4BTKA

Ttbk1 in complex with inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
287
Chain Sequence
DILPANYVVKDRWKVLKKIGGGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAU-TUBULIN KINASE 1
publication title X-Ray Structural Analysis of Tau-Tubulin Kinase 1 and its Interactions with Small Molecular Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 287
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btkA01
3Q60A 5ANGA 4WKQA 3GC7A 5FXQA 4FV7A 3TACA 4X2GA 4QO9A 3DKCA 3HP5A 3QL8A 5CT0A 4HW7A 5M51A 4R3CA 4P7EA 2PVFA 2UW5A 3QC9A 2XKEA 5E1SA 1IASA 2BDWA 4DEAA 1GOLA 3A7GA 2E9UA 4TRLA 2OXYA 4DFNA 1XBBA 2J51A 4WRSA 5BYYA 4UMUA 2W05A 2IW9A 3PE2A 4XG6A 3FY0A 4IWDA 3UVPA 4XOYA 5GIOE 3HRCA 4FICA 2XB7A 2NPQA 3QUEA 4V04A 3MPMA 3JUHA 1F5QA 3W32A 5CSVA 3T9IA 4FTKA 4DH1A 2AC5A 3MVMA 4O0UA 4GCJA 2VTSA 4O1OA 4NM0A 3LCSA 3GB2A 5EI8A 3KK9A 4HCTA 3HMMA 3PE1A 4W8DA 5L2SA 1IAJA 1OL6A 3LQ5A 4U8ZA 4CQGA 4CZTA 5BUEA 2BHHA 3CGFA 2R5TA 2B52A 5FBOA 2VTQA 4NIFA 2OFVA 3EOCA 2C5XA 3MN3A 3R28A 4G3EA 4BBFA 3BELA 4EH4A 5HEZA 4Z7HA 2C3IB 3S00A 4NM3A 2VV9A 2W1DA 5FXSA 5M55A 3RPYA 4O2PA 4BDHA 4DH7A 4FSUA 4FZDB 3EQPA 4ACCA 4FKRA 5J8IA 3EN9A 1FOTA 2X2KA 4U9AA 4FA2A 4CKJA 4XG9A 2QO2A 4HZRA 4IADA 3ORTA 3OWPA 2BIYA 4HGEA 5I3RA 4OTDA 4E26A 3F3WA 4XJ0A 3UIBA 1FBNA 3DJ6A 4Z16A 4IB3A 1Q61A 1U54A 1PXOA 4I23A 4XEYA 4C2WA 5D7VA 4F4PA 4FT5A 4Y85A 2OH4A 2R7BA 4M0YA 3DXNA 3V01A 4M68A 3RM6A 4ANOA 1NY3A 2ERKA 2Y9QA 3I5NA 3I6WA 1PRYA 1SVHA 2ITVA 4EOSA 4AN9A 3CTQA 3R8VA 4G16A 3VUDA 3GCPA 4A9UA 5A6OA 4K11A 1Y91A 4FV3A 3R1NA 4QNYA 3PXFA 4R5SA 3TKUA 3DLSA 5JEBA 4EOIA 4NM7A 4JDKA 4TYIA 3KXMA 3KFAA 3ET7A 2ZV2A 2YERA 2YISA 4GMYA 3NIEA 3W2OA 3OCGA 4G3GA 5JH6A 4YJSA 2B9JA 3QCSA 1R1WA 3E3BX 5JT2A 5LCJA 2ZV8A 5JFVA 3DBQA 4YO6A 2BFXA 5IUIA 3TEIA 4BCOA 3EQGA 4AGWA 1ZZLA 4GYGA 4IBMA 4RIYA 3VBWA 5JRQA 1PXMA 4QQ5A 2WTKB 4PF4A 4ERWA 2XKFA 3QAME 3IK3A 4BWPA 1T46A 3BYOA 