4Q9SA

Crystal structure of human focal adhesion kinase (fak) bound to compound1 (3,5-dihydro[1,2,4]triazino[3,4-c][1,4]benzoxazin-2(1h)-one)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
252
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Focal adhesion kinase 1
publication title Discovery of Selective and Orally Bioavailable Protein Kinase C theta (PKC theta ) Inhibitors from a Fragment Hit.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 252
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4q9sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4q9sA01
4IX5A 3BQCA 4H39A 2J0IA 1UWHA 2F7XE 5CVFA 4DLIA 4LMNA 3QXPA 5TF9A 5L8LA 2X4FA 2CNQA 3FXWA 4IW0A 4FIJA 4EH5A 3CD3A 2C6EA 3RI1A 3VJNA 4UN0C 3DBQA 3HKOA 4CNHA 1H08A 1GZKA 3TZ7A 3TIYA 2YISA 2QOLA 1PHKA 2XNNA 1PW2A 3BGZA 2YWPA 3PWYA 2RFSA 4QMMA 4XBUA 5EDQA 3UVRA 2XJ2A 1OL6A 4IAAA 4FV3A 4UWCA 4ZMEA 4FMQA 4AAAA 4BTJA 4I4FA 4JBOA 1GIIA 3WF8A 4L43A 5HTCA 4KUJA 3BYMA 5BVDA 3U9CA 2Y8OA 4R7IA 4CQGA 1JKSA 3EIDA 4U42A 4D1ZA 2F9GA 3D2IA 3PPKA 3UPXA 2XA4A 3W55A 3FYJX 4NT4A 3EN6A 4YTHA 5DEYA 4WRGA 4ASZA 5IA3A 1WBNA 3HMNA 1VR2A 4E20A 3MW1A 3O2MA 1ZRZA 1FGIA 3NSZA 4G3DA 4I94A 3P7AA 2XYNA 3KXXA 2XB7A 1PF8A 4QMTA 4BYIA 4N4SA 2EU9A 4GU9A 4GSBA 1I09A 3L1SA 2YITA 3LXNA 3KVXA 3LIJA 1RJBA 5AR7A 2PSQA 2X2LA 3BGPA 4TYIA 4USDA 5HCXA 3RPSA 5K0KA 4NKSA 5C03A 1BYGA 4YNOA 2YN8A 3NWWA 5HLWA 4FX3A 2XZSA 1TKIA 1XHAA 4NYEA 4CZYB 2W1GA 5IH4A 2R0UA 5EH0A 5A4EA 3OROA 1SZMA 4FIIA 4WG5A 3L8SA 4I5CA 4GH2A 5M07A 4O96A 3PSBA 1ERKA 4LOQA 2PZIA 2YIXA 3ET7A 4UYNA 2I0HA 5I0BA 2ZOQA 1BUHA 4LYNA 3OS3A 3OOGA 4GIHA 1PXIA 4UALA 5KZ0A 4DT9A 3AC4A 1R1WA 1YDSE 3H4JA 4RWJA 2PVJA 4HYUA 3CEKA 2PMOX 3CXWA 3LW0A 1R78A 2WMXA 3GCUA 1PXJA 3TG1A 4DEBA 4XNEA 5FM2A 3BZ3A 2J0LA 2PMNX 4JG6A 4FGBA 4NM5A 3LHJA 4O86A 3GBZA 3VS2A 5AX3A 5KMMA 5K4IA 3OXTA 3VIDA 3VF9A 3C4XA 4RJ3A 3VBXA 4D4VA 5J5TA 5J7BA 3UZPA 3SDJA 3VRYA 2GMXA 2JDOA 4FL1A 4P90A 4LOPA 5HBEA 4BCMA 5HE3A 3E64A 3QQHA 3VBYA 4QP6A 3MFTA 3VQUA 4DCAA 4RIXA 3AGLA 4H1JA 3QX2A 4EJ7A 4WIHA 1PMNA 2OZAB 3ORKA 4PUZA 4U97A 5CY3A 3CTJA 5EHLA 4CFUA 3LLAA 3U55A 3ULIA 4YZCA 1W82A 2C3LA 3CIKA 3A7GA 4GFOA 2UZTA 3II5A 4R1YA 4JXFA 2O65A 2V62A 4TWPA 4PQNA 5AWMA 2X6DA 2VO7A 3E8DA 3LMGA 5IQGA 4M0YA 5CASA 2OLCA 4IZYA 3U54A 4E4XA 2YEXA 2J4ZA 3LCOA 3Q96A 5FDPA 3UVPA 3A99A 4DG2E 4K77A 4CSVA 3PP1A 4NKAA 2RL5A 1FMKA 2C0TA 2E2BA 4JDHA 5E8WA 3UG1A 4F0FA 3QTSA 5HKMA 2QKRA 3P7BA 4DYMA 4XRLA 4JLCA 4WNKA 1ZZ2A 4DE4A 4F9CA 3IECA 1GNGA 4BBFA 1Q4LA 2NP8A 3RWQA 4V0GA 4BDFA 4BRXA 2BMCA 4TRLA 5DT4A 3ZO2A 4DFNA 4BBEA 5HQ0A 3A61A 2X2MA 5EDPA 4BCOA 5LARA 4OTRA 4BDBA 3NW5A 2Z7SA 3U6HA 4FC0A 4W8DA 2UZOA 4MKCA 4EOPA 4LGHA 4TY1A 3R7UA 4XP0A 4JG8A 3PLSA 3IGGA 4FR4A 1AD5A 3C50A 3I1AA 4FV2A 5AV0A 5LXMA 2VTLA 3R9DA 4D2RA 4GS6A 4FKTA 2CGXA 2QCSA 3TI1A 4G34A 3WIKA 4NZWB 2AC5A 3OCTA 1U5QA 4PPAA 4QMWA 4WG4A 3RJCA 3ZMMA 2WTDA 4FICA 4EUUA 3UODA 4RA4A 2YCSA 5EFQA 3AD4A 2JIVA 3ZBFA 5BVOA 2HZNA 4NU1A 3TV7A 3NPCA 4B0GA 2VX3A 4XMOA 3DDQA 3CY2A 3HV5A 1SVHA 3C0HA 3IW6A 4NFMA 4U43A 4YPSA 1U54B 1BLXA 3H10A 4PPBA 5AR2A 4ZK5A 4HVGA 1KOAA 2C6DA 3NNXA 5CXHA 4QPSA 3UIUA 3VW8A 3AGMA 4ZLOA 2Y6OA 5IZFA 3UQCA 3L8XA 2VTRA 3R9OA 4G9CA 5H3QA 3BHTA 3R8VA 5AA9A 1G8AA 2CCIA 3F88A 3RAKA 5IQBA 3ZRLA 4MXZA 4H05A 3GB2A 5CQUA 2C47A 3MDYA 4M69B 4ANSA 1S9JA 4EOOA 5HO8A 4CKJA 4N70A 4ZXTA 2GCDA 4MWHA 3UJGA 2BIKB 2JDVA 4GIIA 4D2WA 4IDTA 5BPYA 2F7ZE 2O64A 4JBVA 4XV2A 4XUFA 4YJOA 2FVDA 5M44A 2CHLA 5EYCA 4K2RA 4MNEB 4J8MA 2A2AA 3KK8A 3FZRA 2J5FA 2G2IA 5HCYA 3AD6A 4FTUA 3MFRA 3TV4A 5BUIA 1KE8A 3BLQA 3RINA 2VWXA 1JVPP 3FQSA 2W1CA 3CJFA 5EHYA 3ALOA 3QCSA 2WQNA 4EHVA 4OTQA 1XWSA 1YVJA 4TYHA 3TNQB 5E4HA 4NM0A 4K9YA 1F3MC 4BZDA 2P33A 4S31A 1ATPE 2GNFA 3MBLA 4QP3A 3ZUUA 3EQBA 1Z57A 3ZDIA 1Y6BA 4AWIA 3CPCA 2HWPA 3QUPA 1URWA 2WQBA 3R1YA 5KBQA 4EQCA 4I5HA 5H2UA 4A06A 4AGUA 1ND4A 4AXAA 5B2MA 3QYZA 4QTAA 4NFNA 2EUFB 2QHNA 3C7QA 5HOAA 1BL7A 4PDPA 2C30A 4YJQA 4J7BA 3Q5IA 4PPCA 4PV0A 2PZPA 5DRBA 3DFAA 3O50A 2P2IA 1FVTA 2OK1A 3BV2A 3QD0A 5AFVA 4C4GA 2JD5A 3NRMA 5HVYA 4AW5A 4FA2A 2CN8A 5AAGA 1DAYA 4WA9A 4YHFA 5IDNA 2WMRA 5IEXA 2YWVA 4RWIA 2OJIA 4CYJA 2YM8A 3DJ7A 3D0EA 4BIEA 4RIWA 3SAYA 2C3IB 4RGJA 4H58A 4P5QA 1PXPA 4NH1A 4KSPA 2VV9A 3IW8A 3FY0A 1JKKA 2J2IB 4CVAA 2XS0A 3Q32A 4FKLA 4IFCA 5KHXA 2BZHB 4DEEA 3JY9A 2G15A 5EM5A 5BMMA 4RWKA 4DTBA 2C5YA 4CZTA 4GMYA 4FTNA 5AV3A 3ODYX 3T9IA 3KMUA 3Q9YA 2VO6A 4WOVA 5HI2A 3IOKA 4RG0A 3LM0A 3LFAA 3QKKA 4DFZE 3F61A 4E6QA 4KD1A 3KN5A 4PMTA 3R73A 1Q97A 3DKCA 4O2PA 4ZJJA 3RZFA 5AUYA 5L6PA 4CYIA 2EXEA 3QUDA 4FV4A 4WD5A 5AA8A 1U59A 2WAJA 2H34A 4YZMA 1OI9A 4OLIA 5E1EA 3UE4A 1DM2A 4C8BA 3HLLA 4U81A 1H0WA 3GGFA 5ANOA 5FRIA 5K5XA 4NM7A 4CRSA 4FVQA 4GCJA 3TTIA 1R3CA 4G5PA 4BCNA 1OKWA 5A6OA 1CM8A 3C9WA 3VS5A 3BKBA 2X2KA 3VN9A 4F9YA 2QHMA 3B2TA 3DZOA 4G6OA 1Y91A 3EYGA 1XKKA 3MS9A 5IU2A 4JAJA 1VJYA 1W7HA 2R3OA 2B9HA 1OBDA 5ITAA 5IQFA 5EDRA 1Q3WA 2OKRA 1SM2A 1ZOEA 3FPMA 1OGUA 1K9AA 1OUKA 2HELA 2Y4IC 4FSYA 4O0WA 4XV3A 1WBSA 2YM6A 2VWIA 2ITUA 4QMZA 4UWYA 2ZVAA 4B6LA 4ANQA 