4BTKA

Ttbk1 in complex with inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
287
Chain Sequence
DILPANYVVKDRWKVLKKIGGGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TAU-TUBULIN KINASE 1
publication title X-Ray Structural Analysis of Tau-Tubulin Kinase 1 and its Interactions with Small Molecular Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 287
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btkA01
3PXFA 1G8SA 2JAVA 3MDYA 1Y8GA 3PWYA 4G3EA 4ZTRA 4J8MA 5HG8A 2F57A 4R78A 4G6NA 3DBEA 1WBNA 3G0FA 4HCUA 4E4MA 1W0XC 3PJ2A 4EH9A 5HX8A 2NO3A 2JKMA 2IVUA 5FM2A 4BCKA 4M0YA 4BTKA 4FSUA 4S34A 5I9UA 2PPQA 4RX5A 5HLPA 2C1BA 2BZJA 2FGIA 3A8WA 4Y72A 3W33A 4C4EA 1J7IA 4XUFA 2Y4IB 3UPXA 3TIYA 4QQ5A 1ZYJA 4DLIA 3LM0A 3MVHA 4CRSA 4ZS4A 4GVAA 4P4CA 3NVMB 1UU3A 3M1SA 4ZOGA 4JVGA 2VWXA 2PZPA 3RK5A 5K4JA 4O0SA 2BAQA 2AUHA 4XMOA 2F2CB 3RI1A 3MIYA 5IQEA 4YGAA 1PXLA 3LFAA 2YJSA 4IM2A 3SOAA 3WBLA 3T8OA 3B8QA 1UV5A 1IRKA 3ALNA 3HLLA 3P08A 3EQCA 3GFWA 3LZBA 4NW6A 3BHHA 4O83A 4Z16A 2E9PA 1P5EA 3PSCA 5LVNA 5E8TA 2YM5A 3SRVA 2E9UA 1YOMA 3EN9A 2C6MA 5H8GA 3OCGA 1URWA 5GZAA 3QHRA 3RALA 4PPBA 1ZY5A 3NYXA 5EDRA 4CFWA 1H0WA 3NX8A 1JKLA 3P7AA 3ZLYA 4EUUA 2UZLA 3PE1A 5ANEA 4NM0A 1SYKA 4AFJA 4FOCA 1RE8A 3JY0A 4AF3A 4EOOA 4C4JA 4UMUA 1LR4A 3D0EA 1NVRA 1JNKA 2B53A 3PVGA 3I0QA 4FZDB 4RWIA 4I20A 2XK6A 5ANGA 3O17A 4HCVA 3RBWA 2OF2A 3W8QA 4TYGA 2W1EA 3IPHA 4MBIA 3V8TA 3ZSGA 4QP4A 4HPUE 2J5FA 4QTBA 4BCMA 4GFOA 5JQ5A 1JLUE 1HCKA 3DJ7A 4QP2A 4YMJA 4DAWA 3V01A 1X8BA 5E1SA 2VTOA 5D9HA 2C6DA 3IO7A 3BEGA 3DNDA 3Q9ZA 4AZVA 4QYFA 5E4HA 3TI1A 4G5JA 2O65A 4JBVA 4KINA 3F3WA 2XCKA 5IZFA 3PUPA 1AD5A 2I1MA 2P2HA 3CQEA 4MBJA 4YJOA 4AOJA 4Z7GA 4WNMA 2OU7A 1XH5A 3A7FA 3F5UA 2Q0NA 3REPA 3C4WA 4YC8A 2HELA 5KZ0A 5DEYA 3RZBA 1OKVA 4AX8A 2OO8X 5CY3A 2Q0BA 1PMUA 3TNHA 3EQFA 3R9RA 3NEWA 3ORLA 3QC4A 5BVKA 1Y8YA 3KCKA 4PX6A 4GH2A 4C35A 4NM3A 5BPYA 2W17A 3R28A 3WF6A 4CFUA 1EH4A 4YSMA 5AV2A 3RP9A 2C3LA 3V5TA 3QTRA 4H58A 2E9NA 5LMBA 2ZDTA 3SDJA 5CU4A 4EOIA 5CASA 5JEBA 3HAMA 3ZEPA 5AV1A 2C6KA 3OXIA 3DNEA 4XG2A 3ELJA 1UVRA 5HEZA 3RWPA 2XNOA 4MKCA 3S4QA 3T9TA 1VZOA 3DLZA 2BILB 4KD1A 4M8TA 4Y5HA 3BGPA 2OLCA 3QLGA 2B9JA 3FI3A 1XH8A 2BFXA 4C38A 4BGQA 1A48A 4LRMA 2RIOA 4BDIA 3PPKA 3MTLA 3GEQA 2C5VA 2CKPA 1MRYA 4FEWA 3O96A 4LGGA 4PY1A 3PSBA 4M69A 2EB3A 2YABA 3RTPA 4L8MA 3GCSA 4B99A 2HIWA 3NYVA 3EN7A 5E8XA 4JJRA 3OT3A 2PE2A 4E5WA 2XIXA 3VN9A 2X1NA 2YDJA 4FKRA 3SV0A 3O8UA 2YDIA 4LYNA 5AUXA 5I3RA 3ROYA 1KWPA 3UNZA 3FPQA 2ZAZA 3MIAA 1WBSA 1Q8TA 2ZJWA 3O0GA 5HCXA 1QMZA 3ORIA 3QXPA 2YIRA 5AR2A 3ZC6A 3U6HA 4AA5A 1UA2A 3P7CA 4YJQA 4FV4A 4USFA 4GU9A 3QF9A 3UDBA 2R3MA 3QRKA 4EORA 2W99B 1KOAA 5TE0A 2VTTA 4XOZA 4F7SA 4MX9A 3BGZA 3FLQA 4XBRA 3ALOA 3NCGA 3R73A 3ZFMA 5LWNA 2Y0AA 4PPAA 2J51A 3T3UA 2C0TA 3DPKA 5CENA 3SC1A 2WB8A 2A19B 1OL5A 3U9NA 4CFMA 3GC7A 2CGUA 5KUPA 2PVJA 3EN5A 4GT4A 3F5XA 1T45A 5CALA 1MQ4A 4YO4A 1KE7A 2HY81 3LAUA 5A4TA 2YCQA 5L2SA 3ZHPC 2Z7RA 4FVQA 4MCVA 4AE9A 3EIDA 4O6LA 3R9OA 4EKKA 3QCQA 3R2YA 4U42A 5CANA 4M97A 1XQZA 3CCNA 4CV8A 1PXIA 3AT2A 4AN9A 4A06A 1Q4LA 4UWBA 2YDKA 4KIQA 5EHLA 2WTVA 3Q2MA 5F4NA 2XNMA 3LCTA 4IZ5A 5ETIA 3ACKA 2HW7A 4RT7A 2X8DA 3R0TA 5EM7A 4OR5A 1F0QA 3F61A 3H3CA 4FYOA 4GEOA 4TRLA 2OICA 4V0GB 5AP7A 2OI4X 4G16A 4O0TA 4DF3A 1Y6AA 3ANRA 3O51A 5AUYA 2JKKA 4YJSA 4J7BA 2JDRA 4JT3A 2XBAA 3W2OA 2CNVA 3CY3A 5LVPA 1FPUA 2OFUA 1KV2A 3GCPA 4GG5A 4K6ZA 3H9OA 3RZFA 3U9CA 5CVGA 4EJ7A 2WTKC 4LOOA 5C8NA 3DTCA 3R7VA 4O7LA 5AR3A 4NT4A 2R3RA 5DR6A 3UYSA 3RAIA 4ACCA 1ZMVA 4AT3A 4OTPA 5IQDA 3NRMA 2VWBA 4QYGA 1KSWA 4JR7A 4KIOA 4HJOA 2FSMX 3BWJA 4NCTC 2WTIA 3QFVA 4B9DA 3ZFXA 4BDKA 1JPAA 5FEEA 2OFVA 3BYOA 3MFTA 3UIXA 1ZOHA 5EM8A 1SNUA 4HYSA 4B6LA 4CCUA 2NP8A 1H0VA 5CQUA 3E8CA 5HG7A 4MF1A 2NRUA 3AC8A 4D28A 3OROA 4WSQA 1BMKA 2CKQA 5HNBA 2QO9A 2CN5A 1H27A 1K9AA 4DFYA 4MTAA 1Q8WA 5M4UA 4KABA 4QP9A 4C0TA 5M4CA 4RFMA 2PMIA 5CEIA 3KF4A 5AV4A 2XIKA 1BX6A 4HVHA 2A0CX 4YTCA 5D10A 2VO7A 4JAIA 2QI8A 5D1JA 4ZSGA 5M06A 5LVMA 1M7NA 4GJ3A 4B8MA 3NWWA 4FG7A 4OLIA 5DRBA 3WZUA 4BICA 4G17A 3KXHA 4IM3A 5FEDA 1P4FA 2PTKA 4QYYA 5BVFA 5HVKA 4A9RA 1XH7A 3LQ8A 3LCDA 5BYZA 5IQCA 4CRLA 5IMXA 3PJ3A 4XRJA 3RKBA 2HWPA 1ZYDA 2JDSA 4IWQA 4QT1A 4G31A 2X9EA 2Z2WA 1V0PA 4DEAA 2GNFA 4IVAA 4ENYA 1SZMA 3ITZA 4YO6A 2OG8A 1FGIA 2PVYA 2QR7A 3N51A 4FL2A 3CXWA 4XJ0A 3EN6A 4DCEA 3BYMA 4DTKA 4HW7A 5KMLA 5M4FA 4FVRA 5FGKA 5I3OA 3JYAA 3FHRA 1CKIA 1LP4A 2PVLA 2PZIA 3OEFX 4DYMA 5M09A 2Z7SA 3TKUA 2EXMA 2EXEA 4GYIA 3BE9A 3I6UA 3C4EA 4C02A 3L9NA 5LOHA 1JVPP 2GS6A 3CBLA 4B4LA 2DQ7X 3VO3A 5GIPE 5KE0A 2BUJA 2ZM4A 2CNQA 1G5SA 3GU4A 4DINA 5IUGA 1JSVA 5JRSA 5A46A 4MBLA 3LXNA 2XRUA 3IGGA 3OFMA 3UZPA 2YITA 4E4NA 1H26A 3KRRA 2C6TA 3E92A 4P5ZA 4AE6A 3DK7A 4I5HA 3DB6A 2PK9A 3ODYX 2R7IA 3FMJA 2BDFA 3GBZA 4I23A 5IH4A 3TXOA 4R3RA 5CZIA 3CP9A 3KMMA 5FWKK 4ZP5A 3UE4A 4I6HA 5LWMA 5J87A 2PUIA 4DEBA 2W1DA 4BBFA 4DCAA 4FIHA 3GU8A 4PF4A 3R1YA 1H1RA 2C47A 4J98A 4W9WA 5EYCA 2UZWE 3QCXA 4RJ6A 3UO6A 4RA5A 4QMYA 5CLPA 2F7EE 3CTJA 3FMNA 2VUWA 4BFMA 