4Q9SA

Crystal structure of human focal adhesion kinase (fak) bound to compound1 (3,5-dihydro[1,2,4]triazino[3,4-c][1,4]benzoxazin-2(1h)-one)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
252
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Selective and Orally Bioavailable Protein Kinase C theta (PKC theta ) Inhibitors from a Fragment Hit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Focal adhesion kinase 1
total genus 79
structure length 252
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4q9sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4q9sA01
3MBLA 3BBTB 3OCGA 5CAVA 3FE3A 3LE6A 4N4SA 4HZSA 2HK5A 3I5NA 1WVYA 1PXKA 4L7FA 3QUEA 5AUZA 1FVVA 3K54A 2YM7A 5I0BA 5L3AA 1R0EA 3EQBA 4X2JA 3BKBA 3O51A 2FB8A 4AZSA 1XBCA 3QX4A 1PXIA 2BDFA 4FKWA 2O64A 3A7FA 3AXWA 3EFKA 3LFSA 3S95A 3I7BA 5I3RA 5AWMA 2R0IA 4HGLA 4ACGA 2PY3A 1YXXA 4XH6A 3R22A 1Q3DA 3KN6A 4I41A 3E8NA 4L43A 3C51A 5D11A 4FIIA 3HZTA 4CNHA 3RNIA 5IQAA 3KY2A 4LUEA 3DLZA 4XP3A 4GYIA 4YLJA 4EH8A 1H00A 4ARKA 2XK7A 4XOYA 4L53A 5AM7A 5J5TA 5CALA 5LVLA 3PXFA 4QTAA 4RC4A 3R9NA 4EUTA 5HVYA 2XK6A 4F1OA 4TWNA 3TUDA 4FNWA 3SLSA 3DXQA 1Q4LA 2OJIA 5BVNA 1ZMWA 4D4VA 4NEUA 3LXKA 4C02A 2OZAB 2F4JA 4JAIA 3I60A 4I23A 4RRVA 3U51A 3NMUF 3EKKA 4L52A 2VTLA 4AT3A 4Y73A 3ELJA 5M44A 4E8AA 3FI4A 4PF4A 5ANGA 5F4NA 5HE0A 1KE6A 4D58A 4NFNA 3LPBA 4PMTA 4HPTE 5BUEA 3F2RA 4QMWA 3R02A 1Q61A 3OOGA 5FXRA 4I5CA 3R8LA 2X9EA 1JSUA 4GRBA 2VWIA 2YJRA 2C6TA 5CSPA 3FI3A 1Q3WA 2E9VA 4XUFA 4TNDA 1PMEA 1W98A 3BYMA 3R71A 1TQMA 3MVHA 3CQWA 5C27A 2ZMCA 4KD1A 4EC8A 4AOIA 3ZYAA 3RAHA 4BKZA 4UMUA 4YP8A 4FTNA 4KKGA 4ZSJA 3V5WA 5HVJA 3FHIA 3BLRA 4YTCA 2YIXA 5DNRA 5LCJA 3KF4A 3FSKA 3LXLA 2HWOA 2JD5A 2KULA 3W8LA 3JXWA 1VR2A 4TN6A 2VTTA 4YLLA 2DUVA 3FY0A 4QMVA 4Z9LA 4C3RA 1PHKA 4FTJA 3GI3A 1W84A 4JQ8A 5JSMA 1UKIA 3TXOA 4ASEA 2ETMA 5TOZA 2C1AA 1WBVA 5CU2A 2GS6A 4ACMA 4DEBA 2YACA 1W8CA 3UNKA 2A4LA 4G3CA 2VWBA 3UYSA 2JAMA 3VUGA 3MFTA 2G2FA 2ITNA 4WUNA 3QBNA 3HRFA 3IONA 3ZFYA 1O6KA 4U3YA 4BYIA 3OW3A 4C33A 5LWMA 3KK9A 2OO8X 4RBLA 1IAHA 4DYMA 3ANQA 2O8YA 3Q96A 5BVFA 2NP8A 2QU6A 3CKWA 2JKQA 3HA8A 4FKVA 3TDVA 4ZY6A 3TL8A 1B6CB 2W17A 3ZOSA 2PYWA 4EHEA 2Z7LA 3POOA 4DEIA 4ANNA 1PF8A 1R3CA 5HNGA 3L8VA 4DTBA 4WNMA 4LGGA 5HCYA 2JGZA 1SNXA 4LL0A 4M97A 3VN9A 2XM8A 2EXCX 3QTRA 4UB7A 5IQBA 5CU0A 3SC1A 4DFXE 2CGXA 3QTWA 5H2UA 3QTSA 4G31A 3H0YA 5AP1A 4KKHA 3FLZA 3U87A 1MQ4A 4QMYA 3QRJA 3MTFA 3ZLWA 3AT2A 4BCMA 5JGAA 3C1XA 5HBHA 5IUIA 4ENYA 5K3YA 2NPQA 4D2RA 3H3CA 4N6YA 4QMUA 3KU2A 3TV4A 1R1WA 4AOJA 1M14A 3O8PA 4BCJA 3GENA 5IDPA 4YZ9A 4GEOA 2X6DA 4D2TA 1V0PA 4AS0A 5BX0A 5CI7A 5IA5A 5KMMA 2OJFE 3NSZA 1SVGA 2I6LA 4BDJA 4W9XA 4A9UA 4G2FA 4EH4A 1CKPA 5FEQA 1XH8A 4KSPA 2HCKA 3R01A 3P79A 3RAKA 3BBWA 4JDIA 4MBLA 3WYYA 4GU9A 3C4EA 2J6MA 2R7IA 2FSTX 2WTJA 4UMPA 3RNYA 3UQFA 3KGAA 4TYHA 1SMHA 4YC3A 1YHWA 3GU7A 4NSTA 3F7ZA 3F3UA 1Q41A 3ZEWA 3OT3A 2CCIA 4A9YA 4G34A 4N6ZA 4C2WA 3OTUA 4G6LA 3QTXA 4N0SA 3NW7A 1YXSA 3GBZA 3OC1A 3GU4A 3K5UA 5ANJA 5EYMA 1H0VA 1XH6A 2BRNA 2Y6OA 4ZTSA 2O5KA 4BI0A 3FL5A 4RG0A 3IW7A 4FG8A 2ERKA 4IM0A 1U5RA 4U42A 1UA2A 3ZTXA 4ERWA 3V5LA 4Q5HA 4FV2A 1Q8UA 4RFMA 5HX6A 4QP1A 3PVWA 5I4NA 3TNPC 3WF9A 3MB7A 2C6LA 3MFRA 3HV6A 4FUYA 3ACJA 5DRDA 2W1EA 3LIJA 3WF5A 1JSVA 4FT3A 2QU5A 3WIKA 1FMOE 1TQPA 4APCA 2X9FA 4FEXA 3UTOA 3DAJA 4F0FA 4QP9A 2C6IA 3VHEA 2XCKA 5A4CA 5CVGA 4R5SA 2VWXA 3ITZA 4FKJA 1NXKA 1S9IA 1XO2B 2C0OA 5AV4A 5M4FA 4LQMA 3K5VA 4E6AA 1GIHA 3D7TB 4O0SA 4EOIA 2XYNA 3DBCA 3EZVA 3PLSA 4I5HA 3T9IA 4E1ZA 1MRYA 3P86A 4QPMA 4Z55A 3NAXA 4YUQA 4V0GB 1YXTA 4EK4A 3TJDA 2W5BA 4PPBA 4OTWA 3C4XA 4IC7A 3CS9A 3DAKA 2W9ZB 3EQIA 2GNLA 5DI1A 3O7LB 4OUCA 4DITA 5HCXA 3HUBA 4DH5A 4OTIA 5DFPA 2WQNA 3NYNA 3CGOA 4UMRA 3ODZX 4QMXA 3VJOA 5AR3A 4IDVA 5AUWA 2I1MA 3RKBA 4Y72A 4L8MA 4BGHA 1Q8ZA 2HZIA 3EH9A 4FL3A 4CCBA 1GAGA 4IACA 5HE1A 1H24A 5L6OA 2PTKA 4EOMA 1JWHA 4JDHA 5EM6A 4N57A 2HZ4A 4FV3A 4RIYB 1ZARA 2VWVA 2YA9A 3PP1A 5EDRA 2ZJWA 2X81A 2PVNA 3KCKA 3KXZA 4DBNA 2CNUA 2QKRA 5C1QB 3VUMA 4AGCA 4IE9A 4H58A 3FMLA 2YM5A 4F4PA 2XIKA 2R3IA 4AZTA 2RG6A 4EUUA 4JBQA 4K9YA 2R3PA 5E8YA 4RJ6A 5L8KA 3TIYA 2PZPA 4XV2A 3HEGA 3BHYA 2Y9QA 4G1WA 4C37A 1FVTA 1VYZA 3NUSA 3OMVA 3S3IA 5K4IA 5T6KA 4I5PA 1H25A 4RC3A 4EH9A 5CWZA 4WG5A 4DH8A 2WMXA 4F08A 3BPRA 4DEDA 3O96A 1YRPA 4XG2A 3RWPA 3ZLSA 5L6PA 1F5QA 3ZZEA 3QRKA 2UV2A 3PA5A 1OIUA 1JOWB 2E9UA 3BQRA 2QG7A 2R3RA 5CT0A 1WZYA 3VUDA 3QWKA 5AR4A 4AWIA 2PVHA 1GZKA 5B2KA 3NR9A 3OBJA 4O0XA 2QOCA 1LP4A 3FJQE 2WPAA 3POZA 4FV6A 3MIYA 4F1TA 3NUNA 5DR2A 4S2ZA 4Y5QA 2BFXA 3EKNA 3ENMA 1OKVA 2HXLA 3FV8A 1OBGA 3KB7A 4H3PA 2UZUE 3DK3A 2UZTA 4HVHA 5EHOA 3FC1X 5LMKC 4FNYA 2JIVA 2PVKA 1E1VA 1TQIA 3PZEA 4JQEA 4IX3A 3ZONA 3W16A 3OG7A 2F7ZE 3NLBA 2VO0A 4E6QA 3COHA 3ZC6A 4FSWA 3QRTA 4RVLA 2Q0NA 5AX9A 2R3JA 2E9OA 2UVYA 5IA4A 3OD6X 4C0TA 3P4KA 4F9BA 3OFMA 4EH3A 4KA3A 1H8FA 5HLWA 2GNFA 2VGOA 4IJ9A 5BNJA 2J5EA 5B2MA 2JLDA 4OTGA 1GIIA 2JDOA 1K9AA 3OUKA 4L6QA 3TIZA 4B99A 4DHFA 3D0EA 5DOSA 4FZFB 5E9EA 4FL2A 4GT5A 5BPYA 1ND4A 4RQKA 4KKEA 1BX6A 1V0BA 4IAIA 2BUJA 