4FKQA 1J3HA 1YHWA 3OT8A 2OJ9A 5D10A 5FP6A 1M7QA 2IVVA 5KMNA 3PFQA 3F5PA 3EFKA 3FKLA 3DCVA 3HX4A 1H8FA 4AW2A 3EL8A 2XK6A 5AIRA 4QMXA 2UVZA 2OJGA 2BAJA 1YDRE 2QOLA 2UZVA 3W2PA 4DITA 5BUIA 4RA5A 1JPAA 4TT7A 4EH6A 4DCAA 4NYEA 4BI2A 2QG7A 3SW4A 3Q53A 3Q6WA 4QMZA 2V0DA 2B4SB 4J96A 4CYJA 4F0FA 3GQLA 3GCQA 4YZBA 3OZ6A 3PUPA 1OITA 2ERZE 4FV4A 3UG2A 3UZPA 3W18A 3IKAA 3ZBFA 4MF0A 3MJ2A 3RHXA 4E8AA 4RT7A 3D83A 3NYOA 3QX2A 4ZP5A 4MVFA 5I9XA 4A07A 1SVEA 2WEVA 4HNFA 3ZUVA 4PDPA 5L2IA 2XK8A 4HJOA 1SM2A 5EDRA 4RVTA 4L45A 5EYDA 3R02A 4CGAA 3K54A 2XK9A 4O2ZA 3MFRA 5IEXA 4FEUA 4RJ3A 4V01A 2FYSA 5HVYA 3VRZA 5HCYA 3DQWA 1YI3A 2R3GA 4FI1A 4AZEA 5J1WA 5IMEA 3QQFA 2CLXA 3DS6A 5HE0A 3HNGA 3QYWA 3DK3A 5AV0A 2PMLX 5C01A 2XS0A 4M14A 3N9XA 1GIJA 5BVKA 4NCTA 3MFTA 2WQMA 2CDZA 4G9CA 2W96B 2B0QA 4DFLA 4JS8A 3RM7A 5K9IA 5CZIA 2UW6A 5J95A 5E92A 5AA9A 1W82A 2CKPA 3H9FA 3AT3A 5HNIX 3OG7A 4BZDA 5HQ0A 5E8UA 2Y4PA 4Y95A 3NVMB 3CQUA 2VWXA 1UNLA 3EB0A 4AA5A 3A8WA 3F88A 5FBNC 3FMDA 4EOMA 5FP5A 3LFQA 3FZOA 3W2RA 5ITAA 4O0TA 1PXJA 5E1EA 1PYEA 4II5A 3O96A 3KULB 4OGRA 5AMNA 2J0MB 5L8JA 4LL0A 1ZY5A 4DEDA 2QOIA 2YCSA 4EBVA 5AUYA 5LXMA 1Z9XA 4NU1A 5KKRC 1J7IA 3COHA 3LCKA 3V5WA 4TTHB 5DIAA 3LQ3A 4UB7A 3MH3A 3HGKA 2B1PA 2I0HA 4NJDA 4ENYA 2UW4A 1KE6A 2VTJA 4TWOA 3TN8A 3TTJA 5M53A 4O7LA 3D14A 1VYWA 3LXPA 2PL0A 5EOLA 5FDXA 4IZAA 3ZFMA 4EC8A 2Q83A 3BEAA 1UWHA 4O0YA 4OT5A 3BEGA 3WE8A 4ASEA 3BLQA 4QPSA 3Q4TA 3ORKA 3QXPA 5C4KA 3D5UA 1VEBA 5BVFA 5TT7A 4FZ6A 2OO8X 4K1BA 3NX8A 4M13A 4E5BA 2OJFE 4JI9A 2X8EA 5CNOA 3O51A 4O0VA 3TDWA 5AV2A 5KMLA 3UO6A 4DG3E 1H1RA 3NW5A 2EXCX 3EKNA 4CFXA 5EQPA 4DLIA 3QHRA 2YLEA 3R04A 4EUUA 1L8TA 3AC8A 3L9NA 4DEIA 4IW0A 3OWKA 2EWAA 3TKHA 1GZNA 3LJ0A 4RIXB 4BTJA 3QKLA 3QZIA 2Z2WA 5E8XA 4ANLA 2OKRA 3ZSIA 3UMXA 4FIHA 1F3MC 1H01A 2BMCA 3RPVA 3LM0A 1G3NA 4QOXA 1RDQE 1Q8YA 5CU2A 4RFYA 4CT2A 3CGOA 2BDJA 4YJTA 3ZZWA 5KCVA 1IEPA 1PMVA 1P2AA 1UWJA 1SVGA 5HBJA 