4Z7HA 3IW5A 3JPVA 4FNWA 5CSWA 3UPZA 5AUTA 3MI9A 4FEQA 3U6IA 3OOGA 3UO4A 1H1PA 1AQ1A 4RFYA 2BIYA 4D58A 3TJCA 5HLNA 2GFCA 5DA3A 3EB0A 4FKLA 4X2NA 4ZIMA 3FYKX 3RNIA 5J9ZA 4J95A 4O7VA 4FIIA 3W16A 3QQGA 3LCKA 4D4YA 4FKQA 3H4JA 3IECA 4JLCA 3VRZA 4JG7A 4BCHA 4CKIA 1YQJA 4JRNA 3RK9A 4AA4A 1L3RE 4PP7A 3EQBA 4RLLA 4EBVA 4LGHA 3KQ7A 1GZOA 3W2CA 1YVJA 3EQRA 1ZMUA 4AP7A 3O71A 3NVKI 4NFMA 3ZTXA 1XJDA 2BTSA 2ZV8A 4L46A 3I1AA 1WMKA 3GU6A 4PL4A 3F7WA 3F3TA 4ZJIA 1OM1A 1ZRZA 3EFWA 4EHZA 4EWQA 4W4WA 4X3FC 5HNGA 3DT1A 4F1OA 3VS1A 2HZ4A 2GQSA 3V8WA 5BYLA 3K3JA 3QTIA 1BLXA 3DKCA 4FL3A 5HGIA 4BDAA 4EHVA 3S3IA 4UMQA 3DXQA 4JR3A 3FSKA 4LMUA 4OTDA 5LMKC 3VS5A 3AMBA 3L9LA 4F7LA 3E3PA 3HDMA 5EOBA 4F4PA 3FZPA 2RKUA 5IDNA 2Z60A 3PRIA 4EH7A 4XBUA 3MY0A 3ULIA 3ZOSA 1R78A 3KK8A 5H8EA 4RIWB 4HGEA 2OXYA 2DS1A 3LFBA 1O6YA 4M67A 4UYAA 5CAOA 3QAME 4YZMA 5JGDA 3NW7A 3KK9A 3HV4A 3KVXA 3QTZA 1OIUA 5L4QA 4AT5A 3FAAA 3OCTA 4R6VA 4FTUA 4Y8DA 1PY5A 4ASXA 3C5IA 5IDPA 2I0YA 4L42A 2ITZA 4XNEA 3NW5A 2VTSA 4UB7A 1YHSA 1SNXA 3FZRA 3ULZA 3PRFA 4JIKA 3SXRA 5EYKA 4FEUA 1JAMA 2GNJA 3F3VA 3R7EA 5KMOA 1K2PA 3BHYA 1HOWA 3QLFA 4LOQA 4DHFA 2R3OA 4EWHA 4ZZOA 4D2WA 1ZMWA 3QBNA 4M3QA 1PXNA 2ACXA 3JVSA 4JDHA 4YZ9A 4W9XA 1JQHA 1Q62A 1MQBA 3G9NA 3OWPA 3FI4A 3P5KA 3H9FA 4HNIA 4JBQA 4UZDA 1PMEA 5D41A 2YN8A 3BELA 4NU1A 4YJRA 3RAWA 1YI3A 4PDOA 5EKOA 4D0WA 4EUTA 3DTWA 5M08A 2OBJA 2I7QA 5EI6A 5JN2A 2Z02A 5JFXA 3FI8A 3L8SA 2WKMA 3LJ1A 1JSTA 4MWHA 4F9WA 4H05A 2VWWA 3AGLA 1WVYA 3ORMA 4C34A 3SG9A 2GS2A 4I41A 2VTAA 2ERKA 5KMNA 4F70A 1V0BA 2R3KA 3RNYA 4RVLA 3I5ZA 3SXFA 4I5MA 4AZFA 4ZS0A 3F9NA 3M2WA 3NR9A 4FTMA 4IACA 3VUKA 3GCQA 4QYHA 4FNXA 5CF4A 5CF6A 1W8CA 3R02A 4CZUA 2IN6A 3ZCLA 5FTQA 2WPAA 4DA5A 3FXXA 4IEBA 4RRVA 5HG9A 5IU2A 4JOAA 3BBWA 3UMXA 1IAJA 1OBGA 1LEZA 3QUEA 4NCTA 5CX9A 3TV4A 4OTHA 5LVLA 4QP1A 2J0IA 4MQ2A 2V0DA 5AP0A 2G01A 3A8XA 4D4SA 5I9WA 2ZV7A 5T6KA 2VTHA 3HV3A 3MBLA 2VGPA 4YTFA 4DE4A 3HMNA 3G33A 4I0SA 1OIRA 3D94A 4AW0A 5DR2A 3NAYA 5L6OA 4AGCA 1WZYA 5J79A 4BYIA 4U0IA 2CNUA 3BU3A 3KN6A 4F9YA 5BVWA 1H28A 2A27A 2QOLA 3UIBA 3F5GA 2R3LA 3SW7A 4EH4A 1Q3DA 2P33A 5C03A 1U54A 3VHKA 3OP5A 4ANBA 3GOKA 3A60A 3ZLXA 5FUTA 2HW6A 3R7GA 4AN2A 5BYYA 5KHWA 4CZYB 5M4IA 3GB2A 4UALA 3TNQB 3KRJA 5IQIA 3EMGA 1UNHA 2E2BA 3OT8A 3MGYA 4FEXA 1FBNA 1R1WA 2V7OA 3COMA 1OIYA 2YHVA 3LFCA 3MB6A 2OIDA 4N0SA 4YLJA 4U79A 5BVEA 3VBWA 2J5EA 2IVVA 4BVUA 5CT7A 4ZK5A 5HD7A 5CEPA 2VX3A 2ONLC 2B9IA 4MXCA 2WQNA 5AWMA 3QGYA 1A9UA 1DAWA 2UZEA 5AEPA 3KL8A 4FV6A 3CD8A 5CWZA 1NVQA 4Q5HA 3TKIA 3DAJA 3MSSA 1YDSE 3R01A 5CAUA 4IADA 4P2KA 4YHFA 3BYUA 4EOSA 3TZ8A 1YOLA 3FE3A 1OGUA 2VTRA 5ETFA 4L7FA 4BHNA 3OF0A 4RSSA 4ASZA 2QOKA 2X4ZA 4RC3A 3BRBA 3KMUA 3TIZA 3EQDA 3ENHA 2W96B 4R3CA 2XK9A 5L2QA 4F6SA 4E4XA 5AADA 4KKGA 1PXKA 5BUEA 5KX8A 4I94A 5IEVA 2Y9QA 3LCOA 4PMTA 4WG4A 3TZMA 2ITOA 2QU5A 2QOCA 4ZSLA 4O38A 4AAAA 4FIFA 3HMPA 4O22A 4BCFA 2JDVA 4ACGA 3O7LD 3D14A 4EONA 3TWJA 4O81A 1LUFA 3PIZA 4GT5A 3U87A 1UNGA 2UZOA 3F6XA 1OB3A 3BKBA 3AD5A 3MPTA 4AQCA 4N6ZA 5FRIA 1H1QA 2JEDA 1CKPA 3R1SA 3EZRA 3R8PA 3EN4A 3VUDA 1FVVA 3G5DA 3QTSA 4X3JA 3TACA 2JIIA 3KVWA 5EH0A 2IW8A 4DFZE 4L44A 4ZY6A 3VVHA 4U97A 4YHTA 4D5KA 2AYPA 2PVHA 4FZ6A 4IMYA 5I5ZA 3SRVB 4TXCA 1ERKA 2QVSE 3TL8A 4X0MA 5DT0A 5AX3A 1TQPA 4J53A 4JRVA 3OHTA 2BDWA 3PWDA 3P78A 4DFLA 3HYHA 2JFMA 4BI1A 3TM0A 3WE8A 4NM7A 2PULA 1GZ8A 2W5AA 3D2IA 3M42A 3P23A 4IWOA 1H24A 1UNLA 3HUBA 3SAYA 5KKRC 3R7UA 4G3GA 4BY9E 4WG5A 2CSNA 4LL0A 4D9UA 5BUIA 4TWNA 5BVDA 2RGPA 3KA0A 4E3CA 5GINE 2X81A 3KY2A 3W2QA 5CSVA 2WXVA 2IVSA 3CPBA 1F3MC 3LJ0A 4RIXA 4CLJA 3A61A 2VTNA 2WO6A 2WAJA 1KUTA 2ITXA 5EM6A 4GMYA 5JFSA 4BDCA 2ZVAA 5AV0A 4GUEA 5AUZA 4FSWA 4X3FA 3NW6A 4UMTA 4YBKA 3CSVA 5E8SA 3OTVA 2PU8A 4RQKA 2W4JA 2WMVA 4MYGA 4G2FA 2WFYA 4PPCA 3P79A 4YLLA 4ZY4A 2CKOA 3SXSA 3TNPC 4DH1A 5BQ0A 5C1QB 2XYNA 3OS3A 3VC4A 1M2RA 5ANOA 4U7ZA 3DCVA 3QYWA 5CXZA 5I9ZA 5LMKA 3HA8A 4K77A 4TY1A 2JAMA 2YIWA 2BZIB 1ZAOA 4IBMA 4TYEA 3OMVA 2IG7A 3QRTA 3GC0A 3QALE 3EQPA 4TWPA 4WUNA 2UW6A 1URCA 2W1IA 4OBQA 4BWPA 3ZSHA 4MXYA 1TKIA 4FTAA 4QPAA 2CN8A 5DRDA 2GNIA 5FTGA 5I0BA 2WTJA 3LLAA 3UOKA 3ZRLA 1U59A 3AMYA 3K2LA 1H01A 3S2PA 3ETAA 3WF8A 3QXOA 4B7TA 1V0OA 4Q5EA 2BKKA 4I22A 3EWHA 3GNIB 4IJPA 3HRFA 2WMWA 5A14A 3OCSA 5H2UA 4J96A 3ORZA 5HBEA 5C4KA 4ALWA 3QZIA 4A9SA 1JWHA 4WNOA 4GU6A 2F7ZE 3DAKA 4M69B 3W10A 3DGKA 4AGUA 1Q5KA 3RHXA 3RAKA 3Q4UA 4KRCA 5EKNA 3R9NA 3ZSIA 4FTOA 3NDMA 3A7GA 3CR0A 4RVTA 4ZTQA 5A4EA 3FLYA 3PG3A 2Z7LA 1DI9A 4C4FA 5F95A 3VUTA 4Y83A 2H8HA 1OKYA 3FJQE 5DFPA 4ERWA 2PVKA 4UN0C 4YTIA 4CG9A 5IISA 4BDDA 1VYWA 3QWJA 4FV7A 3UGCA 5IQHA 1ZOEA 4RC2A 4EJNA 3CGOA 4C36A 3EYHA 3UVQA 4N6YA 3BLRA 4FYNA 2B9HA 3B2TA 5KCVA 3FI2A 2VU3A 3WYYA 4D2PA 3LKMA 3MA6A 3TEIA 3EH9A 4FT9A 3WYXA 5LCJA 1RQQA 4YJVA 5L3AA 1W84A 5EI2A 4W8DA 4WHZA 2I0HA 5AP6A 2PYWA 4UZHA 4QRCA 5IUHA 4ZEGA 1R0EA 4FIJA 2CCIA 5EM5A 1P4OA 4GRBA 3JXWA 4FICA 4G6OA 4XP2A 4C3PA 4WT6A 4FIEA 3FC1X 5KO1A 2BHHA 5CF8A 5KZIA 5DGZA 4M0ZA 3ZBXA 2RL5A 4AZWA 3E64A 1QPEA 2KULA 4NSTA 5FD2A 5EDPA 5JGBA 