2DYLA 1IASA 4IM3A 5A4TA 4LOOA 3IOKA 3SGCA 4FZ6A 2OG8A 2V7AA 4MH7A 4NL0A 2XUUA 2F2CB 3BU3A 4FNXA 4TRLA 2C5YA 4MF1A 3CTQA 4XBUA 4B6LA 1ZYCA 3NW5A 4B8LA 4BWKA 2Z02A 3G2FA 3U6JA 3C4CA 3KRJA 1P4OA 4I4FA 3DTCA 3TZMA 4CG8A 1BMKA 4WBOA 3H30A 4I6HA 4CLIA 3K3JA 2WGJA 1DI8A 3HRCA 2GNIA 4IB3A 2OIDA 4ZJJA 1WVXA 3CEKA 3DBEA 3WIGA 4X6QC 4O27B 4ZJVA 3ZM4A 4WIHA 4BVUA 3QQGA 3VUKA 4EBWA 4BTMA 1O6YA 4RWKA 4RA5A 4IEBA 4YJPA 1KUTA 3V8WA 4YHJA 4E5BA 5M51A 2J0LA 3FLYA 4BCQA 2XH5A 3MWUA 4IWQA 3Q5IA 4J1RA 2R3LA 4U81A 4R3PA 1MP8A 4CT2A 5HTCA 2WOTA 3H0ZA 3OUNB 4G5JA 4BTJA 2VNWA 1JAMA 4J53A 3RPRA 1KOBA 4J97A 1PXOA 3L1SA 3S0OA 3AC5A 1DS5A 3I0OA 4OBPA 4LYNA 3GT8A 4IAYA 4DGNA 1WBOA 4A7CA 2YCSA 1QPEA 3PFQA 3ROCA 1DAYA 2EU9A 2C5XA 2CLQA 2CDZA 3SA0A 3KL8A 5ITAA 4ZZMA 2Y4IB 5BUJA 4EOJA 1HCKA 3UJGA 3UGCA 3W18A 3FMDA 2X8IA 2QD9A 2UZBA 4BHNA 1KE8A 5J5SA 3ZRKA 5IQFA 2R4BA 4FV7A 5FXSA 4EK8A 2BROA 4IANA 2CPKE 3ZU7A 2VTJA 3ATTA 1NT2A 4LV5A 2X2KA 3ZFMA 5A6OA 4RMZA 5EYKA 5IZFA 3L8PA 2BDWA 3G0FA 4FV0A 4GMYA 4YSJA 2YEXA 1YOJA 3BV3A 3P7BA 2W5AA 3OXIA 4P5ZA 3TKUA 4FVPA 3C0IA 3SXFA 3OXZA 5CAUA 3BHVA 4ZJIA 1BL7A 4EK5A 4NM7A 3O17A 3HMIA 4PP7A 4O2ZA 4Y8DA 5C9CA 4M84A 4CRLA 1UU3A 3GOPA 1A06A 1V0OA 3NUYA 4M7IA 3UIXA 3V5JA 1TKIA 4ACHA 1ZLTA 3FQHA 4C7TA 2REIA 2VWYA 5HI2A 3DK7A 2W5HA 5A14A 3V51A 4TYHB 5AAGA 5EI6A 4TYJA 5E8VA 3LMIA 4CV9A 3RCDA 3PSBA 3A2CA 4IXPA 4A4OA 4AOTA 3PRIA 3N4VA 3DB6A 3S1HA 3IW8A 4OGRA 4UY9A 3D4QA 4FSZA 4FV1A 3BE2A 3D83A 3HA6A 2QLUA 4LMUA 4I4EA 5M4UA 2GNGA 2WKMA 4EOSA 4KBKA 4S32A 2OBJA 4BKJA 5AV2A 5TR6A 3NNUA 4X7QA 3P23A 4YTIA 5BVOA 3WZJA 5JZJA 2QONA 4JOAA 3KRLA 4FOBA 1XWSA 3FZPA 2PVJA 2BVAA 2PZIA 4LGHA 4PTCA 5TKDA 4USEA 2UW7A 5AJQA 4Z7HA 4YBKA 4KIOA 3E7OA 4O91A 5EYCA 2GU8A 3VIDA 2VWUA 5JQ8A 4MD8E 4BF2A 4WHZA 3NNXA 2ITOA 3AD4A 2J5FA 3VRZA 2BHEA 3E93A 4C34A 1PXJA 4NM5A 4KSQA 3U9NA 4A4LA 4JAJA 2IZSA 3C4FA 5CX9A 3C4ZA 4JR7A 5L8JA 2C3KA 5EH0A 3KULB 2GNJA 5CU6A 3UC4A 5D41A 5FTQA 3R8VA 1J3HA 4WG3A 4WKQA 4BB4A 4R3RA 4YNEA 2BIYA 1V1KA 3FQSA 4RA4A 3QHRA 3SV0A 2VTSA 4WD5A 3RHKA 4ALVA 3AD6A 4W4XA 2FH9A 2CCHA 4EOOA 1YWNA 2YCQA 1BUHA 5CQUA 4EH6A 3UO4A 2XIRA 5E8ZA 2J51A 1JNKA 3R2BA 3FL4A 4UXQA 3SW4A 2VO3A 4EORA 5CS6A 1ZYJA 4BWPA 4OTPA 4GUEA 2IVSA 5JFXA 1L8TA 5CEQA 2OZAA 5AR8A 3DGKA 4ASDA 2WMRA 5GJGA 2GSFA 3PA3A 4BICA 4MCVA 4GG5A 4MNFA 2WMTA 1DI9A 2ONLA 1CMKE 1ZY4A 1U5QA 1ZWSA 2XJ1A 3DNDA 3HP2A 3IW6A 3NS9A 3QYWA 4JVGA 4AGWA 4CFVA 5FXQA 4OBOA 3DJ7A 2B1PA 1J7LA 1CKJA 5KUPA 4XJ0A 2HENA 3F2AA 2OXDA 5LMAA 3OWKA 4RIXA 4RGJA 5EOLA 5CEKA 2C3IB 3A4PA 3ZCLA 3OWPA 5CTPA 4WRSA 2PVYA 4C38A 4EONA 3BGZA 3VHKA 1GZ8A 5M4CA 4UXLA 2WELA 3IDCA 5L2QA 5JGBA 2UW6A 4UALA 4IVDA 3WARA 5DVRA 4PNIA 4FSYA 2VTMA 4A07A 4C62A 2RFEA 3E8CA 2OFUA 4DG2E 1M2RA 1U54B 3LW0A 4MXXA 4QMTA 5HU9A 1H28A 2G2HA 2WU6A 4AXAA 4F0GA 3TUBA 4AFJA 4IAFA 2XNBA 4YJRA 4O7ZA 5D7VA 2R3QA 4KBAA 2PUUA 1UWHA 3RP9A 4H3QA 2IWIA 3BEAA 2HYYA 2YLFA 2ZB0A 2UW5A 4PWNA 4IWOA 1CSNA 2X0GA 4IVCA 3CTHA 4OTRA 4DFLA 2ZV9A 3BYSA 3EMGA 3F3ZA 4BI1A 2X6EA 4D1ZA 2O63A 2EWAA 3LQ5A 5LVPA 5IH4A 5EW8A 3W33A 4FSTA 4EHZA 2YIWA 4Q5EA 4I0TA 2B0QA 3FQEA 1FOTA 2EVAA 3HL7A 3KMMA 2XKFA 4I3ZA 4WSQA 3PA4A 3RK9A 4GFMA 4IFGA 1DAWA 4JBOA 2C47A 2C6KA 4FTUA 3RJCA 4CXAA 4BGQA 2XZSA 3ORTA 2VTQA 5JRSA 3R83A 5C4KA 1RE8A 3ZM9A 2I0YA 4FX3A 3D9VA 4YPDA 2VO7A 1OPKA 2GQGA 3LFBA 3F5PA 3RPYA 3FLWA 1M2PA 2UVZA 5ANOA 1UNHA 3U55A 3EQDA 3FXWA 3RK7A 4M67A 1M17A 3N51A 4JIAA 5IA0A 1JSTA 5EQEA 1MRVA 2P4IA 4FKUA 1RW8A 3R00A 5KMNA 3HAVA 3GU5A 3PWDA 2J0JA 3F82A 4K6ZA 3NW6A 3LLAA 4F1MA 1OVEA 3W2SA 3R7YA 2AC3A 3R7OA 2JEDA 2H34A 5FDPA 2QURA 5HIDA 3MH0A 3LFAA 3R30A 5DE2A 2WD1A 4LUDA 4CLJA 2VX0A 3MH3A 3QC9A 1GZOA 3EQRA 4O96A 4GL9A 2P2IA 1KOAA 2WMAA 3R8PA 4NYEA 4BDFA 4C59A 4AU8A 4QO9A 1H26A 3D14A 4DGOA 2CMWA 4D2SA 1UNLA 4A9SA 5DLSA 4PMPA 4LV8A 3KRXA 2QOQA 1PXLA 3LFQA 5M08A 3C0GA 3PZHA 1ZY5A 3AGMA 5J9YA 1OKYA 3OOMA 1X8BA 4RLLA 2YZAA 4QTEA 4UX9A 4ZMEA 1OECA 4ZSLA 5BQ0A 4C4IA 3II5A 4YJNA 3PJ2A 3IGGA 5LVOA 3AGLA 3Q6UA 3Q52A 5KBQA 4RVTA 3BWJA 3CP9A 4C3FA 3C9WA 1CM8A 4F70A 5LXMA 3DY7A 4E93A 1BI7A 2P3GX 2HW7A 4ID7A 3RZFA 5AIRA 3O71A 1OIQA 4L01A 3H4JA 2DS1A 3ORLA 2Y4PA 4QYFA 3H9RA 3R6XA 3H9FA 1Y6BA 2XM9A 4M69A 3HV4A 3A61A 4IB0A 3FLQA 5EW3A 4EOQA 2B54A 3A4OX 2YDKA 1HCLA 4FZDB 4B9DA 2J0MB 4BCHA 1WBWA 3PIXA 4CFFA 2BTRA 4K2RA 4QTCA 5D10A 5KCVA 4O38A 5ACKA 5DHJA 4DFBA 4R8QA 5J9LA 3IS5A 3IKAA 5AAFA 4YSMA 1PXPA 2ITTA 3OWLA 4ITJA 5HG5A 1PMUA 1LUFA 3WZDA 2J90A 3I6UA 5IQGA 4OLIA 3B8RA 5IQIA 3VQUA 2OK1A 3ORPA 2XMYA 5G1XA 4IB1A 4IX4A 4G3EA 4YBJA 3SXSA 2RIOA 4MBJA 1PMNA 3ZUTA 5D12A 4EYJA 4UV0A 1NA7A 5HNBA 4IC8A 2UZEA 5L2IA 2W0JA 3UBDA 3ET7A 4W4YA 3D2KA 3IDBA 2J4ZA 4YTFA 3WE4A 4Q2AA 3FPMA 3COMA 3HV7A 4NTTA 2PE0A 5E92A 2C69A 4UYAA 3SOAA 1KV2A 2W1ZA 3F3TA 4QYEA 5A46A 1YOMA 2ACXA 2WTDA 4Y83A 5ACBC 2VD5A 2CN8A 3FPQA 4BDDA 2XBJA 1A48A 2ZV7A 3DAEA 3JPVA 3PUPA 2G15A 4FF8A 4GFOA 3CJGA 3L9PA 3MFUA 3QZFA 1U4DA 2Z60A 1L3RE 4FKQA 3PXKA 5FEDA 3V5TA 1BYGA 2JDRA 4D0WA 2VX1A 2JDSA 1W82A 4I20A 2Y6MA 3FZOA 3QD0A 4O2PA 2LAVA 3TCPA 3TI1A 4W9WA 2I40A 3U54A 