XBUA 4JS8A 4NCTA 3IOPA 1BX6A 3OTVA 5IKWA 4QP8A 4AGCA 4WNOA 2CGXA 3K5VA 4GFMA 4XG6A 5IDNA 4K0YA 1NVQA 2OF4A 2YJSA 5FM3A 4PL3A 2A2AA 5L2IA 5BQ0A 3COHA 4J99A 3R7YA 2YDKA 4TYGA 3ZFYA 4PRJA 4OBOA 4W4VA 3LIJA 3RI1A 3LKMA 4MXYA 3P79A 3SC1A 3QWKA 4U43A 4EOPA 4A4OA 3U6IA 4FGRA 2WMTA 1W83A 4UYAA 4NKAA 4ZZOA 5CAOA 5IH6A 4Y83A 4PPBA 4I5MA 1PXLA 3A8WA 3FYKX 3MYGA 4BKJA 4UZHA 3HMNA 2R0UA 3R1QA 2OIDA 3VQHA 4DBXA 2VWWA 4CT2A 4C4FA 4YNEA 4YO4A 4L42A 2QODA 5IU2A 4O0WA 3C9WA 4FEQA 2QO7A 5ITAA 5L3AA 1SMHA 4BIBA 4U79A 3ZRMA 4RX5A 4EWHA 1XWSA 5AAFA 3P1AA 5EH0A 4DGGA 2PVMA 2XRUA 4OR5A 4O7TA 3VRZA 4O22A 2W99B 5IQBA 3D7TB 4ZLZA 2X2KA 3DBEA 2IVUA 3KULA 1WMKA 2VTPA 2WMSA 2ZB0A 4IM0A 1G3NA 1J7LA 4XLIA 5CVGA 3EHAA 4ZSLA 4I92A 3OY1A 4DH8A 1BYGA 1UNLA 4MXCA 3PSDA 4A9YA 2VU3A 3I5ZA 2GDOA 4CFFA 3LE6A 5B0XA 3KY2A 2BFXA 3GU6A 4FKWA 4WSQA 4AACA 3ZLWA 4Z16A 3HDNA 5IA4A 1TVOA 4RPVA 3ORPA 5JQ8A 3QBNA 3IDPA 1FBNA 3R7VA 3V01A 4FTNA 3W2CA 4D5HA 1OVEA 2WQNA 3DLSA 5K4JA 4L3LA 4O38A 3TNPC 2VTIA 3DY7A 3LVPA 1DI8A 4YZDA 4PMTA 4LOQA 4USEA 2YZAA 5BVEA 1IEPA 1JNKA 4FKTA 4RLLA 2UZTA 4MNEB 3OCBA 4XP0A 2WB8A 2Z7RA 4IEBA 1R1WA 5AIKA 4P4CA 1WBWA 3POOA 4IDTA 1OIRA 3FZPA 4ERKA 4BR3A 1PJKA 5L2SA 3IQ7A 3CIKA 3WYXA 2WQBA 2W17A 4GVAA 3ENHA 4YTHA 5HI2A 4BZNA 3LQ8A 3UZTA 3W33A 2RF9A 4NM0A 4FODA 3FC2A 3R9NA 3BEGA 2KULA 3QRUA 4G6NA 2ZV8A 4RQKA 4XLVA 4FZFB 4BDHA 4QYYA 5KMNA 5H9BA 3ZM9A 5JMSA 3QC9A 2OXDA 3PRFA 4DG3E 5CSVA 4DH1A 4ZSAA 4RC3A 2I40A 3BBWA 3AD6A 4AFEA 5L8LA 4UWBA 2UW8A 2IW6A 3AT3A 1TQIA 3NNUA 2QOHA 2WTVA 2VX0A 4F6WA 4RT7A 4PX6A 2VAGA 3QL8A 5CZHA 2GS7A 3Q5ZA 4F4PA 4J98A 3C4WA 4JLCA 4MK0A 4O1OA 2PY3A 3BYSA 4PDPA 4WG4A 3VS2A 4BDEA 4C62A 5JGBA 1URWA 4JQ8A 2R3IA 4GUBA 5M44A 4HOKA 2C6MA 4UEUA 5BUJA 3CD8A 4FKVA 3ORKA 4KIOA 3TDVA 1UVRA 3RHKA 3ZLXA 4AN2A 4LFIA 5BMSA 1J91A 3KCFA 5E8YA 4BI2A 2XNPA 3LLTA 4AWIA 5CU0A 2XJ1A 5ETIA 3RGFA 2GTNA 5DEWA 3D94A 3OCGA 1BKXA 2XIRA 2BKZA 3DAJA 1AGWA 2C30A 4I94A 5EKOA 1IR3A 3RK7A 4BB4A 2QOIA 3HMPA 3MTFA 4FTQA 1XHAA 4KAOA 3ZFMA 4BTMA 4EHEA 4F7NA 5HD4A 2X39A 2XK9A 3OBGA 1OZ1A 3OBJA 3PXYA 1OM1A 4TKSA 4YHFA 5DT0A 3EQRA 4G3DA 3TV7A 1UV5A 2YM5A 4LYNA 4MQ1A 3DFAA 5GJFA 3V8TA 4EL9A 3COIA 4K9YA 4U45A 4BKYA 5FD2A 3TCPA 2C0IA 1PMEA 4KIKA 3ZZWA 5I4NA 3AMBA 4NJDA 4RA5A 2QC6A 3UNZA 2G9XA 2YERA 3COKA 4U3ZA 2J0KA 4K77A 5EK7A 2VRXA 5HO6A 5LVLA 2Y4IC 4FKPA 3SV0A 4AZFA 4BGHA 4IMYA 1FVRA 4QMSA 4FV1A 3ZLSA 1KV2A 4H36A 2X1NA 4MWHA 4D1XA 3VBQA 4HCVA 3PLAE 2W1ZA 4CCBA 5AFVA 3A7FA 1H1PA 4MD9E 5LCJA 1ERKA 3R9RA 3LMHA 4DFLA 2EB2A 5IEXA 2XKEA 3Q5IA 3BQRA 3UNKA 5HESA 2CNQA 2OJ9A 3KMMA 4IE9A 5A4EA 2H8HA 5IQHA 4O81A 4IAZA 3DJ6A 4L8MA 4HNFA 4OTRA 3HV3A 4CCUA 4APCA 3SDJA 3DCVA 3MS9A 5LVMA 3NAYA 3RAHA 3P7AA 4IAAA 4JX3A 3KN6A 4NIFA 5IA1A 4KSPA 2R3NA 1W8CA 4C2VA 1Q24A 4Z3VA 4TZRA 4NYEA 3ET7A 3C5UA 4FKIA 4I0TA 4AW2A 4ACCA 1XBBA 4USFA 4BZOA 5IZFA 2PU8A 4OUCA 4FKLA 1XH8A 3VS7A 5T68A 3A2CA 3WZUA 4V01A 4X3FB 2Z8CA 4GSBA 4O7ZA 1LEWA 4DH5A 4C58A 2O3PA 1F3MC 2QD9A 3RPRA 4IX6A 4ZTQA 4DFZE 2BIYA 5I9VA 5KBQA 1MRVA 4UX9A 2QG5A 2W1DA 3EFKA 1ZMWA 1K9AA 4XMOA 1WBNA 4C35A 3PJ3A 3V5TA 4C3FA 2OJFE 5J1WA 4UXQA 3SD0A 1XJDA 3LQ5A 4J8NA 4L00A 3OWPA 3UO5A 4HVSA 5EHYA 3O50A 4HW7A 4F7JA 4FV4A 4WHZA 4JQ7A 2W1GA 3CGFA 2W96B 4S30A 1MQ4A 3P5KA 4UYNA 5AR8A 3BHTA 3KF4A 1YXTA 3L8VA 2ITVA 3S4QA 4FV2A 4GT5A 4YJQA 4JRVA 5LQFA 3U9CA 4FOBA 1B39A 4KABA 4QYGA 2C1AA 3PE1A 3PY3A 4JBQA 5EM8A 3KRWA 3QTRA 2ONLC 4XV2A 3UQFA 5IQFA 1ATPE 1IG1A 3Q53A 1KV1A 4FIJA 2W1CA 2Y4PA 3FQHA 2OJGA 4J8MA 5CSXA 3RALA 3V3VA 4XG4A 3P78A 4ZJVA 4RWJA 3ZC6A 4QMVA 3QUPA 