4LM5A 5D7VA 4FV2A 1SVHA 2XIYA 3BQRA 4FTQA 2EB2A 1OUYA 3LXPA 2JC6A 4F9AA 1OL6A 3F88A 2WMXA 1RJBA 2ITNA 3EOCA 4FGBA 3IDCA 4DGGA 3I60A 2VGOA 3ET7A 4O91A 4EK5A 4F09A 2E9OA 3TUBA 1GJOA 4BTJA 2RG6A 2CCHA 4JS8A 3NLBA 2ZOQA 3VWAA 4EKLA 5B2MA 3EFLA 4AACA 5AP3A 2X7OA 3ATSA 2YEXA 5H8BA 3ZO1A 4RX8A 3NAXA 2P2IA 4NH1A 2O63A 3NYNA 4NJ3A 5A4LA 3JY9A 2UW8A 2XNGA 4U3ZA 4FSRA 5AUVA 4FSMA 5C8MA 4IAZA 4HZSA 3POZA 4OTFA 2FB8A 4EH3A 4G6LA 4IAYA 4WOVA 2ONLA 3BHUA 4FTRA 1YXVA 2J0MB 5A9UA 5BVNA 4Z55A 2XIRA 3EHAA 3QUPA 4LL5A 4FGRA 1WBVA 3IQ7A 3IW8A 2UW5A 1U5QA 5KNJA 1W7HA 3ERKA 3FLNC 4FSNA 4L7SA 4FG9A 4KBAA 4KSQA 4XG7A 1YWRA 3RGFA 2O0UA 2QC6A 2JITA 5J9LA 2C68A 2R2PA 4IFCA 5FEQA 2XNNA 1ZZLA 2UZDA 2R0UA 4FV0A 4K2RA 3MVMA 3HL7A 5DEWA 4S33A 2HENA 3F2NA 4YJNA 2VO3A 4GIHA 4MXAA 4E20A 4FTLA 3PA3A 3EKKA 3FV8A 4KRDA 2B54A 1ZYSA 4FV8A 5AAEA 5JZNA 4O0WA 4XLIA 5ITAA 2BIKB 3FXZA 1QCFA 4CFVA 2R9SA 4EZ5A 2EU9A 4RC4A 4RJ5A 3NUXA 4DH8A 1MP8A 4DN5A 4QQJA 1TVOA 2WOUA 3IOKA 3ROCA 3AC3A 4XHKB 2XA4A 5JKGA 1FGKA 1STCE 4IZYA 2VAGA 3BV3A 3SA0A 4QMMA 1JOWB 3ZDIA 1JBPE 2J0JA 2C6EA 3UMWA 5CEKA 3ATTA 3Q5IA 3QQLA 4D2RA 3ZO3A 3JR1A 3Q3BA 3FMKA 4MK0A 3RINA 4YP8A 3H0ZA 3Q9YA 4AW2A 4DH7A 4NTSA 4HYIA 1SM2A 2HAKA 2GNLA 4CSVA 3EQHA 4D55A 4FSTA 2C30A 3LIJA 2HCKA 3FLSA 3I7BA 2J50A 2QOQA 4AWIA 3GP0A 5F94A 5EG3A 4IDTA 2XYUA 3BBTB 3QQKA 4WG3A 2KTYA 2W5BA 3C0IA 4Z3VA 5JGAA 1R0PA 3KXGA 3Q6WA 3O8TA 4Q2AA 3NUPA 5GJDA 4UMRA 5AFVA 3F7ZA 4MHAA 2GCDA 3IKAA 3R8UA 5HICA 2VWVA 1E1XA 3V51A 2REIA 3O2MA 5M56A 1H1WA 4FR4A 4U43A 4DLJA 4YZDA 4O0XA 1BKXA 4KKEA 5HU9A 4NWMA 5T3QA 3RK7A 3FKNA 4O0UA 4N57A 4C59A 3KB7A 4PMPA 1Q41A 3BHVA 3KF7A 3OCBA 4CNHA 3WZDA 2QG7A 2PWLA 3W2RA 4II5A 4G1WA 3MFRA 4RGJA 4BDGA 5J7HA 4EOPA 5IPJA 3THBA 3LFQA 4F9CA 2WMRA 3E87A 4IQ6A 3NNVA 5BUJA 1XWSA 5IG1A 4I93A 4R1VA 3FBVA 5JK3A 5AP5A 3UOHA 3LMGA 4FKUA 4IFGA 4DH5A 3FDNA 3NUAA 1W82A 4KNBA 4GUBA 3QTUA 5AIRA 4BKYA 4OUCA 2ZYBA 2DYLA 1M17A 3EFJA 2CMWA 2VWUA 4CEGA 1YI6A 4ZSJA 4K8AA 3OG7A 4QMVA 4C33A 1GNGA 2O3PA 2W1FA 3R7IA 3A62A 4MWIA 4B0GA 3FZ1A 4WRSA 1UU7A 4LFIA 2ITYA 3WILA 4FZFB 2PL0A 3Q96A 3SD0A 3UP7A 2CGWA 3HV5A 2QONA 4G5PA 2HZNA 3E62A 2I6LA 1DS5A 1YHWA 3HA6A 4FF8A 2JGZA 4MQ1A 4OW8A 2EUFB 4HGSA 2XNPA 4D9TA 2VWIA 4DEEA 2C6IA 3O7LB 3ZRMA 2J0LA 3OY3A 4F64A 3HUCA 4LI5A 4EK4A 4PV0A 3Q5ZA 2IO6A 2YM7A 4M7IA 3UNJA 1REJA 3OC1A 4YJPA 3C0GA 2GQGA 4BF2A 4JNWA 1CKJA 2F4JA 4FODA 2WEIA 3W8LA 3BX5A 4YZNA 4CTCA 3C5UA 4O86A 4MXOA 1XH4A 2PMNX 3LFNA 4W4XA 2UVZA 4EQUA 3A4PA 1BI8A 2OJFE 3R8MA 3V5JA 2XVDA 3TJDA 3R1QA 2BTRA 4EL9A 3CJGA 4O82A 1GIHA 4J1RA 5B2LA 5KMJA 2GHGA 4D4VA 3GGFA 4E8AA 2VTJA 4QMTA 1BYGA 5DR9A 2ZB1A 4RFZA 5IUIA 2B0QA 1GIJA 3NUNA 5E92A 3DQXA 2C5NA 2BHEA 1IEPA 1OPKA 4FKWA 4GVJA 3C9WA 3V6SA 4DGLC 2X0GA 2G9XA 4A9UA 1Q24A 3E7VA 2VTPA 3CQUA 4WUAA 4BDEA 1XHAA 3PTGA 3Q2JA 3LFSA 3FKLA 4KA3A 3D7TA 5CSXA 4UV0A 5HE1A 5BVOA 2C0IA 3A4OX 5G6VA 1O6LA 2W9ZB 5LARA 3COKA 2CKEA 5GZ8A 3MA3A 1E9HA 3MS9A 4L52A 2NRYA 5J1WA 3LFEA 3LXLA 4L67A 3DK3A 4U8ZA 5A3XA 4V01A 4IB5A 2R4BA 4UX9A 4PMSA 1B38A 2ZV2A 3PYYA 5E8YA 3KXZA 3ZDUA 4DG0E 3KGAA 5IA0A 5K5XA 4LUDA 3QD2B 3ZUTA 2OZAA 2J6MA 5HIEA 3RMFA 5JZJA 4DT9A 3FQHA 3V3VA 4YJUA 4IM0A 4MXZA 4ZTNA 4ZXTA 2J0KA 2QG5A 4LG4A 4RWKA 2GFSA 4O7RA 5CVFA 2WNTA 4BIDA 4IC7A 3LFFA 3QWKA 1M7QA 4D1SA 5CSPA 5C27A 2BVAA 4R8QA 2WTKB 2I0EA 3UJGA 4DEGA 4JBPA 2R3QA 4U5JA 4XOYA 5G1XA 4I6BA 2QCSA 3IOPA 2I0VA 3OBGA 3SKCA 4OAVB 2VTQA 1DI8A 2CLQA 4EOKA 2PY3A 3ORNA 2XKEA 4ZMFA 4K9YA 1SVEA 3QTQA 1YOJA 4IHPA 2G15A 1Q8UA 3ZONA 4CD0A 1J91A 2YA9A 1XBAA 3GI3A 3KMWA 4NIFA 4PTEA 3KULA 2PVNA 4NK9A 3P4KA 3VBVA 1IR3A 3UG2A 4X2FA 3E8NA 4FV1A 4TWCA 4GK4A 3VBTA 4C4IA 5M53A 4IB0A 4UXQA 4AZTA 3UZTA 4ANQA 3I79A 3GU7A 5EQPA 2WTWA 4AG8A 4UEUA 3G15A 3R63A 4QNYA 2IZRA 4H39A 1UKHA 4IJ9A 3PJ8A 2B7AA 2W1GA 3GU5A 5E8WA 5IKWA 3SVVA 4FUXA 4IVBA 3CPCA 4QP7A 1U54B 4C7TA 4O7SA 2XK8A 3QKLA 1Q3WA 3UVPA 1R39A 3BGQA 2XZSA 4NFNA 2RF9A 5I9VA 3HDNA 3MTFA 5I9XA 5HCZA 3QQFA 4WA9A 5CYIA 3VBXA 1MRUA 2X9FA 1G8AA 2X2KA 4IC8A 2OJJA 3HKOA 4AGDA 5CF5A 2XJ1A 4L6QA 2ITPA 5HG5A 4FKTA 1WBTA 1RDQE 3VS0A 4AGWA 4BGGA 4TZRA 4BCNA 4FK3A 4CGAA 3VUHA 5F20A 4EI4A 2R64A 3R00A 3AT4A 4TYHA 5JMSA 4BDBA 1ZY4A 4E5BA 3QTXA 4EK6A 5HI2A 4YURA 2PVRA 4R7BA 1XH9A 2FSOX 4U6RA 1B39A 2W4OA 3VRYA 3V5LA 4RA4A 2W1ZA 4PDSA 2NPQA 3POOA 5HOAA 5C01A 4XV1A 1CDKA 4XV3A 2IZUA 5A4CA 3CKWA 3QRIA 3DS6A 3PP0A 2UZVA 5IA3A 2YACA 4FTJA 3AD6A 2XBJA 4QYEA 5BMSA 5IH6A 4M14A 4ZTSA 2GNGA 4J71A 2VTIA 1DAYA 1M14A 4DBNA 1NT2A 4K0YA 5M57A 3ZFYA 5J7BA 2QO7A 3DLSA 2HXQA 3LXKA 3CC6A 1H8FA 4UYNA 3R8ZA 3OXTA 3U54A 3GQIA 4BR3A 2C1AA 4FTCA 2HZ0A 4H1MA 3UC4A 2QLUA 3HRBA 4DH3A 2EVAA 3MFUA 2WMAA 3IDBA 2W06A 3DFAA 1OIQA 4Q9SA 1OL7A 2W1HA 2YZAA 3SGCA 1ZXEA 3UYTA 3ZM4A 5K3YA 1UWJA 4IW0A 2PUUA 3KN5A 4YJTA 3QHWA 4LRJA 3C51A 1UWHA 3V6RA 3VJOA 4ACDA 2GQRA 4WNPA 4IAFA 3V5WA 3Q53A 4MXXA 2C5XA 2QOFA 3E3BX 2QO2A 3OTUA 3QCSA 4BKZA 1YXUA 3GCVA 2UZNA 3GXLA 4DFNA 4XH6A 4CQGA 4O27B 3TNWA 3WARA 2RFNA 4QP6A 3II5A 3K54A 4C61A 3VBYA 2WIHA 4FNZA 2XJ2A 4WO5A 3RPSA 3NIZA 