3BLRA 4E4MA 3ZLWA 3RCJA 2HIWA 2X81A 3RK7A 3KQ7A 2PUUA 2O63A 2QR8A 5L6WL 2ZB0A 3DNEA 3T3UA 2W96B 2YERA 2Y0AA 4RQVA 3NYVA 4WRSA 4USEA 4W4YA 3G5DA 3ZEWA 2WEIA 4NW5A 4UMRA 2VTMA 4QQJA 3ZRMA 5GJDA 1KV1A 4MD7E 4IJ9A 3O8PA 3S95A 4ZTRA 3DKFA 5ANJA 3DOGA 4ZTNA 1X8BA 4X3FB 5DBXA 4A9YA 4L52A 3D83A 2VO3A 3KXNA 3R30A 4PRJA 3LFEA 4RC2A 3I7BA 3QD4A 4FTAA 5TKDA 3IW4A 5CEKA 4AT4A 4QTBA 4D1XA 3QA8A 5CT7A 2VZ6A 3P4KA 2YCFA 3PTGA 4AZEA 3ZUVA 5BVWA 4RJ7A 2RG6A 2UZVA 1H1WA 3Q60A 3ZRKA 3E87A 4EQUA 3F69A 4R7BA 1W83A 2HY0A 3QRTA 5D41A 4OBQA 3ZEPA 4CZUA 3DJ6A 3CD8A 3KN6A 4ZS0A 4F7LA 1TQIA 3F2NA 4F4PA 3CGFA 2IW8A 5EOBA 5AIRA 4ANOA 3E8CA 3IONA 4F1OA 1IA9A 4FBXA 4RFMA 5HO6A 2R3MA 3QQFA 1H25A 3QCYA 4I93A 4DH1A 3JY0A 1MRYA 3ETAA 2PZRA 2ITZA 3C5UA 2ITOA 2P0CA 3F7WA 3F5GA 3KULB 4L3LA 1G3NA 3BQRA 1GZNA 4K1BA 4BB4A 4D5KA 2VN9A 4BICA 4BCKA 5FTGA 4FKGA 4A4LA 1ZYDA 3EKNA 4QP4A 2C0IA 2UVXA 3FSFA 4BZOA 1QL6A 3Q4CA 2PVMA 5DFPA 3OF0A 4R8QA 3VWAA 1NVRA 4PF4A 5FXSA 4OW8A 5CEQA 3DGKA 4U6RA 2PE0A 4I3ZA 2BDJA 3H3CA 3IDPA 2GPHA 4FZDB 1QPEA 4MWIA 3QAME 3FPQA 3KCFA 3ZOSA 4BHZA 1RW8A 4F09A 3KL8A 4L8MA 3SKCA 3CGOA 4QMOA 4AW0A 3UC3A 4ARKA 4C2WA 4C62A 3UPZA 4Y73A 2X9EA 5FP5A 4IAIA 1NA7A 3THBA 1YXXA 2QOBA 3LFCA 2J9MA 4Z7GA 5EK7A 3GUBA 1NT2A 3EJ1A 4OT6A 4EBVA 4YO4A 4RBLA 3TNWA 2B9JA 3QZFA 1KWPA 2UUEA 5DWRA 5BNJA 4L01A 5D12A 3UNKA 2QU6A 4QMYA 1YOJA 1FGKA 5L2SA 4G17A 4QYHA 4AA5A 3GC8A 3PP0A 5AM7A 5AP5A 2V22A 2V5QA 4RJ6A 3TZ8A 2QO9A 3AT3A 3AD5A 4BDJA 4FVPA 3F66A 3BV3A 3D14A 4KBKA 2J0JA 1OIYA 3MY1A 1P2AA 1XJDA 2JKKA 5FXQA 4JRNA 3V04A 3VULA 3VS7A 3MA3A 4KIKB 2GS2A 4OBOA 3LQ8A 2CCHA 4UV0A 3TZ9A 4JAIA 3VQHA 3R8MA 4H3PA 4XYFA 4O0XA 3PSCA 3FLWA 4FZFB 2CNVA 4CTBA 2VWBA 3COKA 4KS7A 5AV2A 4FIHA 3HGKA 2VWZA 2OZAA 3C4ZA 5LOHA 3QZGA 2JITA 2YAKA 4AGDA 3FHRA 2ZJWA 3BWFA 3DBEA 4ZOGA 3TDWA 2WPAA 3LZBA 3TKHA 3Q9XA 3WE8A 4DAWA 4Y46A 5KCVA 1OPLA 3PY0A 2B7AA 4BGHA 3MWUA 3DBDA 4ZP5A 3U51A 3MVHA 3KRXA 4WHZA 4BVUA 2A27A 3G0FA 2YIRA 1JAMA 2C6MA 3BYSA 3ZFMA 4ANBA 4BCGA 2F2UA 3HYHA 3CCNA 4G3FA 4QMSA 5CU3A 1BI7A 1JSUA 3IKAA 2VWVA 3UOLA 3VS3A 1XBAA 1XH9A 4EJNA 1UNHA 4ZMFA 2AUHA 3GC0A 1WBOA 5AP4A 5FGKA 2B52A 2WTVA 2JKQA 1H4LA 3OHTA 4YPDA 3QRKA 1JBPE 4KSQA 2OG8A 4BDDA 4BCPA 3F3UA 4P7EA 2FUMA 3BLHA 4ZY4A 5L8KA 3QC9A 5DHJA 4D2SA 2CGUA 2WHBA 4APCA 4CT1A 5IA1A 3EL7A 2QNJA 1J7LA 4DG3E 2XK9A 2ONLC 3TNHA 3WIGA 2WMSA 3VVHA 4O7YA 3GOKA 1WCCA 5TOZA 2XK3A 2BRBA 4BTKA 5AUTA 5JFSA 1UVRA 4IX4A 2HZIA 4X2KA 4GT5A 5DI1A 4FZ7A 5L3AA 2QQ7A 3W18A 3WYYA 2J90A 2X4ZA 4RIOA 4QP9A 1GY3A 2VTHA 4XG3A 4A9RA 1UV5A 4I1ZA 2W5BA 1YI4A 4O2ZA 3OY1A 3UC4A 3EOCA 4GK3A 4IAKA 4M7IA 2H96A 1M7NA 3BU3A 3R8UA 5EHOA 2BRMA 4ITJA 4DGNA 4ALUA 1K3AA 2OFUA 1U54A 3ZS5A 1Q8YA 2PUIA 5HVKA 2XKDA 4K18A 4XOZA 3IDCA 3WARA 3K5VA 2DQ7X 1H1QA 5LVMA 3TCPA 5KMLA 4CD0A 5B0XA 5EYDA 2C5VA 2W1DA 4RLLA 4C33A 2OIQA 4IB5A 2VTIA 4M69A 1J1BA 5HESA 4QD6A 4ASDA 1H0VA 3BI6A 2BVAA 3GENA 4R77A 2PUNA 4AZSA 3ATTA 1P4FA 2CN5A 2C6OA 3SQQA 3RPOA 4HPUE 4ZZOA 1YWNA 4HJOA 4MNEA 4OR5A 5CSHA 4FV6A 5F1ZA 4K8AA 3MN3A 4EZ3A 3ZC5A 5AAFA 3QRJA 5ETFA 3PPJA 4XG8A 1OVEA 3MTLA 4BFMA 3O8TA 2W1FA 5CAPA 5GINE 3EFJA 1XH8A 2OBJA 4XJ0A 4D0XA 3NNUA 5CAVA 3Q4TA 2X8IA 4U3ZA 3CTQA 4DC2A 4XG7A 4FEXA 3OC1A 4ERWA 4AN3A 1IR3A 4I23A 3DXPA 3DY7A 4IJPA 4TWNA 3ZO3A 4MVFA 1MRUA 3FXXA 4OTDA 5E8UA 2XIXA 2VWYA 3ULZA 3E92A 3ZO1A 4AQCA 3DPKA 4C58A 2X7FA 3FMHA 2CDZA 2NO3A 4TT7A 4AP7A 3OVVA 4WNPA 3VUKA 4E4LA 3W33A 5KMKA 2XRUA 3G90X 1JNKA 3BU5A 3GCPA 2R7IA 4M12A 3L9LA 3FL4A 3V01A 2YACA 3Q4ZA 4II5A 4F7NA 5LWNA 3TUCA 4KNBA 3QALE 4R6VA 3CS9A 5KO1A 3HV4A 4PDSA 3NUPA 5HNIX 4EKLA 4Y95A 2JAMA 5F4NA 2YLFA 3LFFA 3FC2A 4FEQA 4FT9A 4YO6A 4O21A 3TKUA 4AX8A 5ANDA 5HTIA 4WNOA 3AC5A 3GP0A 4JQ8A 4X2JA 1W0XC 5HCZA 4E26A 4EK3A 4YTCA 3HA8A 3RBWA 2YZAA 2WEVA 2X39A 4FG7A 3MB7A 2IVUA 3TXOA 2JIIA 4G3CA 3G2FA 5DLSA 3PRFA 4RC3A 4G1WA 4E3CA 4BN1A 4ZLZA 1S9IA 2YCRA 3FLNC 4EH6A 2QOCA 3H0YA 4X3JA 5GZ9A 4IX3A 3F3TA 4IC8A 3VS4A 4I41A 3UQFA 2BHHA 4YBJA 4D55A 4A07A 3A7HA 4BYJA 3RPYA 4BKZA 3P23A 4O1OA 4NSTA 2PULA 3NX8A 2J51A 5HE0A 3ZC6A 2C5OA 2PVYA 3MFUA 3Q9ZA 3K54A 4MHAA 2EXCX 5FWKK 5AP1A 3I79A 3LJ1A 5CVHA 4ZSLA 3ZHPC 4FK3A 4ZSAA 4L00A 4XH6A 4CXAA 2QLQA 2RIOA 5CSVA 4QRCA 4IHPA 5AP0A 3WF6A 3FSKA 4ID7A 4IB0A 3JVRA 2UZEA 3PJCA 2J6MA 5AV1A 2Z7RA 3ZLYA 3OT3A 2CNUA 4DFUA 4GK4A 3HX4A 2C69A 5GIOE 5FM3A 5FBOA 4GKHA 2XK8A 4IX6A 2PYWA 4I0TA 3U4UA 5CU2A 4YSMA 4PP7A 5LMBA 4H36A 2I40A 4AG8A 4B8LA 2IZTA 2QVSE 2X1NA 2AC3A 4KKHA 1PXMA 3NR9A 2XNMA 3GXLA 4RIYB 4ACHA 2G2FA 4C59A 2VU3A 3C51A 1WMKA 2R3NA 2W1ZA 3E62A 3GQIA 3I60A 4KINA 2QLUA 5LVPA 4FTOA 2W1HA 4KA3A 3AXWA 3F6XA 4GJ2A 1YHVA 4HGEA 4NL0A 4DGGA 3GI3A 2R64A 1OPJA 3FZSA 3MB6A 5FTQA 4IVBA 3R9HA 2OU7A 4BCJA 3AT4A 5HD7A 1DS5A 3ATSA 4KIOA 5ANEA 3VAPA 3QBNA 4FKQA 5AMNA 4AN9A 4BIDA 1V0BA 4C4HA 2SRCA 3GCSA 3K3IA 4JOAA 4O83A 4FSQA 1V0PA 5CI6A 3AMAA 4R3RA 3D94A 2YAAA 5K0XA 5C9CA 4O82A 2XNBA 4BKJA 1J7UA 3L8VA 1PKGA 4YJPA 3QA0A 4XX9A 4E5WA 3ITZA 4GL9A 4U8ZA 1IASA 4WSQA 5AIKA 3SOCA 4C61A 5FTOA 4EKKA 2Q0NA 4XBRA 2WB8A 4B9DA 3VUTA 4O7LA 3SA0A 3BHYA 3DBFA 