5EOBA 4FTMA 5HCZA 1XR1A 3UQGA 2WQMA 3UPXA 4DH3A 4ZLOA 3FDNA 3PXYA 4D2WA 2H9VA 3Q4UA 3AC1A 4NK9A 1PY5A 2QR8A 2JIUA 4NWMA 4PQNA 4O7NA 4L7SA 3MV5A 2HOGA 3GC7A 4EBVA 2X7FA 3E87A 3TKHA 2BTSA 3OVVA 3PJCA 5HX8A 5JFWA 3ZDIA 4QMOA 4L00A 4G5PA 5ETFA 5A9UA 2OGVA 4HCUA 3CCNA 4RVMA 5AEPA 2J0IA 3VBWA 4YR8A 3NX8A 4RC2A 3TUCA 1URCA 2YDJA 2XB7A 3I1AA 3OY1A 2E2BA 3U4WA 4CYIA 3QCSA 4QMQA 4OAUC 2OSCA 3WZEA 3N4UA 4JRNA 3FEGA 2XRUA 4HGEA 3BYUA 3EN6A 5KZ0A 3WZKA 4E6DA 1NVSA 2JC6A 3KMWA 3R7EA 3V5PA 5CF4A 1DM2A 1GJOA 1H07A 1ZAOA 3LXNA 4E4LA 2XNMA 4QPAA 3E92A 2W1FA 2YCRA 1URWA 3DA6A 5C8NA 4HVGA 3PPZA 3BQCA 3JYAA 4KABA 4MF0A 5DT0A 3TNHA 5A54A 4NIFA 1VEBA 4Z16A 1YDRE 1WMKA 3NCZA 4KS8A 2YM3A 4QQCA 4BWXA 5IEVA 3Q5ZA 1ZYDA 3ZSHA 5JKGA 5LVNA 3L9LA 4ORKA 2QKWB 3FMJA 5I9YA 3ZXTA 5CAQA 4L45A 5JFVA 5AA9A 1IA9A 4PTEA 3UOLA 3E7VA 3GU6A 3TEIA 1FBNA 2Y4IC 4BCFA 4BDAA 4E20A 3LKMA 4MVFA 2WFYA 3MGYA 2CLXA 4FMQA 4CQEA 4X3JA 2ITXA 3P7AA 3GNIB 2NNWB 2PVFA 5T68A 4NW6A 4M15A 4V05A 1Q8YA 3NZ0A 4FSMA 4LRKA 3PYYA 4GVAA 5IQEA 4ANBA 3MVMA 2IZUA 4X3FA 3RZBA 3ZHPC 3NAYA 3PRFA 4FL1A 2A1AB 1JKTA 3RVGA 4I93A 5HICA 2HIWA 1BL6A 3MY0A 4L3LA 3KA0A 1SNUA 5GIOE 2JFLA 3WYXA 4DFZE 2UW3A 3OHTA 4II5A 4KS7A 3ZO1A 4DEGA 4FTAA 4I24A 4DC2A 4RJ7A 5HQ0A 3TWJA 5AM6A 4AW1A 4JLCA 1XH9A 4O0TA 5M56A 4FIEA 2WB8A 3F7WA 5C8KA 1H4LA 4FEUA 3S2PA 4BCNA 4BY9E 1STCE 1VYWA 2SRCA 5GJDA 2VWZA 4HPUE 4XLVA 1H08A 1H1WA 3KK8A 4FUXA 4BKYA 3DV3A 3QA0A 4I21A 3W32A 3Q9ZA 4G9RA 2OIQA 4ZXTA 3IW5A 2XNEA 2X4ZA 2QOHA 2C6MA 1OITA 2Z8CA 4IMYA 4QP2A 3M11A 2V55A 5C01A 4XEYA 2BZIB 5CF5A 1XBAA 3ENHA 2BZKB 3FZSA 5HGIA 5LARA 3RMFA 2FVDA 3JVRA 1RDQE 3ORKA 4S30A 2C0TA 4E7WA 4LG4A 4FEWA 5HD4A 1Q8TA 5CLPA 5LQFA 5BYLA 4DH1A 3QYZA 1RQQA 5L2TA 3EHAA 5FM3A 1GZNA 3VWAA 2RF9A 4CMTA 4O6LA 4FV4A 3GEQA 1YI6A 5LVMA 4C4EA 1GY3A 2XK4A 2BR1A 3UO6A 4EHGA 4J52A 5BYYA 1Q24A 2VTRA 3PJ8A 5CASA 3EQFA 3KFAA 3GOKA 3MA3A 4U43A 4W8EA 4YZCA 1UU8A 2IW8A 4CFXA 4BZDA 4DFUA 2VTNA 4P2KA 1M7NA 3I7CA 2GQRA 2XCHA 2UUEA 4FEVA 2BRMA 4LRMA 3CY3A 5BVEA 3GCQA 4JG8A 2HY81 3UG1A 5AV3A 3FMHA 3D5UA 2QLQA 3JVSA 4FV8A 5AUXA 4D5KA 3DXNA 1YXVA 4F7NA 5J1WA 4R1VA 5JEBA 3R7UA 3E88A 2FSMX 5G6VA 4YU2A 3V5QA 3NIEA 4BZOA 2BIKB 2GFCA 2WMBA 3G9NA 5H8GA 3FBVA 3ZZWA 4HVDA 3SW7A 3R9DA 2Z7SA 4ZTHA 4EWHA 3UZRA 1KE9A 4J95A 3ZO4A 2XP2A 3PJ1A 5E1SA 4BCIA 2QOOA 1G8AA 5KMOA 1GOLA 4L42A 2FSLX 5I3OA 3HECA 4CT1A 3CD3A 3CPBA 4GIHA 2WQBA 4P5QA 4PL4A 2ETKA 3GQLA 3I0QA 1UKHA 4KIKA 3VAPA 3NRMA 4RLKA 3GP0A 2W05A 3PJ3A 2CGUA 3CE3A 3HMOA 4Y5HA 4YHTA 1XQZA 3TNQB 3SHEA 3LLTA 3MDYA 3OEZA 4M0ZA 4TYIA 3WF8A 2YIRA 4WSYA 3VF9A 4BCOA 4C4HA 3ALNA 4G3DA 5CF8A 2X7GA 2F7EE 2I0HA 1OIYA 4BTKA 2R5TA 5LOHA 5HOAA 2NO3A 4PRJA 5GZAA 4IQ6A 4MQ1A 4Y95A 4S31A 3VS1A 3FZ1A 4O0VA 5IUGA 4X3FC 4X6RA 4HYHA 4EQCA 4CKJA 1REKA 1YDSE 4AA4A 3ALOA 4ZAUA 4M13A 2Q83A 1OL6A 2OXYA 2XJ0A 1H27A 3DQXA 4GT3A 3PTGA 4A06A 3KXMA 3EQHA 3SG8A 5CSXA 1Y57A 4GS6A 4IWDA 3T9TA 4QYHA 2YJSA 4XBRA 1OI9A 1XHAA 4AQCA 4FSQA 3U6HA 2WTKC 3GC9A 4FR4A 5GHVA 5KZIA 5IQDA 4U80A 3OT8A 4BGGA 3VC4A 4I6FA 4HJOA 2XEZA 2VNYA 3LFDA 3DKGA 1PJKA 3N4TA 2R7BA 4U41A 3CD8A 2WMVA 2BFYA 3VS0A 2CSNA 4APPA 2WTIA 1LPUA 2JBOA 4YTHA 4C58A 4XMOA 2GS7A 3ZRMA 2A0CX 3EFJA 4DT8A 3SXRA 5IEXA 2Z7RA 4ANSA 4EZ5A 5M57A 4IH8A 2C6OA 4CGAA 3FMEA 3VW6A 4O7RA 2XNNA 3MS9A 3RGFA 3W1FA 5A4EA 4UN0C 3V04A 4IJPA 4TPTA 4OTDA 4PDOA 3EQPA 3SKCA 1UNGA 3OF0A 4J8MA 5IA2A 3EYGA 3KF7A 5CQWA 1UVRA 2B7AA 4AGUA 2I7QA 4MXYA 4B8MA 4K77A 4G6OA 2CNVA 4EOKA 4CCUA 3O50A 3SQQA 3C50A 3QUPA 5FWKK 4DAWA 2PL0A 1KV1A 2PZYA 3CJFA 3ZSGA 5J95A 3OP5A 5KE0A 2XKCA 3V3VA 3DDQA 2GCDA 2H96A 4D1XA 4DFNA 3TDWA 4X2NA 3QQKA 3UOHA 5A4LA 3I4BA 3VBVA 2BCJA 2R9SA 2IJMA 3PPJA 1FGIA 1UWJA 2J7TA 3LQ3A 5HBEA 4EL9A 2PVRA 2X7OA 4CFWA 5M09A 4AN3A 5HD7A 1KWPA 5HIBA 5LWNA 3NVKI 4EH5A 2HXQA 5CNNA 2BAJA 4PY1A 3BIZA 4IVBA 1YXUA 3TT0A 3ZC5A 4L68A 4F9WA 2XNPA 4UZDA 3EZRA 3LM0A 4ZTNA 2OJGA 3ZBFA 1WBNA 2CGWA 2B9HA 4NM0A 1Y8YA 4GYGA 4YGAA 5DEWA 1KE5A 2BALA 2V7OA 3EN9A 3PSDA 5AAEA 4FKTA 2R2PA 3G6HA 3R8MA 2UW9A 3G51A 1Z9XA 5FBOA 2F9GA 2QOIA 3MTLA 3R9HA 3TV7A 4RT7A 4QTDA 2PMOX 5K0XA 4PX6A 5GZ9A 5IISA 3D7ZA 4FKOA 3ERKA 3QRIA 4QNAA 4KIQA 3VBYA 2PUPA 5HEZA 4FGRA 3DTWA 3QQJA 3A62A 3OXTA 4D4SA 3F61A 2XRWA 3AQVA 3P7CA 3CIKA 2ONLC 4LOQA 4WBBB 3WF7A 4E4NA 4FZAB 2B9JA 2IW9A 4TXCA 3PLAE 1T45A 1WCCA 4QMMA 3VBTA 3FXZA 5F1ZA 4YC8A 2PMLX 4G3FA 4M66A 4O0RA 3UQCA 1A9UA 3MFSA 4HVIA 2OFVA 3MH2A 2XNOA 4GSBA 1QMZA 4K0YA 4O22A 5A4QA 2UVXA 2UZDA 4USDA 4EZ3A 4X21A 4L9IA 2NRYA 4FZ7A 3PXQA 4GVJA 4QQJA 3D7TA 2BAQA 2YDIA 3ORIA 4LL5A 3TNWA 5I9ZA 4Z7GA 2WMUA 4QTBA 4UWYA 3KRRA 5DT3A 3W2PA 4O7LA 2KTYA 3QU0A 1XH7A 4HOKA 1J1BA 4F7JA 3PIZA 4TKSA 5F95A 3BX5A 5CSWA 4IADA 5EI8A 5IA1A 3PWYA 3ZXZA 5ETIA 5DG5A 3B2TA 2OICA 5JN2A 3RM6A 3B8QA 4QMPA 4LFIA 4B4LA 5CU3A 4RIWA 5E8UA 2ZOQA 5DYJA 5AMNA 2WXVA 5CVHA 4FI1A 3QX2A 3PSCA 3UYTA 4EOPA 1M7QA 2GMXA 2HY0A 4FT0A 3M1SA 1FVRA 4BDHA 1IG1A 2BRHA 1T46A 5F9EA 3GU8A 3LFNA 4AN2A 2ITPA 5LJJA 2ITWA 1ZXEA 3CGFA 4FTLA 3KVXA 4DN5A 4TYEA 5IH5A 5KBRA 4MXCA 1ZOEA 2QO9A 3FC2A 2VX3A 4QOXA 4U40A 4WUAA 