4AOTA 4C4GA 1OI9A 2IJMA 3VULA 2GNHA 3HECA 4FTNA 3U6JA 3MY5A 3NMUF 3ZUUA 4FT0A 4JQEA 2BAKA 4F1MA 3UOLA 3IW7A 4MVFA 4GG7A 3ZMMA 3P1AA 2UVXA 3RM7A 4JX3A 3TTIA 5FDPA 2XK3A 4BB4A 2F2UA 3WZKA 3RPVA 2BRMA 1J3HA 2JBOA 2X4FA 5T68A 4C8BA 4FVPA 3UNKA 3FSFA 5M44A 4GKHA 2Q83A 2PZRA 2OSCA 2P0CA 3P0MA 3I7CA 3A7HA 4RIXB 4RX7A 5HESA 3BV2A 3VIDA 4CFXA 1GZNA 4ZLOA 4ENXA 3K3IA 3NIEA 3OBJA 4IX5A 4D1XA 4O84A 4YZBA 1YDTE 3MH1A 3TUDA 4BL1A 4JDJA 4X3FB 5EHOA 3TV7A 5ETCA 4ERKA 3LJ2A 2Y6OA 4EOLA 4FT5A 3GOPA 5DH3A 4EHGA 3I0OA 1GOLA 4G9RA 4R7IA 1PKDA 2PMOX 1E1VA 4RBLA 4A9YA 5J8IA 4DEDA 1FINA 2XM9A 3LM5A 4JL9A 1ATPE 3VAPA 2VTLA 3Q52A 2YAAA 5EFQA 4J8NA 1UU9A 3ZM9A 2XNBA 4PUZA 1TQIA 4IDVA 2ITQA 2X8EA 3PP1A 4N70A 3JUHA 4E1ZA 4RIOA 4Z9LA 2OJGA 3ZZEA 3F69A 3HEGA 4JAJA 5IQBA 4J52A 2GDOA 2OGVA 4TW9A 4DC2A 1FVTA 1H1SA 3UP2A 2BZHB 2GS7A 2JFLA 2C3JA 4RWLA 5IEYA 3MVLA 4O7ZA 4WNKA 4QMNA 4FT3A 3O23A 1BI7A 4QO9A 3ZRKA 4NUSA 4D4RA 2HWOA 3OWLA 5IA4A 1ND4A 3PA5A 2GHLA 3S95A 3U4WA 4BKJA 2BR1A 2C5YA 3DDQA 4O96A 5TKDA 4L45A 5LQFA 4O7YA 3KU2A 2YIXA 2JIUA 1PHKA 4K18A 4JG6A 4QTAA 4RZVA 2AC5A 3QD4A 3QU0A 4PWNA 2I40A 2R0IA 1OL1A 1PMNA 3MN3A 3MPMA 2QD9A 4ZAUA 5M51A 3PJCA 4L9IA 4PNKA 4NL0A 3RVGA 1BL7A 1GAGA 4BIEA 3Q4CA 5AIKA 3SW4A 4L53A 5J9YA 4DEIA 2VTMA 1G3NA 2QHMA 2V55A 2C5OA 4RIYA 1IASA 3HP2A 2HY0A 5CAPA 4I0RA 5DT4A 4RJ3A 2BRNA 2FSTX 4ZSEA 3Q6UA 4ZTHA 2R5TA 2WQOA 1PKGA 5TR6A 2HYYA 3PDTA 4RJ8A 3OW3A 2RSVA 2OIQA 3IK3A 4ANOA 3DY7A 4NZWB 1KE8A 3UIMA 3U4UA 4YU2A 3F3UA 5C8KA 3FZTA 4PL5A 5C4LA 4FUYA 3DK6A 2W1CA 5DE2A 3VS6A 2B55A 2CHLA 4AS0A 4QQTA 1JKSA 5BNJA 2V5QA 5LCKA 2Y4IC 2BAJA 3R6XA 4Y95A 5F9EA 2XK7A 3DAEA 1GY3A 4BCQA 4BCOA 2R3GA 5E8UA 2CDZA 4AZSA 1REKA 2YIQA 4LQMA 4AUAA 2YWVA 2X39A 3KCFA 5HE0A 3T3VA 4IZAA 4I92A 5CSHA 4ITHA 4LV8A 5FXQA 2QURA 4KBKA 4C37A 3ZC5A 4U45A 4GFMA 3BLQA 4JBOA 1K3AA 2YZLA 4G3DA 3EQIA 2HXLA 5HTCA 4X6QC 2C69A 4IAKA 2WMSA 4YUQA 3Q9WA 4M15A 2IPXA 5M07A 2VNYA 5E9EA 4L3JA 3K5UA 3PY3A 1LEWA 3D4QA 1OITA 3GT8A 5ANDA 5CEQA 2EXCX 4FC0A 2VX0A 2YERA 4XLVA 4EH8A 4F08A 4AT4A 4TKSA 5FDXA 2IZTA 4O0RA 4YNOA 4NYEA 3ORKA 4UBAA 5BX0A 3QD3A 5EDQA 3LW0A 2QKRA 3EZVA 4D2SA 4NKAA 4F0FA 1Z9XA 1J7UA 1ZYLA 1YXSA 3QX4A 5AAGA 3DBQA 3TZ7A 3PA4A 4CG8A 4DT8A 3DXNA 3QX2A 5HU3A 2P4IA 5HO8A 1FMKA 4TPTA 5AR4A 3WI6A 4Y73A 4IAIA 4F7NA 2OJIA 4CYIA 3CKXA 1WFCA 3AC4A 3C4XA 3Q32A 2PE1A 4TTHB 5K4IA 3Q4ZA 4E26A 2UW3A 3HAVA 3L8PA 3BLHA 2PUNA 5L6PA 4J99A 3KKVA 3CQWA 2GTMA 3E88A 2WQMA 5LVOA 5TF9A 3DV3A 4A4LA 1BUHA 5CQWA 5AMNA 2F9GA 4F6WA 4FMQA 3PY1A 4QMLA 4EQMA 2FYSA 4OBOA 4MAOA 4LOPA 4FKPA 4AW1A 4UXLA 2XM8A 5CZHA 2QHNA 2YCRA 3D5XA 2IW9A 3TN8A 1WVXA 2DUVA 4PP9A 2IVTA 1YKRA 5CI7A 3CLYA 3DZOA 1T46A 1ZZ2A 3ORXA 4I6FA 3SX9A 3A7IA 4MD9E 3W2SA 4BIBA 4A4XA 4EC9A 4I0TA 4BC6A 3E8DA 4KSPA 4O2ZA 4FKIA 1XBCA 3R22A 4G34A 3F2RA 4XEYA 2G2IA 2W9FB 4GL9A 1M2QA 3R04A 3QZGA 4HGLA 4CXAA 4E6CA 5L2WA 4AOIA 3LQ3A 4O1PA 5HKMA 2YLFA 1F5QA 2FO0A 4KUJA 4FKVA 1PYEA 2B4SB 4IWDA 4IB3A 4IANA 5FM3A 4UWCA 5J5SA 1PF8A 4R77A 5K0XA 4FTKA 3PLAE 3ACJA 4QTCA 1OBDA 4N4SA 1W83A 3QGWA 3KC3A 4JXFA 4G3CA 1L8TA 3D9VA 2FUMA 4Y5QA 5EYMA 2OXXA 5HX6A 1P2AA 4AZEA 3G51A 5CNOA 4QMUA 1PJKA 2OH0E 1PYXA 4BGHA 5GZ9A 2XH5A 5HORA 3BYVA 4LMNA 4X2JA 3CD3A 3VS4A 4OT6A 5AUUA 3FPMA 5KKRB 5DHJA 2IW6A 2Y7JA 2C4GA 4X2GA 5A6NA 4YPSA 4X21A 3UQGA 4IVDA 4HVGA 5A4QA 4O6EA 1KE6A 4M68A 5FTOA 3NYOA 5FQDC 3OEZA 5A6OA 3BE2A 5K5NA 4P5QA 4QPSA 3V5QA 3ZH8A 5AA8A 5EQEA 4MNEA 3F3ZA 3HV6A 3TT0A 2H9VA 4H3PA 4XRLA 3QRJA 2PUPA 2FSLX 2J4ZA 2VWZA 1OKWA 4RVKA 4H3BA 4DTAA 3VS2A 4HCTA 3RWQA 4YTHA 3QC9A 4HYHA 1YWNA 4KS8A 3TZ9A 3ZEWA 4C3FA 4KIKA 5BMMA 4U9AA 5E7RA 2R3FA 3MH0A 3PVBA 5DG5A 1HCLA 2WHBA 4JI9A 3ZS5A 4EYMA 3FLWA 3UOJA 3KREA 4TT7A 5B2KA 5FP5A 3GC9A 3UQFA 3FUPA 4OT5A 3G0EA 5IQGA 3W1FA 4L00A 5HO6A 3U51A 3ZLWA 4GKIA 3QA0A 4I5CA 2ZV9A 2OF4A 2ETMA 3BQCA 3PFQA 3H10A 3N4TA 3IS5A 3FLZA 2UW9A 2W0JA 5HBJA 3ANQA 4U41A 4EZ7A 4I3ZA 4JDIA 3DKOA 4XYFA 3PPZA 5JFVA 4L3PA 4RJ7A 4DFUA 2R3JA 4KS7A 4O21A 3OZ6A 3MJ2A 4FTTA 4BN1A 5HQ0A 3ZLSA 3VNTA 4CCBA 3ID6C 5AM7A 4NM5A 2EWAA 5LJJA 4GW8A 1S9JA 3C4FA 5HTBA 1U46A 5ANKA 2VN9A 3PXQA 4XX9A 2Z7QA 3AT3A 5CS6A 4BCPA 2X7FA 1ZWSA 2ESMA 3OY1A 4NTTA 3CTHA 4R5YA 5C26A 3L8XA 3Q60A 3RPOA 4MD7E 4ASDA 4BZOA 1Z5MA 3DKFA 2X2MA 4R7HA 3FL4A 3TUCA 2A2AA 3LE6A 3COHA 3G90X 4O2PA 2WMTA 4QTDA 4FV9A 3DDPA 2OK1A 3PXZA 4AFEA 2CPKE 2BZKB 1Y91A 3FHIA 3GUBA 4X2KA 3P7BA 3TV6A 1J1CA 4HGTA 4YSJA 4MH7A 3LPBA 3F66A 5K9IA 3RJCA 2QR8A 3KXXA 1KE5A 2PE0A 3QQHA 5HTIA 4AU8A 5DVRA 3DA6A 4B8LA 5HIBA 5HZNA 4QMSA 1IA9A 1PW2A 4H1JA 1BL6A 2VZ6A 3FMDA 4PNIA 4YPDA 4OTWA 4YR8A 3CJFA 4FT7A 1Y57A 4TN6A 5KMIA 1TQMA 3E63A 5CNNA 1WBWA 2UZTA 3OUNB 5FLFA 2P3GX 2WTDA 4EQCA 2JKQA 1NY3A 3I6WA 2W5HA 2JBPA 5D7AA 4FX3A 4R5SA 5ANIA 3WF9A 3I4BA 2ZM3A 3OWKA 2ETRA 5EW8A 4FZAB 5HCYA 5CVHA 4E93A 2XF0A 1CMKE 2BDJA 1I09A 2W4KA 4MD8E 4O1OA 4PDPA 4IH8A 2WU7A 2H6DA 3D7TB 2C6LA 3CTQA 5EW3A 4H3QA 1MUOA 4PTCA 2P55A 3LVPA 4G9CA 4O7WA 3R30A 4BDJA 4CV9A 2HZIA 3IONA 1Q61A 4CFFA 4H36A 2X7GA 4NKSA 4F6UA 4QOXA 5K0KA 2XS0A 4KWPA 