5JRSA 3TDWA 4OTPA 5IUIA 2VTHA 4R1YA 2GSFA 3MFSA 4U0IA 1PKDA 4HYSA 2ETRA 3UP2A 3D14A 5FTQA 4PUZA 4O0VA 4DGMA 5A9UA 4I5PA 4G34A 4NM3A 1PY5A 2WMAA 3G90X 5CAQA 4GU9A 4OAVB 2R3MA 2WGJA 3EQCA 4RC4A 3FI8A 2UZDA 4TY1A 5EYMA 3VWAA 4YU2A 3VS4A 2LAVA 4FZDB 4PTEA 4QTDA 1VEBA 4JBPA 3KB7A 4BI0A 4EK8A 3R73A 1PKGA 3W55A 2BTRA 4E6CA 2O0UA 5HX6A 2GNIA 2YDIA 3FZTA 5FBNC 4ANLA 1BMKA 1OKVA 4FSTA 2CKPA 3NSZA 1H00A 3BLQA 3WE8A 4TNBA 5M57A 4R3PA 4UMPA 4QTEA 5AM7A 5L6WL 2YWPA 2IVTA 2E9VA 4KB8A 2XIXA 4BKZA 2CNVA 3IG7A 4JBOA 3AC1A 5A3XA 5JGAA 4FV0A 1P2AA 1Q97A 3NYNA 2RL5A 4HCUA 2B1PA 5ETFA 4CFMA 3E7VA 3RAIA 4EQMA 3QQJA 1YRPA 3OOMA 3TNHA 3TIZA 3KRRA 3JR1A 2I0YA 3SW7A 4Y46A 4AW5A 3MTLA 1JLUE 3ZHPC 3ZUVA 2QOKA 3PVUA 3I6UA 3KXNA 4HNIA 4L6QA 2ITWA 2IPXA 1M2RA 3R02A 3V6SA 1Q8ZA 3R8PA 4D58A 4ZTNA 4H3PA 5CT0A 1R39A 5CANA 3D4QA 4Z7HA 1JVPP 2W0JA 3O8TA 1T45A 2X8EA 3BHVA 4FV9A 5J1VA 4E20A 2QVSE 4AT4A 4F1TA 1IAJA 3R28A 2PWLA 3LFCA 5E1SA 5FP6A 3UVRA 5K5NA 1IA8A 2ZVAA 5C4KA 5BVDA 1Q8TA 2R2PA 5CI7A 4D0XA 1XO2B 2XJ0A 3GC7A 2VTRA 2XM8A 4BDDA 4QNYA 4RJ8A 1Y6BA 5AJQA 5EW8A 3WF6A 5HBHA 4ANSA 3S1HA 4OTWA 2BDFA 3OCTA 4EK4A 2QHMA 3FZSA 4F08A 4F9YA 3DXPA 5T3QA 2C0TA 3RVGA 3I0OA 1ZYJA 2PMIA 3V5QA 1MUOA 4CTCA 2QQ7A 1RDQE 2YN8A 1KE8A 5KNJA 3RCDA 4MHAA 3KU2A 5I9WA 1ZZLA 4IC7A 2WXVA 1XH5A 4LGGA 4G6LA 4PL4A 4AX8A 1CKPA 1BI8A 4JT3A 4BF2A 4ZZNA 4NSTA 4FT0A 1YXVA 3ETAA 4G3FA 2ZOQA 4U97A 5KZ0A 5HEZA 4AAAA 4J52A 3LFQA 4CMUA 1PW2A 3E3BX 4IDVA 3QC4A 1XR1A 2W05A 2I6LA 3AGMA 3PIXA 2WTIA 4IZYA 5IA2A 3S00A 4EK6A 4DTBA 2UW7A 3LCSA 3QUEA 5DE2A 2ZYBA 3QWJA 4FTKA 3ZH8A 5CEMA 4QQJA 2CGWA 4O2ZA 4E7WA 2LGCA 2NO3A 5FWKK 4YGAA 4YHTA 2PPQA 1X8BA 3E92A 3NUYA 4MF1A 2JLDA 2GQRA 2J5FA 3ENMA 3JVRA 4XV9A 2F9GA 4KD1A 2YAKA 5ACBC 4OW8A 4R7IA 4A4XA 2CLQA 1CMKE 4J97A 4AA0A 1GZKA 3ACKA 3AXWA 3F82A 4R1VA 4XV3A 2OU7A 2J5EA 4S2ZA 4HGSA 1H27A 4JR3A 3EQHA 2NRYA 4UWCA 1YVJA 3RK5A 3CR0A 2Z60A 4YUQA 2Y6OA 3F2AA 1OL1A 2V7OA 3GU7A 4H39A 4QMLA 3RHXA 3SW4A 3UOHA 5DBXA 5FP5A 1Z5MA 4DC2A 2UZWE 4AP7A 4ZY4A 3QX4A 5B2MA 1YDRE 4F1MA 1YWNA 4QMMA 2VGPA 4BCOA 4QMYA 5CALA 2QO2A 3VUHA 1YI4A 2XKCA 2JKQA 4PTGA 3FPQA 5IQGA 2XMYA 1IASA 2QKRA 5DLSA 2BIKB 2ACXA 2H6DA 4XOZA 3ZCLA 3PXRA 5HBEA 3OC1A 3MY0A 4AE6A 4M84A 3Q60A 4WG5A 3F9NA 3L8PA 4I22A 3SLSA 3VF8A 3WBLA 4ACMA 4BL1A 2PUIA 4EOSA 2P55A 4RIOA 5I9XA 4ZJIA 2QOBA 2VO3A 3UNJA 3MH1A 3ALOA 1WFCA 4IB5A 5I3RA 3P0MA 3MH2A 4DITA 1OBGA 4FSYA 2BROA 2VO7A 5HE2A 1OPKA 3EB0A 3F3WA 5KHWA 3DOGA 2H9VA 2OIBA 3CD3A 4L7SA 3FUPA 4DEEA 2HY81 3QFVA 2WZJA 3DXQA 4DFYA 4RC2A 4FV8A 2CKEA 3HRBA 3DAEA 3OVVA 2ZV9A 4DT8A 5AEPA 4KRDA 2BDJA 3LW0A 5HGIA 5CY3A 3AD4A 2WTKC 5K3YA 4F9BA 4O7WA 4FV5A 4UN0C 4BYIA 2W1FA 4X2GA 5E9EA 1SVEA 2HWPA 3PP0A 2C5VA 2BR1A 3A62A 3PFQA 4OTFA 4AFJA 4C33A 4EUTA 5AUTA 2CMWA 3RBWA 4Z55A 4WA9A 4NH1A 3WZEA 2ITNA 3QTSA 4YJNA 2QOFA 3VN9A 4IFCA 2PVYA 5ANEA 4EKKA 3IGOA 4QMXA 3MJ2A 3QZIA 1CSNA 5J9ZA 3QXOA 5DRDA 2XVDA 4MH7A 1GZOA 3ZO1A 3BEAA 1QL6A 4JXFA 2ITUA 4BTFA 4IM2A 4GYGA 4J71A 4ANNA 2BHHA 1P4OA 1NT2A 4FL2A 4CKIA 3MVJA 4GIIA 4O0XA 2C4GA 3PXFA 5EQPA 1STCE 3RPVA 2IN6A 2UV2A 3ZO3A 4HPTE 4PDYA 3BGQA 3LFDA 4FSWA 5BVNA 3WF8A 1XH7A 3RKBA 4N6YA 5CU6A 4R77A 3DTCA 4QPMA 4WBBB 1FQ1B 4IZ7A 3UZPA 2ONLA 3CQUA 2H96A 2XF0A 2XS0A 5ANDA 4C2WA 1G8SA 5AP4A 5M53A 4RJ6A 4E1ZA 2WQMA 2PMLX 4NFMA 4YPDA 2NPQA 3H4JA 4Z9LA 4BGGA 5CF5A 5L6PA 3F6XA 3FPMA 1PRYA 4W9WA 2R3FA 3EN7A 1CM8A 4RG0A 3ZLYA 4TL0A 4JDHA 3GI3A 2Q0BA 3MB7A 4RVLA 3MPAA 5AA8A 3QALE 4M68A 5B2KA 3ZXTA 4M15A 5HTIA 2UW0A 4FTMA 4IBMA 5IEVA 3E8DA 2BAJA 2C47A 4DEBA 4FKGA 3VS1A 3LCDA 