5GNKA 1I44A 3GC8A 3UVPA 2A27A 4ZS4A 3PVGA 4BDEA 4RSSA 1YI3A 4MYGA 2W1IA 3LVPA 4JX7A 1REJA 4NZWB 3EFLA 3GFEA 5EQPA 3QZGA 3MSSA 1XH5A 2ZV2A 2GDOA 3NYXA 3ZEPA 3NUXA 4JI9A 4XLIA 5AIKA 1E1XA 5LMBA 4R1YA 5HNIX 3SRVA 2WOUA 3VS6A 4O0YA 3Q9WA 3DU8A 2ITYA 3LFEA 5HG7A 4U44A 5HE3A 4MTAA 3VUHA 5FTOA 5EHLA 5L4QA 2X8EA 2XF0A 2P0CA 4BZNA 3NUAA 1LR4A 3HAMA 4ZLZA 4O82A 2B9FA 4KRCA 4ANOA 2RG5A 5KKRB 2DQ7X 4FK6A 2JDTA 3CY2A 4BN1A 3QL8A 2W06A 5F20A 3FMKA 3VS7A 5AUTA 3U6IA 1ZYLA 3SVVA 3EN7A 4W4VA 3FYKX 1WBPA 5A3XA 3Q60A 4ZSGA 3T3VA 3QCQA 4C36A 3UZTA 3O0GA 3ZO2A 4EZ7A 5JFSA 2JITA 3QC4A 5BVDA 1WVWA 3H10A 4K11A 1ERKA 2CGVA 4D4RA 4D2VA 5AP7A 3AC8A 2EUFB 3A8WA 5DRBA 5HO6A 1R39A 2YFXA 4D5HA 3R9RA 5GINE 3D94A 2YN8A 3R2YA 2W1HA 4U7ZA 3FKOA 4M68A 3BV2A 3VUTA 2X1NA 3BLHA 1PKDA 3MN3A 4FSNA 2ETRA 2VTIA 4RJ5A 5CEIA 3QD2B 4CMOA 2GHMA 4ZZNA 3WOWA 4G16A 5KKRC 1JKKA 3ZRLA 3GUBA 2XKEA 2OZOA 2R3KA 4Y85A 5CT7A 4FTCA 5E91A 3DT1A 2IVUA 3OY3A 2BDJA 3W8QA 4ZZOA 3HNGA 1Y8GA 4RWJA 5EM8A 2YM6A 4ENXA 1JPAA 2QQ7A 2JKOA 3IPHA 2V0DA 2PZRA 3NNWA 3UO5A 2BPMA 3ATSA 2F57A 5AP6A 1OPLA 4RX9A 5EYDA 3F6XA 5FG8A 4DLJA 4R7BA 1PW2A 5M06A 2G1TA 1QCFA 5CAPA 1ZZ2A 5CSVA 4C2VA 1TVOA 3NIZA 2XIXA 4YPSA 2WEIA 3F5UA 4EOLA 1OB3A 4O7VA 1M52A 3THBA 2C3JA 5BUIA 2WTVA 3QF9A 1IAJA 4F9AA 4CZTA 5DWRA 2WHBA 4AAAA 4F6SA 4RFZA 3WI6A 5C03A 3A7HA 5M53A 3LCOA 3QQHA 1AQ1A 2UW0A 3L9NA 2BRBA 2R0UA 3KMUA 3R7IA 2RFDA 3SX9A 4WNPA 3UE4A 5CZIA 4FG9A 1IEPA 3IECA 4F09A 1IR3A 2W99B 4F7SA 1NW1A 2C68A 4B0GA 5CEOA 2AC5A 4AFEA 5C8MA 5IKWA 4YJUA 4F6WA 5TT7A 3GCPA 4PMSA 3MESA 1F3MC 3MVLA 4FKIA 2R3GA 3ULIA 4DA5A 3IG7A 3R8UA 3QLFA 2FUMA 4O1PA 1APME 3LCSA 4XCUA 4FK3A 2JKKA 3FXXA 3QGYA 5JT2A 3BI6A 5EHYA 2FO0A 4ZTLA 5HKMA 1J1CA 3C7QA 4QMSA 3PVBA 4OTHA 2QOLA 4GH2A 1XH4A 4EWQA 2ZM3A 4KB8A 2CKPA 3NYOA 3KKVA 5IF1A 2F49A 3QAME 4MWHA 3LJ2A 4NFMA 5E8WA 3OEFX 3DJ6A 4C4GA 3Q2MA 4L3JA 3QD3A 3QQLA 3UPZA 3NYVA 3PE2A 4QPSA 2PMIA 3HRBA 5DT4A 3VBQA 4M8TA 3QTQA 4MNEA 2PULA 4R77A 4FVQA 3Q2JA 2W1DA 3HP5A 4XG3A 4CFUA 2PUIA 3BU6A 4MBIA 3KVWA 4KINA 5E8SA 1Q99A 2OW3A 5AV1A 4MEDA 5H3QA 3R7VA 3C0HA 5CU4A 3I79A 3OW4A 4IZAA 1E9HA 4MNEB 5AUVA 3VO3A 4IAZA 4PPAA 4AP7A 4DEEA 4HNIA 3U9CA 2AUHA 3R9OA 4I1ZA 4O86A 4D55A 5EKNA 1G5SA 3ULZA 3BE9A 1FQ1B 3WBLA 4CG9A 3HKOA 2PU8A 2G9XA 4MQ2A 3HX4A 1CTPE 2X2LA 3SAYA 1KSWA 2IO6A 3L8SA 3LJ1A 2YWVA 3TTIA 2WU7A 1QPJA 2ZDUA 4BFMA 1CDKA 3A99A 4UZHA 3CBLA 4BTFA 4YURA 3E62A 4OW8A 5KX8A 4U79A 1B38A 2BMCA 2OXXA 2WIHA 1FINA 3QALE 4X2FA 4AA0A 4Q9SA 4RZWA 4ACDA 5CAOA 4KRDA 5CEPA 4F99A 1R0PA 4CVAA 2HWPA 4RX7A 4D2PA 5BMSA 3C5IA 1CKIA 4EQMA 3QFVA 4XP0A 3CLYA 4G6NA 4ZSAA 3KXNA 4V04A 2J9MA 4RQVA 1OBDA 3E5AA 3F69A 3QXPA 3U8WA 2WQEA 3AMBA 4XHKB 4O7WA 2ZMDA 2VN9A 5D1JA 5M4IA 3F2NA 2WQOA 2CKQA 2C0IA 4BL1A 1WFCA 2XK3A 3UVRA 1Y91A 4EQUA 3SG9A 3EN5A 2BZHB 2IVTA 4FT7A 2VV9A 5DBXA 1IRKA 5AP5A 3D2IA 3KXXA 3LFCA 5CF6A 5FDXA 3UG2A 1SZMA 4YZMA 5E1EA 5KHWA 3PY3A 3RTPA 4M12A 3HDMA 4QP6A 5HORA 5J9ZA 4MK0A 4OTQA 4GV1A 3ZMMA 4ASXA 4ZTMA 3OTVA 5AUUA 3SOCA 3BEGA 2OF4A 3PE1A 5FLFA 4PPCA 4HVSA 4E4MA 1PMVA 4FTQA 2YZLA 1H1PA 4BDIA 3S00A 3OWJA 4IAKA 5E7RA 4EJ7A 4KWPA 3IOPA 2F2UA 4U45A 3OROA 3UOKA 4BDKA 2YITA 3DBFA 4KAOA 5E8TA 5CSHA 5HO8A 2BKKA 3FHRA 1YOLA 3KREA 4HNFA 3GGFA 3DNEA 3FZTA 3NUPA 4MD9E 4RWIA 2QODA 3QCYA 5EK7A 2A2AA 2GPHA 2WTKB 2OU7A 4XX9A 2RKUA 1WBTA 1U59A 4JS8A 4NKAA 3IW4A 3KXGA 3F5GA 4EC9A 5AR5A 1BI8A 5I9UA 2G01A 3CQUA 2JIIA 4IDTA 4YO4A 2YAAA 4CRSA 4R7HA 4C3PA 3PXZA 1YWVA 4V01A 2PSQA 3UMWA 4UMTA 5T3QA 4U3ZA 3AT3A 5FGKA 5AP0A 3ZFXA 4WG4A 3Q4TA 4MKCA 5DEYA 4MD7E 4A4XA 2ITZA 4D9UA 4AW0A 4CZUA 4KUJA 4X3FB 3TTJA 3KCFA 3HV5A 3DB8A 4C57A 2VU3A 4K8AA 4CSVA 4YHFA 3LM5A 3EN4A 5HTBA 3DK6A 1SVEA 2R3MA 4EH7A 3BCEA 3NEWA 4EH2A 3QHWA 4U0IA 4FTTA 2W1GA 2BRGA 4XG7A 3CQEA 3RHXA 5JH6A 2EXMA 4FEQA 2RSVA 2ZV8A 4AE6A 4TWPA 2EXEA 3ETAA 2QOBA 1J91A 4XG9A 5AR7A 4UYNA 4D1SA 4L67A 5IUHA 2FGIA 4A9RA 4DLIA 5KHXA 4JRVA 3FKNA 2VGPA 3ZBXA 4DE4A 4NH1A 4RX5A 4IX6A 3UNZA 2Z2WA 1OL7A 3UMXA 4ZS0A 4HCVA 4HW7A 4YJVA 5AV0A 5AFVA 1U46A 1B39A 2IZTA 4QP8A 4NT4A 3UIUA 4BHZA 4L44A 4QP3A 5AADA 3DPKA 4QYYA 5JK3A 3EJ1A 2BILB 5L6WL 2YHVA 4U8ZA 3VF8A 3ZUVA 3QQUA 2B9IA 4MHAA 1ATPE 3F66A 4IW0A 4RZVA 4UBAA 5LCKA 3RPVA 1UU7A 3Q4ZA 2WNTA 3GFWA 3H9OA 2WAJA 4LMNA 4E26A 4O7SA 1QPCA 2IPXA 3UOJA 2V62A 4FG7A 3TZ9A 2IW6A 4ACCA 3UNJA 3PVUA 3VRYA 3JR1A 4X2KA 3ZUUA 4IM2A 1G3NA 3MPMA 4BDGA 3ORXA 4RIOA 5IQHA 1FMKA 4EKLA 2XKDA 5K4JA 3E8DA 5LMKA 1BLXA 2I0VA 3CKXA 4F9CA 5H8BA 3WE8A 4AUAA 2Q0BA 3ODYX 4N70A 2QO2A 2GHLA 4QD6A 2QHNA 4FGBA 4IZYA 5KMLA 4H39A 2C5OA 5FP5A 3R1YA 4ERKA 4GIIA 5AP2A 5J87A 2RL5A 5J8IA 3MVJA 4QRCA 4NUSA 4L3PA 4QMZA 3BWFA 3CPCA 2V22A 3R8ZA 4CFMA 5CEMA 3Q3BA 4P90A 2OI4X 2BAKA 4E73A 5HG9A 2VAGA 4JDJA 4I6BA 4ITHA 1JBPE 3F88A 3TKIA 4Z3VA 2PE1A 1Q8WA 3FMNA 2C3LA 3ID6C 4D0XA 4G17A 5HBJA 3W2RA 3CSVA 3BZ3A 2C5NA 4G3GA 4AT5A 4F63A 1NY3A 4IHPA 2YCFA 1WAKA 1VJYA 2PVMA 3LQ8A 3HMPA 4O0UA 1XJDA 2BKZA 4AZEA 3I5ZA 2CN5A 3O2MA 4AW5A 4BRXA 2Z7QA 4EI4A 5TO8A 3RPOA 4XG8A 4JT3A 1J7IA 3SDJA 4HGSA 4E5AX 3P1AA 3EIDA 4MXZA 5HU3A 2VWWA 3RCJA 