4CMTA 3NUSA 3DZQA 4IZ7A 4QPMA 1FOTA 2R3IA 2OZAB 5EI8A 3A99A 3O8PA 3OVVA 4BI0A 3D15A 1OL2A 4BZNA 5KBRA 2YWPA 3HVCA 4DEHA 3FEGA 3OOMA 3WZJA 2OKRA 4OTRA 4EOQA 4ZJVA 4FZ7A 5AX9A 5EK7A 4EOJA 5E1EA 2GMXA 3MWUA 4DBXA 3DKGA 3MB7A 3VW6A 3FMLA 1ZARA 2UW7A 3WE4A 2PZ5A 3HX4A 4JDKA 3EL8A 4EOMA 5DPVA 5AM6A 4ZY5A 4C2WA 4L3LA 2H34A 4QMWA 2OW3A 1QPCA 1XH6A 5CU2A 3G6HA 4CMOA 1NW1A 2PHKA 4CT1A 2FA2A 2HOGA 1S9IA 2V22A 4NIFB 4IIRA 3KULB 3LCSA 3FQSA 2JDTA 1YI4A 4ZLYA 3DXPA 4M13A 5CI6A 5I4NA 3DU8A 4YBJA 2VD5A 2LAVA 1DM2A 3BZ3A 3S00A 1H07A 2V62A 4ALUA 4XV2A 2BCJA 4ACMA 3PG1A 3BIZA 3GC8A 4BWKA 4UMPA 3UQCA 3W55A 4ZSAA 1NVSA 5KMKA 4BTMA 1GIIA 3PE2A 3D5UA 4FOBA 1M2PA 3D5VA 5GIOE 2IWIA 3SLSA 5H3QA 4UWYA 4JQ8A 4ZZNA 4CKRA 3KFAA 5M55A 4PMMA 4GK3A 3TKHA 4EK3A 5DT3A 2YFXA 1R3CA 4HNFA 3RM6A 5FBNC 2B52A 4YC3A 1APME 3LQ5A 2XMYA 3QD0A 3BI6A 4RVMA 3B8RA 2YM8A 5L8JA 3DBDA 5DYJA 5TT7A 1YW2A 3D83A 2R3NA 4LUEA 3ZU7A 1OKZA 4E7WA 1YHVA 4I21A 4FA2A 3AXWA 1NXKA 5HLWA 4XG3A 4D2VA 4FI1A 4D0XA 2YLEA 3ZBFA 2ZB0A 2WTCA 2Y8OA 4TYHB 4DFBA 3PJ1A 4WRGA 2XEYA 3BEAA 4QP3A 4C2VA 3QKMA 4BCIA 3R9DA 4YHJA 1YRPA 4FV3A 5CEOA 4I5PA 3CE3A 5AUWA 4V05A 3G2FA 4HPTE 5IQAA 2C6OA 4BZDA 3NS9A 4E6DA 5HHWA 2UZUE 2QOOA 2BRGA 4S30A 4I24A 3NNWA 3NSZA 3DQWA 2YAKA 4FL1A 2RFEA 4FKGA 5JRQA 5GJFA 2F7XE 2ZM1A 3C4ZA 1O9UA 2XCHA 3CEKA 3DFCB 3FKOA 3MW1A 4R3PA 5EYDA 4Y85A 2QOHA 4ID7A 3IDPA 4OTGA 3MY1A 5HNIX 2BKZA 4M66A 3QA8A 4ZMEA 1OECA 2OWBA 5ETAA 1ZOGA 3UO5A 2X8IA 3MFSA 5TO8A 4QMOA 1H00A 4XG9A 3QUDA 2G2FA 2CGXA 5GJGA 5E90A 5KMMA 5FXSA 2JIVA 4NJDA 2ZDUA 4ONAA 4WBBB 4EH5A 4TL0A 2JKOA 4DTBA 3R83A 5GHVA 5CT0A 4W4VA 2VX1A 3SHEA 3WF7A 3FZOA 4F9BA 4GS6A 3PZHA 4AW5A 4CLIA 2SRCA 4KKHA 4WSYA 4PL3A 4RZWA 5ANJA 5AP4A 1OMWA 3U8WA 3WIGA 2QODA 3U55A 4QMXA 3W2PA 5FG8A 2XNEA 3P86A 3VS3A 4O7TA 3QYZA 4OBPA 5TOZA 2X6EA 2WELA 1UU8A 3GFEA 1PMVA 4FNYA 2V7AA 4PQNA 4QP8A 3NCZA 5CEMA 5F1ZA 3HRCA 4AN3A 5FXRA 4O0VA 3RPRA 1PXPA 2R7BA 3TTJA 3G6GA 3HP5A 4KB8A 4IX4A 2QLQA 3D7ZA 3R7OA 3EQGA 3VBQA 4V0GA 2UUEA 5IA1A 4K1BA 4QD6A 4DGMA 2PVFA 3F5PA 5DIAA 3EL7A 4GCJA 3LOKA 3PVWA 2FVDA 1H25A 5E8VA 2WMBA 3RCDA 2W7XA 4P7EA 3VHEA 4A4OA 4BCGA 4CVAA 1PXOA 2WU6A 3E93A 2CGVA 3IW4A 3TCPA 1XR1A 4CQEA 3OXZA 4F65A 5IA2A 3S1HA 4RX9A 4ALVA 3FC2A 3NUUA 4PTGA 4R1YA 4M12A 4F99A 3HGKA 4GSBA 3KXMA 1LPUA 3FWQA 2IZSA 1XBBA 2ITTA 3R21A 1I44A 3Q04A 3COIA 5HVYA 2YM6A 3PY0A 4YC6A 1ZYCA 4LRKA 4NEUA 3TG1A 4C57A 4CKJA 4LV5A 1CTPE 3C7QA 2YCSA 3KRWA 3V04A 2WMQA 2ETKA 4XP3A 3DJ6A 3JS2A 4KAOA 3VF9A 1OVEA 2BALA 2QNJA 3OD6X 4U40A 4QQCA 3SG8A 1KE9A 3QZHA 2VV9A 2WIPA 4APPA 1U4DA 4OTQA 5HO7A 5AP2A 4XG8A 3OWJA 5HE2A 4OAUC 2J7TA 4WIHA 5ACBC 2UZBA 3EKNA 5JSMA 3GCUA 3C1XA 1XKKA 3EYGA 4S2ZA 3OW4A 4YZCA 2WZJA 5J95A 5DWRA 4WD5A 4DG2E 2XEZA 2C3IB 4OGRA 4RMZA 5L8KA 4AXAA 4E5AX 2OH4A 4YLKA 3ZUVA 3VW8A 2WOTA 3FY0A 5IH5A 1ZLTA 3ODZX 4EHEA 3HZTA 2VO0A 2XP2A 2QOBA 3L1SA 4F0GA 4LGDA 3D5WA 1Q8ZA 3KRXA 5EW9A 2GPHA 1OUKA 1QL6A 3PIXA 4DFXE 3VQUA 2QKWB 4GIIA 2BRBA 3DBFA 4A07A 4HZRA 4ZTLA 4TWOA 3R8VA 5DMZA 4RQVA 4HOKA 3V8SA 2J9MA 5AR5A 4ORKA 1KV1A 1VEBA 3TDVA 3ENMA 4RIYB 1OZ1A 4U3YA 5DNRA 5C9CA 1QPDA 4QMQA 1Q8YA 3R2BA 1NA7A 5I9YA 4USEA 2UW4A 3HNGA 3VQHA 3TDWA 4GYGA 4L43A 4G3FA 3PXRA 4XG4A 1A06A 2VWYA 4RLKA 4K11A 1WAKA 3F2AA 4BI2A 2E9VA 4EEVA 4W8EA 4JX7A 4CFNA 5CU3A 5A54A 3P9JA 2JDOA 4BDFA 2G2HA 4OTIA 4JG8A 3E8EA 1V1KA 3BU5A 3EJ1A 3UZRA 4ZZMA 5AJQA 3LHJA 5B7VA 3SQQA 3G9LX 4KIPA 1W98A 2ITWA 2ERZE 5DOSA 3RPYA 1IAHA 4FSQA 4L68A 4Y46A 4ANLA 3BWFA 5CXHA 5L2IA 5CTPA 5JQ8A 3MYGA 3Q9XA 2CLXA 2X6DA 3C0HA 2O64A 3NGAA 4C3RA 5CAVA 5IF1A 3LFDA 2W05A 4U81A 2ITUA 5CAQA 5HIDA 1JSUA 3EFKA 4QMZA 4V04A 5FBOA 3W32A 4DGNA 3Q4TA 2A4LA 3NNXA 3KEXA 4IAAA 4EBWA 4CTBA 3AQVA 4C62A 3RHKA 3N4UA 4CMUA 4WBOA 2RG5A 3MJ1A 1PXMA 1IA8A 3IW6A 3BU6A 3KRLA 5EOLA 4BHZA 2JLDA 2PMLX 4F1TA 2WMUA 5L8LA 4WKQA 2O5KA 3ZXZA 5H9BA 5D12A 3F82A 3IG7A 5AR7A 4HVIA 3ZZWA 1PXJA 2C0OA 4AA0A 2H96A 3MH2A 4I6QA 4FG8A 5E91A 1OPLA 5AAFA 3RAHA 4ANNA 4GT3A 1FVRA 1GZKA 4ITJA 4RWJA 1O6KA 3CGFA 3M11A 3OUKA 2BROA 1IG1A 4ANSA 2O2UA 4EH6A 2OXDA 4E6AA 2Y4PA 5HD4A 3GVUA 3ZXTA 3H9RA 3KXNA 5KBQA 4ARKA 3GQLA 4ZTMA 5L2TA 2C3KA 4E73A 3FXWA 4S31A 4F7JA 5HBHA 2X2LA 3IGOA 4FV5A 3FY2A 2Y6MA 4IX3A 3UTOA 5CU6A 3FMHA 3I81A 2NNWB 4TYIA 4FE2A 4XG6A 5AA9A 5LXMA 5J1VA 3WF5A 4HVSA 2OIBA 3AGMA 4ITIA 2ZMDA 2AC3A 2VNWA 3AD4A 4I4FA 4MF0A 4U44A 3ZO4A 4EZ3A 4USDA 3LMIA 2QQ7A 3NNUA 4FSZA 3S0OA 4HVDA 3PZEA 2XIZA 5J5TA 4CYJA 1FMOE 4GK2A 5AP1A 5E8ZA 4X6RA 4E6QA 4BCJA 4PDYA 2XRWA 1WBPA 3ZO2A 3PPJA 4RIWA 5EQYA 4X7QA 4FKSA 2F49A 2GU8A 3VUGA 1SMHA 2XJ0A 3JVRA 4IVCA 2BFYA 3BYSA 3DB8A 1RW8A 2J2IB 4GJ2A 4K33A 3H30A 4F0IA 3N4VA 1WVWA 3R1NA 2GHMA 3PLSA 4EK8A 4A9TA 5DN3A 4F63A 3FL5A 1SVGA 2WQBA 4IXPA 4FBXA 4TNBA 4ACHA 5LMAA 4BBMA 4Q9ZA 2UVYA 3SOCA 2YIYA 3GENA 4BBEA 4HYUA 4D2TA 3L9MA 3R7YA 2WD1A 3FZSA 4MEDA 4S32A 5DLSA 3DOGA 3D2KA 5IQFA 3PVUA 3C50A 3R71A 4FIGA 5IMEA 3DJ5A 4D5HA 2YM3A 3VUMA 3HMIA 3QL8A 4QMPA 3ORTA 2BMCA 2R3PA 1XO2B 2ITVA 5ICPA 3QCYA 3FMEA 3UVRA 4E4LA 5JT2A 2WEVA 2RFDA 3K5VA 4L01A 5HVJA 