3R21A 5JQ5A 3ZRLA 1UWJA 4C37A 4H3QA 4L52A 4WNPA 2YCRA 3UVPA 4G3CA 4EZ7A 4ACHA 4HVGA 4MCVA 3I81A 4FTRA 2PZYA 4LV5A 2FVDA 4JAJA 4DFNA 2UVZA 5KKRC 2CCIA 4D55A 4Q9ZA 3BYUA 1Q8WA 2WFYA 2UUEA 4RVKA 3FXXA 4W8EA 2JD5A 5AX3A 4A9SA 4XG3A 4FV7A 4XRJA 4EH7A 1Q62A 1SNXA 4YBJA 1Y8YA 4D28A 2VTLA 3DXNA 3UO4A 1Q3DA 3PPKA 3FC1X 3QQHA 3FSFA 3DGKA 3L9LA 3A4OX 4GVJA 5IPJA 1QMZA 3KXXA 5EOLA 5JFXA 5BYLA 3O8UA 1DS5A 4FIHA 3F3VA 3IK3A 4C59A 3GU4A 1Y6AA 4FIIA 1T46A 5E8TA 3PIYA 3QZHA 2BMCA 1OL7A 4O0RA 3GXLA 4IAFA 4ZXTA 5JZNA 3UQCA 4DGLC 4M67A 4ZY5A 4RJ3A 3F2RA 2JDOA 3G0FA 3G2FA 4RFYA 4QPSA 3R7EA 3VUTA 5I5ZA 4IB1A 4D1SA 2VTMA 4JIKA 4CD0A 4ZLYA 1JOWB 5GJDA 3Q3BA 3IDBA 3AC3A 2UZBA 5AV0A 5CU4A 4CZUA 4PMSA 4G5PA 1GZ8A 4GT4A 3QD3A 5LCKA 3IW4A 3D0EA 5IQAA 5HO8A 3ZSIA 1YOJA 3IW7A 1M14A 1FMKA 3BGZA 3R7IA 3MH3A 3EZRA 1WVWA 4YZNA 1OB3A 4I6QA 4F1OA 1UNHA 5GZ9A 4I3ZA 5B7VA 4G3GA 2ZMDA 5AP3A 2W06A 4I6HA 4EH2A 4Q5HA 4CFNA 2WO6A 3GC8A 3FDNA 3QD2B 3PWYA 1R0PA 2HZNA 3AD5A 3Q9ZA 4QQCA 4ASZA 4O7RA 2REIA 5BVFA 4FYNA 3S2PA 5CXZA 4BTJA 1PF8A 2X4FA 2P33A 3A7GA 1M2PA 2GNJA 4G6OA 3VBVA 3H30A 4DLJA 3HAVA 2XKFA 4Y95A 2BILB 5AUWA 2BRMA 3SXRA 3U51A 3N4TA 3NPCA 4NFNA 3UOLA 2BDWA 2R3PA 2HIWA 3H0YA 5C8NA 2B9HA 4IC8A 4NWMA 5HE1A 4CSVA 3UE4A 4O82A 5DR6A 5HG8A 4RJ5A 1YDSE 3Q2MA 5HNBA 4CKRA 1JQHA 3L1SA 2X8IA 3QRJA 5GIOE 2I0HA 2X7FA 3KXMA 1APME 3NYVA 3D83A 3GB2A 3RZFA 3UOKA 4JBVA 2ERKA 2R3QA 5BYZA 2JBPA 3QZGA 3W32A 4IX3A 1J7UA 3DAKA 5HQ0A 3THBA 3SG9A 1F0QA 1WZYA 4YZMA 2ZMCA 3AMAA 2HELA 4MWIA 1NA7A 4Q9SA 3TV4A 4ITHA 3O17A 3EWHA 3P08A 1SNUA 2Y6MA 3LFAA 4IADA 3KK9A 4F7SA 3PA5A 4E3CA 4PF4A 2P4IA 3GT8A 4XRLA 5DH3A 4IWOA 4EOLA 5JSMA 2OF2A 4MAOA 4YZCA 5L2QA 2GS6A 4F09A 1QPEA 3VC4A 3LM5A 2X8DA 5AX9A 2O63A 2X6EA 2HXLA 2OFVA 3ULIA 4IJ9A 4C4HA 4F6SA 2VWXA 4YURA 3M1SA 4D9UA 4DEHA 2P2IA 4YLLA 2O2UA 3R7GA 3GC0A 3LFNA 3UGCA 2VWUA 1WAKA 3EQFA 1WVYA 1ZYDA 4ZK5A 4J53A 3HV5A 4W8DA 4NIFB 1YI6A 1KUTA 4TN6A 5GIPE 5HE0A 4QP4A 4NTSA 5TO8A 5A6NA 5FG8A 4HGEA 5DWRA 4I41A 4KWPA 4RLKA 3G5DA 2VD5A 2VTQA 3E8CA 5T6KA 1W98A 4C3RA 3QUDA 1H4LA 3RP9A 3NS9A 3V04A 4ACGA 1BUHA 4R7BA 4HYIA 2OK1A 2XK6A 3K5UA 3KVWA 4ASDA 2QKWB 5BVKA 3PXZA 4KBKA 4CYIA 1ZARA 4BIEA 4D1ZA 5C26A 1OITA 3F2NA 5CAUA 1H1RA 2PZPA 3OWLA 3I0QA 2E9NA 2JKKA 5TR6A 4N70A 2EB3A 2GFSA 4CZTA 4ANOA 3EYGA 2B9IA 4N57A 5DYJA 3E5AA 5CXHA 3GGFA 2UW9A 5EM7A 3VS0A 3JUHA 2HWOA 4BWXA 1VZOA 2VWVA 5HVYA 3UIUA 4RX8A 2QHNA 3QTZA 5TE0A 5CI6A 3G15A 2F7ZE 4CQEA 3HMMA 3Q9WA 5CU3A 4E6AA 4CEGA 4GUEA 1YHVA 4IX4A 5BVOA 4IAIA 1OIYA 3EN5A 5KCVA 2FSTX 1LR4A 5J95A 3L9PA 1Q41A 2RFNA 4A07A 1H0VA 5K0XA 2YM4A 5AUYA 2IVVA 3UP7A 4JOAA 4RQVA 4YC8A 5E8VA 4ZS4A 3DV3A 4E4XA 2QOQA 5LMKC 4H05A 5JT2A 3PA4A 4BBEA 3F5PA 4HGLA 2IJMA 3JY9A 4F99A 3F3ZA 3WZJA 5M09A 3CSVA 4MBLA 4K1BA 4HGTA 3ZMMA 2V5QA 4AQCA 3EL7A 3LFSA 3TV6A 3FL4A 5CX9A 4I23A 4L46A 4ANBA 2WHBA 3BWFA 2AYPA 3VUIA 4DFUA 4EH8A 4EI4A 2XB7A 4FV6A 2ITXA 2HCKA 4LL0A 4B99A 4EONA 2AUHA 1PMUA 2XNMA 4FTAA 3G6HA 5IUHA 3SQQA 5DN3A 3FMDA 3MFTA 4MD7E 4QRCA 3AC5A 3GU5A 3F3UA 1B6CB 4WG3A 4QQTA 2X7GA 3KFAA 2YIXA 3KK8A 3OEFX 2RG6A 5BUIA 2GU8A 3LFBA 4M0ZA 3KCKA 4XYFA 5E8UA 3SXSA 4EZ3A 2JFMA 4QP2A 3GBZA 4L53A 5F4NA 1FVVA 4AOJA 2PVHA 5AADA 4BIDA 1XBCA 3SOAA 2NRUA 3HV7A 2HZ0A 2J4ZA 3Q2JA 2XP2A 3R00A 3FI3A 3NUAA 4O7LA 3ZBFA 3I5NA 4DCAA 1TQPA 3RM6A 4AA5A 4QOXA 4KS8A 2GMXA 5JFSA 2YACA 3KKVA 5CTPA 3UIBA 1Z9XA 5HVKA 4ITIA 2EU9A 4RWIA 3MJ1A 4OTDA 5AR2A 1M7NA 3P86A 3CP9A 5LARA 1QPCA 3ATSA 5L8JA 3ROYA 2BZKB 2UZEA 4AN3A 1Y91A 1H26A 4NKSA 4GG7A 5J9LA 2HZ4A 4LMUA 4YJRA 3POZA 3EJ1A 5C03A 5DOSA 3RPYA 