2UZUE 5AR4A 4DH8A 5HICA 3UOHA 3P9JA 2VNYA 5HD4A 5M53A 1QPJA 3DAJA 4J71A 2GHLA 4P5ZA 1CKIA 2R3IA 5BUEA 3MH3A 2JLDA 4OTHA 1Y57A 1H27A 3QTQA 4U3YA 4DT8A 3NW6A 1KE6A 4V05A 1UNGA 3KVWA 4IWPA 3ZSGA 1M2RA 2PTKA 4OTFA 3DKGA 5DGZA 2B54A 3ZO4A 5IQAA 2ZDTA 4PMMA 4DGMA 1PRYA 1YW2A 2B9FA 4MQ1A 3FXZA 5CEOA 4X3FC 3PDTA 5IKWA 2BDFA 2I1MA 3CTHA 4JT3A 4NUSA 5AP2A 3UO6A 4CFXA 5D11A 2HXQA 5DT0A 4RSSA 4DTAA 2C6TA 1G8SA 2VGPA 2W4OA 3FQEA 3KXHA 3I81A 3ZZEA 4WBBB 3VJOA 4E6DA 5A4QA 4BKYA 4CGAA 5E8SA 4J96A 4DF3A 3GEQA 2J7TA 3T3VA 1M7QA 1OL2A 2FSLX 4TWCA 4UB7A 3KULA 1GOLA 4BC6A 2GHGA 3I4BA 4FSUA 4HYSA 4Z7HA 5F94A 3FMJA 2QG5A 1O6KA 4BF2A 1Q5KA 3RMFA 5C1QB 5HTBA 3GVUA 4RWLA 2XKEA 3ORLA 5DPVA 3EN9A 4HGSA 1YXTA 3OCBA 5TE0A 3ZFXA 1GJOA 2F7EE 4C38A 1HCKA 3VW6A 4MD9E 3QQLA 4C3FA 4ONAA 3VUHA 4LGGA 5E7RA 4BGQA 4ZAUA 2I0YA 3CSVA 2I0EA 2C6LA 4GEOA 4FG8A 5JMSA 1H1SA 3W10A 1OL5A 5JFVA 4IAYA 4F0IA 4FTLA 3QGYA 4FV1A 4KIPA 2IVTA 2IVSA 4ZS4A 3RWPA 4C02A 2W1IA 2C6IA 4TKSA 3WZKA 4AOIA 4J99A 3Q53A 2XVDA 4YZNA 3VBQA 3MFSA 1OITA 1LP4A 2I6LA 2YABA 3MPMA 4ZZNA 5LJJA 4W4VA 4Y72A 5IQCA 5AUXA 4RQKA 2RFEA 2NPQA 2PE1A 5KHWA 2EB2A 4UXLA 2O3PA 5JGAA 3UNZA 1YKRA 4AF3A 1OIUA 3I0QA 3OEZA 4KIKA 2HW7A 3MPAA 2XEYA 4U9AA 4XV9A 4LV5A 4C4IA 1H07A 4HGTA 2YM7A 4S33A 1NVSA 3A7JA 5IEYA 3SX9A 4BCQA 3SW7A 3P86A 3E5AA 4JIKA 4EQMA 5IH5A 4YLJA 4EONA 4U7ZA 2OJJA 3R2YA 4M3QA 2QC6A 2WQEA 4NJ3A 2ITYA 3GC7A 2GS7A 2PUPA 4U40A 4IVAA 2VTQA 5FEEA 1R0PA 1TVOA 2VTTA 3JUHA 3ANQA 3KU2A 3RK9A 3NAXA 3T9TA 5HBJA 5KBRA 3MESA 4D4SA 3RM6A 3U6IA 2W05A 3KB7A 4BDAA 3NUNA 4FF8A 3ORMA 4FG9A 4L42A 3PXFA 1YHWA 4MH7A 1NW1A 4LG4A 4BBMA 2B53A 5DR2A 4QMQA 3PXYA 4U0IA 2V7AA 4ZSEA 3W8LA 2O5KA 4DINA 3QWKA 4GKIA 2OH0E 1P4OA 3FZTA 4AGCA 2E9OA 2W0JA 3BYVA 1H1PA 1OBGA 2AYPA 4TYGA 5CLPA 4FV5A 4CT2A 3AC8A 2RFDA 3IOPA 2QD9A 3AT2A 4USFA 4HZRA 5IEVA 3NNWA 5KE0A 5BUJA 3W8QA 4FL2A 3A8WA 3PZHA 3HRCA 4RVKA 3H0ZA 4C4EA 5AV4A 5B2LA 4XHKB 2BZIB 5J1WA 3G0EA 4RA5A 3RM7A 2V7OA 2PZ5A 1WBVA 4FSMA 4BCHA 4BR3A 3CKWA 1K2PA 4QMUA 2PMLX 4LL0A 3DZQA 3NW7A 2B0QA 1ZMWA 3B2WA 3PXKA 3LJ0A 4TYEA 4XRJA 2WMWA 5BX0A 3EFWA 3MY0A 5E91A 4O7SA 2IW6A 2RG5A 4A4XA 3E8NA 2XUUA 5JRSA 3SXSA 5EW3A 2CJMA 4EZ7A 5D10A 2VNWA 2W9FB 2RSVA 1GAGA 4AOTA 4EK4A 5EM6A 4IWDA 1E9HA 3FJQE 3WF9A 1ZOHA 2NNWB 4L53A 3UP2A 4YURA 4J98A 4YC3A 1EH4A 2XM9A 1FPUA 3DLZA 4IM2A 3WILA 3LKMA 3HZTA 4N0SA 4EORA 4RX5A 4CKRA 4WUAA 5EQPA 5CENA 3ELJA 2Z8CA 3QRIA 2JDRA 3PE2A 3R1NA 1Q8WA 5L2TA 3EQRA 1SVGA 4WNMA 4O7WA 1YWVA 2GSFA 4DH5A 4EC9A 3ID6C 3LJ2A 3PIYA 2GNJA 3W2RA 4L3JA 4FSZA 3H30A 5HIDA 4QMPA 1YI3A 2CMWA 4HYIA 4O7VA 3IW7A 2VD5A 3FZ1A 5JFXA 2R0IA 3ORXA 3WI6A 2Q83A 3BEGA 3CJGA 5AR8A 4EHGA 3DA6A 1DI8A 1H26A 5AUZA 3EN7A 4RFZA 4C7TA 5CSPA 3DK6A 4O22A 4ZIMA 3GU4A 4FI1A 2F4JA 4K0YA 3TEIA 3RNIA 1PYEA 3FAAA 2YJRA 3O71A 5HGIA 2WTIA 5DR6A 2ZV7A 3G33A 4ANMA 4EHZA 2WMQA 2ZYBA 3LAUA 4O0VA 5HNBA 5M4IA 2ZAZA 2YCQA 4JX7A 3DS6A 2WELA 3BU6A 3VS6A 3TACA 3COMA 2J0KA 3KGAA 3LFDA 4FL3A 3RAWA 3FMLA 3QQJA 3G9LX 4ENYA 2WMTA 4DCEA 3SGCA 3BIZA 3DBCA 4QP1A 3C4FA 4KS8A 5E8VA 4CEGA 4AE6A 4CLIA 4MBLA 4AW1A 4L68A 5DMZA 3HVCA 3W32A 3WF7A 1MRVA 3NIEA 4GYGA 2YJSA 4KKEA 2CGVA 3DLSA 4PMSA 4X21A 4Y5HA 3CQUA 3GCQA 4ZSJA 5CNNA 2WD1A 2GU8A 1OIRA 4A7CA 4IAFA 4FV0A 5CX9A 2BHEA 3MA6A 3TN8A 2W9ZB 4C34A 3SVVA 5A14A 3NCGA 4HVDA 4KIQA 2FSOX 3GFEA 5M57A 1WBPA 4CG8A 3LFQA 3KEXA 2GNLA 3Q6UA 4QQCA 3FV8A 3PJ2A 2WTCA 4UWBA 3COHA 3E3PA 4PTEA 2JEDA 5H8GA 2QI8A 2RFNA 1IA8A 1ZYJA 2GQGA 4ZEGA 5L8JA 4X2NA 2WMUA 4EH7A 4J8NA 4NW6A 5CU0A 4DGLC 3PSDA 4IC7A 1O6LA 1BKXA 2W1EA 3C4EA 3KK9A 3NUSA 4FTIA 4G31A 5EKOA 5EM7A 3LCKA 2P4IA 3R83A 4UMQA 3WYXA 2I0VA 3MPTA 2JKOA 4LOOA 3KXZA 4CKIA 4DEAA 2UVYA 3S4QA 3WBLA 4N6YA 2CKEA 2OXXA 5BVKA 2EXMA 3H9FA 4IEBA 5FQDC 2UW3A 3LXKA 1YXVA 3KRJA 1FMOE 4FNYA 2QOKA 2J0MB 3MVLA 3RNYA 2OZOA 5DVRA 5KNJA 4IE9A 3C0IA 5IA0A 3AC3A 1U4DA 4AT3A 5JEBA 2FGIA 4FK6A 1UU7A 4IVCA 4FT3A 4PTGA 2PVKA 2R2PA 3MH1A 3OCSA 3R8PA 1PMVA 2NRYA 3I7CA 3P0MA 4YZ9A 4C2VA 2UW9A 2ZM3A 4OT5A 4C57A 5I4NA 4ZY5A 3R1SA 3BBWA 4BZNA 4D9UA 4MF1A 2WZJA 3ANRA 5GNKA 2VX1A 4YJSA 5HG7A 4RC4A 5FG8A 3W2CA 4BDCA 5KKRC 4U80A 1ZXEA 3Q52A 4Z3VA 3N4UA 3U8WA 5E90A 4KKGA 1ZAOA 4PDOA 3SW4A 4FYOA 2X8EA 4FSRA 4BDHA 4NEUA 4K6ZA 5LVOA 4RIYA 2B1PA 4L67A 3C13A 5AX9A 5F9EA 5HG9A 4RRVA 2R5TA 3RGFA 1M2PA 3F5UA 2C1AA 2HZ0A 1KSWA 2R3KA 1Q24A 3BX5A 3P1AA 4MEDA 1A48A 3EN5A 4MF0A 2DS1A 3IQ7A 5I9VA 4MAOA 4J53A 5B7VA 5LMKC 4FT7A 3UIXA 5L6OA 3OT8A 4P2KA 4YZBA 4AZWA 4O84A 2W06A 3MSSA 4IWQA 4JDJA 4YJUA 4FKJA 1SVEA 5CZHA 3BPRA 3ZBXA 3V8WA 4F6WA 4K33A 4S32A 1WVXA 4I24A 3QU0A 4RX7A 5ANIA 4D9TA 4GG5A 3R7IA 2QOOA 3CKXA 4O81A 1YI6A 2PL0A 4G5JA 2YZLA 2YIQA 1H8FA 3PG1A 4QMVA 4DEHA 3I5ZA 4ORKA 4AU8A 3QUEA 3VUIA 3MVJA 5DOSA 3ZH8A 3FI8A 4MNFA 5EI8A 3W16A 4KRCA 4XG9A 5IQEA 4F9AA 4EZ5A 3VBTA 3CC6A 2BKKA 3C5IA 5KUPA 4WUNA 4X0MA 5EOLA 1L8TA 1Q61A 1UNLA 5IUIA 2IWIA 2XEZA 4AGWA 4FE2A 2IZRA 4DTKA 3PWDA 4L7FA 4YUQA 4O1PA 5T3QA 3R22A 4FTJA 3HNGA 3NYXA 5AP3A 5JK3A 3SG8A 1E1XA 4DHFA 3F2RA 4AFJA 4IANA 4CCUA 3MJ1A 2WQMA 1MUOA 4IB3A 3OXIA 2VTJA 3DK3A 4FYNA 