5TO8A 2A1AB 4QP8A 3SXFA 3C4XA 2YZAA 3ORXA 4GFOA 4G2FA 4CEGA 3E8DA 3ZO4A 1Q3DA 3ELJA 3DQXA 3GBZA 4D4RA 3JS2A 3I7CA 4GFMA 4MX9A 3V5JA 1PYXA 4UMTA 3A4PA 5LVMA 2VTTA 3UZTA 2YFXA 1T45A 2J0JA 2R3RA 3O8TA 5EW3A 2BFYA 4XP3A 5KZIA 4AT5A 4FTOA 4YZMA 4TL0A 4FG7A 3OBJA 4GJ3A 4YSMA 5D1JA 3MYGA 3UQGA 3E87A 4FL1A 2H34A 4AE6A 3OS3A 4K9YA 2ITOA 4FTUA 4IM3A 4ZTQA 4BN1A 1PJKA 1YQJA 5KHWA 5M08A 4KAOA 3IG7A 3TG1A 4ZLOA 3LFBA 3TT0A 4I94A 4FKLA 4AWIA 4ZTNA 4DGOA 1B39A 2GDOA 1UNHA 1YKRA 2HIWA 3E8EA 4RJ8A 3QGYA 4RX9A 5EDPA 1WBVA 4IAFA 2XK4A 5G6VA 4J1RA 5FXRA 2VTIA 4DAWA 3QQJA 4PV0A 2REIA 3WIGA 3O7LD 4DFYA 5HE2A 4DTAA 1ZOEA 3FHRA 3NNWA 2JKMA 1JKLA 4FE2A 2I0EA 2XIXA 4W9XA 4UYNA 3R8PA 1KSWA 2OZOA 3IGGA 3NS9A 4IH8A 3CPBA 1Q8TA 2ITWA 3AD5A 2UVYA 4S31A 3VS3A 1XJDA 4IM2A 3LLAA 4IX5A 4MXCA 2R9SA 4MTAA 4E5AX 2XRUA 4GG7A 4PY1A 4V0GB 4BIDA 4AOIA 1M2RA 3ZONA 4Y5QA 2YCFA 5E4HA 1YXSA 4BDFA 3LPBA 4AOJA 4H1JA 3DBEA 4EQMA 3NIZA 5G1XA 4QTDA 4Z55A 3I6UA 2WMRA 3NGAA 2QURA 4BCNA 4BDDA 3C4FA 4C57A 1HCLA 3SRVB 4RG0A 4O6EA 4RZVA 3LW0A 5AX3A 4CMUA 1U5RA 4H58A 2OH0E 3VBTA 3WF6A 1NW1A 1ZYCA 2E9OA 4LFIA 4EHEA 2A2AA 1X8BA 2WTJA 3UIMA 4ASZA 4K33A 3GU6A 3KXNA 4O0RA 3KC3A 3OMVA 3VBVA 3GP0A 4MH7A 1V0PA 5IZFA 4I0RA 1ZMWA 1ZYLA 4BICA 4E6QA 4ZZNA 5T3QA 3U6HA 2R3HA 2BTSA 4FTAA 3NAYA 4JXFA 3ZUTA 3U4UA 2XEZA 2YM4A 4FIFA 4S30A 4O6LA 2C6KA 2ITPA 3MGYA 4FOBA 4L67A 2WMVA 4D1XA 3A62A 3QALE 4QQCA 5I4NA 4TWPA 3RK7A 3C4WA 4X2JA 5AAEA 1B38A 3QC4A 3K3JA 5DVRA 3TUDA 2E9NA 2JD5A 4FSNA 4FT7A 3RZBA 4BDEA 5B2KA 5JFSA 4QPAA 3ZEPA 2ZDTA 3ZEWA 4F6WA 3ZOSA 2X7GA 3FKNA 3GU4A 3GCUA 3WF7A 2HAKA 4U42A 5M57A 3V5TA 4PUZA 2VZ6A 4DG0E 5IG1A 2RF9A 4HPUE 4H39A 2Z7SA 3R8MA 1OIUA 4QMMA 3BE2A 1JSUA 3BYUA 4W4YA 4NUSA 3DV3A 5EHLA 5EK7A 4O82A 3F3ZA 4MBIA 4RWKA 5AR2A 3UQCA 2LAVA 4ITHA 1XH9A 2Y7JA 1LPUA 4KD1A 2RL5A 3FMLA 5C9CA 4TWCA 1GIIA 3A60A 4YTHA 4AOTA 3C50A 4E93A 3EQDA 1XH6A 3UDBA 3HYHA 3Q9WA 4FNWA 4RLLA 