5HLNA 3DNEA 2GS2A 3EFWA 2VWIA 5AAEA 4O7NA 4ARKA 3QTXA 4F7LA 3H9FA 1GIJA 3VUGA 1REJA 1AD5A 3ZO2A 4S33A 3F7WA 2OXXA 3VRYA 4L7FA 5C1QB 4HZSA 3C7QA 3FY2A 2IW8A 5C9CA 1DAWA 4DGOA 5FEEA 4WBOA 2ITZA 3HUCA 5BUEA 4FL1A 4OBQA 4BICA 1A06A 2GPHA 5IH5A 4EQUA 3QX2A 4EC9A 5AV4A 4FTOA 2GHMA 4KIQA 4QMNA 2W4JA 3PTGA 3G0EA 2UZVA 2R7IA 3T3VA 1NY3A 2PMNX 3A4PA 4K6ZA 5BVWA 3TIYA 2YISA 3IS5A 4YO6A 1V1KA 4AUAA 3BV2A 1ZXEA 4FNWA 4QYHA 2OZOA 4ZTHA 1GNGA 3GCUA 2FO0A 1QCFA 4E5AX 3E64A 4ENYA 4WRGA 1O6LA 2B53A 4FG9A 1URCA 3FXZA 3TT0A 4DBNA 3NNVA 4E5BA 1JAMA 3Q96A 4D4RA 4E8AA 2PSQA 3VBYA 4QMPA 4KINA 3C51A 3QRTA 3HA8A 3MIAA 4DH3A 3WARA 4JRNA 3MFRA 1GIHA 4L68A 5LMAA 4PNIA 3ELJA 3QHRA 4NM7A 4Y72A 3RJCA 3NR9A 3QA8A 2C69A 1PYEA 3UIMA 4I0SA 5L2WA 4WIHA 5EQEA 4P2KA 3M2WA 4E4LA 4EJ7A 2BRBA 4YPSA 3CTJA 5DGZA 5AR3A 3BE2A 1CKIA 5AWMA 2WU6A 1KWPA 3EQPA 3UPZA 4BCNA 3PJCA 3W2OA 5HKMA 4D4VA 1KE5A 1FGIA 5CZIA 4ZIMA 1J7IA 4HVHA 4GCJA 4RIYA 1PXOA 2B4SB 3QF9A 3PYYA 5GZ8A 3C0GA 1R78A 2RFSA 1BLXA 3D9VA 3NX8A 5M4CA 2HW7A 3QQKA 2W9ZB 4DG0E 4U9AA 5ETAA 4DF3A 2WD1A 2Y4IB 3JY0A 3LPBA 4LUEA 4XHKB 3RMFA 1H28A 5M56A 2J51A 2BZJA 3OT3A 3LZBA 4GL9A 4O91A 1F5QA 3TZMA 5IG1A 3AG9A 2ETKA 3PG3A 4E4NA 4G17A 4BWKA 1ZRZA 3NCGA 4IM3A 4WO5A 5EFQA 5CEPA 4AZSA 2PULA 2A4LA 4RMZA 1IRKA 3NIZA 4IB3A 5AMNA 5ACKA 2BRGA 5AP2A 3TL8A 4DN5A 2QR8A 2JIUA 1SVHA 3FWQA 4ALWA 3KEXA 1HOWA 1IAHA 1GIIA 5JFVA 4IJPA 3LHJA 5HIBA 3W1FA 4TYIA 2OG8A 4JDJA 4FG7A 2P3GX 3ODYX 3MI9A 4PTCA 3C50A 4G16A 4P5ZA 4GW8A 3C4XA 2W5HA 2CPKE 1YWVA 3FLQA 3R71A 5HTCA 4EEVA 3RNYA 3FXWA 4G31A 4QTAA 1KE6A 3GQLA 3BYMA 2UVXA 3GCQA 2G2FA 3HMOA 3ANQA 3FY0A 2QOLA 3KXGA 3QKLA 1NXKA 4OTGA 3QCQA 3TTIA 3UC4A 5LJJA 3HZTA 4L45A 3KXZA 1HCKA 4GH2A 4XJ0A 3ZEWA 5LVOA 5CAPA 1Z57A 3BLRA 3KRLA 2C6KA 3ZONA 4C8BA 5IDPA 3QKMA 2IW9A 5HG7A 4CMOA 5BYYA 5EOBA 4JDKA 2O65A 4B7TA 1S9JA 3DK3A 4KBCA 4LRJA 4A9TA 2C0OA 2X0GA 3IDCA 3QHWA 3UDBA 3KVXA 4V0GB 3Q9XA 5AV3A 4Y5QA 4DLIA 3GENA 4FX3A 4L3PA 4DTKA 1JSTA 2OZAB 3FQEA 3PG1A 2ZDUA 2WKMA 4M13A 3WIKA 4FF8A 4I1ZA 4YTCA 4L01A 1OIUA 2O64A 1MRUA 4CTBA 5LMKA 5L4QA 3NMUF 1R0EA 2VO6A 2GQSA 2NNWB 5B2LA 2FYSA 3DZOA 3HA6A 3KMUA 4H1JA 4AZTA 3DK6A 4TRLA 5KUPA 4EH6A 2G15A 3OEZA 1H8FA 3W8LA 3NYXA 5KMOA 3SG8A 3B8RA 4WKQA 3RAWA 4G2FA 1BI7A 3WILA 3D5VA 3S3IA 4Y5HA 2UZLA 5KMLA 3PXKA 2OLCA 2VZ6A 3ORIA 4JAIA 4FK3A 5CNNA 4CVAA 3D7ZA 4QMUA 5AUZA 4ERWA 2IG7A 1OPJA 4D4YA 2Y8OA 3VF9A 2VTOA 3K2LA 3OHTA 4DT9A 1BL6A 2ITYA 3C5IA 3DFCB 3LJ1A 2OH0E 1FGKA 3W10A 4CXAA 3FMMA 4U40A 4X2NA 4C0TA 2WQEA 4A7CA 4BZDA 4QYEA 4YC6A 4MX9A 3FAAA 4BCJA 2PUPA 4FEUA 5IQDA 4JG8A 3GEQA 4IIRA 4DYMA 4L43A 3F61A 2A1AB 3PXQA 3OCSA 3Q32A 5M07A 3FLNC 3QYZA 4C4GA 4GEOA 1O6KA 5HU9A 2I1MA 5AP7A 3O96A 5EKNA 4D5KA 1B38A 3AC2A 2VWZA 3F66A 4FIGA 3VBWA 2EXCX 5AUUA 5KHXA 2ZV2A 3FZ1A 5HO7A 1OL6A 2W7XA 3MESA 4TTHB 4TYHA 2GHGA 5DPVA 1VR2A 3KQ7A 3R8LA 3H0ZA 4LMNA 3HLLA 4AT5A 3Q4TA 2HY0A 4N6ZA 1ZOHA 5HG5A 1J3HA 4B0GA 4L3JA 1DI9A 3H3CA 2PVNA 4BCHA 4BI1A 3SVVA 4MXZA 4H3BA 3OUNB 3VULA 2Q0NA 3U9NA 3DDQA 5J79A 5CVHA 3NAXA 1LUFA 3DK7A 3FMKA 4YMJA 3OS3A 4CFWA 5F1ZA 2J90A 4FYOA 5FEQA 2Z7LA 3SA0A 3UMWA 3CPBA 4ZTSA 5ICPA 1DM2A 1UU3A 2QONA 4DFBA 4G5JA 3QKKA 2PMOX 5HORA 1GJOA 4NCTC 2YM8A 4F64A 3UMXA 3UZRA 5TF9A 4TWNA 3D5XA 3Q6WA 3OW4A 4I5CA 5H8GA 4GKHA 1CDKA 3FZRA 4QNAA 3E62A 2E9UA 2WOUA 5ANIA 5DT3A 4J7BA 5HG9A 2C68A 3HRCA 3OTUA 1REKA 5HX8A 2W1HA 5D1JA 4HYHA 4CGAA 3B2WA 2GNGA 5HNGA 3PE2A 2UW6A 4GKIA 4FI1A 2CJMA 4IVCA 4FTTA 4NJ3A 3IECA 4WNKA 3UODA 3CQWA 4XEYA 2G2HA 3UG2A 4F9AA 1VJYA 5C27A 1XQZA 4UMRA 5JRQA 3DKGA 4EK5A 4HVDA 