4FTQA 4DN5A 3PXRA 3VRZA 4FKUA 4LRJA 5KMJA 4QYEA 3LE6A 5C8KA 2W99B 1XO2B 2BCJA 4NWMA 5E8ZA 4TWOA 2GHMA 5HEZA 1OKVA 3UBDA 4QP8A 3DB6A 3OZ6A 5CZIA 4E6AA 4WT6A 2UV2A 3KREA 1KV2A 4HYHA 4EOKA 1SNXA 1UU8A 1ZYSA 5CS6A 4XS2A 1Z5MA 4BDGA 2YIWA 5C27A 4OAVB 4O7NA 1NVQA 3FDNA 4GU6A 2IN6A 4DH3A 1WBTA 3H9RA 2BDWA 3E63A 4EH3A 4I0SA 3QYWA 4MQ2A 3NEWA 3PA4A 3TJDA 2ONLA 4PL5A 1OMWA 2C1BA 5T6KA 1ZY5A 4IACA 1MQBA 1FINA 4AOJA 3MV5A 4FKWA 3W2QA 3ORZA 5BQ0A 3CP9A 2PVLA 3EKKA 3F2AA 3V5QA 5IQIA 2X0GA 5M08A 4AT5A 1Y8GA 3HUBA 3HMMA 5A6NA 2BAJA 1BL6A 2EB3A 2FYSA 1PXKA 1YXUA 1OKZA 3EB0A 4IFGA 2W4KA 3GU8A 3PJ1A 4RVTA 5HE1A 3VF8A 2UW8A 4QYYA 3UG2A 4BWKA 1Q62A 3PA3A 4M97A 5CI7A 3Q04A 3ERKA 3FI3A 3HRFA 3OY3A 3KCKA 4QO9A 3ROYA 4EL9A 5CQWA 4KWPA 3LLTA 4RLKA 5G1XA 3PA5A 3S2PA 1B39A 2C0OA 3DAEA 3QQUA 3QQGA 4I6BA 5D7VA 1PXNA 3BE2A 1MQ4A 5EYMA 3IDBA 3P5KA 2EWAA 3LQ3A 4ASXA 2W4JA 3HMIA 3KKVA 1O9UA 3E7OA 4YMJA 5CAQA 4JR7A 3AC1A 2X9FA 3QL8A 1XH5A 5GHVA 3DU8A 2HOGA 4AA0A 4QOXA 4F1MA 3A7IA 3TNPC 5ACBC 5BVFA 1W8CA 3CR0A 2JGZA 3R00A 4BDKA 4BTMA 5IUGA 4O0SA 2YA9A 3RCDA 4YJVA 3K2LA 3DQWA 4I0RA 4A4OA 4M8TA 4L44A 1BMKA 4O6LA 5CF5A 4FGRA 2GQSA 1ZZLA 3PZEA 3AMBA 4HNIA 5AP7A 5EM8A 5FLFA 5ANKA 1QPCA 1YOLA 1ZWSA 4F6UA 1JKTA 3OW4A 3DXQA 3V5JA 2E9UA 5AR5A 4E8AA 4E4NA 3PY3A 1JKLA 3ORIA 5IISA 4RX8A 1FVRA 3QCXA 2X7GA 3WZEA 4E93A 3G6GA 3POOA 2OSCA 2BZKB 5IA4A 3OWJA 4PNKA 3DK7A 3FMNA 4QTEA 2WU6A 4Z16A 5CEPA 4HGLA 5EYKA 5HG5A 1ZYLA 2OGVA 2VRXA 2UVZA 3EL8A 3HUCA 2XP2A 3OXZA 2OIBA 3OG7A 4RT7A 4FV8A 2JC6A 1VYWA 2XIRA 3R63A 2REIA 5TT7A 3QTIA 5AP6A 4J52A 4PTCA 3ENMA 3UTOA 5GJFA 5CT0A 4U45A 4YC6A 3R7YA 4E73A 4EC8A 1U46A 1IRKA 5C4KA 3AQVA 4FEUA 5M4FA 4HNFA 3IG7A 1Z9XA 5I3OA 3BEAA 4E7WA 3IW5A 3NLBA 4GT3A 3K3JA 4JQ7A 4YTFA 5L2QA 3SRVB 4JRVA 2JKMA 2UW5A 2ITNA 5IH6A 2GQRA 4Y8DA 3IGOA 3ORNA 4V01A 3V51A 1OIQA 2R3JA 3CLYA 2OXYA 1SMHA 3DJ5A 3OWKA 3OTVA 3MVMA 4HCTA 5AJQA 3F9NA 3QGWA 3UYTA 5CXZA 5L4QA 2JAVA 1GZ8A 4MXXA 4G3GA 4ZTSA 4CRLA 4O7ZA 3FKLA 2JBPA 4EI4A 4G6NA 3FQHA 3SV0A 4F7SA 5A3XA 3ORPA 3C4WA 3IO7A 3OWPA 4IM3A 4KABA 3A8XA 1PYXA 2PWLA 3D5UA 4J97A 3UOKA 5T68A 2C5XA 5ETCA 2PK9A 4YP8A 2RF9A 3UOJA 4D58A 4CG9A 3FI2A 3GOPA 3ZFYA 5HU3A 3HV6A 3V5TA 3ZYAA 2WMAA 5BVNA 1WVYA 2R4BA 3NYNA 3GCVA 3RAIA 2UW7A 3PYYA 1M17A 2VTPA 3OBGA 2QO2A 3UZRA 2J50A 4M14A 4FKPA 4IAZA 4JDKA 3HP5A 3JYAA 2BUJA 3POZA 5J1VA 4NCTC 4DGOA 3KMWA 1CKJA 5AR3A 4AUAA 4I6QA 1PKDA 3HP2A 4CQEA 5LVLA 2IZUA 2BRHA 5A54A 4FODA 4GVJA 3PJ3A 4UBAA 2GTMA 3UMXA 4L6QA 5HLNA 4F64A 3HAMA 3WF5A 3BBTB 1URCA 4JI9A 5CSWA 4LM5A 2I7QA 2WTJA 2ZDUA 4I92A 3HA6A 4E6CA 3LCTA 5HBHA 5KKRB 3OTUA 4Y5QA 1APME 2ETRA 2W17A 2XK4A 4QPMA 4ACMA 4FUXA 4YLKA 3FLSA 4ACGA 3PUPA 3IK3A 2VWWA 2WIPA 2ERZE 3TUBA 2HAKA 3OW3A 2ZV8A 4QYGA 4YBKA 4EUTA 2XKFA 1WFCA 3GT8A 5JN2A 5K5NA 1YQJA 2HZ4A 3T8OA 3NZ0A 1NXKA 3FBVA 5AUVA 2NRUA 3U87A 4EOIA 3LCDA 2XKCA 3EMGA 5CAOA 2YM3A 5JH6A 2ITPA 4JG7A 2ETMA 3PLAE 1OUYA 3PE1A 4FKOA 2A1AB 1T45A 2EVAA 2ZM4A 4UYAA 2WMVA 3OOMA 3W2PA 4EEVA 3WZDA 3VS0A 2W7XA 3EN4A 3LXPA 4AACA 2C4GA 4AA4A 3I0OA 5C4LA 1A9UA 3S0OA 2ZM1A 5E8XA 3OCGA 4JIAA 2BAKA 3Q6WA 3KXMA 5J87A 1Q8TA 1JQHA 1CSNA 2X6EA 4MX9A 4R5YA 2BRGA 4GRBA 5EI6A 4G6LA 4EOLA 2F2CB 1JSTA 1STCE 2XNGA 2BFXA 2GFSA 3GC9A 3QX4A 4CTCA 5I5ZA 4AW2A 3TM0A 5CSXA 3M11A 2X8DA 1VYZA 4OTPA 1UWJA 3F7ZA 4P4CA 4U79A 4L45A 5FUTA 3VNTA 2FSMX 4NK9A 4F6SA 4LMUA 5J79A 2GNIA 4QMLA 5BMSA 2WOTA 5HO7A 2UZWE 4YLLA 2YDKA 2XCKA 4O38A 2V0DA 2YHVA 2XJ1A 4S30A 3QTZA 2JBOA 5JQ5A 1WZYA 3M1SA 2PVFA 3UO4A 3E93A 4X3FA 2R9SA 3AOXA 2XCHA 3N9XA 4RJ5A 4BL1A 3VC4A 2FB8A 4C0TA 3VUGA 5C26A 4W8EA 5AAEA 2PHKA 4YZDA 3QQKA 2VTOA 4NIFB 4DG0E 3OMVA 3DTCA 3PVGA 3QFVA 1AQ1A 1YRPA 2VAGA 3RALA 3SLSA 5M09A 3EQIA 4R78A 5EQYA 1OB3A 3HMOA 4DBNA 4QQTA 3L9NA 3TIZA 3ZLSA 4S2ZA 5CANA 1IEPA 1UU9A 4UY9A 1PJKA 3QC4A 1HOWA 4I22A 1PXLA 1Q8ZA 4F0GA 1YHSA 3BE9A 3EQPA 1UU3A 3ZM9A 3QTWA 4JBPA 3RPRA 3SHEA 3OUNB 3VBWA 1IG1A 4C4JA 4PX6A 4MXYA 2Z60A 3DQXA 5H8EA 3S3IA 4Z55A 4ANLA 1Y6AA 1YWRA 4K11A 4NTSA 3QWJA 4I5PA 4E5AX 5A9UA 3KXGA 4FEVA 4E5BA 4UXQA 4ZSGA 4FKRA 3KRLA 4FTKA 2VTNA 4LRMA 3LPBA 4M13A 3WOWA 3UO5A 1H24A 1OL7A 2OWBA 4GFGA 4QPAA 4XLVA 1LUFA 4H3BA 2UZBA 3R28A 3HL7A 3JVSA 4GK2A 3UDBA 5K9IA 3PXQA 5DR9A 4XCUA 2WOUA 2B4SB 4W9XA 4GV1A 5GZ8A 2BIYA 5IF1A 2QOQA 1FVVA 3A4OX 5CU6A 4RPVA 5HG8A 5HORA 3FHIA 5KMNA 4C37A 4YSJA 3E88A 4IM0A 2O2UA 1W84A 3G9NA 4KRDA 3LVPA 3S00A 5HIEA 3NVMB 3M2WA 5HNGA 2XNPA 1M2QA 1REJA 2Z7LA 3QTUA 5HX6A 3PJ8A 2XK6A 2R3RA 2A19B 3E8EA 2OFVA 5E92A 4FT0A 4I21A 4CFNA 4LRKA 4PL4A 5ETAA 5DN3A 5LMAA 2DYLA 4O0RA 5CEIA 2CGWA 3O17A 4UMTA 3QKLA 5GJGA 3WZJA 1JOWB 4Q9ZA 4IB1A 2HENA 2GNGA 3I6UA 3MY5A 3NNVA 4QTDA 3OFMA 2IJMA 3CBLA 3UIMA 3QHWA 5ETIA 1I44A 3EQHA 4QNAA 4EHEA 3D4QA 3ZSHA 3ZZWA 2C3KA 3D5XA 4CLJA 3MH2A 2ZMCA 3UNJA 5DG5A 5KZIA 3KFAA 1W98A 2G2HA 2BALA 1KE9A 5JT2A 4FNZA 4DFBA 2B55A 2C3JA 4UEUA 3O8UA 5HIBA 3R2BA 5DE2A 5ANGA 4B7TA 3B8QA 3DKOA 4PWNA 3QCQA 4F9WA 2JFLA 4LUEA 3B8RA 2ZMDA 4IH8A 4DEDA 5AUUA 2OI4X 2ETKA 1R39A 1JWHA 3F5XA 3NGAA 4FNXA 4ZY6A 4IADA 4YHTA 1RQQA 2R3PA 5JZNA 2XNEA 4MD8E 