4XYFA 4F6UA 2YIYA 4QQTA 5IG1A 1AD5A 4FBXA 2OF2A 4FT9A 1H0WA 1KE7A 4R7IA 4LM5A 4MXOA 2VTHA 3UIMA 2PK9A 5HHWA 4GKIA 4JQ7A 4BIDA 4ZTRA 3Q6WA 4FV9A 4CMUA 5DMZA 2JFMA 1W7HA 1P14A 2HELA 3HLLA 4ZP5A 4GT4A 5HO7A 4TNBA 5EI2A 1P2AA 3MI9A 1PRYA 2GS2A 4ZMFA 4JL9A 4DINA 1UU9A 4O84A 4PMMA 5KMJA 4NIFB 1Q5KA 4RIYA 4GFGA 4S34A 3DLSA 4NTSA 4MWIA 3KEXA 1QPDA 2X2MA 3F5XA 3MY5A 5D7AA 5BVKA 4AX8A 3TG1A 3NVMB 2YM4A 5EDPA 5IQCA 5FRIA 4TWCA 2PUNA 3ZH8A 1WBSA 1Q62A 4W4WA 3NWWA 4BBFA 4QYGA 2XK9A 4FTRA 2Y0AA 5FTGA 3DBQA 4FICA 2ERZE 2AYPA 3ORMA 4RPVA 5BVWA 2XNGA 4LRJA 2CJMA 1ZOHA 3GQIA 4I0SA 5AR2A 4ANQA 3CTJA 4O81A 4DTKA 3KC3A 4NW5A 3QTZA 4C4FA 3HUCA 4FKPA 2JBPA 3JS2A 4FVRA 2WTWA 3D5VA 2W4OA 3TZ7A 3EQGA 4UMQA 3REPA 4S33A 2QI8A 3MA6A 3DXPA 4I94A 2OIBA 2VO6A 3LOKA 4BCKA 1K3AA 2VTPA 5AUYA 4NJDA 1PYEA 5HESA 3WILA 3R7GA 4IAAA 4ZLYA 4CZYB 5FP6A 4RJ3A 4GK4A 5FEEA 4O1OA 3BRBA 4TZRA 2CKOA 2RFSA 3IO7A 4C4JA 3PY1A 2WZJA 3EL8A 1XKKA 2XK8A 3RI1A 3LCDA 1YVJA 4BDBA 3P78A 3BGPA 3HYHA 3UP2A 2R3OA 4IWPA 4O7YA 5J79A 1PKGA 3W2QA 4EK6A 1AGWA 2P55A 3WZUA 2ZM4A 4J98A 3ZO3A 2FSOX 2J0KA 4P7EA 3NGAA 5B7VA 2C6DA 3JY0A 3VBXA 4PNKA 5IA3A 4ZSEA 4X0MA 4ZIMA 2O2UA 3RWQA 3A8XA 4K18A 3JUHA 4QP7A 3AC4A 4OTFA 5J7HA 2HZNA 4FKRA 2ESMA 4YZBA 4XV1A 2IVVA 3EQCA 2JAVA 3ZS5A 3TACA 3UIBA 5HE2A 4X2GA 4R5YA 2QHMA 3VQHA 1LEWA 4RWLA 1BKXA 4JBPA 2GFSA 2QO7A 3G33A 3NNVA 4FKLA 4JNWA 2UZNA 5FQDC 1FGKA 5ANIA 2O65A 4QMNA 1R78A 1OGUA 4W8DA 2X4FA 5DR9A 4J8NA 4PDYA 4MX9A 1IA8A 2OKRA 3AT4A 4QT1A 4CV8A 4QNYA 3TN8A 4E4XA 2IN6A 4F9YA 4M14A 5DR6A 5DH3A 5HZNA 1SVHA 4F64A 4WT6A 2CHLA 4FYOA 5KMKA 3E64A 3E3PA 4F65A 3L9MA 3W2CA 3BHUA 3NDMA 5HLNA 4EYMA 2R3NA 1PYXA 3R1NA 5GJFA 2B52A 1OIRA 2XBAA 2YABA 4XP2A 2C1BA 4ANLA 4EKKA 5JGDA 1NVQA 2J50A 3DKOA 3DZQA 4QP4A 3CXWA 3TZ8A 5FD2A 3W55A 1OKWA 3M42A 1F0QA 5DGZA 4GK2A 4IIRA 3F3WA 4AACA 4B7TA 4PV0A 3DQWA 5HIEA 1YKRA 2UZOA 2WIPA 4FSRA 4KIKB 3ZLXA 4JG7A 2CNQA 1OL5A 1O9UA 4IB5A 2PWLA 2EB2A 2XIYA 3OCBA 4FTIA 4PDSA 3QRUA 1P5EA 1YI4A 3AC3A 1MRUA 3BHHA 4FOCA 3L8XA 1OUKA 4R6VA 1OPJA 3I81A 2XJ2A 4FYNA 4ZEGA 3HMNA 4RJ4A 3QTIA 3QQFA 3GXLA 3V6RA 3OBGA 4FIGA 3VS2A 1NVRA 3DJ5A 2XEYA 4ZTQA 4O7TA 3EFWA 4FTKA 3AMYA 4NCTC 4L46A 5HG8A 4UWCA 4I22A 4RIXB 5HTIA 3BHTA 3QTUA 4RFYA 4XV3A 2P2HA 3ORNA 4ALWA 3K3IA 2YM8A 3FMMA 4LI5A 3OCSA 4DH7A 1ZMVA 4AZVA 3TM0A 4DEAA 4E5WA 4CTBA 2JKMA 3PP0A 3WF6A 5E90A 4CKIA 5JQ5A 5B2LA 5K9IA 1OL2A 2V5QA 4BDCA 2CKEA 5EW9A 3MH1A 3QKKA 5JMSA 4ONAA 3UVQA 4BYJA 1U54A 2RFNA 3MJ1A 4JG6A 2J2IB 4JIKA 2XS0A 3Q9YA 4PP9A 5ANKA 4AA5A 4OAVB 2GQSA 3B2WA 1J7UA 5CENA 3S4QA 5IEYA 3N9XA 2OH4A 2JDVA 2RGPA 4YJQA 3HV3A 4FA2A 5KO1A 2YAKA 2GNHA 2YIQA 1VZOA 3QKMA 2YISA 2XVDA 3E3BX 4M0YA 5IMXA 1Z57A 1JQHA 3QUDA 4U97A 3QKLA 2VRXA 2VZ6A 2ITVA 4WRGA 2W9FB 2WO6A 3FSFA 1Q97A 1I09A 3MY1A 2X8DA 4FNZA 4WNOA 5F94A 1H1SA 1GNGA 5H8EA 3RM7A 4DG0E 4DG3E 3M2WA 3VS4A 4HYSA 5K5XA 2ZDTA 3QCXA 5IU2A 4J99A 4O6EA 1OL1A 5DN3A 5BMMA 3F9NA 1H01A 3TJCA 5IDNA 1YQJA 3MYGA 2R64A 3QZHA 4IX5A 3R0TA 4WNKA 4IBMA 3W2OA 4CQGA 2HZ0A 4YZNA 4ZY4A 1HOWA 5CVFA 4BBMA 1XBBA 4EEVA 3R28A 4TWOA 5M55A 4YO6A 4JDKA 3VW8A 4BCGA 4DTAA 2WTCA 4GW8A 4YJOA 3QA8A 5CYIA 5GZ8A 1JVPP 4TL0A 4XV9A 4I0RA 2X39A 2W1CA 3KRWA 3VS3A 2R3FA 3Q04A 4UEUA 3Q32A 4RVKA 4V0GA 3PPKA 4BIBA 3GB2A 1H1QA 2IG7A 4DCAA 4IZ5A 2H8HA 2XA4A 3DCVA 2WMQA 4O0WA 2FA2A 4YJSA 4BIEA 4F7LA 5GIPE 3P08A 4I92A 3VULA 3MJ2A 5TF9A 1W0XC 4ZK5A 4DGMA 4QMLA 3EOCA 4YLKA 4UWBA 5CY3A 4CTCA 3OCTA 2QG5A 4ALUA 1W83A 4DEHA 4U9AA 5IH6A 2R3HA 2B53A 3IK3A 3Q9XA 4JX3A 3T8OA 2I0EA 3UZPA 4AG8A 3FAAA 5CI6A 2OWBA 3DFAA 3LJ0A 2Y7JA 3GCVA 3UDBA 3C4WA 4YC6A 4H36A 2E9NA 2GTMA 5EM7A 5A6NA 3FWQA 3OS3A 3RBWA 5ETCA 4H1MA 5CNOA 3V8SA 2C30A 5B0XA 4G9CA 3FI8A 3G5DA 3C5UA 3O8UA 3V6SA 4R78A 3PG3A 4BC6A 3DZOA 3MPAA 1OUYA 4OT5A 1UV5A 4KBCA 1PXNA 3G9LX 3QXOA 3P0MA 5DPVA 2Y8OA 2GHGA 4RX8A 2W4JA 2WMWA 2P33A 1YHSA 3UODA 4NKSA 4YNOA 5AP4A 4EK3A 4NM3A 5C4LA 3NCGA 2YLEA 3A7IA 3W10A 3QLGA 4FSUA 2O3PA 4HYUA 3A7GA 4LOPA 3G0EA 3C13A 4M69B 1FPUA 1JKLA 4GJ2A 3LFFA 4AZFA 3KULA 3LCTA 4FV5A 5FBNC 4PL5A 5BYZA 3NPCA 4EJNA 3BYVA 2QNJA 3P5KA 4GCJA 1JKSA 5EG3A 4CFNA 3LZBA 4DGGA 4HGTA 4WO5A 3AC2A 5J1VA 4Q9ZA 5ANDA 5ETAA 2G2IA 3MIAA 3DS6A 2VTOA 3KN5A 4BI2A 3MW1A 4F0IA 1OMWA 2PE2A 4U5JA 2B55A 2DWBA 3EWHA 3PY0A 5FM2A 2IZRA 3DBDA 4KIPA 1MQBA 3A60A 3HMMA 4OBQA 5K0KA 5M07A 3ACKA 4H05A 1SM2A 1YHVA 4RIWB 3DFCB 5I9VA 3RAWA 3IDPA 2O0UA 4XNEA 3DDPA 4MAOA 4PUZA 4GKHA 3ANRA 3FI2A 4D28A 2UZWE 4GJ3A 3EB0A 2PVLA 3RK5A 4YJTA 1K2PA 1M2QA 2C5VA 4ASZA 3BLQA 3PIYA 3BELA 3QWJA 4I6QA 1OKZA 3A7JA 4PL3A 4XS2A 5JRQA 4ANMA 5CXZA 4AN9A 3RPSA 3CR0A 2E9PA 3VVHA 4XG6A 2C4GA 1YDTE 1SYKA 3K2LA 2UZLA 1OM1A 3R21A 3RALA 2BHHA 5DA3A 1YWRA 4TW9A 2OJ9A 3COKA 4DFYA 2ZVAA 5CANA 1G8SA 2QR7A 3G6GA 3VUIA 1S9JA 4FIFA 3R1QA 5KMIA 3EL7A 5EQYA 1Z5MA 5TE0A 5ANEA 5L2SA 4TTHB 4BR3A 3SD0A 3Q53A 4D4YA 2PMNX 4FODA 3O7LD 4USFA 1O6LA 4HCTA 2PPQA 4FKGA 3VJNA 4KNBA 5EFQA 4PDPA 2ITUA 1H1RA 2HW6A 2NRUA 3V01A 4LGDA 4IZ7A 3HGKA 2H6DA 3R63A 4M3QA 4AE9A 1LEZA 3PXRA 3T3UA 4FC0A 4AW2A 4JBVA 3JY9A 4XRLA 3LCKA 2W96B 4FIJA 4FE2A 