2PUUA 2XYNA 3ZEPA 2IZSA 3OY3A 4I24A 4WD5A 5C8MA 4K8AA 2WU7A 4NU1A 3I7BA 3E3PA 4HYUA 2PUNA 4KNBA 3NUSA 4DAWA 4W4XA 2R3HA 4FEWA 3L9NA 4RIXA 4RZWA 4OGRA 3NW5A 1WBPA 3R22A 3ZSGA 4JG7A 5HE3A 4ALVA 2YIQA 2R3RA 4M0YA 4RSSA 4UZDA 1L8TA 1U59A 3PA3A 4JNWA 4BRXA 3DNDA 2CN5A 4NK9A 5HCZA 3ZBXA 4TNDA 2RSVA 3PJ1A 3QTWA 4I4EA 1U54B 1JSVA 4MEDA 2XNBA 4R8QA 2W1IA 1Q4LA 5AR5A 3I4BA 5F20A 5EYCA 2GHLA 4WRSA 1OGUA 4I93A 4U80A 4RX7A 3PY1A 2AC5A 4V0GA 4BDFA 3CY2A 3Q6UA 4ZSJA 4D4SA 2IO6A 4ORKA 3R0TA 2F7XE 3ZUTA 3RM7A 4IW0A 2OZAA 4Q2AA 1H01A 4EHZA 2C5XA 3DPKA
chains in the Genus database with same CATH superfamily
3PLSA 1H25A 5IQIA 3UBDA 1J1CA 4O21A 4O2PA 4FSQA 2C6LA 4KKEA 3W2QA 3HP2A 2Z7QA 2Y7JA 5L2TA 4BGQA 4FZ6A 3RZBA 3BE9A 4X2JA 5DR9A 3TI1A 2PE2A 2ESMA 2QURA 2XIZA 5A4TA 3DBQA 3P7CA 3BV3A 3R1SA 4FTCA 4KBAA 4XP3A 3ZC5A 5E4HA 3BHYA 3N9XA 4G3EA 3SKCA 4BDBA 4D9TA 3NLBA 3LAUA 3AC8A 5CU2A 2W1EA 3B2TA 5D7AA 4C34A 2EUFB 2CCHA 2GFCA 3M11A 5H2UA 3FKOA 3ORZA 4FOCA 4O0UA 3TTJA 2OSCA 4QYFA 5KMJA 3MY1A 4CRSA 3TUDA 4E26A 1PXIA 4FSNA 1UU7A 3VUMA 5LMBA 4IANA 4ZS0A 3CGOA 3EIDA 3E8EA 3ZS5A 4MXXA 4EZ5A 3U6HA 1RJBA 2V22A 3I60A 2B9JA 3KL8A 1O6YA 4WUNA 4EH3A 4DGNA 3CCNA 2RFDA 4EYJA 1MQBA 4YJSA 4S34A 4X6RA 5IQEA 2UZUE 4GFOA 5DRBA 4FEVA 3DS6A 3PIZA 4DTAA 1H1WA 1Q61A 4CV8A 1V0PA 4O86A 1VYZA 4FZ7A 4X6QC 4CYJA 4RJ4A 1GOLA 1WBOA 5KMKA 2WTKB 4ID7A 5AP6A 1W7HA 1PXKA 3F69A 4UMTA 2YABA 4DH7A 5CS6A 4G1WA 3LCTA 4X0MA 3EQGA 2Z02A 4OTQA 3W0SA 4F9WA 4TWCA 5AA9A 5AV2A 3VJNA 3DQXA 5KE0A 1UA2A 1OKYA 3KA0A 3P7BA 4HJOA 3CY3A 4G9RA 3LXNA 5DG5A 2PL0A 1SZMA 3V51A 4J95A 2PZ5A 3TEIA 2AC3A 4A4LA 3CEKA 3FMEA 4AGUA 5JKGA 3TN8A 4YJOA 5A54A 3BCEA 2HAKA 3QLFA 1LEZA 3QTQA 5A14A 4AE9A 3NUPA 1YW2A 5E8SA 4XNEA 3Q52A 2YJRA 3R7UA 2QR7A 4QMWA 5F9EA 4YNOA 3FKLA 4DHZA 1YOLA 3HP5A 4YJUA 3I6WA 5JEBA 3DKOA 5D10A 3TZ9A 4YJPA 3BHUA 3FKNA 3QCSA 2OI4X 4D2SA 4TT7A 5HOAA 3CTHA 4O0YA 4JL9A 3II5A 2FSLX 3GC9A 4DEGA 4A9UA 2J0JA 4GT3A 3UVQA 5JFWA 2RGPA 1P14A 3O7LB 2WMVA 4AS0A 2B52A 4EHVA 2R4BA 2OO8X 4M66A 5CVFA 3QRKA 3ML1A 2JDVA 4F6UA 4DA5A 3OROA 4YZ9A 3V5LA 2WTDA 3RNIA 3SHEA 5HZNA 4XV1A 3D2IA 3R01A 3I1AA 2W9FB 3AT2A 1XH4A 1ZAOA 5G1XA 5GHVA 3R8UA 5J9YA 5CWZA 1OECA 4DDIA 2CSNA 3BPRA 3TUBA 2JAVA 2OJIA 3KXHA 4WUAA 2C5YA 3FSKA 3LMGA 3OXTA 3E8NA 2WQOA 3W2PA 5ANKA 2HOGA 4BHNA 3EN6A 4MKCA 2WELA 5FLFA 4ZTMA 3FEGA 3SAYA 3TACA 5IMEA 3U87A 1UKIA 1K3AA 1ZYSA 4B6LA 4DEAA 3H9OA 2VWYA 2WTWA 3LCOA 3NYOA 3KIOC 5LWMA 5KKRB 5HICA 4FG8A 3FQSA 2BRNA 2WNTA 4TW9A 4YLJA 1J1BA 4BFMA 4FKJA 1DAYA 5LOHA 2XNEA 4TWPA 4FT5A 3F7ZA 4MF0A 3R30A 1U54A 2XANA 2BAQA 4FTIA 4U42A 1EH4A 2NP8A 2UZOA 3Q04A 1A48A 1H0WA 4FVQA 2JDTA 5CEOA 4C3PA 3QCXA 5HLWA 2A19B 2R0IA 3LFEA 1TKIA 3MVMA 3QQUA 4RIWA 3HKOA 1H1QA 4NUSA 3OT8A 2BPMA 4IHPA 2XEYA 3CS9A 3ERKA 2ERZE 2QLUA 2X6DA 4IQ6A 4E5WA 3BKBA 4V05A 1NVRA 3N51A 3ORTA 2PTKA 2DQ7X 3E7OA 4Y73A 4BCIA 5A46A 4FMQA 3EN9A 4LV8A 2ITPA 2YIYA 1H08A 2CDZA 5D11A 4F65A 5A6OA 5E8WA 5TT7A 2I0EA 2QNJA 2YCSA 3F88A 3BBTB 4FUYA 4YTIA 3V8WA 4D2PA 4EOQA 3FMNA 2QG7A 4F9CA 3C0HA 1JBPE 2BZHB 3NDMA 4P90A 5JGDA 4ZMFA 4ONAA 3PPJA 5EG3A 2OJJA 4R6VA 4AF3A 2J50A 4BDCA 3W2RA 4BVUA 3DA6A 2CN8A 3F5XA 2EXMA 5C8KA 3QYWA 2BCJA 4ZJJA 4NL0A 4O96A 5AP5A 3BIZA 4MVFA 4XCUA 3L8XA 2WEVA 5M51A 2XBJA 5FQDC 2OFUA 3EFJA 3NRMA 3HNGA 4R3CA 5GZAA 3ID6C 4EOJA 4RFMA 3HUBA 3CPCA 4W4WA 1YXXA 3VQUA 3G51A 4QO9A 4FTUA 1MRYA 3OZ6A 4AOTA 4JG6A 4HPUE 4O6LA 3VUKA 4AZWA 2VN9A 4I6FA 2X4ZA 3BRBA 4PMPA 1JKSA 3LMIA 4MD8E 2FGIA 4XS2A 5EI8A 1XMLA 1XKKA 2YM6A 3G9NA 5FTGA 2WMWA 2PE1A 3OMVA 4NEUA 5HNIX 3EYHA 