3GU5A 5LCKA 4UZDA 5I9ZA 4QP2A 2JDSA 2BZJA 4PMPA 3KF4A 5K3YA 5J9YA 2BILB 2G9XA 2IG7A 2W5AA 1WBWA 4U41A 2JDTA 4JS8A 3UMWA 3LMIA 5F95A 3V5LA 3DCVA 3R7EA 3V8TA 3KA0A 3ZXTA 5M4CA 2R3QA 3UVQA 1QCFA 3KF7A 4Y85A 2PVNA 4YR8A 4ZTMA 4IXPA 5HLPA 4O7RA 4H3QA 3L9PA 4AE9A 3F5PA 2HXLA 1GIHA 3Q5ZA 3JR1A 5FXRA 3F3WA 5ACKA 3PFQA 4EK5A 1Q3DA 3TKIA 3V3VA 4CMOA 2BROA 4KBCA 5FEQA 3FKOA 4LUDA 4BDIA 5A4LA 1B6CB 3BYOA 3BWJA 3C1XA 2WKMA 2PMIA 3FL5A 2FSTX 1DI9A 5IMXA 1RDQE 2OW3A 5CAUA 2PVHA 4BCFA 2OJGA 2P2HA 2HYYA 1YXSA 3LM5A 4D2VA 5L2IA 4TZRA 3QZHA 1LEZA 1UKIA 4X6QC 4PY1A 3QLFA 4FKVA 3F3VA 5AM6A 5CALA 4ALWA 4ZLYA 5CNOA 5HU9A 2CLQA 4A9SA 1WAKA 4BWPA 4I6FA 4F9BA 2BTRA 1LR4A 2XM8A 4C3PA 2ZV9A 3R9RA 3WE4A 1XH7A 3EQFA 3R6XA 2BRNA 2XIYA 3PRIA 4D5HA 2PPQA 2QG7A 3BYUA 3ALNA 3ODZX 4RJ8A 5JGBA 4GT4A 3ZONA 3RAHA 4XG4A 4X7QA 1PXOA 1J91A 5K4JA 5BYLA 4DH7A 4IQ6A 2WO6A 1KE7A 4L46A 4W4WA 4Q9SA 1XBCA 4PDYA 3SD0A 2H6DA 3D2KA 1DAWA 3EZRA 2OJ9A 4EYJA 3K5UA 2G1TA 4ANNA 3R01A 4QQ5A 3RPVA 4F70A 3QXOA 3DDPA 4TW9A 3FI4A 3NVKI 2PY3A 5A4CA 3BELA 3EHAA 3D7TB 4IBMA 5J9ZA 2XK7A 3LMHA 1AGWA 4FIGA 3RK5A 4S34A 3FMMA 4O91A 4RVMA 2YM5A 3NCZA 5KMIA 4YJNA 1QMZA 2HWOA 4M15A 5JSMA 3EQCA 2Y7JA 4FSWA 4UMPA 4H1MA 4U5JA 5JFWA 3Q4UA 4ZTLA 2WXVA 2E9VA 4BTFA 3OWLA 4I5MA 5DA3A 3TUDA 1F5QA 1VEBA 4O0UA 4BI0A 4HVSA 1ZOGA 1H00A 4TXCA 3GU6A 3WZUA 5EQEA 3HDNA 4B4LA 3ROCA 5B2KA 4AFEA 1HCLA 3A60A 4APPA 2J5EA 3EFLA 4EOQA 1NY3A 3RKBA 4XP3A 3QTRA 4BHNA 3SRVA 4X2FA 4BY9E 4DBXA 3QTXA 3MJ2A 4EH9A 2UZNA 3QLGA 4EH4A 4O0YA 3L9MA 2R3HA 2GDOA 4YHJA 3BHUA 3S1HA 2DWBA 2R3LA 1TQPA 3DFCB 3MI9A 3R0TA 4QTCA 2OXDA 1J1CA 3VUDA 3FLZA 2BAQA 2WTKC 2XJ0A 2YLEA 5DNRA 5I3RA 3JXWA 2G01A 4PNIA 5H9BA 4L9IA 2OF4A 4XOYA 4BCIA 5FP6A 5BVEA 2Y6MA 4YGAA 1ZLTA 3FC1X 4UMUA 3QRUA 4IWOA 3FLQA 4EYMA 5D7AA 1RE8A 3R8LA 3REPA 4L3PA 5C8MA 1OL1A 4G16A 3P7CA 2QKWB 2XMYA 4MK0A 5EW9A 3A4PA 2ITXA 2B9IA 4R3CA 5IA2A 2HK5A 5LCJA 3LXLA 3H9OA 3DAKA 4EWQA 3HMPA 5BYYA 4FNWA 4ASEA 4ZTHA 3TTJA 2ERKA 3W2SA 1PMEA 2P55A 3AMYA 3QKMA 4HPTE 4O0TA 4ZTQA 4UX9A 3O23A 3ZUTA 5CTPA 3UP7A 4CFMA 2BKZA 1P5EA 5IQDA 4BI2A 3FMEA 4IIRA 3OBJA 3ZXZA 5M4UA 3P08A 2CKQA 4A9UA 5CF8A 1MP8A 4FTTA 3NS9A 4E1ZA 3GNIB 3U9NA 5FBNC 4HZSA 5I9YA 3KRRA 4XV1A 3FKNA 2FH9A 2IPXA 3MTFA 2ACXA 4UZHA 4HVIA 2ITVA 4M67A 1SNUA 2LGCA 1H28A 2QU5A 2VTAA 1XR1A 4I20A 4IZAA 5IMEA 2CKPA 4U44A 4WO5A 4IZ5A 1KOBA 5M56A 5AUWA 1FBNA 3D5WA 5EG3A 4W9WA 4ITHA 2RKUA 1Q99A 4J1RA 4DA5A 4GUEA 4C36A 4ZJIA 1XBBA 2O8YA 5E9EA 4OTIA 4RFYA 4Z9LA 1QPDA 3E3BX 3EYHA 2ZB1A 4JVGA 1OZ1A 3PVBA 4RX9A 3NAYA 3ACKA 2Y4PA 4ZZMA 2Z02A 5DRDA 3NUYA 4G3EA 4TPTA 4QT1A 4RVLA 5JGDA 5LMKA 4BWXA 2PE2A 2DUVA 4FSTA 2F49A 4M84A 5IQHA 3ZCLA 3EQGA 3FZOA 3FY2A 5GIPE 4JJRA 4G2FA 5M51A 5TO8A 2BTSA 4M66A 3DT1A 4N57A 3GFWA 1XQZA 3KRWA 3RZBA 3HDMA 3PPZA 1V0OA 3O7LD 1OECA 4RZVA 5IA5A 1Q8UA 1FQ1B 3LFSA 4NJDA 4TYJA 4YJTA 4BGGA 3AC2A 2Y9QA 3R7OA 1Y8YA 4B99A 3D5VA 5EI2A 3BRBA 3A7FA 4F08A 5FD2A 3N4VA 3MIYA 3LQ5A 4X6RA 3R1QA 3A62A 4RIXB 5CWZA 3DV3A 5CVGA 2CPKE 5TR6A 4FOBA 1CTPE 3KC3A 4LQMA 4F7JA 3R04A 2QOHA 3O96A 3P78A 2XBAA 4IVDA 3V5PA 2IW9A 4EBWA 4CFWA 1O6YA 3D7ZA 3PVWA 2HW6A 3BHVA 4TN6A 5C01A 3QD2B 2RGPA 4XEYA 4LGDA 2BR1A 5LWMA 4CV8A 2FA2A 4GG7A 3UZTA 4WSYA 1E1VA 3QHRA 4DEGA 2UZDA 5CF6A 3VBVA 4F65A 5D9HA 4FIFA 3M42A 3PIXA 3COIA 5DIAA 4R7HA 3SOAA 4MXOA 3NDMA 2C68A 5BYZA 3V6RA 4MBIA 2C5NA 2IZSA 4D1SA 4V04A 4WG3A 1JSVA 1KE5A 2KTYA 4DEIA 4ITIA 2H8HA 4KBAA 4YC8A 5I9UA 3FYKX 4PL3A 3D15A 4V0GB 4ZJVA 4EOJA 5CYIA 4NIFA 1SYKA 3V6SA 4EK8A 5CF4A 2XYUA 1H01A 3HV7A 3LFBA 1BX6A 4HOKA 4FKSA 1TQMA 4KAOA 4GYIA 1B38A 3QZIA 1OKYA 3QD3A 3RTPA 3ZSIA 5JKGA 2C6KA 4YJRA 3EQDA 2VO0A 4B8MA 3UYSA 3TDVA 3F3ZA 1BI8A 4EOSA 4A9TA 2QOFA 3BCEA 2WMBA 4CFFA 3C4CA 3LOKA 3Q2MA 4AN2A 4M68A 1KUTA 4MYGA 3O51A 5L2WA 1OM1A 1R0EA 2OF2A 2WNTA 1GZOA 2GNHA 4GVAA 3VUMA 4EH8A 1PY5A 2JFMA 2QR7A 3HEGA 3SC1A 3CQWA 3OD6X 3ORTA 3L8PA 3PXZA 4XG6A 3TL8A 3NUAA 5A46A 3I5NA 3SXRA 3GQLA 4QYFA 4FTRA 5DH3A 4HCVA 2GTNA 3V5WA 4D2TA 2YIYA 2BPMA 5D1JA 5HX8A 4FZ6A 1CMKE 3EZVA 3MGYA 2YDIA 3NUXA 4FTMA 5HE2A 2WU7A 3TWJA 4DITA 4RJ4A 4F63A 2Z2WA 3G15A 2VGOA 2WGJA 3SG9A 1VZOA 5CEMA 3HRBA 3FEGA 4ALVA 4TNBA 2X7OA 1GIJA 4L7SA 3G6HA 4YU2A 2WQOA 3A2CA 4R1VA 2XIKA 4D4RA 3E7VA 4IDVA 3R9NA 4JQEA 4AZVA 4XG2A 4C3RA 2CSNA 2IVVA 3G51A 5LVNA 3RHXA 1ZYCA 4AZTA 3C0GA 3Q3BA 2Z7QA 3Q9WA 3IS5A 2UZLA 2JIUA 4FKIA 3RVGA 3ZTXA 4X2GA 3F82A 4FV9A 4JR3A 2ESMA 5E8YA 5EW8A 2ITTA 3R8ZA 3NMUF 2OICA 3UGCA 1XH6A 4EWHA 4MXAA 4JX3A 2QONA 3DXNA 4RZWA 1UA2A 4GJ3A 3R21A 4O6EA 4QP7A 2E9NA 4I4EA 2OO8X 2YFXA 4FIEA 5DEWA 2QODA 2WTWA 4I6HA 4TYHB 3R71A 1CKPA 3ZLXA 3U6JA 4O7TA 2W5HA 3VHEA 4EH2A 5F20A 4Y83A 4IMYA 3ZM4A 2PZYA 3O0GA 4R3PA 4G9RA 5JRQA 1OPKA 2A0CX 4BI1A 5AADA 2UW0A 3CE3A 3DTWA 4OBPA 3ACJA 1JLUE 4JDIA 4BIBA 5IG1A 1A06A 4GUBA 3V8SA 3LFNA 1ZY4A 3IPHA 2ITQA 1M14A 2OH4A 2A4LA 3HECA 4LFIA 4YNEA 3UIBA 3NYOA 2VX0A 4PP9A 3VS1A 4YTIA 1XH4A 3OP5A 2UW4A 3HAVA 5AEPA 3FMKA 3MYGA 4N6ZA 1L3RE 4F99A 3R02A 3VO3A 4CV9A 3N51A 4Q5EA 4WBOA 5E8TA 2WFYA 2GS6A 5JQ8A 5DT3A 4D4YA 4C35A 2CKOA 3RHKA 4QNYA 4FUYA 