4WNPA 1PXLA 3ULIA 4BDIA 3OTVA 1UV5A 2P55A 2R3LA 3HV4A 4YZCA 2F7EE 2UW0A 3EFJA 4RC3A 3QUDA 2C6MA 3OXIA 1KOAA 3EN5A 1OUKA 4X2KA 1ERKA 3EL7A 3VW6A 2OXDA 2W5BA 3IW4A 5HICA 4C4EA 4YTCA 5KKRB 2BAQA 5F4NA 4RJ7A 4EYMA 1QMZA 4Y46A 1YVJA 4HYUA 2WU6A 1G8SA 4N57A 1PXKA 2UZDA 3EHAA 1V0OA 2JEDA 4UXLA 1ZYDA 4YLKA 4PL5A 4C8BA 4J7BA 2Z8CA 4X6RA 3ANRA 2R3FA 3ENHA 5CEPA 1XKKA 3KXXA 4WNMA 2PVYA 5AUVA 3PJ1A 5H8GA 4CFWA 4GVJA 4R3PA 2YDIA 4QYHA 5AM7A 5AR7A 4L7SA 3NUNA 4GS6A 3DBCA 4BCGA 2JKOA 5BYLA 4HCVA 3E8NA 2CKOA 2XBJA 1GZKA 5IMXA 4I6BA 1ZWSA 1ZYSA 1JKKA 3IDCA 5HO6A 2WQOA 4EHVA 4ZJJA 3L9MA 3WZJA 3NNXA 2I7QA 3DB8A 4FV8A 4L3JA 4ACMA 5CY3A 4J52A 2VTLA 3L8SA 4ZTHA 3RAHA 3TIZA 5CAQA 4KRCA 4DEGA 2QOFA 3FY2A 4R7HA 3I0QA 3LCTA 3VQUA 3BLRA 3HDNA 4F7LA 4IC7A 4F63A 2KULA 3LXKA 4RPVA 4YC8A 3NZ0A 1VJYA 4I3ZA 5A14A 4P5ZA 4G6LA 4EJNA 3BHHA 2C6IA 2G15A 4FKUA 4N6YA 4CTBA 5AUXA 2BHEA 3NUUA 3Q32A 2EVAA 1H07A 5CEKA 3P5KA 2CCIA 4BKYA 3UGCA 2VTOA 3HRFA 3MB7A 3LMIA 3MFSA 4FKJA 2Z7LA 4LRJA 3TNPC 4F7JA 3NLBA 3QD4A 5L8LA 4EK6A 5HI2A 4USEA 2J6MA 4JIAA 5HO7A 5LMAA 2VNYA 3G0EA 4FIGA 1SMHA 1JNKA 4OTGA 3KRRA 1H1PA 3JR1A 2JITA 2QOCA 1MRUA 4UYAA 4XMOA 5LVPA 2VU3A 2VWYA 4IZYA 1M52A 2EU9A 4BF2A 4DFBA 5GINE 2Y0AA 2HW6A 3GC0A 4FV0A 4RVKA 2WAJA 3CLYA 3Q04A 3HMIA 2G01A 2DUVA 2ITNA 5EYMA 4CFFA 4I5MA 4WIHA 3IGOA 3PG1A 4YGAA 5HX6A 4PTGA 4YC3A 4BC6A 2G2FA 5IKWA 1OGUA 3KK8A 3K5UA 4HGTA 3TIYA 5IQCA 1JOWB 4EZ5A 3QBNA 4ONAA 2HXQA 2ZMCA 2WD1A 4XYFA 2PVRA 5EM8A 3CP9A 4WG3A 4EZ3A 2PZIA 5HLWA 4YLJA 4BCKA 4F9AA 3DZQA 5CAVA 1I44A 2JFLA 5J79A 3UNKA 3EMGA 3D94A 2PTKA 3II5A 2C1AA 3MB6A 4MXZA 4AFEA 3THBA 2WXVA 2XIKA 3AT4A 5HKMA 3R7IA 4DTBA 5GIPE 1BI7A 5CI6A 5AAFA 5IEYA 4BRXA 4HYIA 4RLKA 3ORMA 3AD6A 5M4CA 4U79A 3ZMMA 5IA0A 3EQCA 3QRJA 2QO9A 4PMPA 3G51A 2YA9A 3AMBA 3MY1A 3PA3A 4AZFA 5KBQA 3KMUA 3MY0A 3VW8A 5IQBA 5CT7A 4XV3A 4BI1A 5EOBA 2VWIA 5DE2A 4DLJA 4FZ7A 3QRKA 1BYGA 3NYNA 5ETIA 3RTPA 3R9RA 