3IKAA 4FKUA 5H8EA 1GY3A 4JJRA 2XK3A 1WBTA 5EHLA 2YM3A 1A9UA 3GCSA 3NNXA 3QQLA 1FPUA 4F70A 2XUUA 5G6VA 3FLWA 5CYIA 3TNQB 4EYMA 2FSMX 4P7EA 4IAKA 2WMQA 5CQUA 3BU6A 2PVRA 3ITZA 3JPVA 3HX4A 3LJ0A 1U4DA 1W84A 4R5SA 5CEQA 5FXQA 1OIQA 3JXWA 4I5HA 5C4LA 3DT1A 3HMIA 4EH5A 2WTCA 5BX0A 5KZIA 1E1VA 5HVJA 5IA5A 4O6EA 3BWJA 4FVPA 4RIYB 1RW8A 3UOJA 3MPMA 4YTFA 1XH6A 3FL5A 3O0GA 5AR7A 3VBXA 5KMIA 3VJOA 5E7RA 4BCPA 1PMVA 5H8BA 2XA4A 4U81A 5GNKA 2HENA 4GS6A 2ZJWA 3R2BA 4J1RA 2XYUA 3OUKA 4EH4A 1IA9A 1KOBA 4D0WA 1GAGA 2CGUA 4I6BA 4KSQA 4RVMA 3EZVA 3WF5A 1SVGA 3MVHA 2JIVA 2ZM4A 3ZYAA 3GOPA 5ANJA 5FTOA 1ZWSA 3F5GA 4M14A 2YLEA 3C4ZA 3HV6A 3MBLA 4S31A 5HCYA 2JDRA 2ITTA 4UWYA 2V0DA 5I0BA 2A0CX 2C5OA 2JIIA 2R64A 3MA3A 2VGOA 4BDAA 4EOKA 5J5SA 1CKJA 4H1MA 5HBJA 2NYAA 4UMUA 4QMZA 3PJ2A 2BKKA 4DHIB 3WE4A 4CZYB 2EVAA 5DI1A 3ATTA 4KUJA 3GCVA 5LVNA 3EL8A 1TZDA 2R3JA 3NIEA 3NUUA 3PZEA 5A4QA 3VAPA 3BYOA 2VX1A 3F3TA 1YXSA 3DJ7A 3FZOA 1YHWA 2VWBA 3DQWA 3MA6A 1WCCA 4NZWB 4RGJA 3C4CA 4R7HA 3GVUA 4XG7A 4G9CA 5E90A 4ZY6A 5F95A 3UC3A 4D2TA 1W82A 4FSRA 3D2KA 4ZP5A 2C6DA 5AV1A 4I4FA 4FICA 5HIEA 5DT4A 3R6XA 4CG8A 3HVCA 3NUXA 4LOPA 4FA2A 5CSWA 4AW1A 4S32A 4X3JA 4QP1A 5BPYA 4WT6A 3DKCA 4Y8DA 4C4IA 3GOKA 2R9SA 2F2CB 3PVGA 4ZEGA 1YI3A 4P5QA 2R3OA 4FV3A 3UJGA 4QTCA 4IWDA 1OKZA 5M4FA 4MBJA 5DMZA 2PVKA 4ANMA 4L44A 5JZJA 3TG1A 4X3FC 1KSWA 3GP0A 4PQNA 4QDEA 2GNHA 5D41A 3TMOA 1TQMA 3AKLA 2GCDA 3BYVA 3PJ8A 2C1BA 2JKMA 3QLGA 4IZAA 4USDA 1SM2A 1OKWA 3RCJA 3UO6A 4CMTA 4JI9A 3ALNA 3HL7A 4OT5A 4U5JA 2F57A 5AAGA 3VO3A 2YAAA 1RQQA 4D2RA 4ZOGA 3R04A 3QTUA 5DFPA 5E91A 1PHKA 4IH8A 4W4YA 5CENA 4BDJA 5M06A 2C5NA 5ANGA 3R1YA 3ROCA 3IONA 3MH0A 3TKUA 4E4MA 2X0OA 4MNFA 3R83A 5CQWA 1QPJA 4PPCA 1Y8GA 3SRVA 2XCHA 4FT3A 2E9PA 3OD6X 4E6QA 1YKRA 2YCQA 4E73A 2QO9A 4FT9A 3DKFA 3U54A 2XRWA 3OXZA 4YHJA 4AOIA 3QXPA 3R2YA 3ZO4A 3IW5A 3LQ3A 1G8JA 4D2VA 1H1SA 2WPAA 4FIEA 4MYGA 4ZZMA 5FXRA 4IVAA 1PXMA 1Q8YA 4O1PA 5KBRA 2WTJA 4AXCA 2F2UA 2UW4A 4B4LA 3L9MA 3QD0A 3PDTA 1OL2A 3NEWA 3P23A 4B8MA 1JSUA 5BMMA 4EHGA 3PP1A 2B7AA 4GK2A 2XM9A 3CE3A 4LOOA 4U8ZA 1I44A 3UYTA 4OTIA 4JX7A 4XOYA 5I3OA 3EKNA 3VVHA 4FNZA 3PY0A 4U7ZA 1VYWA 4II5A 3H9RA 4AG8A 3CTQA 3WOWA 2CNUA 5EW3A 2Z2WA 5JK3A 3FJQE 3O23A 2RFEA 4BJJB 5IISA 4AT3A 4NTTA 2IZRA 3HGKA 3EFLA 3AT4A 3AOXA 4APPA 3GFWA 3BZ3A 1G5SA 5AUVA 5FM2A 3TNWA 4FZAB 5JH6A 2C6TA 4YJTA 2XNNA 2YM7A 3BU5A 3TZ8A 5EI2A 5J7HA 5IQCA 3NUNA 4QMTA 4RJ7A 5EM6A 2ITQA 3D7TA 3MWUA 4C4JA 5ANOA 5CAVA 3TUCA 1K2PA 5K0KA 4TYHB 4UALA 3CLYA 4FSMA 2JAMA 4DINA 3FYJX 3TKHA 4HZRA 3MY5A 3GQIA 3WZKA 2IZTA 2WMBA 2JEDA 2CHLA 5K5XA 4O7VA 4CG9A 5FUTA 5AUXA 2VNYA 3UQGA 3U8WA 2HK5A 4CV9A 3WF7A 3S0OA 2UZNA 3NW7A 5EYDA 4A06A 4DE4A 4J96A 3VHEA 1H24A 3C4FA 4LGHA 2OBJA 5DHJA 3R8MA 2CKQA 1CTPE 2DS1A 3CXWA 3OWKA 3A7JA 3IPHA 4K33A 4XUFA 3K54A 3R9OA 3W8QA 1E9HA 2G01A 3R8VA 5ETCA 2HW6A 1O9UA 2YITA 4IZ5A 4RA4A 4DHFA 4ZSGA 4MNEA 4FGBA 4AQKA 2HZIA 3A7IA 2OKRA 4MTAA 3ZDIA 4C7TA 2YZLA 4FKQA 4BWPA 3UPXA 2SRCA 5K4IA 5AM6A 3K3JA 5LVPA 2F7EE 4FK6A 3ULZA 1HCLA 2WOTA 3KRJA 3QQFA 2C3LA 1OL5A 4FR4A 3T9IA 4DDGA 2VUWA 5EYKA 4X21A 4OAUC 2XZSA 3E63A 4QP3A 3LXPA 3NZ0A 3U6JA 3ZU7A 1ZYLA 3VNTA 3NW6A 4E93A 3MSSA 2XCKA 2XARA 3OOGA 4BDGA 3AGLA 2WIPA 2ZB1A 4NW6A 3UG1A 3UYSA 4QP7A 3VS3A 4QP6A 3GU8A 4EOIA 4KKHA 5HCXA 4UMQA 4BCMA 4PNKA 3MB6A 1WBSA 5IA3A 2C3JA 3BQCA 2EXEA 2R3GA 2YWVA 2BFYA 5CSHA 2GQGA 3E87A 3EN4A 4M7IA 3RK9A 1YDTE 2YFXA 3NWWA 5IMXA 2OGVA 4K18A 3V8SA 3QD4A 4RIXB 4ZTRA 2RKUA 4BN1A 2KTYA 4M3QA 1L3RE 3O2MA 4ZTLA 4YBKA 4O7YA 4N0SA 3CKWA 1WBVA 2RG5A 3QA0A 3Q4ZA 2ZAZA 