5JZJA 4RMZA 2P3GX 3OEFX 4FEWA 2XF0A 3UQGA 3FLYA 1CDKA 2BFYA 5FDXA 2V55A 4GFMA 2PU8A 3P79A 2UW6A 5J9LA 3ENHA 1YDRE 2R7BA 3BGQA 2YM4A 4M0ZA 4RIWB 2XRWA 2ITWA 1T46A 2WTKB 2XNOA 1H1RA 3R7GA 4MXCA 3ZDUA 5J5SA 4CMTA 3RP9A 5IPJA 2Q0BA 2F57A 1LEWA 3EWHA 3TV6A 4TL0A 3LCSA 4W4XA 4FSNA 4FOCA 4JNWA 5I9WA 4LI5A 4FT5A 3TJCA 5E1SA 2QURA 4LL5A 2LAVA 2O0UA 4ENXA 4FV7A 5FEDA 3FWQA 4C4FA 1FOTA 3DNDA 2R3FA 4D2PA 3EFKA 3AG9A 4FTCA 5G6VA 4AS0A 1F0QA 5IDPA 5M06A 1YOMA 3GU7A 1V1KA 2QOIA 4IZ7A 3KY2A 3W1FA 4EK6A 3O7LB 3PG3A 3CPBA 3R7VA 3FUPA 2CLXA 5J7HA 3SXFA 3OUKA 4FVRA 4DLJA 4DFXE 4NM3A 4HW7A 4GW8A 3MH0A 3JPVA 1WVWA 1ZARA 4FZAB 4NCTA 5CU4A 4CFVA 4ERKA 4F1TA 2H9VA 3I6WA 4OGRA 2XBJA 1ZMUA 3VHKA 2Y4IB 4TNDA 3TZMA 2XH5A 3D9VA 1ZMVA 2QO7A 3PVUA 4ACCA 5KX8A 4D28A 3TT0A 3Q2JA 5HHWA 3PIZA 5J95A 4OTGA 3D7TA 5GZAA 1J3HA 2HY81 4LV8A 3NUUA 3DB8A 2ZV2A 2VTSA 1REKA 2XIZA 4CMUA 5A4TA 1IAJA 4O27B 4D0WA 1YDTE 2R3GA 4OAUC 4KB8A 4XLIA 3TNIA 2OJFE 5HVJA 5IUHA 4MBJA 4BDEA 4NTTA 4Q5HA 4XP2A 3EH9A 1J7IA 1M52A 3QF9A 4DFYA 4OUCA 4HVHA 5I9XA 5DYJA 3NIZA 5EKNA 2E9PA 5LQFA 3U4WA 1U5RA 3HV3A 2WIHA 4MCVA 2VWUA 4JL9A 2VUWA 3W2OA 4TTHB 2YDJA 2GFCA 4QMXA 5H8BA 4DFLA 4QMNA 2KULA 1G5SA 4OTWA 3FZPA 2OIDA 2PVRA 4HCUA 1Q41A 3CY3A 3MIAA 5ICPA 1IAHA 5HZNA 4WKQA 1PMUA 3ZU7A 2HCKA 4MTAA 3BHHA 3FMDA 5C8NA 4ACDA 3N4TA 4Q2AA 3KMMA 5J8IA 4CCBA 4J95A 4AZFA 5KMOA 2IO6A 1JPAA 4R5SA 3CQEA 5M55A 1UKHA 2FO0A 3FE3A 3JS2A 4EOMA 1P14A 3PY1A 1LPUA 4JBQA
chains in the Genus database with same CATH superfamily
4IX5A 3BQCA 4H39A 2J0IA 1UWHA 2F7XE 5CVFA 4DLIA 4LMNA 3QXPA 5TF9A 5L8LA 2X4FA 2CNQA 3FXWA 4IW0A 4FIJA 4EH5A 3CD3A 2C6EA 3RI1A 3VJNA 4UN0C 3DBQA 1ST0A 3HKOA 4CNHA 1H08A 1GZKA 3TZ7A 3TIYA 2YISA 2QOLA 1PHKA 2XNNA 1PW2A 3BGZA 2YWPA 3PWYA 2RFSA 4QMMA 4XBUA 5EDQA 3UVRA 2XJ2A 1OL6A 4IAAA 4FV3A 4UWCA 4ZMEA 4FMQA 4AAAA 4BTJA 4I4FA 4JBOA 1GIIA 3WF8A 4L43A 5HTCA 4KUJA 3BYMA 5BVDA 3U9CA 2Y8OA 4R7IA 4CQGA 1JKSA 3BLAA 3EIDA 4U42A 4D1ZA 2F9GA 3D2IA 3PPKA 3UPXA 2XA4A 3W55A 3FYJX 4NT4A 3EN6A 4YTHA 5DEYA 4WRGA 4ASZA 5IA3A 1WBNA 3HMNA 1VR2A 4E20A 3MW1A 3O2MA 4QEBA 1ZRZA 1FGIA 3NSZA 4G3DA 4I94A 3P7AA 2XYNA 3KXXA 2XB7A 1PF8A 4QMTA 4BYIA 4N4SA 2EU9A 4GU9A 4GSBA 1I09A 3L1SA 2YITA 3LXNA 3KVXA 3LIJA 1RJBA 5AR7A 2PSQA 2X2LA 3BGPA 4TYIA 4USDA 5HCXA 3RPSA 5K0KA 4NKSA 5C03A 1BYGA 4YNOA 2YN8A 3NWWA 5HLWA 4FX3A 2XZSA 1TKIA 1XHAA 4NYEA 4CZYB 2W1GA 5IH4A 2R0UA 5EH0A 5A4EA 3OROA 1SZMA 4FIIA 4WG5A 3L8SA 4I5CA 4GH2A 5M07A 4O96A 3PSBA 1ERKA 4LOQA 2PZIA 2YIXA 3ET7A 4UYNA 4JMQA 2I0HA 5I0BA 2ZOQA 1BUHA 4LYNA 3OS3A 3OOGA 4GIHA 1PXIA 4UALA 3VONA 5KZ0A 4DT9A 3AC4A 1R1WA 1YDSE 3H4JA 4RWJA 2PVJA 4HYUA 3CEKA 2PMOX 3CXWA 3LW0A 1R78A 2WMXA 3GCUA 1PXJA 3TG1A 4DEBA 4XNEA 5FM2A 3BZ3A 2J0LA 2PMNX 4JG6A 4FGBA 4NM5A 3LHJA 4O86A 3GBZA 3VS2A 5AX3A 5KMMA 5K4IA 3OXTA 3VIDA 3VF9A 3C4XA 4RJ3A 3VBXA 4D4VA 5J5TA 5J7BA 3UZPA 3SDJA 4AAYA 3VRYA 2GMXA 2JDOA 4FL1A 4P90A 4LOPA 5HBEA 4BCMA 5HE3A 3E64A 3QQHA 3VBYA 4QP6A 3MFTA 3VQUA 4DCAA 4RIXA 3AGLA 4H1JA 3QX2A 4EJ7A 4WIHA 1PMNA 2OZAB 3ORKA 4PUZA 4U97A 5CY3A 3CTJA 5EHLA 4CFUA 3LLAA 3U55A 3ULIA 4YZCA 1W82A 2C3LA 3CIKA 3A7GA 4GFOA 2UZTA 3II5A 4R1YA 4JXFA 2O65A 2V62A 4TWPA 4PQNA 5AWMA 2X6DA 2VO7A 3E8DA 3LMGA 5IQGA 4M0YA 5CASA 2OLCA 4IZYA 3U54A 4E4XA 2YEXA 2J4ZA 3LCOA 3Q96A 5FDPA 3UVPA 3A99A 4DG2E 4K77A 4CSVA 3PP1A 4NKAA 2RL5A 1FMKA 2C0TA 2E2BA 4JDHA 5E8WA 3UG1A 4F0FA 3QTSA 5HKMA 2QKRA 3P7BA 4DYMA 4XRLA 4JLCA 4WNKA 1ZZ2A 4DE4A 4F9CA 3IECA 1GNGA 4BBFA 1Q4LA 2NP8A 3RWQA 4V0GA 4BDFA 4BRXA 2BMCA 4TRLA 5DT4A 3ZO2A 4DFNA 4BBEA 5HQ0A 3A61A 2X2MA 5EDPA 4BCOA 5LARA 4OTRA 4BDBA 3NW5A 2Z7SA 3U6HA 4FC0A 4W8DA 2UZOA 4MKCA 4EOPA 4LGHA 4TY1A 3R7UA 4XP0A 4JG8A 3PLSA 3IGGA 4FR4A 1AD5A 3C50A 3I1AA 4FV2A 5AV0A 5LXMA 2VTLA 3R9DA 4D2RA 4GS6A 4FKTA 2CGXA 2QCSA 3TI1A 4G34A 3WIKA 4NZWB 2AC5A 3OCTA 1U5QA 4PPAA 4QMWA 4WG4A 3RJCA 3ZMMA 2WTDA 4FICA 4EUUA 3UODA 4RA4A 2YCSA 5EFQA 3AD4A 2JIVA 3ZBFA 5BVOA 2HZNA 4NU1A 3TV7A 3NPCA 4B0GA 2VX3A 4XMOA 3DDQA 3CY2A 3HV5A 1SVHA 3C0HA 3IW6A 4NFMA 4U43A 4YPSA 1U54B 1BLXA 3H10A 4PPBA 5AR2A 4ZK5A 4HVGA 1KOAA 2C6DA 3NNXA 5CXHA 4QPSA 3UIUA 3VW8A 3AGMA 4ZLOA 2Y6OA 5IZFA 3UQCA 3L8XA 2VTRA 3R9OA 4G9CA 5H3QA 3BHTA 3R8VA 5AA9A 1G8AA 2CCIA 3F88A 3RAKA 5IQBA 3ZRLA 4MXZA 4H05A 3GB2A 5CQUA 2C47A 3MDYA 4M69B 4ANSA 1S9JA 4EOOA 5HO8A 4CKJA 4N70A 4ZXTA 2GCDA 4MWHA 3UJGA 2BIKB 2JDVA 1W2CA 4GIIA 4D2WA 4IDTA 5BPYA 2F7ZE 2O64A 4JBVA 4XV2A 4XUFA 4YJOA 2FVDA 5M44A 2CHLA 5EYCA 4K2RA 4MNEB 4J8MA 2A2AA 3KK8A 3FZRA 2J5FA 2G2IA 5HCYA 3AD6A 4FTUA 3MFRA 3TV4A 5BUIA 1KE8A 3BLQA 3RINA 2VWXA 1JVPP 3FQSA 2W1CA 3CJFA 5EHYA 3ALOA 3QCSA 2WQNA 4EHVA 4OTQA 1XWSA 1YVJA 4TYHA 3TNQB 5E4HA 4NM0A 4K9YA 1F3MC 4BZDA 2P33A 4S31A 1ATPE 2GNFA 3MBLA 4QP3A 3ZUUA 3EQBA 1Z57A 3ZDIA 1Y6BA 4AWIA 3CPCA 2HWPA 3QUPA 1URWA 2WQBA 3R1YA 5KBQA 4EQCA 4I5HA 5H2UA 4A06A 4AGUA 1ND4A 4AXAA 5B2MA 3BL9A 3QYZA 4QTAA 4NFNA 2EUFB 2QHNA 3C7QA 5HOAA 1BL7A 4PDPA 2C30A 4YJQA 4J7BA 3Q5IA 4PPCA 4PV0A 2PZPA 5DRBA 3DFAA 3O50A 2P2IA 1FVTA 2OK1A 3BV2A 3QD0A 5AFVA 4C4GA 2JD5A 3NRMA 5HVYA 4AW5A 4FA2A 2CN8A 5AAGA 