4CYJA 3DKCA 4DCEA 3MB6A 1JLUE 3TNIA 3CC6A 2HAKA 2OJJA 3AMAA 3R73A 2OH0E 3QGWA 4NCTA 2W7XA 3Q4CA 3F3VA 5C26A 5L8LA 2VTAA 4A9TA 4HZRA 4HYIA 1GIJA 3LMGA 3G90X 3UP7A 4IVAA 4K33A 4GUBA 4JXFA 2BZJA 3FY2A 2YERA 5IMEA 3NUUA 4OR5A 4AT4A 4GK3A 4EHVA 3PG1A 5I5ZA 2QC6A 1ZZLA 4DT9A 5I9XA 3TV6A 3FUPA 3ROYA 2B4SB 4O21A 1OZ1A 2ZM1A 4JR3A 5CXHA 4YMJA 1P4FA 2EB3A 4I5MA 4OT6A 4WA9A 4Y46A 2QOKA 3D15A 4H1JA 5E8XA 3ZSIA 2C6EA 3GCSA 4QQ5A 3BYOA 3FLSA 5DIAA 5AP3A 1QL6A 4XG4A 1ZYSA 3LXPA 2WEVA 5CZHA 2GTNA 5L2WA 4R3CA 3COIA 3R04A 4TYGA 3P9JA 2VUWA 4CD0A 3O23A 3ZDUA 5AX3A 4RJ8A 4CKRA 4MXAA 4FT5A 4IFCA 1Y6AA 3BGQA 4AGDA 2XYUA 3E63A 1EH4A 5FUTA 1MUOA 2UW8A 1ZRZA 4U6RA 4DBXA 2PZ5A 5I9WA 5ICPA 2W4KA 3DKFA 4XRJA 4AF3A 3IQ7A 3R1SA 4GG7A 5H9BA 4FIHA 5D9HA 3KQ7A 2OLCA 3UC3A 4TY1A 3FYJX 3VNTA 3AOXA 4NJ3A 2ZAZA 3D5XA 3DOGA 3VS5A 5IPJA 2A19B 2ITQA 3V8TA 4P4CA 4C61A 4GU6A 4J96A 3O8TA 4J71A 2F7XE 3FKLA 5EKOA 5JZNA 2WMSA 2LGCA 2UW4A 3PDTA 2PHKA 3BU5A 4ZY5A 5K5NA 3AD5A 4H3BA 3LAUA 4DGLC 5EM5A 3MPTA 4FTOA 4D9TA 3KXHA 3ORZA 2YWPA 3RINA 3I6WA 2XIZA 4JJRA 3QZIA 3HVCA 3GVUA 5AA8A 4XOZA 5KNJA 2QVSE 1ZMUA 3D5WA 4BBEA 1PXMA 3LMHA 5E4HA 4YZDA 5HLPA 4K1BA 2QCSA 2UZVA 2ZB1A 3EYHA 1ZOGA 4ZOGA 4ITIA 4C35A 4E3CA 3AG9A 5J7BA 3OZ6A 2FYSA 5EDQA 4CEGA 3ZLYA 4O83A 3GCUA 3GC0A 4TT7A 1YW2A 3U4UA 3QD4A 4DF3A 3SRVB 3HDNA 3G15A 4E6CA 4BCPA 3E8EA 4NU1A 4WOVA 5HVKA 3IGOA 4PTGA 3FLNC 3FZRA 1RJBA 3RAIA 4AZWA 4C8BA 4FKSA 2ZYBA 2QOFA 3LHJA 4J7BA
chains in the Genus database with same CATH superfamily
3MBLA 3BBTB 3OCGA 5CAVA 3FE3A 3LE6A 4N4SA 4HZSA 2HK5A 3I5NA 1WVYA 1PXKA 4L7FA 3QUEA 5AUZA 1FVVA 4O4BB 3K54A 2YM7A 5I0BA 5L3AA 1R0EA 3EQBA 4X2JA 3BKBA 3O51A 2FB8A 4AZSA 1XBCA 3QX4A 1PXIA 2BDFA 4FKWA 2O64A 3A7FA 3AXWA 3EFKA 3LFSA 3S95A 3I7BA 5I3RA 5AWMA 2R0IA 4HGLA 3W0QA 4ACGA 2PY3A 1YXXA 4XH6A 3R22A 1Q3DA 3KN6A 4I41A 3E8NA 4L43A 3C51A 5D11A 4FIIA 3HZTA 4CNHA 3RNIA 5IQAA 3KY2A 4LUEA 3DLZA 4XP3A 4GYIA 4YLJA 4EH8A 1H00A 4ARKA 2XK7A 4XOYA 4L53A 5AM7A 5J5TA 5CALA 5LVLA 3PXFA 4QTAA 4RC4A 3R9NA 4EUTA 5HVYA 2XK6A 4F1OA 4TWNA 3TUDA 4FNWA 3SLSA 3DXQA 1Q4LA 2OJIA 5BVNA 1ZMWA 4D4VA 4NEUA 3LXKA 4C02A 2OZAB 2F4JA 4JAIA 3I60A 4I23A 4RRVA 3U51A 3NMUF 3EKKA 4L52A 2VTLA 4AT3A 4Y73A 3ELJA 5M44A 4E8AA 3FI4A 4PF4A 5ANGA 5F4NA 5HE0A 1KE6A 4D58A 4NFNA 3LPBA 4PMTA 4HPTE 5BUEA 3F2RA 4QMWA 3R02A 1Q61A 3OOGA 5FXRA 4I5CA 3R8LA 2X9EA 1JSUA 4GRBA 2VWIA 2YJRA 2C6TA 5CSPA 3FI3A 1Q3WA 2E9VA 4XUFA 4TNDA 1PMEA 1W98A 3BYMA 3R71A 1TQMA 3MVHA 3CQWA 5C27A 2ZMCA 4KD1A 4EC8A 4AOIA 3ZYAA 3RAHA 4BKZA 4UMUA 4YP8A 4FTNA 4KKGA 4ZSJA 3V5WA 5HVJA 3FHIA 3BLRA 4YTCA 2YIXA 5DNRA 5LCJA 3KF4A 3FSKA 3LXLA 2HWOA 2JD5A 2KULA 3W8LA 3JXWA 1VR2A 4TN6A 2VTTA 4YLLA 2DUVA 3FY0A 4QMVA 4Z9LA 4C3RA 1PHKA 4FTJA 3GI3A 1W84A 4JQ8A 5JSMA 1UKIA 3TXOA 4ASEA 2ETMA 5TOZA 2C1AA 1WBVA 5CU2A 2GS6A 4ACMA 4DEBA 2YACA 1W8CA 3UNKA 2A4LA 4G3CA 2VWBA 3UYSA 2JAMA 3VUGA 3MFTA 4AAYA 2G2FA 2ITNA 4WUNA 3QBNA 3HRFA 3IONA 3ZFYA 1O6KA 4U3YA 4BYIA 3OW3A 4C33A 5LWMA 3KK9A 2OO8X 4RBLA 1IAHA 4DYMA 3ANQA 2O8YA 3Q96A 5BVFA 2NP8A 2QU6A 2X0PA 3CKWA 2JKQA 3HA8A 4FKVA 3TDVA 4ZY6A 3TL8A 1B6CB 2W17A 3ZOSA 2PYWA 4EHEA 2Z7LA 3POOA 4DEIA 4ANNA 1PF8A 1R3CA 5HNGA 3L8VA 4DTBA 4WNMA 4LGGA 5HCYA 2JGZA 1SNXA 4LL0A 4M97A 3VN9A 2XM8A 2EXCX 3QTRA 4UB7A 5IQBA 5CU0A 3SC1A 4DFXE 2CGXA 3QTWA 5H2UA 3QTSA 4G31A 3H0YA 5AP1A 4KKHA 3FLZA 3U87A 1MQ4A 4QMYA 3QRJA 3MTFA 3ZLWA 3AT2A 4BCMA 5JGAA 3C1XA 5HBHA 5IUIA 4ENYA 5K3YA 2NPQA 4D2RA 3H3CA 4N6YA 4QMUA 3KU2A 3TV4A 1R1WA 4AOJA 1M14A 3O8PA 4O4FA 4BCJA 4AXEA 3GENA 5IDPA 4YZ9A 4GEOA 2X6DA 4D2TA 1V0PA 4AXCA 4AS0A 5BX0A 5CI7A 5IA5A 5KMMA 2OJFE 3NSZA 1SVGA 2I6LA 4BDJA 4W9XA 4A9UA 4G2FA 4EH4A 1CKPA 5FEQA 1XH8A 4KSPA 2HCKA 3R01A 3P79A 3RAKA 3BBWA 4JDIA 4MBLA 3WYYA 4GU9A 3C4EA 2J6MA 2R7IA 2FSTX 2WTJA 4UMPA 3RNYA 3UQFA 3KGAA 4TYHA 1SMHA 4YC3A 1YHWA 3GU7A 4NSTA 3F7ZA 3F3UA 1Q41A 3ZEWA 3OT3A 2CCIA 4A9YA 4G34A 4N6ZA 4C2WA 3OTUA 4G6LA 3QTXA 4N0SA 3NW7A 1YXSA 3GBZA 3OC1A 3GU4A 3K5UA 5ANJA 5EYMA 1H0VA 1XH6A 4BJJB 2BRNA 2Y6OA 4ZTSA 2O5KA 3BL9A 4BI0A 3FL5A 4RG0A 3IW7A 4FG8A 2ERKA 4IM0A 1U5RA 4U42A 1UA2A 3ZTXA 4ERWA 3V5LA 4Q5HA 4FV2A 1Q8UA 3VONA 4RFMA 5HX6A 3BLAA 4QP1A 3PVWA 5I4NA 3TNPC 3WF9A 3MB7A 2C6LA 3MFRA 3HV6A 4FUYA 3ACJA 5DRDA 2W1EA 3LIJA 3WF5A 1JSVA 4FT3A 2QU5A 3WIKA 1FMOE 1TQPA 4APCA 2X9FA 4FEXA 3UTOA 3DAJA 4F0FA 4QP9A 2C6IA 3VHEA 2XCKA 5A4CA 5CVGA 4R5SA 2VWXA 3ITZA 4FKJA 1NXKA 1S9IA 1XO2B 2C0OA 5AV4A 5M4FA 4LQMA 3K5VA 4E6AA 1GIHA 3D7TB 4O0SA 4EOIA 2XYNA 3DBCA 3EZVA 3PLSA 4I5HA 3T9IA 4E1ZA 1MRYA 3P86A 4QPMA 4Z55A 3NAXA 4YUQA 4V0GB 1YXTA 4EK4A 3TJDA 2W5BA 4PPBA 4OTWA 3C4XA 4DHIB 4IC7A 3CS9A 3DAKA 2W9ZB 3EQIA 2GNLA 5DI1A 3O7LB 4OUCA 4DITA 5HCXA 3HUBA 4DH5A 4OTIA 5DFPA 2WQNA 3NYNA 3CGOA 4UMRA 3ODZX 4QMXA 3VJOA 5AR3A 4IDVA 5AUWA 2I1MA 3RKBA 4Y72A 4L8MA 4BGHA 1Q8ZA 2HZIA 3EH9A 4FL3A 4CCBA 1GAGA 4IACA 5HE1A 1H24A 5L6OA 2PTKA 4EOMA 1JWHA 4JDHA 5EM6A 4N57A 2HZ4A 4FV3A 4RIYB 1ZARA 2VWVA 2YA9A 3PP1A 5EDRA 2ZJWA 2X81A 2PVNA 3KCKA 3KXZA 4DBNA 2CNUA 2QKRA 5C1QB 3VUMA 4AGCA 4IE9A 4H58A 3FMLA 2YM5A 4F4PA 2XIKA 2R3IA 