1V0OA 1KE7A 4L9IA 3SXFA 3H10A 3Q4UA 1H07A 4MBIA 1ZOEA 2PVFA 2UW5A 1LPUA 3DB8A 3OG7A 4GK3A 1LP4A 5EW9A 1XBAA 3KMWA 4O4BB 4QMOA 1XMMA 1PXJA 5DIAA 3OP5A 4EUUA 2EWAA 4BTKA 3RINA 1V0BA 3HECA 3CC6A 3FLZA 3GCPA 2OXYA 3PVBA 1U5RA 3VBTA 4CT1A 1BL7A 4IB0A 4M69B 4GV1A 2GNLA 5FGKA 3HAMA 3QGWA 4Z7GA 3LM0A 4AW0A 4F63A 4KRCA 4U44A 5DVRA 2OICA 3RAKA 4FE2A 5FBOA 2C6OA 5CASA 2JFLA 3QTIA 1ZY5A 2YIRA 5DA3A 5D9HA 1ZOGA 4RX9A 3T9TA 4BBMA 1Y57A 4LUDA 5J8IA 3ZXZA 3FI2A 4WNMA 3RPOA 3SOCA 4EORA 2XJ2A 4GU6A 4QD6A 4PL5A 4NM5A 4X7QA 3QRIA 3HDMA 4FJVA 5FDPA 5L6OA 3IW6A 2QOOA 2X2MA 4FT7A 2PVJA 4C57A 3PZHA 3ZOSA 3VIDA 1JKLA 4RWKA 4LL5A 1UNGA 4BYJA 3FMLA 3B8QA 4AU8A 2J6MA 3QAME 4R5YA 1M17A 3V5WA 2UVYA 4QP9A 3TWJA 2Y0AA 4WOVA 3EQDA 4I20A 3C13A 1JWHA 3PSCA 1W2FA 3HEGA 1YWRA 2V62A 4IAYA 3G33A 3A8XA 3ORXA 5AIRA 5FRIA 1Q8UA 4EC8A 2BALA 3QQGA 5EDQA 4U3YA 5E8XA 4PPAA 3JYAA 3BGPA 4YP8A 5J7BA 4TWOA 2QOCA 1KOAA 4BC6A 2ZFYA 1XH9A 3V5JA 4AN9A 2HYYA 4O0TA 2CGVA 4QMQA 4JVGA 3BL7A 4BY9E 3P9JA 3PWDA 3MW1A 4IVDA 3IOKA 3MPTA 2VTTA 4UBAA 3ZTXA 3C1XA 3ZZEA 2IVSA 4GFGA 1FMOE 3KRXA 3W2SA 4F0GA 5L8KA 4EBWA 3HYHA 4XX9A 1FOTA 4UXLA 1WVXA 4NT4A 2PHKA 2P2HA 3FLYA 4HVIA 4X3FA 4LQMA 3BX5A 4U41A 4YSMA 4IFGA 3FI4A 4O4DA 3DB6A 1UU9A 2V7AA 3ODZX 3JS2A 4QPAA 3G9LX 4F78A 2RIOA 1YHSA 5CF8A 3LCKA 2BTSA 3LFFA 3O7LD 1Q3WA 3UTOA 4ZSEA 3PVWA 3D15A 4CLIA 3QU0A 4QQ5A 5GJGA 5J5TA 2PZRA 4R3RA 3EKKA 3NVKI 2GNFA 5HD7A 3E88A 3LXKA 4OLIA 2G2IA 3DBCA 3EMGA 2ZM1A 4FC0A 4UY9A 5M4IA 4FTJA 4C61A 4IWQA 5CF6A 2JBOA 2O5KA 3E93A 3I79A 2PZIA 3FLSA 2XK4A 3A61A 2OW3A 3MV5A 4GG5A 2FH9A 2VV9A 4XG9A 4DFXE 3GUBA 4IXPA 3EOCA 4YLKA 4PP9A 1P5EA 3HV4A 4I21A 3TJCA 4AZVA 5EQYA 2P0CA 5A4CA 2ETMA 5BNJA 4DG2E 3LXLA 4X2FA 2J9MA 5GINE 4IWPA 1ND4A 3CQEA 5M08A 2PE0A 4BCKA 4EBVA 2WEIA 5K9IA 3CBLA 5KMMA 4YSJA 4BCQA 3MVLA 1GZNA 3DJ5A 3TNIA 4F0FA 1PYXA 3ANRA 4K11A 4GMYA 3ZUUA 4YJVA 4EOOA 3P4KA 4AXAA 4F0IA 1M52A 2BZIB 2FB8A 2YA9A 4NW5A 4EOMA 1AQ1A 2E2BA 3DLZA 2J0MB 3ORMA 4JIAA 2XBAA 3U4WA 3DBDA 4BCFA 1R3CA 2BAKA 2FSOX 3WYYA 3ZFXA 3DBFA 5TOZA 4I0RA 3DTWA 4YR8A 4LRMA 4OT6A 4UB7A 3MIYA 4YZBA 3TJDA 3IO7A 4DCEA 2Q83A 4FEXA 5FEDA 3O71A 3R8ZA 3LOKA 2XNGA 2R3KA 3ACJA 4M97A 3ORLA 3SGCA 4ZMEA 1OI9A 4N4SA 4FSUA 4LRKA 4RIWB 3QCYA 5CNOA 3C4EA 3FMJA 3ZRKA 3TM0A 5E8ZA 5AR4A 4UV0A 4BBFA 4PDOA 2IWIA 5HU3A 5DNRA 3D5WA 3AC4A 4M69A 4O7SA 2JDSA 1G8AA 3BU3A 3NCZA 5AP0A 2X9FA 3IW8A 2QLQA 4XG2A 5FXSA 5KO1A 4W9XA 4FSZA 5F94A 2XK7A 3R9DA 4QT1A 4PWNA 4DHJA 2BVAA 2J2IB 4GRBA 4GYIA 3VW8A 4EKLA 4EWQA 2ZV7A 2B55A 2QI8A 4PP7A 3MN3A 4M8TA 3M42A 4KS7A 2XKDA 3U55A 4AGDA 3NVMB 3CJFA 5CT7A 2XNOA 2CKOA 4BHZA 2X2LA 3BI6A 3EQIA 2J0LA 2X81A 5IUGA 2V55A 4AGWA 5E92A 2QU6A 4BDIA 4RVTA 3F5UA 4TYEA 4CLJA 3ZDUA 3R1NA 4WSYA 3IGGA 3VUDA 3R63A 4EQCA 2H34A 2VTAA 4XBRA 3OWJA 5TKDA 3V5PA 5CEKA 2VNWA 2VTSA 1P4FA 4R78A 4ALUA 4IACA 1PMNA 1JKTA 3MFUA 3I7CA 2R3LA 4H58A 3NNWA 2JITA 4RWLA 2B0QA 2CLXA 3JVSA 3PPZA 1UKHA 1W0XC 2VTNA 5J87A 5M4UA 2JGZA 5M55A 2I7QA 3W18A 1KE9A 3FHIA 3K3IA 5EHOA 4JQEA 2FUMA 3KF7A 4GJ2A 2WMXA 2ITOA 3D5UA 5D7VA 3LLAA 3GNIB 3BLHA 2XIYA 4FVRA 1SYKA 4O84A 4Y85A 4MQ2A 1QPDA 4FBXA 3VS6A 4LDTA 3KGAA 2G1TA 3VHKA 3O51A 3BHHA 5KX8A 2B54A 5HLPA 4FKSA 3RWPA 4AZEA 4O0SA 4CFUA 1PXNA 3FMHA 3L8SA 2OIQA 4EH9A 4C36A 3N4UA 1YOMA 1OUKA 1Q5KA 2I0VA 2W4OA 4CFVA 1NW1A 4FL3A 2XEZA 4BDKA 4CRLA 4LI5A 3TZ7A 2W4KA 3GFEA 2JC6A 3KULB 3ZM4A 3VS5A 4O27B 1E1XA 3A7HA 1ZZ2A 3AQVA 4GIHA 3REPA 5I9ZA 4K2RA 2J7TA 5EDRA 4B9DA 3R7OA 4C4EA 5IA0A 2R7BA 5LXMA 3RTPA 5EI6A 2BRHA 4U6RA 1VLRA 2W5AA 4RBLA 1I09A 4ZLOA 3FHRA 4KA3A 5E1EA 