5IEXA 3FQEA 2PSQA 2FH9A 3NPCA 4XV9A 3UBDA 3H0YA 4GFGA 1Z57A 1MRVA 4FEVA 2GTNA 2QU6A 1VYZA 3E7OA 2B9FA 5ACKA 3W18A 3UC3A 4KBCA 4QNAA 3AOXA 5D11A 3BCEA 4BYJA 3C4CA 2HK5A 2VO6A 1AGWA 2YM4A 3N9XA 3PXYA 2GSFA 4NW5A 4EC8A 4QTEA 1J1BA 2XUUA 3L9PA 4RG0A 3CIKA 3A7JA 5B0XA 4CZTA 2UW0A 2XKFA 3B2WA 4M84A 4DGOA 4MNEB 2XB7A 3NUYA 3ZYAA 4ANMA 5DI1A 1B6CB 2B1PA 1WBOA 2YJRA 3DBCA 4MNFA 3WZEA 4FKOA 4CT2A 4U80A 4XP0A 3HMOA 1PRYA 5GNKA 4I1ZA 2LGCA 2O8YA 1YWVA 1KOBA 3PSDA 4XS2A 4FK6A 5DBXA 3VF8A 4O0YA 4RPVA 1P14A 3UODA 3HMMA 3AC2A 1YXTA 4KIKB 4UY9A 3UIUA 4ZJJA 3QRUA 3QKKA 1CM8A 3I5NA 3LLTA 4DITA 3NZ0A 1J7LA 4TYJA 4XCUA 2OZOA 3A2CA 3MPAA 5HE3A 4GV1A 2DWBA 2PZYA 2YCFA 3O50A 3AC5A 3AG9A 4FSYA 3VJNA 4C58A 2UV2A 1FQ1B 2YISA 4I4EA 1H4LA 4W4YA 1Y6BA 4IE9A 3AC1A 4IX6A 2XKDA 2OJ9A 2JD5A 4RJ4A 3V5PA 3VUIA 4ASEA 3QZFA 3ORPA 3PIYA 3E5AA 2BRHA 2VRXA 2G1TA 3QQJA 1JKKA 2RFSA 3MVJA 2XK4A 3MV5A 4FTIA 4APCA 4A7CA 2XKCA 4BTFA 1WCCA 4O7NA 1VJYA 2A1AB 3HV7A 2ZMCA 4YNEA 3L8VA 2QOIA 4JQ7A 1VR2A 3BHTA 4PRJA 2R3HA 2PVMA 1H08A 2BPMA 5EHYA 5AV3A 5FP6A 3RCJA 4BDHA 4EH2A 5JFWA 4DG3E 5JH6A 1Q99A 3WOWA 4JIAA 1JKTA 4J97A 5IA5A 3MESA 3CS9A 4TNDA 1Q97A 3WIKA 1YDRE 3BPRA 3PXKA 3TNIA 3VS7A 4P90A 4IWPA 3C13A 3FYJX 1OPJA 3CY2A 4BRXA 5AR8A 5KHXA 1QPJA 1CSNA 3R9HA 3QQUA 1YXXA 4EYJA 2WGJA 4FKJA 4D1ZA 3R8LA 3QTWA 4C4HA 4IB1A 2CJMA 3FMMA 1M52A 3MH3A 3T9IA 5CU0A 3AMAA 1UKIA 2J90A 3LMHA 2WQEA 3UG1A 4BWXA 1U5RA 2Z8CA 5L6WL 4ZLZA
chains in the Genus database with same CATH superfamily
3PXFA 1G8SA 2JAVA 3MDYA 1Y8GA 3PWYA 4G3EA 4ZTRA 4J8MA 5HG8A 2F57A 4R78A 4G6NA 3DBEA 1WBNA 3G0FA 4HCUA 4E4MA 1W0XC 3PJ2A 4EH9A 5HX8A 2NO3A 2JKMA 2IVUA 5FM2A 4BCKA 4M0YA 4BTKA 4FSUA 4S34A 5I9UA 2PPQA 4RX5A 5HLPA 2C1BA 2BZJA 2FGIA 3A8WA 4Y72A 3W33A 4C4EA 1J7IA 4XUFA 2Y4IB 3UPXA 3TIYA 4QQ5A 1ZYJA 4DLIA 3LM0A 3MVHA 4CRSA 4ZS4A 4GVAA 4P4CA 3NVMB 1UU3A 3M1SA 4ZOGA 4JVGA 2VWXA 2PZPA 3RK5A 5K4JA 4O0SA 2BAQA 2AUHA 4XMOA 2F2CB 3RI1A 3MIYA 5IQEA 4YGAA 1PXLA 3LFAA 2YJSA 4IM2A 3SOAA 3WBLA 3T8OA 3B8QA 1UV5A 1IRKA 3ALNA 3W0SA 3HLLA 3P08A 3EQCA 3GFWA 3LZBA 4NW6A 3BHHA 4O83A 4Z16A 2E9PA 1P5EA 3PSCA 5LVNA 5E8TA 2YM5A 3SRVA 2E9UA 1YOMA 3EN9A 2C6MA 5H8GA 3OCGA 1URWA 5GZAA 3QHRA 3RALA 4PPBA 1ZY5A 3NYXA 5EDRA 4CFWA 1H0WA 3NX8A 1JKLA 3P7AA 3ZLYA 4EUUA 2UZLA 3PE1A 5ANEA 4NM0A 1SYKA 4AFJA 4FOCA 1RE8A 3JY0A 4AF3A 4EOOA 4C4JA 4UMUA 1LR4A 3D0EA 1NVRA 1JNKA 2B53A 3PVGA 3I0QA 4FZDB 4RWIA 4I20A 2XK6A 5ANGA 3O17A 4HCVA 3RBWA 2OF2A 3W8QA 4TYGA 2W1EA 3IPHA 4MBIA 3V8TA 3ZSGA 4QP4A 4HPUE 2J5FA 4QTBA 4BCMA 4GFOA 5JQ5A 1JLUE 1HCKA 3DJ7A 4QP2A 4YMJA 4DAWA 3V01A 1X8BA 5E1SA 2VTOA 3KIOC 5D9HA 2C6DA 3IO7A 3BEGA 3DNDA 3Q9ZA 4AZVA 4QYFA 5E4HA 3TI1A 4G5JA 2O65A 4JBVA 4KINA 3F3WA 2XCKA 5IZFA 3PUPA 1AD5A 2I1MA 2P2HA 3CQEA 4MBJA 4YJOA 4AOJA 4Z7GA 4WNMA 2OU7A 1XH5A 3A7FA 3F5UA 2Q0NA 3REPA 3C4WA 4YC8A 2HELA 5KZ0A 5DEYA 3RZBA 1OKVA 4AX8A 2OO8X 5CY3A 2Q0BA 1PMUA 3TNHA 3EQFA 3R9RA 3NEWA 3ORLA 3QC4A 5BVKA 1Y8YA 3KCKA 4PX6A 4GH2A 4C35A 4NM3A 5BPYA 2W17A 3R28A 3WF6A 4CFUA 1EH4A 4YSMA 5AV2A 3RP9A 2C3LA 3V5TA 3QTRA 4H58A 2E9NA 5LMBA 2ZDTA 3SDJA 5CU4A 4EOIA 5CASA 5JEBA 3HAMA 3ZEPA 4O4EA 2XAOA 5AV1A 2C6KA 3OXIA 3DNEA 4XG2A 3ELJA 1UVRA 5HEZA 3RWPA 2XNOA 4MKCA 3S4QA 3T9TA 1VZOA 3DLZA 1VLRA 2BILB 4KD1A 4M8TA 4Y5HA 3BGPA 2OLCA 3QLGA 2ZFYA 2B9JA 3FI3A 1XH8A 2BFXA 4C38A 4BGQA 1A48A 4LRMA 2RIOA 4BDIA 3PPKA 3MTLA 3GEQA 2C5VA 2CKPA 1MRYA 4FEWA 3O96A 4LGGA 4PY1A 3PSBA 4M69A 2EB3A 2YABA 3RTPA 4L8MA 3GCSA 4B99A 2HIWA 3NYVA 3EN7A 5E8XA 4JJRA 3OT3A 2PE2A 4E5WA 2XIXA 3VN9A 2X1NA 2YDJA 4FKRA 3SV0A 3O8UA 2YDIA 4LYNA 5AUXA 5I3RA 3ROYA 1KWPA 3UNZA 3FPQA 2ZAZA 3MIAA 1WBSA 1Q8TA 2ZJWA 3O0GA 5HCXA 1QMZA 3ORIA 3QXPA 2YIRA 5AR2A 3ZC6A 3U6HA 4AA5A 1UA2A 3P7CA 4YJQA 4FV4A 4USFA 4GU9A 3QF9A 3UDBA 2R3MA 3QRKA 4EORA 2W99B 1KOAA 5TE0A 2VTTA 4XOZA 4F7SA 4MX9A 3BGZA 3FLQA 4XBRA 3ALOA 3NCGA 3R73A 3ZFMA 5LWNA 2Y0AA 4PPAA 2J51A 3T3UA 2C0TA 3DPKA 5CENA 3SC1A 2WB8A 2A19B 1OL5A 3U9NA 4CFMA 3GC7A 2CGUA 5KUPA 2PVJA 3EN5A 4GT4A 3F5XA 1T45A 5CALA 1MQ4A 4YO4A 1KE7A 2HY81 3LAUA 5A4TA 2YCQA 5L2SA 3ZHPC 2Z7RA 4FVQA 4MCVA 4AE9A 3EIDA 4O6LA 3R9OA 4EKKA 3QCQA 3R2YA 4U42A 5CANA 4M97A 1XQZA 3CCNA 4CV8A 1PXIA 3AT2A 4AN9A 4A06A 1Q4LA 4UWBA 2YDKA 4KIQA 5EHLA 2WTVA 3Q2MA 5F4NA 2XNMA 3LCTA 4IZ5A 5ETIA 3ACKA 2HW7A 4RT7A 2X8DA 3R0TA 5EM7A 4OR5A 1F0QA 3F61A 3H3CA 4FYOA 4GEOA 4TRLA 2OICA 4V0GB 5AP7A 2OI4X 4G16A 4O0TA 4DF3A 1Y6AA 3ANRA 3O51A 5AUYA 2JKKA 4YJSA 4J7BA 2JDRA 4JT3A 2XBAA 3W2OA 2CNVA 3CY3A 5LVPA 1FPUA 2OFUA 1KV2A 3GCPA 4GG5A 4K6ZA 3H9OA 3RZFA 3U9CA 5CVGA 4EJ7A 2WTKC 4LOOA 5C8NA 3DTCA 3R7VA 4O7LA 5AR3A 4NT4A 2R3RA 5DR6A 3UYSA 3RAIA 4ACCA 1ZMVA 4AT3A 4OTPA 5IQDA 3NRMA 2VWBA 4QYGA 1KSWA 4JR7A 4KIOA 4HJOA 2FSMX 3BWJA 4NCTC 2WTIA 3QFVA 4B9DA 3ZFXA 4BDKA 1JPAA 5FEEA 2OFVA 3BYOA 3MFTA 3UIXA 1ZOHA 5EM8A 1SNUA 4HYSA 4B6LA 4CCUA 2NP8A 1H0VA 5CQUA 3E8CA 5HG7A 4MF1A 2NRUA 3AC8A 4D28A 3OROA 4WSQA 1BMKA 2CKQA 5HNBA 2QO9A 2CN5A 1H27A 1K9AA 4DFYA 4MTAA 1Q8WA 5M4UA 4KABA 4AAYA 4LV7A 4QP9A 4C0TA 5M4CA 4RFMA 2PMIA 5CEIA 