4AZTA 2RG6A 4EUUA 4JBQA 4K9YA 2R3PA 5E8YA 4RJ6A 5L8KA 3TIYA 2PZPA 4XV2A 3HEGA 3BHYA 2Y9QA 4G1WA 4C37A 1FVTA 1VYZA 3NUSA 3OMVA 3S3IA 5K4IA 5T6KA 4I5PA 1H25A 4RC3A 4EH9A 5CWZA 4WG5A 4DH8A 2WMXA 4F08A 3BPRA 4DEDA 3O96A 1YRPA 4XG2A 3RWPA 3ZLSA 5L6PA 1F5QA 3ZZEA 3QRKA 2UV2A 3PA5A 1OIUA 1JOWB 2E9UA 3BQRA 2QG7A 2R3RA 5CT0A 1WZYA 3VUDA 3QWKA 5AR4A 3TYKA 4AWIA 2PVHA 1GZKA 5B2KA 3NR9A 3OBJA 4O0XA 2QOCA 1LP4A 3FJQE 2WPAA 3POZA 4FV6A 3MIYA 4F1TA 3NUNA 5DR2A 4S2ZA 4Y5QA 2BFXA 3EKNA 3ENMA 1OKVA 2HXLA 3FV8A 1OBGA 3KB7A 4H3PA 2UZUE 3DK3A 2UZTA 4HVHA 5EHOA 3FC1X 5LMKC 4FNYA 2JIVA 2PVKA 1E1VA 1TQIA 3PZEA 4JQEA 4IX3A 3ZONA 3W16A 3OG7A 2F7ZE 3NLBA 2VO0A 4E6QA 3COHA 3ZC6A 4FSWA 3QRTA 4RVLA 3UDSA 2Q0NA 5AX9A 2R3JA 2E9OA 2UVYA 5IA4A 3OD6X 4C0TA 3P4KA 4F9BA 3OFMA 2X0QA 4EH3A 4KA3A 1H8FA 5HLWA 2GNFA 2VGOA 4IJ9A 5BNJA 2J5EA 5B2MA 2JLDA 4OTGA 1GIIA 2JDOA 1K9AA 3OUKA 4L6QA 3TIZA 4B99A 4DHFA 3D0EA 5DOSA 4FZFB 5E9EA 4FL2A 4GT5A 5BPYA 1ND4A 4RQKA 4KKEA 1BX6A 1V0BA 4IAIA 2BUJA 2DYLA 1IASA 4IM3A 5A4TA 4LOOA 3IOKA 3SGCA 4FZ6A 4QDVA 2OG8A 2V7AA 4MH7A 4NL0A 2XUUA 2F2CB 3BU3A 4FNXA 4TRLA 2C5YA 4MF1A 3CTQA 4XBUA 4B6LA 1ZYCA 3NW5A 4B8LA 4BWKA 2Z02A 3G2FA 3U6JA 3C4CA 3KRJA 1P4OA 4I4FA 3DTCA 3TZMA 4CG8A 1BMKA 4WBOA 3H30A 4I6HA 4CLIA 3K3JA 2WGJA 1DI8A 3HRCA 2GNIA 4IB3A 2OIDA 4ZJJA 1WVXA 3CEKA 3DBEA 3WIGA 4X6QC 4O27B 4ZJVA 3ZM4A 4WIHA 4BVUA 3QQGA 3VUKA 4EBWA 4BTMA 1O6YA 4RWKA 4RA5A 4IEBA 4YJPA 1KUTA 3V8WA 4YHJA 4E5BA 5M51A 2J0LA 3FLYA 4BCQA 2XH5A 3MWUA 4IWQA 3Q5IA 4J1RA 2R3LA 4U81A 4R3PA 1MP8A 4CT2A 5HTCA 2WOTA 3H0ZA 3OUNB 4G5JA 4BTJA 2VNWA 1JAMA 4J53A 3RPRA 1KOBA 4J97A 1PXOA 3L1SA 3S0OA 3AC5A 1DS5A 3I0OA 4OBPA 4LYNA 3GT8A 4IAYA 4DGNA 1WBOA 4A7CA 2YCSA 1QPEA 3PFQA 3ROCA 1DAYA 2EU9A 2C5XA 2CLQA 2CDZA 3SA0A 3KL8A 5ITAA 4ZZMA 2Y4IB 5BUJA 4EOJA 1HCKA 3UJGA 3UGCA 3W18A 3FMDA 2X8IA 2QD9A 2UZBA 4BHNA 1KE8A 5J5SA 3ZRKA 5IQFA 2R4BA 4FV7A 5FXSA 4EK8A 2BROA 4IANA 2CPKE 3ZU7A 2VTJA 3ATTA 1NT2A 4LV5A 2X2KA 3ZFMA 5A6OA 4RMZA 5EYKA 5IZFA 3L8PA 2BDWA 3G0FA 4FV0A 4GMYA 4YSJA 2YEXA 1YOJA 3BV3A 3P7BA 2W5AA 3OXIA 4P5ZA 3TKUA 4FVPA 3C0IA 3SXFA 3OXZA 5CAUA 3BHVA 4ZJIA 1BL7A 4EK5A 4NM7A 3O17A 3HMIA 4PP7A 4O2ZA 4Y8DA 5C9CA 4M84A 4CRLA 1UU3A 3GOPA 1A06A 1V0OA 3NUYA 4M7IA 3UIXA 3V5JA 1TKIA 4ACHA 1ZLTA 3FQHA 4C7TA 2REIA 2VWYA 5HI2A 3DK7A 2W5HA 5A14A 3V51A 4TYHB 5AAGA 5EI6A 4TYJA 5E8VA 3LMIA 4CV9A 3RCDA 3PSBA 3A2CA 4IXPA 4A4OA 4AOTA 3PRIA 3N4VA 3DB6A 3S1HA 3IW8A 4OGRA 4UY9A 3D4QA 4FSZA 4FV1A 3BE2A 3D83A 3HA6A 2QLUA 4LMUA 4I4EA 5M4UA 2GNGA 2WKMA 4EOSA 4KBKA 4S32A 2OBJA 4BKJA 5AV2A 5TR6A 3NNUA 4X7QA 3P23A 4YTIA 5BVOA 3WZJA 5JZJA 2QONA 4JOAA 3KRLA 4FOBA 1XWSA 3FZPA 2PVJA 2BVAA 2PZIA 4LGHA 4PTCA 5TKDA 4USEA 2UW7A 5AJQA 4Z7HA 4YBKA 4KIOA 3E7OA 4O91A 5EYCA 2GU8A 3VIDA 2VWUA 5JQ8A 4MD8E 4BF2A 4WHZA 3NNXA 2ITOA 3AD4A 2J5FA 3VRZA 2BHEA 3E93A 4C34A 1XMLA 1PXJA 4NM5A 4KSQA 3U9NA 4A4LA 4JAJA 2IZSA 3C4FA 5CX9A 3C4ZA 4JR7A 5L8JA 2C3KA 5EH0A 3KULB 2GNJA 5CU6A 3UC4A 5D41A 5FTQA 3R8VA 1J3HA 4WG3A 4WKQA 4BB4A 4R3RA 4YNEA 2BIYA 1V1KA 3FQSA 4RA4A 3QHRA 3SV0A 2VTSA 4WD5A 3RHKA 4ALVA 3AD6A 4W4XA 2FH9A 2CCHA 4EOOA 1YWNA 2YCQA 1BUHA 5CQUA 4EH6A 3UO4A 2XIRA 5E8ZA 2J51A 1JNKA 3R2BA 3FL4A 4UXQA 3SW4A 2VO3A 4EORA 3UDTA 5CS6A 1ZYJA 4BWPA 4OTPA 4GUEA 2IVSA 5JFXA 1L8TA 5CEQA 2OZAA 5AR8A 3DGKA 4ASDA 2WMRA 5GJGA 2GSFA 3PA3A 4BICA 4MCVA 4GG5A 4MNFA 2WMTA 2ZFYA 1DI9A 2ONLA 1CMKE 1ZY4A 1U5QA 1ZWSA 2XJ1A 3DNDA 3HP2A 3IW6A 3NS9A 3QYWA 4JVGA 2X0OA 4AGWA 5FXQA 4CFVA 4OBOA 3DJ7A 2B1PA 1J7LA 1CKJA 5KUPA 4XJ0A 2HENA 3F2AA 3PFYA 2OXDA 5LMAA 3OWKA 4RIXA 4RGJA 5EOLA 5CEKA 2C3IB 3A4PA 3ZCLA 3OWPA 5CTPA 4WRSA 2PVYA 4C38A 4EONA 3BGZA 3VHKA 1GZ8A 5M4CA 4UXLA 2WELA 3IDCA 5L2QA 5JGBA 2UW6A 4UALA 4IVDA 3WARA 5DVRA 4PNIA 4FSYA 2VTMA 4A07A 4C62A 2RFEA 3E8CA 2OFUA 4DG2E 1M2RA 1U54B 3LW0A 4MXXA 4QMTA 5HU9A 1H28A 2G2HA 2WU6A 4AXAA 4F0GA 3TUBA 4AFJA 4IAFA 2XNBA 4YJRA 4O7ZA 5D7VA 2R3QA 4KBAA 2PUUA 1UWHA 3RP9A 4H3QA 2IWIA 3BEAA 2HYYA 2YLFA 2ZB0A 2UW5A 2AQXA 4IWOA 4PWNA 1CSNA 2X0GA 4IVCA 3CTHA 4OTRA 4DFLA 2ZV9A 3BYSA 3EMGA 3F3ZA 4BI1A 2X6EA 4D1ZA 2O63A 2EWAA 3LQ5A 5LVPA 5IH4A 5EW8A 3W33A 4FSTA 4EHZA 2XAMA 2YIWA 4Q5EA 4I0TA 2B0QA 3FQEA 1FOTA 2EVAA 3HL7A 3KMMA 2XKFA 4I3ZA 4WSQA 3PA4A 3RK9A 4GFMA 4IFGA 1DAWA 4JBOA 2C47A 2C6KA 4FTUA 3RJCA 4CXAA 4BGQA 2XZSA 3ORTA 2VTQA 5JRSA 3R83A 5C4KA 1RE8A 3ZM9A 2I0YA 4FX3A 3D9VA 4YPDA 2VO7A 1OPKA 2GQGA 3LFBA 3F5PA 3RPYA 3FLWA 1M2PA 2UVZA 5ANOA 1UNHA 3U55A 3EQDA 3FXWA 3RK7A 4M67A 1M17A 3N51A 4JIAA 5IA0A 1JSTA 5EQEA 1MRVA 2P4IA 4FKUA 1RW8A 3R00A 5KMNA 3HAVA 3GU5A 3PWDA 2J0JA 3F82A 4K6ZA 3NW6A 3LLAA 4F1MA 1OVEA 3W2SA 3R7YA 2AC3A 3R7OA 2JEDA 2H34A 5FDPA 2QURA 5HIDA 3MH0A 3LFAA 3R30A 5DE2A 2WD1A 4LUDA 4CLJA 2VX0A 3MH3A 3QC9A 1GZOA 3EQRA 4O96A 4GL9A 2P2IA 1KOAA 2WMAA 3R8PA 4NYEA 4BDFA 4C59A 4AU8A 4QO9A 1H26A 3D14A 4DGOA 2CMWA 4D2SA 1UNLA 4A9SA 5DLSA 4PMPA 4LV8A 3KRXA 2QOQA 1PXLA 3LFQA 5M08A 3C0GA 3PZHA 1ZY5A 3AGMA 5J9YA 1ST4A 1OKYA 3OOMA 1X8BA 4RLLA 2YZAA 4QTEA 4UX9A 4ZMEA 1OECA 4ZSLA 5BQ0A 4C4IA 3II5A 4YJNA 3PJ2A 3IGGA 5LVOA 3AGLA 3Q6UA 3Q52A 