3TKIA 4E6DA 3A99A 3T8OA 3ZSHA 4X2KA 4PY1A 4XP2A 2ZM3A 5CEIA 2BHEA 2WAJA 4M12A 5I9UA 4FTLA 2Y9QA 2YEXA 3FBVA 4RFZA 2UW3A 1Q99A 5CSPA 2GTMA 3BL9A 3PSBA 2XK8A 4O83A 4HCTA 1M7QA 1NVSA 1JKKA 1FINA 2F4JA 1MP8A 2IZUA 4JR7A 4OTHA 5HIDA 4ZAUA 3T3UA 3BELA 2JKOA 4LGDA 2YCFA 2C6EA 5FDXA 2WMRA 2VTJA 3SX9A 3HRFA 4LG4A 1ZMVA 2DUVA 2WMUA 3LJ2A 3OW3A 4YC3A 4FNYA 3O8PA 3RWQA 4KKGA 4ASXA 2VO0A 1S9IA 3QGYA 4TXCA 3WI6A 4EK3A 5HTBA 4V04A 5IH4A 1ST4A 3CJGA 4PDSA 1ZLTA 4MXAA 1PXPA 5CLPA 2QU5A 2X9EA 3KC3A 4EJNA 5I9YA 4PMMA 4GJ3A 4ASEA 4L67A 2BUJA 2E9OA 2F49A 3EQBA 4LM5A 2A27A 4FKOA 4DEDA 5CF4A 5IF1A 4XG8A 2YIWA 4CQGA 1ZMUA 2Z7SA 3VW6A 2R5TA 2YLFA 3DU8A 3DDPA 4FNXA 3WZDA 3Q4CA 3KN5A 4FIFA 4RZVA 3V6RA 4BCGA 5A4LA 2B9FA 3COMA 3OFMA 4AA4A 4XH6A 2FA2A 4ACDA 3U4UA 3TXOA 4ITJA 4MXOA 2PYWA 1UU8A 1OMWA 4QTBA 5EDPA 4C02A 3N4VA 3ORNA 3MDYA 3WIGA 5IEYA 2X7OA 1OPLA 3G6GA 4AXEA 2HXQA 3FV8A 2C3IB 5C01A 5AP1A 3S95A 2XH5A 1UWHA 2J0IA 4D2WA 1U46A 2DYLA 4CKJA 1M2QA 2C6IA 3RPSA 2C3KA 3W16A 4B8LA 2OH4A 4DEIA 5LWNA 3C0IA 4JDIA 3OXIA 2OWBA 1OUYA 2AEGA 1RE8A 2XIKA 5D12A 4ANQA 1OBDA 5HHWA 2O8YA 4FKRA 3MGYA 5JN2A 4A9RA 3QZFA 1FVTA 3WF9A 4IX5A 3PUPA 4C38A 2PVLA 3OF0A 3Q9YA 3FE3A 2DWBA 3AMYA 4GK4A 5DR2A 4PV0A 2VX3A 3KREA 2ZDTA 3PRIA 4O4EA 3A60A 2QCSA 4FUXA 5EM5A 4OBPA 2YHVA 4TYJA 4CFXA 1ZYCA 4ENXA 2PK9A 5DEYA 3SRVB 3UIXA 2W5BA 3DZQA 3R9HA 4TPTA 3NGAA 2YDJA 4CNHA 4Q5EA 2WIHA 4KIKB 4IVBA 1YQJA 3CKXA 3EH9A 1JPAA 1ZY4A 4RRVA 1YXUA 4KIPA 5H3QA 1U5QA 4XBUA 4JS8A 4NCTA 3IOPA 1BX6A 3OTVA 5IKWA 4QP8A 4AGCA 4WNOA 2CGXA 3K5VA 4GFMA 4AXDA 4XG6A 5IDNA 4K0YA 1NVQA 2OF4A 2YJSA 5FM3A 4PL3A 2A2AA 5L2IA 5BQ0A 3COHA 4J99A 3R7YA 2YDKA 4TYGA 3ZFYA 4PRJA 4OBOA 4W4VA 3LIJA 3RI1A 3LKMA 4MXYA 3P79A 3SC1A 3QWKA 4U43A 4EOPA 4A4OA 3U6IA 4FGRA 2WMTA 1W83A 4UYAA 4NKAA 4ZZOA 5CAOA 5IH6A 4Y83A 4PPBA 4I5MA 1PXLA 3A8WA 3FYKX 3MYGA 4BKJA 4UZHA 3HMNA 2R0UA 3R1QA 2OIDA 3VQHA 4DBXA 2VWWA 4CT2A 4C4FA 4YNEA 4YO4A 4L42A 2QODA 5IU2A 4O0WA 3C9WA 4FEQA 2QO7A 5ITAA 5L3AA 1SMHA 4BIBA 4U79A 3ZRMA 4RX5A 4EWHA 1XWSA 5AAFA 3P1AA 5EH0A 4DGGA 2PVMA 2XRUA 4OR5A 4O7TA 3VRZA 4O22A 2W99B 5IQBA 3D7TB 3UDSA 4ZLZA 2X2KA 3DBEA 2IVUA 3KULA 1WMKA 2VTPA 2WMSA 2ZB0A 4IM0A 1G3NA 1J7LA 4XLIA 5CVGA 2AQXA 3EHAA 4ZSLA 4I92A 3OY1A 4DH8A 1BYGA 1UNLA 4MXCA 3PSDA 4A9YA 2VU3A 3I5ZA 2GDOA 4CFFA 3LE6A 5B0XA 3KY2A 2BFXA 3GU6A 4FKWA 4WSQA 4AACA 3ZLWA 4Z16A 3HDNA 5IA4A 1TVOA 4RPVA 3ORPA 5JQ8A 3QBNA 3IDPA 1FBNA 3R7VA 3V01A 4FTNA 3W2CA 4D5HA 1OVEA 2WQNA 3DLSA 5K4JA 4L3LA 4O38A 3TNPC 2VTIA 3DY7A 3LVPA 1DI8A 4YZDA 4PMTA 4LOQA 4USEA 2YZAA 5BVEA 1IEPA 1JNKA 4FKTA 4RLLA 2UZTA 4MNEB 3OCBA 4XP0A 2WB8A 2Z7RA 4IEBA 1R1WA 5AIKA 4P4CA 1WBWA 3POOA 4IDTA 1OIRA 3FZPA 4ERKA 4BR3A 1PJKA 5L2SA 3IQ7A 3CIKA 3WYXA 2WQBA 2W17A 4GVAA 3ENHA 4YTHA 5HI2A 4BZNA 3LQ8A 3UZTA 3W33A 2RF9A 4NM0A 4FODA 3FC2A 3R9NA 3BEGA 2KULA 3QRUA 4G6NA 2ZV8A 4O4CA 5BV3A 4RQKA 4XLVA 4FZFB 4BDHA 4QYYA 5KMNA 5H9BA 3ZM9A 5JMSA 3QC9A 2OXDA 3PRFA 4DG3E 5CSVA 4DH1A 4ZSAA 4RC3A 2I40A 3BBWA 3AD6A 4AFEA 5L8LA 4UWBA 2UW8A 2IW6A 3AT3A 1TQIA 3NNUA 2QOHA 2WTVA 2VX0A 2X0QA 4F6WA 4RT7A 4PX6A 2VAGA 3QL8A 5CZHA 2GS7A 3Q5ZA 4F4PA 4J98A 3C4WA 4JLCA 4MK0A 4O1OA 2PY3A 3BYSA 4PDPA 4WG4A 3VS2A 4BDEA 4C62A 5JGBA 1URWA 4JQ8A 2R3IA 4GUBA 5M44A 4HOKA 2C6MA 4UEUA 5BUJA 3CD8A 4FKVA 3ORKA 4KIOA 3TDVA 1UVRA 3RHKA 3ZLXA 4AN2A 4LFIA 5BMSA 1J91A 3KCFA 5E8YA 4BI2A 2XNPA 3LLTA 4AWIA 5CU0A 2XJ1A 5ETIA 3RGFA 2GTNA 5DEWA 3D94A 3OCGA 1BKXA 2XIRA 2BKZA 3DAJA 1AGWA 2C30A 4I94A 5EKOA 1IR3A 3RK7A 4BB4A 2QOIA 3HMPA 3MTFA 4FTQA 1XHAA 4KAOA 3ZFMA 4O4FA 4BTMA 4EHEA