1DAYA 4WA9A 4YHFA 5IDNA 2WMRA 5IEXA 2YWVA 4RWIA 2OJIA 4CYJA 4AXDA 2YM8A 3DJ7A 3D0EA 4BIEA 4RIWA 3SAYA 2C3IB 4RGJA 4LV7A 4H58A 4P5QA 1PXPA 4NH1A 4KSPA 2VV9A 3IW8A 3FY0A 1JKKA 2J2IB 4CVAA 2XS0A 3Q32A 4FKLA 4IFCA 5KHXA 2BZHB 4DEEA 3JY9A 2G15A 5EM5A 5BMMA 4RWKA 4DTBA 2C5YA 4CZTA 4GMYA 4FTNA 5AV3A 3ODYX 3T9IA 3KMUA 3Q9YA 2VO6A 4WOVA 5HI2A 3IOKA 4RG0A 3LM0A 3LFAA 3QKKA 4DFZE 3F61A 4E6QA 4KD1A 3KN5A 4PMTA 3R73A 1Q97A 3DKCA 1W2FA 4O2PA 4ZJJA 3RZFA 5AUYA 5L6PA 4CYIA 2EXEA 3QUDA 4FV4A 4WD5A 5AA8A 1U59A 2WAJA 2H34A 4YZMA 1OI9A 4OLIA 5E1EA 3UE4A 1DM2A 4C8BA 3HLLA 4U81A 1H0WA 3GGFA 5ANOA 5FRIA 5K5XA 4NM7A 4CRSA 4FVQA 4GCJA 3TTIA 1R3CA 4G5PA 4BCNA 1OKWA 5A6OA 1CM8A 3C9WA 3VS5A 3BKBA 2X2KA 3VN9A 4F9YA 2QHMA 3B2TA 3DZOA 4G6OA 1Y91A 3EYGA 1XKKA 3MS9A 5IU2A 4JAJA 1VJYA 1W7HA 2R3OA 2B9HA 1OBDA 5ITAA 5IQFA 5EDRA 1Q3WA 2OKRA 1SM2A 1ZOEA 3FPMA 1OGUA 1K9AA 1OUKA 2HELA 2Y4IC 4FSYA 4O0WA 4XV3A 1WBSA 2YM6A 2VWIA 2ITUA 4QMZA 4UWYA 2ZVAA 4B6LA 4ANQA 3BLRA 4E4MA 3ZLWA 3RCJA 2HIWA 2X81A 3RK7A 3KQ7A 2PUUA 2O63A 2QR8A 5L6WL 2ZB0A 3DNEA 3T3UA 2W96B 2YERA 2Y0AA 4RQVA 3NYVA 4WRSA 4USEA 4W4YA 3G5DA 3ZEWA 2WEIA 4NW5A 4UMRA 2VTMA 4QQJA 3ZRMA 5GJDA 1KV1A 4MD7E 1VLRA 4IJ9A 3O8PA 3S95A 4ZTRA 3DKFA 5ANJA 3DOGA 4ZTNA 1X8BA 4X3FB 5DBXA 4A9YA 4L52A 3D83A 2VO3A 3KXNA 3R30A 4PRJA 3LFEA 4RC2A 3I7BA 3QD4A 4FTAA 5TKDA 3IW4A 5CEKA 4AT4A 4QTBA 4D1XA 3QA8A 5CT7A 2VZ6A 3P4KA 2YCFA 3PTGA 4AZEA 3UDZA 3ZUVA 5BVWA 4RJ7A 2RG6A 2UZVA 1H1WA 3Q60A 3ZRKA 3E87A 4EQUA 3F69A 4R7BA 1W83A 2HY0A 3QRTA 5D41A 4OBQA 3ZEPA 4CZUA 3DJ6A 3CD8A 3KN6A 4ZS0A 4F7LA 1TQIA 3F2NA 4F4PA 3CGFA 2IW8A 5EOBA 5AIRA 4ANOA 3E8CA 3IONA 4F1OA 1IA9A 4FBXA 4RFMA 5HO6A 2R3MA 3QQFA 1H25A 3QCYA 4I93A 4DH1A 3JY0A 1MRYA 3ETAA 2PZRA 2ITZA 3C5UA 2ITOA 2P0CA 3F7WA 3F5GA 3KULB 4L3LA 1G3NA 3BQRA 1GZNA 4K1BA 4BB4A 4D5KA 2VN9A 4BICA 4O4EA 4BCKA 5FTGA 4FKGA 4A4LA 1ZYDA 3EKNA 4QP4A 2C0IA 2UVXA 3FSFA 4BZOA 1QL6A 3Q4CA 2PVMA 5DFPA 3OF0A 4R8QA 3VWAA 1NVRA 4PF4A 5FXSA 4OW8A 5CEQA 3DGKA 4U6RA 3NFGB 2PE0A 4I3ZA 2BDJA 3H3CA 3IDPA 2GPHA 4FZDB 1QPEA 4MWIA 3QAME 3FPQA 3KCFA 3ZOSA 4BHZA 1RW8A 4F09A 3KL8A 4L8MA 3SKCA 3CGOA 4QMOA 4AW0A 3UC3A 4ARKA 4C2WA 4C62A 3UPZA 4Y73A 2X9EA 3AKKA 5FP5A 4IAIA 1NA7A 3THBA 1YXXA 2QOBA 3LFCA 2J9MA 4Z7GA 5EK7A 3GUBA 1NT2A 2XAOA 3EJ1A 4OT6A 4EBVA 4YO4A 4RBLA 3TNWA 2B9JA 3QZFA 1KWPA 2UUEA 5DWRA 5BNJA 4L01A 5D12A 3UNKA 2QU6A 4QMYA 1YOJA 1FGKA 5L2SA 4G17A 4QYHA 4AA5A 3GC8A 3PP0A 5AM7A 5AP5A 2V22A 2V5QA 4RJ6A 3TZ8A 2QO9A 3AT3A 3AD5A 4BDJA 4FVPA 3F66A 3BV3A 3D14A 4KBKA 2J0JA 1OIYA 3MY1A 1P2AA 1XJDA 2JKKA 5FXQA 4JRNA 3V04A 3VULA 3VS7A 3MA3A 4KIKB 2GS2A 4OBOA 3LQ8A 2CCHA 4UV0A 3TZ9A 4JAIA 3VQHA 3R8MA 4H3PA 4XYFA 4O0XA 3PSCA 3FLWA 4FZFB 2CNVA 4CTBA 2VWBA 3COKA 4KS7A 5AV2A 4FIHA 3HGKA 2VWZA 2OZAA 3C4ZA 5LOHA 3QZGA 2JITA 2YAKA 4AGDA 3FHRA 2ZJWA 3BWFA 3DBEA 4ZOGA 3TDWA 2WPAA 3LZBA 3TKHA 3Q9XA 3WE8A 4DAWA 4Y46A 5KCVA 1OPLA 3PY0A 2B7AA 4BGHA 3MWUA 3DBDA 4ZP5A 3U51A 3MVHA 3KRXA 4WHZA 4BVUA 2A27A 3G0FA 2YIRA 1JAMA 2C6MA 3BYSA 3ZFMA 4ANBA 4BCGA 2F2UA 3HYHA 3CCNA 4G3FA 4QMSA 5CU3A 1BI7A 1JSUA 3IKAA 2VWVA 3UOLA 3VS3A 1XBAA 1XH9A 4EJNA 2IF8A 1UNHA 4ZMFA 2AUHA 3GC0A 1WBOA 5AP4A 5FGKA 2B52A 2WTVA 2JKQA 1H4LA 3OHTA 4YPDA 3QRKA 1JBPE 4KSQA 2OG8A 4BDDA 4BCPA 3F3UA 4P7EA 2FUMA 3BLHA 4ZY4A 5L8KA 3QC9A 5DHJA 4D2SA 2CGUA 2WHBA 4APCA 4CT1A 5IA1A 3EL7A 2QNJA 1J7LA 4DG3E 2XK9A 2ONLC 3TNHA 3WIGA 2WMSA 3VVHA 4O7YA 3GOKA 1WCCA 5TOZA 2XK3A 2BRBA 4BTKA 5AUTA 5JFSA 1UVRA 4IX4A 2HZIA 4X2KA 4GT5A 5DI1A 4FZ7A 5L3AA 2QQ7A 3W18A 3WYYA 2J90A 2X4ZA 4RIOA 4QP9A 1GY3A 2VTHA 4XG3A 4A9RA 1UV5A 4I1ZA 2W5BA 1YI4A 4O2ZA 3OY1A 3UC4A 3EOCA 4GK3A 4IAKA 4M7IA 2H96A 1M7NA 3BU3A 3R8UA 5EHOA 2BRMA 4ITJA 4DGNA 4ALUA 1K3AA 2OFUA 1U54A 3ZS5A 1Q8YA 2PUIA 5HVKA 2XKDA 4K18A 4XOZA 3IDCA 3WARA 3K5VA 2DQ7X 1H1QA 5LVMA 3TCPA 5KMLA 4CD0A 5B0XA 5EYDA 2C5VA 2W1DA 4RLLA 4C33A 4F78A 2OIQA 4IB5A 2VTIA 4M69A 1J1BA 5HESA 4QD6A 4ASDA 1H0VA 3BI6A 2BVAA 3GENA 4R77A 2PUNA 4AZSA 3ATTA 1P4FA 2CN5A 2C6OA 3SQQA 3RPOA 4HPUE 4ZZOA 1YWNA 4HJOA 4MNEA 4OR5A 5CSHA 4FV6A 5F1ZA 4K8AA 3MN3A 4EZ3A 3ZC5A 5AAFA 3QRJA 5ETFA 3PPJA 4XG8A 1OVEA 3MTLA 4BFMA 3O8TA 2W1FA 5CAPA 5GINE 3EFJA 1XH8A 2OBJA 4XJ0A 4D0XA 3NNUA 5CAVA 3Q4TA 2X8IA 4U3ZA 3CTQA 4DC2A 4XG7A 4FEXA 3OC1A 4ERWA 4AN3A 1IR3A 4I23A 3DXPA 3DY7A 4IJPA 4TWNA 3ZO3A 4MVFA 1MRUA 3FXXA 4OTDA 5E8UA 2XIXA 2VWYA 3ULZA 3E92A 3ZO1A 4AQCA 3DPKA 4C58A 3PFYA 2X7FA 3FMHA 2CDZA 2NO3A 4TT7A 4AP7A 3OVVA 4WNPA 3VUKA 4E4LA 3W33A 5KMKA 2XRUA 3G90X 1JNKA 3BU5A 3GCPA 2R7IA 4M12A 3L9LA 3FL4A 3V01A 2YACA 3Q4ZA 4II5A 4F7NA 5LWNA 3TUCA 4KNBA 3QALE 4R6VA 3CS9A 5KO1A 4DDIA 3HV4A 4PDSA 3NUPA 5HNIX 4EKLA 3W0SA 4Y95A 2JAMA 5F4NA 2YLFA 3LFFA 3FC2A 4FEQA 4FT9A 4YO6A 4O21A 3TKUA 4AX8A 5ANDA 5HTIA 4WNOA 3AC5A 3GP0A 4JQ8A 4X2JA 1W0XC 5HCZA 4E26A 4EK3A 4YTCA 3HA8A 3RBWA 2YZAA 2WEVA 2X39A 4FG7A 3MB7A 2IVUA 3TXOA 2JIIA 4G3CA 3G2FA 5DLSA 3PRFA 4RC3A 4G1WA 4E3CA 4BN1A 4ZLZA 1S9IA 2YCRA 3FLNC 4EH6A 2QOCA 3H0YA 4X3JA 5GZ9A 4IX3A 3F3TA 4IC8A 3VS4A 4I41A 3UQFA 2BHHA 4YBJA 4D55A 4A07A 3A7HA 4BYJA 3RPYA 4BKZA 3P23A 