3KF4A 5AV4A 2XIKA 1BX6A 4HVHA 2A0CX 4YTCA 5D10A 2VO7A 4JAIA 2QI8A 5D1JA 4ZSGA 5M06A 5LVMA 1M7NA 4GJ3A 4B8MA 3NWWA 4FG7A 4OLIA 5DRBA 3WZUA 4BICA 4G17A 3KXHA 4IM3A 5FEDA 4BJJB 1P4FA 2PTKA 4QYYA 5BVFA 5HVKA 4A9RA 1XH7A 3LQ8A 3LCDA 5BYZA 5IQCA 4FRFA 4CRLA 5IMXA 3PJ3A 4XRJA 3RKBA 2HWPA 1ZYDA 2JDSA 4IWQA 4QT1A 4G31A 2X9EA 3PUFC 2Z2WA 1V0PA 4DEAA 2GNFA 4IVAA 4ENYA 1SZMA 3ITZA 4YO6A 2OG8A 1FGIA 2PVYA 2QR7A 3N51A 4FL2A 3CXWA 4XJ0A 3EN6A 4DCEA 3BYMA 4DTKA 4HW7A 5KMLA 5M4FA 4FVRA 5FGKA 5I3OA 3JYAA 3FHRA 1CKIA 1LP4A 2PVLA 2PZIA 3OEFX 4DYMA 5M09A 2Z7SA 3TKUA 2EXMA 2EXEA 4GYIA 3BE9A 3I6UA 1W2DA 3W0MA 3C4EA 4C02A 3L9NA 5LOHA 1JVPP 2GS6A 3CBLA 4B4LA 2DQ7X 3VO3A 2IF8A 5KE0A 5GIPE 2BUJA 2ZM4A 2CNQA 1G5SA 3GU4A 4DINA 5IUGA 1JSVA 5JRSA 5A46A 4MBLA 3LXNA 2XRUA 3IGGA 3OFMA 3UZPA 2YITA 4E4NA 1H26A 3KRRA 2C6TA 3E92A 4P5ZA 4AE6A 3DK7A 4I5HA 3DB6A 2PK9A 2XAMA 3ODYX 2R7IA 3FMJA 2BDFA 3GBZA 4I23A 5IH4A 3TXOA 4R3RA 5CZIA 3CP9A 3KMMA 5FWKK 4ZP5A 3UE4A 4I6HA 5LWMA 5J87A 2PUIA 4DEBA 2W1DA 4BBFA 4DCAA 4FIHA 3GU8A 4PF4A 3R1YA 1H1RA 2C47A 4J98A 4W9WA 5EYCA 2UZWE 3QCXA 4RJ6A 3UO6A 4RA5A 4QMYA 5CLPA 2F7EE 3CTJA 3FMNA 2VUWA 4BFMA 4Z7HA 3IW5A 3JPVA 4FNWA 5CSWA 3UPZA 5AUTA 3MI9A 4FEQA 3U6IA 3OOGA 3UO4A 1H1PA 1AQ1A 4RFYA 2BIYA 4D58A 3TJCA 5HLNA 2GFCA 5DA3A 3EB0A 4FKLA 4X2NA 4ZIMA 3FYKX 3RNIA 5J9ZA 4J95A 4O7VA 4FIIA 3W16A 3QQGA 3LCKA 4D4YA 4FKQA 3H4JA 3IECA 4JLCA 3VRZA 4JG7A 4BCHA 4CKIA 1YQJA 4JRNA 3RK9A 4AA4A 1L3RE 4PP7A 3EQBA 4RLLA 4EBVA 4LGHA 3KQ7A 1GZOA 3W2CA 1YVJA 3EQRA 1ZMUA 4AP7A 3O71A 3NVKI 4NFMA 3ZTXA 1XJDA 2BTSA 2ZV8A 4L46A 3I1AA 1WMKA 3GU6A 4PL4A 3F7WA 3F3TA 4ZJIA 1OM1A 1ZRZA 3EFWA 4EHZA 4EWQA 4W4WA 4X3FC 5HNGA 3DT1A 4F1OA 3VS1A 2HZ4A 2GQSA 3V8WA 5BYLA 3K3JA 3QTIA 1BLXA 3DKCA 4FL3A 5HGIA 4BDAA 4EHVA 3S3IA 4UMQA 3DXQA 4JR3A 3FSKA 4LMUA 4OTDA 5LMKC 3VS5A 3AMBA 3L9LA 4F7LA 3E3PA 3HDMA 5EOBA 4F4PA 3FZPA 2RKUA 5IDNA 2Z60A 3PRIA 4EH7A 4XBUA 3MY0A 3ULIA 3ZOSA 1R78A 3NFFB 3KK8A 5H8EA 4RIWB 4HGEA 2OXYA 4QDEA 2DS1A 3LFBA 1O6YA 4M67A 4UYAA 5CAOA 3QAME 4YZMA 5JGDA 3NW7A 3KK9A 3HV4A 3KVXA 3QTZA 1OIUA 5L4QA 4AT5A 3FAAA 3OCTA 4R6VA 4FTUA 4Y8DA 1PY5A 4ASXA 3C5IA 5IDPA 2I0YA 4L42A 2ITZA 4XNEA 3NW5A 2VTSA 4UB7A 1YHSA 1SNXA 3FZRA 3ULZA 3PRFA 4JIKA 3SXRA 5EYKA 4FEUA 1JAMA 2GNJA 3F3VA 3R7EA 5KMOA 1K2PA 3BHYA 1HOWA 3QLFA 4LOQA 4DHFA 2R3OA 4EWHA 4ZZOA 4D2WA 1ZMWA 3QBNA 4M3QA 1PXNA 2ACXA 3JVSA 4JDHA 4YZ9A 4W9XA 1JQHA 1Q62A 1MQBA 3G9NA 3OWPA 3FI4A 3P5KA 3H9FA 4HNIA 4JBQA 4UZDA 1PMEA 5D41A 2YN8A 3BELA 4NU1A 4YJRA 3RAWA 1YI3A 4PDOA 5EKOA 4D0WA 4EUTA 3DTWA 5M08A 2OBJA 2I7QA 5EI6A 5JN2A 2Z02A 5JFXA 3FI8A 3L8SA 2WKMA 3LJ1A 1JSTA 4MWHA 4F9WA 4H05A 2VWWA 3AGLA 1WVYA 3ORMA 4C34A 3SG9A 2GS2A 4I41A 2VTAA 2ERKA 5KMNA 4F70A 1V0BA 2R3KA 3RNYA 4RVLA 3I5ZA 3SXFA 4I5MA 4AZFA 4ZS0A 3F9NA 3M2WA 3NR9A 4FTMA 4IACA 3VUKA 3GCQA 4QYHA 4FNXA 5CF4A 5CF6A 1W8CA 3R02A 4O4BB 4CZUA 2IN6A 3ZCLA 5FTQA 2WPAA 4DA5A 3FXXA 4IEBA 4RRVA 5HG9A 5IU2A 4JOAA 3BBWA 3UMXA 1IAJA 1OBGA 1LEZA 3QUEA 4NCTA 5CX9A 3TV4A 4OTHA 5LVLA 4QP1A 2J0IA 4MQ2A 2V0DA 5AP0A 2G01A 3A8XA 4D4SA 5I9WA 2ZV7A 5T6KA 2VTHA 3HV3A 3MBLA 2VGPA 4YTFA 4DE4A 3HMNA 3G33A 4I0SA 1OIRA 3D94A 4AW0A 5DR2A 3NAYA 5L6OA 4AGCA 1WZYA 5J79A 3UDSA 4BYIA 4U0IA 2CNUA 3BU3A 3KN6A 4F9YA 5BVWA 1H28A 2A27A 2QOLA 3UIBA 3F5GA 2R3LA 3SW7A 4EH4A 1Q3DA 2P33A 5C03A 1U54A 3VHKA 3OP5A 4ANBA 3GOKA 3A60A 3ZLXA 5FUTA 2HW6A 3R7GA 3TMOA 4AN2A 5BYYA 5KHWA 4CZYB 5M4IA 3GB2A 4UALA 3TNQB 3KRJA 5IQIA 3EMGA 1UNHA 2E2BA 3OT8A 3MGYA 4FEXA 1FBNA 1R1WA 2V7OA 3COMA 1OIYA 2YHVA 3LFCA 3MB6A 2OIDA 4N0SA 4YLJA 4U79A 5BVEA 3VBWA 2J5EA 2IVVA 4BVUA 5CT7A 4ZK5A 5HD7A 5CEPA 2VX3A 2ONLC 2B9IA 4MXCA 2WQNA 5AWMA 3QGYA 1A9UA 1DAWA 2UZEA 5AEPA 3KL8A 4FV6A 3CD8A 5CWZA 1NVQA 4Q5HA 3TKIA 3DAJA 3MSSA 1YDSE 3R01A 5CAUA 4IADA 4P2KA 4YHFA 3BYUA 4EOSA 3TZ8A 1YOLA 3FE3A 1OGUA 2VTRA 5ETFA 4L7FA 4BHNA 3OF0A 4RSSA 4ASZA 2QOKA 2X4ZA 4RC3A 3BRBA 3KMUA 3TIZA 3EQDA 3ENHA 2W96B 4R3CA 2XK9A 5L2QA 4F6SA 4E4XA 5AADA 4KKGA 1PXKA 5BUEA 5KX8A 4I94A 5IEVA 2Y9QA 3LCOA 4PMTA 4WG4A 3TZMA 2ITOA 2QU5A 2QOCA 4ZSLA 4O38A 4AAAA 4FIFA 3HMPA 4O22A 4BCFA 2JDVA 4ACGA 3O7LD 3D14A 4EONA 3TWJA 4O81A 1LUFA 3PIZA 4GT5A 3U87A 1UNGA 2UZOA 3F6XA 3W0NA 1OB3A 3BKBA 3AD5A 3MPTA 4AQCA 3UDZA 4N6ZA 5FRIA 1H1QA 2JEDA 1CKPA 3R1SA 3EZRA 3R8PA 3EN4A 3VUDA 1XMMA 1FVVA 3G5DA 3QTSA 4X3JA 3TACA 2JIIA 3KVWA 5EH0A 2IW8A 4DFZE 4L44A 4ZY6A 3VVHA 4U97A 4YHTA 4D5KA 2AYPA 2PVHA 4FZ6A 4IMYA 5I5ZA 3SRVB 4TXCA 1ERKA 2QVSE 3TL8A 4X0MA 1OGYA 5DT0A 5AX3A 3W0PA 1TQPA 4J53A 4JRVA 3OHTA 2BDWA 3PWDA 3P78A 4DFLA 3HYHA 2JFMA 4BI1A 3TM0A 3WE8A 4NM7A 2PULA 4DHZA 1GZ8A 2W5AA 3D2IA 3M42A 3P23A 4IWOA 1H24A 1UNLA 3HUBA 3SAYA 5KKRC 3R7UA 4G3GA 4BY9E 4WG5A 2CSNA 4LL0A 4D9UA 5BUIA 4TWNA 5BVDA 2RGPA 3KA0A 4E3CA 5GINE 2X81A 3KY2A 1W2CA 3W2QA 5CSVA 2WXVA 2IVSA 3CPBA 1F3MC 3LJ0A 4RIXA 4CLJA 3A61A 2VTNA 2WO6A 2WAJA 2XANA 1KUTA 2ITXA 5EM6A 4GMYA 5JFSA 4BDCA 2ZVAA 5AV0A 4GUEA 5AUZA 4FSWA 4X3FA 3NW6A 4UMTA 4YBKA 3CSVA 5E8SA 3OTVA 2PU8A 4RQKA 2W4JA 2WMVA 4MYGA 4G2FA 2WFYA 4PPCA 3P79A 4YLLA 4ZY4A 