3D5XA 4DGMA 1XO2B 5CENA 5I9UA 3ZO1A 4ZMFA 2I1MA 2BKKA 1WVYA 2XMYA 3IW7A 5DMZA 4PDOA 2UW8A 4E4LA 4Q5HA 3F61A 4O22A 4TYJA 4WHZA 2H9VA 4KIQA 3EN6A 3P1AA 3FQHA 1UNGA 1WBWA 3LFAA 3C1XA 3PJCA 5IQHA 3NNUA 2NNWB 4KKEA 4WSQA 4YJVA 3FJQE 3C7QA 3I81A 4KKHA 3PLSA 3NRMA 5ANIA 4JBPA 5CVFA 4LGDA 3UPXA 1A9UA 3ZYAA 2PVMA 4C34A 4D4SA 2AYPA 4RWLA 1EH4A 3VS5A 3HMOA 3LKMA 2GS2A 1FVVA 3JYAA 2GNGA 3LFCA 4QQJA 4XOZA 1MRYA 4ZS0A 3UZRA 4JIKA 2OIBA 4FZFB 4JT3A 4OBPA 4ZZMA 1BL7A 2C3JA 2YIWA 5AP5A 5HLPA 1SNXA 3NW6A 4K0YA 2O64A 4AS0A 1Q62A 3TWJA 5AV1A 2JC6A 3SD0A 3OWJA 3MSSA 3TCPA 4QMLA 4IVCA 4LUEA 1U5QA 4FX3A 3NUPA 4RC4A 4PTCA 1A06A 2X7OA 3PXQA 5E8SA 5HD7A 4DF3A 1FMKA 1FINA 1XH4A 3OFMA 3LXNA 2J90A 5CI7A 5LVNA 4QMWA 3NWWA 5ANDA 3GQIA 3S1HA 2RSVA 2O3PA 1SZMA 3KCFA 3O50A 4FV9A 4N0SA 1YWNA 5FM3A 3PDTA 2ITTA 3FMJA 3P08A 2WMUA 3F9NA 3L9PA 1H00A 4BGGA 3R9NA 4JDJA 2QOHA 4Q9SA 2JGZA 5D12A 3F3UA 3LMGA 4HVIA 3ZDUA 3POZA 4TNDA 4CMTA 3R63A 4IE9A 4MXXA 5K0XA 1GNGA 1Y8GA 5H2UA 4I4EA 5IPJA 2B9IA 5DHJA 1GZOA 4WO5A 3TL8A 2C6TA 5AR5A 5CYIA 5B2LA 3R9DA 5FTOA 4BKZA 3RNIA 5CU0A 1BI8A 4EOKA 4QMVA 5ANKA 5DT0A 4O96A 2CN8A 2R3JA 1Q5KA 3H10A 2BKZA 3I60A 4M66A 4IDTA 2PZYA 2P4IA 4AXAA 3A7JA 1J1BA 2UZLA 2R3OA 4O0WA 3VS1A 2WMSA 3HDMA 2JDRA 3CY2A 3D7ZA 4K18A 1XQZA 1WBSA 4PPAA 4X3FA 4LGGA 4P4CA 3H9OA 2EUFB 3EN7A 4IWQA 4QMOA 3FZ1A 2JAVA 4ZSJA 2XP2A 2GNJA 2IO6A 4C4HA 4N6ZA 4QP6A 2VD5A 2UZWE 3BQCA 4PX6A 4M8TA 4FIIA 5EDQA 2PSQA 1ZMUA 2R3KA 5DG5A 1JLUE 4ACHA 5DYJA 4RIWB 4U6RA 2X1NA 3TTIA 5HD4A 4WG5A 4NFNA 2W1ZA 3DXQA 4LM5A 3RPSA 4O7TA 2J0IA 4MXAA 4G3FA 3BI6A 5AFVA 3NR9A 4BWXA 3PLAE 4CRLA 4NW5A 1LP4A 2A4LA 1YRPA 2XCKA 2ZJWA 1OL2A 4FSRA 4BYIA 2ETMA 4JG6A 4O7WA 3U54A 3NNVA 1CKPA 5FWKK 4RQKA 2YLFA 3EJ1A 5CF4A 2UV2A 3WF8A 5BYZA 1YWVA 2W1HA 4O7YA 5T68A 4HPTE 5H8BA 2HOGA 1IG1A 4JOAA 5AP4A 1FVTA 2XK3A 4DC2A 2VX0A 3Q5ZA 3G15A 4EZ7A 5ETAA 1UKHA 3C9WA 3QQKA 3D7TB 4E20A 4EH9A 3UNZA 3L9LA 