4O1OA 4NSTA 2PULA 3NX8A 2J51A 5HE0A 3ZC6A 2C5OA 2PVYA 3MFUA 3Q9ZA 3K54A 4MHAA 2EXCX 5FWKK 5AP1A 1XMMA 3I79A 3LJ1A 5CVHA 4ZSLA 3ZHPC 4FK3A 4ZSAA 4L00A 4XH6A 4CXAA 2QLQA 2RIOA 5CSVA 4AQKA 4QRCA 4IHPA 5AP0A 3WF6A 3FSKA 4ID7A 4IB0A 3JVRA 2UZEA 3PJCA 2J6MA 5AV1A 2Z7RA 3ZLYA 3OT3A 2CNUA 4DFUA 4GK4A 3HX4A 2C69A 5GIOE 5FM3A 5FBOA 4GKHA 2XK8A 4IX6A 2PYWA 4I0TA 3U4UA 5CU2A 4YSMA 4PP7A 3W0PA 5LMBA 4H36A 2I40A 4AG8A 4B8LA 2IZTA 2QVSE 2X1NA 3AKJA 2AC3A 4KKHA 1PXMA 3NR9A 2XNMA 3GXLA 4RIYB 4ACHA 2G2FA 4C59A 2VU3A 3C51A 1WMKA 2R3NA 2W1ZA 3E62A 3GQIA 3I60A 4KINA 2QLUA 5LVPA 4FTOA 2W1HA 4KA3A 3AXWA 3F6XA 4GJ2A 1YHVA 4HGEA 4NL0A 4DGGA 3GI3A 2R64A 1OPJA 3FZSA 3MB6A 1TZDA 4IVBA 5FTQA 2OU7A 3R9HA 4BCJA 3W0MA 3AT4A 5HD7A 1DS5A 3ATSA 4KIOA 5ANEA 3VAPA 3QBNA 4FKQA 5AMNA 4AN9A 4BIDA 1V0BA 4C4HA 2SRCA 3GCSA 3K3IA 4JOAA 4O83A 4FSQA 1V0PA 5CI6A 3AMAA 4R3RA 3D94A 2YAAA 5K0XA 5C9CA 3P5JC 4O82A 2XNBA 4BKJA 1J7UA 3L8VA 1PKGA 4YJPA 3KIOC 3QA0A 4XX9A 4E5WA 3ITZA 4GL9A 4U8ZA 1IASA 4WSQA 5AIKA 3SOCA 4C61A 1TFFA 5FTOA 4EKKA 2Q0NA 4QDEA 4XBRA 2WB8A 4B9DA 3VUTA 4O7LA 3SA0A 3BHYA 3DBFA 2UZUE 5AR4A 4DH8A 5HICA 3UOHA 3P9JA 2VNYA 5HD4A 5M53A 1QPJA 3DAJA 4J71A 2GHLA 4P5ZA 1CKIA 2R3IA 5BUEA 3MH3A 2JLDA 4OTHA 1Y57A 1H27A 3QTQA 4U3YA 4DT8A 3NW6A 1KE6A 4V05A 1UNGA 3KVWA 4IWPA 4DHIB 3ZSGA 1M2RA 2PTKA 4OTFA 3DKGA 5DGZA 2B54A 3ZO4A 5IQAA 2ZDTA 4PMMA 4DGMA 1PRYA 1YW2A 2B9FA 4MQ1A 3FXZA 5CEOA 4X3FC 3PDTA 5IKWA 2BDFA 2I1MA 3CTHA 4JT3A 4NUSA 5AP2A 3UO6A 4CFXA 5D11A 2HXQA 5DT0A 4RSSA 4DTAA 2C6TA 1G8SA 2VGPA 2W4OA 3FQEA 3KXHA 3I81A 3ZZEA 4WBBB 3VJOA 4E6DA 5A4QA 4BKYA 4CGAA 5E8SA 4J96A 4DF3A 3GEQA 2J7TA 3T3VA 1M7QA 1OL2A 2FSLX 4TWCA 4UB7A 3KULA 1GOLA 4BC6A 2GHGA 3I4BA 4FSUA 4HYSA 4Z7HA 5F94A 3FMJA 2QG5A 1O6KA 4BF2A 1Q5KA 3RMFA 5C1QB 5HTBA 2X0OA 3GVUA 4RWLA 2XKEA 3ORLA 5DPVA 3EN9A 4HGSA 1YXTA 3OCBA 5TE0A 3ZFXA 1GJOA 2F7EE 4C38A 1HCKA 1W2DA 3VW6A 4QDVA 4MD9E 3QQLA 4C3FA 4ONAA 3VUHA 4LGGA 5E7RA 4BGQA 4ZAUA 2I0YA 3CSVA 2I0EA 2C6LA 4GEOA 4FG8A 5JMSA 1H1SA 3W10A 1OL5A 5JFVA 4IAYA 4F0IA 4FTLA 3QGYA 4FV1A 4KIPA 4MUQA 2IVTA 2IVSA 4ZS4A 3RWPA 4C02A 2W1IA 2C6IA 4TKSA 3WZKA 4AOIA 4J99A 3Q53A 2XVDA 4YZNA 3VBQA 3MFSA 1OITA 1LP4A 2I6LA 2YABA 3MPMA 4ZZNA 5LJJA 4W4VA 4Y72A 5IQCA 2NYAA 5AUXA 4RQKA 2RFEA 2NPQA 2PE1A 5KHWA 2EB2A 4UXLA 2O3PA 5JGAA 3UNZA 1YKRA 4AF3A 1OIUA 3I0QA 3OEZA 4KIKA 2HW7A 3MPAA 2XEYA 4U9AA 4XV9A 4LV5A 4C4IA 1H07A 4HGTA 2YM7A 4S33A 1NVSA 3A7JA 5IEYA 3SX9A 4BCQA 3SW7A 3P86A 3E5AA 4JIKA 4EQMA 5IH5A 4YLJA 4EONA 4U7ZA 2OJJA 3R2YA 4M3QA 2QC6A 2WQEA 4NJ3A 2ITYA 3GC7A 2GS7A 2PUPA 4U40A 4IVAA 2VTQA 5FEEA 1R0PA 1TVOA 2VTTA 3JUHA 3ANQA 3KU2A 3RK9A 3NAXA 3T9TA 5HBJA 5KBRA 3MESA 4D4SA 3RM6A 3U6IA 2W05A 3KB7A 4BDAA 3NUNA 4FF8A 3ORMA 4FG9A 4L42A 3PXFA 1YHWA 4MH7A 1NW1A 4LG4A 4BBMA 2B53A 5DR2A 4QMQA 3PXYA 4U0IA 2V7AA 4ZSEA 3W8LA 2O5KA 4DINA 3QWKA 4GKIA 2OH0E 1P4OA 3FZTA 4AGCA 2E9OA 2W0JA 3BYVA 1H1PA 1OBGA 3PUFC 2AYPA 4TYGA 5CLPA 4FV5A 4CT2A 3AC8A 2RFDA 3IOPA 2QD9A 3AT2A 4USFA 4HZRA 5IEVA 3NNWA 5KE0A 5BUJA 3W8QA 4FL2A 3A8WA 3PZHA 3HRCA 4RVKA 3H0ZA 4C4EA 5AV4A 5B2LA 4XHKB 2BZIB 5J1WA 3G0EA 4RA5A 3RM7A 2V7OA 2PZ5A 1WBVA 4FSMA 4BCHA 4BR3A 3CKWA 1K2PA 4QMUA 2PMLX 4LL0A 3DZQA 3NW7A 2B0QA 1ZMWA 3B2WA 3PXKA 3LJ0A 4TYEA 4XRJA 2WMWA 5BX0A 3EFWA 3MY0A 5E91A 4O7SA 2IW6A 2RG5A 4A4XA 3E8NA 2XUUA 5JRSA 3SXSA 5EW3A 2CJMA 4EZ7A 5D10A 2VNWA 2W9FB 2RSVA 1GAGA 4AOTA 4EK4A 5EM6A 4IWDA 1E9HA 3FJQE 3WF9A 1ZOHA 2NNWB 4L53A 3UP2A 4YURA 4J98A 4YC3A 1EH4A 2XM9A 1FPUA 3DLZA 4IM2A 3WILA 3LKMA 3HZTA 4N0SA 4EORA 4RX5A 4CKRA 4WUAA 5EQPA 5CENA 3ELJA 2Z8CA 3QRIA 2JDRA 3PE2A 3R1NA 1Q8WA 5L2TA 3EQRA 1SVGA 4WNMA 4O7WA 1YWVA 2GSFA 4DH5A 4EC9A 3ID6C 5BV3A 3LJ2A 3PIYA 2GNJA 3W2RA 4L3JA 4O4FA 4FSZA 3H30A 5HIDA 4QMPA 1YI3A 2CMWA 4HYIA 4O7VA 3IW7A 2VD5A 3FZ1A 5JFXA 2R0IA 3ORXA 3WI6A 2Q83A 3BEGA 3CJGA 5AR8A 4EHGA 3DA6A 1DI8A 1H26A 5AUZA 3EN7A 4RFZA 4C7TA 5CSPA 3DK6A 4O22A 4ZIMA 3GU4A 4FI1A 2F4JA 4K0YA 3TEIA 3RNIA 1PYEA 3FAAA 2YJRA 3O71A 5HGIA 2WTIA 5DR6A 2ZV7A 3G33A 4ANMA 4EHZA 2WMQA 2ZYBA 3LAUA 4O0VA 5HNBA 5M4IA 2ZAZA 2YCQA 4JX7A 3DS6A 1G8KA 2WELA 3BU6A 3VS6A 3TACA 3COMA 2J0KA 3KGAA 3LFDA 4FL3A 3RAWA 3FMLA 3QQJA 3G9LX 4ENYA 2WMTA 4DCEA 3SGCA 3BIZA 3DBCA 4QP1A 3C4FA 4KS8A 5E8VA 4CEGA 4AE6A 4CLIA 4MBLA 4AW1A 4L68A 5DMZA 3HVCA 3W32A 3WF7A 1MRVA 3NIEA 4GYGA 2YJSA 4KKEA 2CGVA 3DLSA 4PMSA 4X21A 4Y5HA 3CQUA 3GCQA 4ZSJA 5CNNA 2WD1A 2GU8A 1OIRA 4A7CA 4IAFA 4FV0A 5CX9A 2BHEA 3MA6A 3TN8A 2W9ZB 4C34A 3SVVA 5A14A 3NCGA 4HVDA 4KIQA 2FSOX 3GFEA 5M57A 1WBPA 4CG8A 3LFQA 3KEXA 2GNLA 3Q6UA 4QQCA 3FV8A 3PJ2A 2WTCA 4UWBA 3COHA 3E3PA 4PTEA 2JEDA 5H8GA 4DDGA 2QI8A 2RFNA 1IA8A 1ZYJA 2GQGA 4AXCA 4ZEGA 5L8JA 4X2NA 2WMUA 4EH7A 4J8NA 4NW6A 5CU0A 4DGLC 3PSDA 4IC7A 1O6LA 1BKXA 2W1EA 3C4EA 3KK9A 3NUSA 4FTIA 4G31A 5EKOA 5EM7A 3LCKA 2P4IA 3R83A 4UMQA 3WYXA 2I0VA 3MPTA 2JKOA 4LOOA 3KXZA 4CKIA 4DEAA 2UVYA 3S4QA 3WBLA 4N6YA 2CKEA 2OXXA 5BVKA 2EXMA 3H9FA 4IEBA 5FQDC 2UW3A 3LXKA 1YXVA 3KRJA 1FMOE 4FNYA 2QOKA 2J0MB 3MVLA 3RNYA 3UDTA 2OZOA 5DVRA 5KNJA 4IE9A 3C0IA 5IA0A 3AC3A 1U4DA 4AT3A 5JEBA