2CKOA 3SXSA 3TNPC 4DH1A 5BQ0A 5C1QB 2XYNA 3OS3A 3VC4A 1M2RA 5ANOA 4U7ZA 3DCVA 3QYWA 5CXZA 5I9ZA 5LMKA 3HA8A 4K77A 4TY1A 2JAMA 2YIWA 2BZIB 1ZAOA 4IBMA 4TYEA 3OMVA 2IG7A 3QRTA 3GC0A 3QALE 3EQPA 4TWPA 4WUNA 2UW6A 1URCA 2W1IA 4OBQA 4BWPA 3ZSHA 4MXYA 1TKIA 4FTAA 4QPAA 2CN8A 5DRDA 2GNIA 5FTGA 5I0BA 2WTJA 3LLAA 2X0PA 3UOKA 3ZRLA 1U59A 3AMYA 3K2LA 1H01A 3S2PA 3ETAA 3WF8A 3QXOA 4B7TA 1V0OA 4Q5EA 2BKKA 4I22A 3EWHA 3GNIB 4IJPA 3HRFA 2WMWA 5A14A 3OCSA 5H2UA 4J96A 3ORZA 5HBEA 5C4KA 4ALWA 3QZIA 4A9SA 1JWHA 4WNOA 4GU6A 2F7ZE 3DAKA 4M69B 3W10A 3DGKA 4AGUA 3W0OA 1Q5KA 3RHXA 3RAKA 3Q4UA 4KRCA 5EKNA 3R9NA 3ZSIA 4FTOA 3NDMA 3A7GA 3CR0A 4RVTA 4ZTQA 5A4EA 3FLYA 3PG3A 2Z7LA 1DI9A 4C4FA 5F95A 3VUTA 4Y83A 2H8HA 1OKYA 3FJQE 5DFPA 4ERWA 2PVKA 4UN0C 4YTIA 4CG9A 5IISA 4BDDA 1VYWA 3QWJA 4FV7A 3UGCA 5IQHA 1ZOEA 4RC2A 4EJNA 3CGOA 4C36A 3EYHA 3UVQA 4N6YA 3BLRA 4FYNA 2B9HA 3B2TA 5KCVA 3FI2A 2VU3A 3WYYA 4D2PA 3LKMA 3MA6A 3TEIA 3EH9A 4FT9A 3WYXA 5LCJA 1RQQA 4YJVA 5L3AA 1W84A 5EI2A 4W8DA 4WHZA 2I0HA 5AP6A 2PYWA 4UZHA 4QRCA 4FJVA 5IUHA 4ZEGA 1R0EA 4FIJA 2CCIA 5EM5A 1P4OA 4GRBA 3JXWA 4FICA 4G6OA 4XP2A 4C3PA 4WT6A 4FIEA 3FC1X 5KO1A 2BHHA 5CF8A 5KZIA 5DGZA 4M0ZA 3ZBXA 2RL5A 4AZWA 3E64A 1QPEA 2KULA 4NSTA 5FD2A 5EDPA 5JGBA 4LM5A 5D7VA 4FV2A 1SVHA 2XIYA 3BQRA 4FTQA 2EB2A 1OUYA 3LXPA 2JC6A 4F9AA 1OL6A 3F88A 2WMXA 1RJBA 2ITNA 3EOCA 4FGBA 3IDCA 4DGGA 3I60A 2VGOA 3ET7A 4O91A 4EK5A 4F09A 2E9OA 3TUBA 1GJOA 4BTJA 2RG6A 2CCHA 4JS8A 3NLBA 2ZOQA 3VWAA 4EKLA 5B2MA 3EFLA 4AACA 5AP3A 2X7OA 3ATSA 2YEXA 5H8BA 3ZO1A 4RX8A 3NAXA 2P2IA 4NH1A 2O63A 3NYNA 4NJ3A 5A4LA 3JY9A 2UW8A 2XNGA 4U3ZA 4FSRA 5AUVA 4FSMA 5C8MA 4IAZA 4HZSA 3POZA 4OTFA 2FB8A 4EH3A 4G6LA 4IAYA 4WOVA 2ONLA 3BHUA 4FTRA 1YXVA 2J0MB 5A9UA 5BVNA 4Z55A 2XIRA 3EHAA 3QUPA 4LL5A 4FGRA 1WBVA 3IQ7A 3IW8A 2UW5A 1U5QA 5KNJA 5BV3A 1W7HA 3ERKA 3FLNC 4FSNA 4L7SA 4FG9A 4KBAA 4KSQA 4XG7A 1YWRA 3RGFA 2O0UA 2QC6A 2JITA 5J9LA 2C68A 2R2PA 4IFCA 5FEQA 2XNNA 1ZZLA 2UZDA 2R0UA 4FV0A 4K2RA 3MVMA 3HL7A 5DEWA 3VONA 4S33A 2HENA 3F2NA 4YJNA 2VO3A 4GIHA 4MXAA 4E20A 4FTLA 3PA3A 3EKKA 3FV8A 4KRDA 2B54A 1ZYSA 4FV8A 5AAEA 5JZNA 3BLAA 4O0WA 4XLIA 5ITAA 2X0QA 2BIKB 3FXZA 1QCFA 4CFVA 2R9SA 4EZ5A 2EU9A 4RC4A 4RJ5A 3NUXA 4DH8A 1MP8A 4DN5A 4QQJA 1TVOA 2WOUA 3IOKA 3ROCA 3AC3A 4XHKB 2XA4A 5JKGA 1FGKA 1STCE 4IZYA 2VAGA 3BV3A 4AQKA 3SA0A 4QMMA 1JOWB 3ZDIA 1JBPE 2J0JA 2C6EA 3UMWA 5CEKA 3ATTA 3Q5IA 3QQLA 4D2RA 3ZO3A 3JR1A 3Q3BA 3FMKA 4MK0A 3RINA 4YP8A 3H0ZA 3Q9YA 4AW2A 4DH7A 4NTSA 4HYIA 1SM2A 2HAKA 2GNLA 4CSVA 3EQHA 4D55A 4FSTA 2C30A 3LIJA 2HCKA 3FLSA 3I7BA 4DDIA 2J50A 2QOQA 4AWIA 3GP0A 5F94A 5EG3A 4IDTA 2XYUA 3BBTB 3QQKA 4WG3A 2KTYA 2W5BA 3C0IA 4Z3VA 5JGAA 1R0PA 3KXGA 3Q6WA 3O8TA 4Q2AA 3NUPA 5GJDA 4UMRA 5AFVA 3F7ZA 4MHAA 2GCDA 3IKAA 3R8UA 5HICA 2VWVA 1E1XA 3V51A 2REIA 3O2MA 5M56A 1H1WA 4FR4A 4U43A 4DLJA 4YZDA 4O0XA 1BKXA 4KKEA 5HU9A 4NWMA 5T3QA 3RK7A 3FKNA 4O0UA 4N57A 4C59A 3KB7A 4PMPA 1Q41A 3BHVA 3KF7A 3OCBA 4CNHA 3WZDA 2QG7A 2PWLA 3W2RA 4II5A 4G1WA 3MFRA 4RGJA 4BDGA 5J7HA 4EOPA 5IPJA 3THBA 3LFQA 3UDTA 4F9CA 2WMRA 3E87A 4IQ6A 3NNVA 5BUJA 1XWSA 5IG1A 4I93A 4R1VA 3FBVA 5JK3A 5AP5A 3UOHA 3LMGA 4FKUA 4IFGA 4DH5A 3FDNA 3NUAA 1W82A 4KNBA 4GUBA 3QTUA 5AIRA 4BKYA 4OUCA 2ZYBA 2DYLA 1M17A 3EFJA 2CMWA 2VWUA 4CEGA 1YI6A 4ZSJA 4K8AA 3OG7A 4QMVA 4C33A 1GNGA 2O3PA 2W1FA 3R7IA 3A62A 4MWIA 4B0GA 3FZ1A 4WRSA 1UU7A 4LFIA 2ITYA 3WILA 4FZFB 2PL0A 3Q96A 3SD0A 3UP7A 3NFGB 2CGWA 3HV5A 4F78A 2QONA 4G5PA 2HZNA 2IEWA 3E62A 2I6LA 1DS5A 1YHWA 3HA6A 4FF8A 2JGZA 4MQ1A 4OW8A 2EUFB 4HGSA 2XNPA 4D9TA 2VWIA 4DEEA 2C6IA 3O7LB 3ZRMA 2J0LA 3OY3A 4F64A 3HUCA 4LI5A 4EK4A 4PV0A 3Q5ZA 2IO6A 2YM7A 4M7IA 3UNJA 1REJA 3OC1A 4YJPA 3C0GA 2GQGA 4BF2A 4JNWA 1CKJA 2F4JA 4FODA 2WEIA 3W8LA 3BX5A 4YZNA 4CTCA 3C5UA 4O86A 4MXOA 1XH4A 2PMNX 3LFNA 4W4XA 2UVZA 4EQUA 3A4PA 1BI8A 2OJFE 3R8MA 3V5JA 2XVDA 3TJDA 3R1QA 2BTRA 4EL9A 3CJGA 4O82A 1GIHA 4J1RA 5B2LA 5KMJA 2GHGA 4D4VA 3GGFA 4E8AA 2VTJA 4QMTA 1BYGA 5DR9A 2ZB1A 4RFZA 5IUIA 2B0QA 1GIJA 3NUNA 5E92A 3DQXA 2C5NA 2BHEA 1IEPA 1OPKA 4FKWA 4GVJA 3C9WA 3V6SA 4DGLC 2X0GA 2G9XA 4A9UA 1Q24A 3E7VA 2VTPA 3CQUA 4WUAA 4BDEA 1XHAA 3PTGA 3Q2JA 3LFSA 3FKLA 4KA3A 3D7TA 5CSXA 4UV0A 5HE1A 5BVOA 2C0IA 3A4OX 5G6VA 1O6LA 2W9ZB 5LARA 3COKA 2CKEA 5GZ8A 3MA3A 1E9HA 3MS9A 4L52A 2NRYA 5J1WA 3LFEA 3LXLA 4L67A 3DK3A 4U8ZA 5A3XA 4V01A 4IB5A 2R4BA 4UX9A 4PMSA 1B38A 2ZV2A 3PYYA 5E8YA 3KXZA 3ZDUA 4DG0E 3KGAA 5IA0A 5K5XA 4LUDA 3QD2B 3ZUTA 2OZAA 2J6MA 5HIEA 3RMFA 5JZJA 4DT9A 3FQHA 3V3VA 4YJUA 4IM0A 4MXZA 4ZTNA 4ZXTA 2J0KA 2QG5A 4LG4A 4RWKA 2GFSA 4O7RA 5CVFA 2WNTA 4BIDA 4IC7A 3LFFA 3QWKA 3BL7A 1M7QA 4D1SA 5CSPA 5C27A 2BVAA 4R8QA 2WTKB 2I0EA 3UJGA 4DEGA 4JBPA 2R3QA 4U5JA 4XOYA 5G1XA 4I6BA 2QCSA 3IOPA 2I0VA 3OBGA 3SKCA 4OAVB 2VTQA 1DI8A 2CLQA 4EOKA 2PY3A 3ORNA 4LDTA 2XKEA 4DHIB 4ZMFA 4K9YA 1SVEA 3QTQA 1YOJA 4IHPA 2G15A 1XMLA 1Q8UA 3ZONA 4CD0A 1J91A 2YA9A 1XBAA 3GI3A 3KMWA 4NIFA 4PTEA 3KULA 2PVNA 4NK9A 3P4KA 3VBVA 1IR3A 3UG2A 4X2FA 3E8NA 4FV1A 4TWCA 4GK4A 3VBTA 4C4IA 5M53A 4IB0A 4UXQA 4AZTA 3UZTA