5KBQA 4RVTA 4AQKA 3BWJA 3CP9A 4C3FA 3C9WA 1CM8A 4F70A 5LXMA 3DY7A 4E93A 1BI7A 2P3GX 2HW7A 4ID7A 3RZFA 5AIRA 3O71A 1OIQA 4L01A 2XAOA 3H4JA 2DS1A 3ORLA 2Y4PA 4QYFA 3H9RA 3R6XA 3H9FA 1Y6BA 2XM9A 4M69A 3HV4A 3A61A 4IB0A 3FLQA 5EW3A 4EOQA 2B54A 3A4OX 2YDKA 1HCLA 4FZDB 4B9DA 2J0MB 4BCHA 1WBWA 3PIXA 4CFFA 2BTRA 4K2RA 4QTCA 5D10A 5KCVA 4O38A 5ACKA 5DHJA 4DFBA 4R8QA 5J9LA 3IS5A 3IKAA 5AAFA 4YSMA 1PXPA 2ITTA 3OWLA 4ITJA 5HG5A 1PMUA 1LUFA 3WZDA 2J90A 3I6UA 5IQGA 4OLIA 3B8RA 5IQIA 3VQUA 2OK1A 3ORPA 2XMYA 5G1XA 4IB1A 4IX4A 4G3EA 4YBJA 3SXSA 2RIOA 4MBJA 1PMNA 3ZUTA 5D12A 4EYJA 4UV0A 1NA7A 5HNBA 4IC8A 2UZEA 5L2IA 2W0JA 3UBDA 3ET7A 4W4YA 3D2KA 3IDBA 2J4ZA 4YTFA 3WE4A 4Q2AA 3FPMA 3COMA 3HV7A 4NTTA 2PE0A 5E92A 2C69A 4UYAA 3SOAA 1KV2A 2W1ZA 3F3TA 4QYEA 5A46A 1YOMA 2ACXA 2WTDA 4Y83A 5ACBC 2VD5A 2CN8A 3FPQA 4BDDA 2XBJA 1A48A 2ZV7A 3DAEA 3JPVA 3PUPA 2G15A 4FF8A 4GFOA 3CJGA 3L9PA 1VLRA 3MFUA 3QZFA 1U4DA 2Z60A 1L3RE 4FKQA 3PXKA 5FEDA 3V5TA 1BYGA 2JDRA 4D0WA 2VX1A 2JDSA 1W82A 4I20A 2Y6MA 3FZOA 3QD0A 4O2PA 2LAVA 3TCPA 1G8KA 3TI1A 4W9WA 2I40A 3U54A 5EOBA 4FTMA 5HCZA 1XR1A 3UQGA 2WQMA 3UPXA 4DH3A 4ZLOA 3FDNA 3PXYA 4D2WA 2H9VA 3Q4UA 3AC1A 4NK9A 1PY5A 2QR8A 2JIUA 4NWMA 4PQNA 4O7NA 4L7SA 3MV5A 2HOGA 3GC7A 4EBVA 2X7FA 3E87A 3TKHA 2BTSA 3OVVA 3PJCA 5HX8A 5JFWA 3ZDIA 4QMOA 4L00A 4G5PA 5ETFA 5A9UA 2OGVA 4HCUA 3CCNA 4RVMA 5AEPA 2J0IA 3VBWA 4YR8A 3NX8A 4RC2A 3TUCA 1URCA 2YDJA 2XB7A 3I1AA 3OY1A 2E2BA 3U4WA 4CYIA 3QCSA 4QMQA 4OAUC 2OSCA 3WZEA 3N4UA 4JRNA 3FEGA 2XRUA 4HGEA 3BYUA 3EN6A 5KZ0A 3WZKA 4E6DA 1NVSA 2JC6A 3KMWA 3R7EA 3V5PA 5CF4A 1DM2A 1GJOA 1H07A 1ZAOA 3LXNA 4E4LA 2XNMA 4QPAA 3E92A 2W1FA 2YCRA 1URWA 3DA6A 5C8NA 4HVGA 3PPZA 3BQCA 3JYAA 4KABA 4MF0A 5DT0A 3TNHA 5A54A 4NIFA 1VEBA 4Z16A 1YDRE 1WMKA 3NCZA 4KS8A 2YM3A 4QQCA 4BWXA 5IEVA 3Q5ZA 1ZYDA 3ZSHA 5JKGA 5LVNA 3L9LA 4ORKA 2QKWB 3FMJA 5I9YA 3ZXTA 5CAQA 4L45A 5JFVA 5AA9A 1IA9A 4PTEA 3UOLA 3E7VA 3GU6A 3TEIA 1FBNA 2Y4IC 4BCFA 4BDAA 4E20A 3LKMA 4MVFA 2WFYA 3MGYA 2CLXA 4FMQA 4CQEA 1ST0A 4X3JA 2ITXA 3P7AA 3GNIB 2NNWB 2PVFA 5T68A 4NW6A 4M15A 4V05A 1Q8YA 3NZ0A 4FSMA 4LRKA 3PYYA 4GVAA 5IQEA 4ANBA 3MVMA 2IZUA 4X3FA 3RZBA 1W2DA 3NAYA 3PRFA 3ZHPC 4FL1A 2A1AB 1JKTA 3RVGA 4I93A 5HICA 2HIWA 1BL6A 3MY0A 4L3LA 3KA0A 3AKKA 1SNUA 5GIOE 2JFLA 3WYXA 4DFZE 2UW3A 3OHTA 4II5A 4KS7A 3ZO1A 4DEGA 4FTAA 4I24A 4DC2A 4RJ7A 5HQ0A 3TWJA 5AM6A 4AW1A 4JLCA 1XH9A 4O0TA 5M56A 4FIEA 2WB8A 3F7WA 5C8KA 1H4LA 4FEUA 3S2PA 4BCNA 4BY9E 1STCE 1VYWA 2SRCA 5GJDA 2VWZA 4HPUE 4XLVA 1H08A 1H1WA 3KK8A 4FUXA 4BKYA 3DV3A 3QA0A 4I21A 3W32A 3Q9ZA 4G9RA 2OIQA 4ZXTA 3IW5A 2XNEA 2X4ZA 2QOHA 2C6MA 1OITA 2Z8CA 4IMYA 4QP2A 3M11A 2V55A 5C01A 4XEYA 2BZIB 5CF5A 1XBAA 3ENHA 2BZKB 3FZSA 5HGIA 5LARA 3RMFA 2FVDA 3JVRA 1RDQE 3ORKA 4S30A 2C0TA 4E7WA 4LG4A 4FEWA 5HD4A 1Q8TA 5CLPA 5LQFA 5BYLA 4DH1A 3QYZA 1RQQA 5L2TA 3EHAA 5FM3A 1GZNA 3VWAA 2RF9A 4CMTA 4O6LA 4FV4A 3GEQA 1YI6A 5LVMA 4C4EA 1GY3A 2XK4A 2BR1A 3UO6A 4EHGA 4J52A 5BYYA 1Q24A 2VTRA 3PJ8A 5CASA 3EQFA 3KFAA 3GOKA 3MA3A 4U43A 4W8EA 4YZCA 3NFFB 1UU8A 2IW8A 4CFXA 4BZDA 4DFUA 2VTNA 4P2KA 1M7NA 3I7CA 2GQRA 2XCHA 2UUEA 4FEVA 2BRMA 4LRMA 3CY3A 5BVEA 3GCQA 3BL7A 4JG8A 2HY81 3UG1A 5AV3A 3FMHA 3D5UA 2QLQA 3JVSA 4FV8A 5AUXA 4D5KA 3DXNA 1YXVA 4F7NA 5J1WA 3UDZA 4R1VA 5JEBA 3R7UA 3E88A 2FSMX 5G6VA 4YU2A 3V5QA 3NIEA 4BZOA 2BIKB 2GFCA 2WMBA 3G9NA 5H8GA 3FBVA 3ZZWA 4HVDA 3SW7A 3R9DA 2Z7SA 4ZTHA 4EWHA 3UZRA 1KE9A 4J95A 3ZO4A 2XP2A 3PJ1A 5E1SA 4BCIA 2QOOA 1G8AA 5KMOA 1GOLA 4L42A 2FSLX 5I3OA 3HECA 4CT1A 3CD3A 3CPBA 4GIHA 2WQBA 4P5QA 4PL4A 2ETKA 3GQLA 3I0QA 1UKHA 4F78A 4KIKA 3VAPA 3NRMA 4RLKA 3GP0A 2W05A 3PJ3A 2CGUA 3CE3A 3HMOA 4Y5HA 4YHTA 1XQZA 3TNQB 3SHEA 3LLTA 3MDYA 3OEZA 4M0ZA 4TYIA 3WF8A 2YIRA 4WSYA 3VF9A 4BCOA 4C4HA 3ALNA 4AXFA 4G3DA 5CF8A 2X7GA 2F7EE 2I0HA 1OIYA 4BTKA 2R5TA 5LOHA 5HOAA 3AKLA 2NO3A 4PRJA 5GZAA 4IQ6A 4MQ1A 4Y95A 4S31A 3VS1A 3FZ1A 4O0VA 5IUGA 4X3FC 4X6RA 4HYHA 4EQCA 4CKJA 1REKA 1YDSE 4AA4A 3ALOA 4ZAUA 4M13A 2Q83A 1OL6A 2OXYA 2XJ0A 1H27A 3DQXA 4GT3A 3PTGA 4A06A 3KXMA 3EQHA 3SG8A 5CSXA 1Y57A 4GS6A 4IWDA 3T9TA 4QYHA 2YJSA 4XBRA 1OI9A 1XHAA 4AQCA 4FSQA 3U6HA 2WTKC 3GC9A 4FR4A 5GHVA 5KZIA 5IQDA 4U80A 3OT8A 4FRFA 4BGGA 3VC4A 4I6FA 4HJOA 2XEZA 2VNYA 3LFDA 3DKGA 1PJKA 3N4TA 2R7BA 4U41A 3CD8A 2WMVA 2BFYA 3VS0A 2CSNA 4APPA 2WTIA 1LPUA 2JBOA 4YTHA 4C58A 4XMOA 2GS7A 3ZRMA 2A0CX 3EFJA 4DT8A 4LV7A 3SXRA 5IEXA 2Z7RA 4ANSA 4EZ5A 5M57A 4IH8A 2C6OA 4CGAA 3FMEA 3VW6A 4O7RA 2XNNA 3MS9A 3RGFA 3W1FA 5A4EA 4UN0C 3V04A 4IJPA 4TPTA 4OTDA 4PDOA 3EQPA 3SKCA 1UNGA 3OF0A 4J8MA 5IA2A 3EYGA 3KF7A 5CQWA 1UVRA 2B7AA 4AGUA 2I7QA 4MXYA 4B8MA 4K77A 4G6OA 2CNVA 4EOKA 4CCUA 3O50A 3SQQA 3C50A 3QUPA 5FWKK 4DAWA 2PL0A 1KV1A 2PZYA 3PUFC 3CJFA 3ZSGA 5J95A 3OP5A 5KE0A 2XKCA 3V3VA 3DDQA 2GCDA 2H96A 4D1XA 4DFNA 3TDWA 4X2NA 3QQKA 3UOHA 5A4LA 3I4BA 3VBVA 2BCJA 2R9SA 2IJMA 3PPJA 1FGIA 1UWJA 2J7TA 3LQ3A 5HBEA 4EL9A 2PVRA 2X7OA 4CFWA 5M09A 4AN3A 5HD7A 1KWPA 5HIBA 5LWNA 3NVKI 4EH5A 2HXQA 5CNNA 2BAJA 4PY1A 3BIZA 4IVBA 1YXUA 3TT0A 3ZC5A 4L68A 4F9WA 2XNPA 4UZDA 3EZRA 3LM0A 4ZTNA 2OJGA 3ZBFA