3KRLA 4ZJIA 2WMXA 2XM8A 3FLSA 3QTIA 2XM9A 4AT4A 5BNJA 4I6FA 4ZMEA 1VR2A 2C5OA 4XCUA 4GK2A 4L3PA 5F1ZA 4QMUA 5LARA 3VWAA 4CT1A 4KIPA 5TOZA 3W8LA 4XLIA 3F5GA 3DBDA 3IOKA 4QMSA 4MCVA 3ZC5A 2PUIA 5HESA 2WPAA 5J5SA 4RC2A 3O71A 3NUYA 3ZRKA 5EW9A 1CMKE 3R8ZA 4ANMA 2J9MA 2W99B 2VWVA 2JKQA 3ETAA 4U3YA 4YZDA 2XZSA 3TV7A 3VF8A 5HG8A 2OLCA 4O7SA 3FI4A 4YTFA 4U97A 2ZM4A 4FL3A 5AV3A 4AUAA 4X21A 2Y6OA 4AZSA 3QQGA 3MH1A 3OWLA 4KSPA 4S34A 2QLQA 2IVUA 2ZAZA 4G1WA 4RVMA 4XV9A 4JLCA 3TJDA 3W8QA 5LVOA 3OBGA 1CKIA 3U6JA 3SKCA 3TNWA 2PZPA 4AGUA 2V55A 1BUHA 2ITZA 3NEWA 2ONLC 5DRBA 4BDGA 2ITQA 4JAIA 5HE1A 4AA0A 4WRGA 4D2SA 1OMWA 3C51A 5AR8A 3FPQA 4RJ6A 5CXZA 4BDKA 5CVGA 3LFDA 3GFEA 3SDJA 1J1CA 4PP7A 1PMUA 5L8KA 3ZM9A 4JR7A 3QGWA 4UMQA 3ORNA 2Z7QA 3LFFA 3VO3A 4QP7A 5IEVA 2OIDA 5GJDA 5LWMA 4LV8A 5HBEA 2RFEA 5LMKC 2GU8A 4APPA 2BRHA 3QQHA 4AW5A 4F64A 3Q52A 4M3QA 5FM2A 4YU2A 5HLNA 4Q5EA 4DFXE 2VO7A 3CY3A 1ZYJA 4FZAB 3TZ9A 2OG8A 4FYNA 3ZSGA 3ATTA 3CXWA 5EW8A 2HW7A 5GJFA 3SG9A 4Z7GA 3O0GA 3PVBA 3ZUUA 3C0IA 3I79A 4LL5A 4X2NA 5I3OA 5CF5A 4BY9E 5EM5A 3L8VA 3ORLA 4P5QA 3F7ZA 3R7GA 4W8EA 1HCKA 5DT3A 4EC9A 5FD2A 5C26A 4ZLZA 5IDPA 3ODYX 2UW7A 5FTGA 4YLLA 2X9FA 4XRJA 3VUGA 4CFNA 2YIXA 1XH5A 4C62A 2XJ1A 4ALUA 2VWWA 3D5VA 3BLHA 4RSSA 3TZ7A 2Z7RA 3DK7A 3N4UA 1O6LA 5CQUA 4UEUA 3RINA 2FSTX 2F4JA 4FT9A 4U5JA 3NUAA 5C8MA 4BWKA 3HEGA 5AJQA 3MW1A 2C3KA 1URWA 3IPHA 4AACA 5K5XA 4NEUA 3FEGA 4K2RA 3DAKA 2OWBA 4RA4A 4IVAA 2GPHA 3F82A 4GYIA 2GHMA 3P0MA 2X6DA 3FC2A 2XNBA 2ITXA 4FKTA 4HGLA 3SXRA 3U55A 4QMPA 2HWPA 3OCSA 4PPCA 2HZ0A 1K2PA 5HG9A 2G2HA 2WTDA 4D9UA 2DWBA 5ETFA 4M15A 4C3PA 3QTSA 2GQSA 1UVRA 2WMTA 4FTQA 1NVRA 1CM8A 3PY0A 5JSMA 4N4SA 1OUYA 1STCE 4FKWA 4QNAA 3NW7A 3LIJA 4BHNA 3NYVA 5KNJA 2W17A 4BZOA 3QU0A 3VUHA 2QR7A 2YACA 4YNOA 4USDA 3S2PA 2WTCA 2GSFA 3R00A 3ALNA 4QMYA 4PMTA 2WGJA 4L43A 2C5YA 4QP1A 3G6HA 3RK9A 1VZOA 2WQNA 4XG3A 3KEXA 2QNJA 2X39A 3O23A 4JQ8A 4KWPA 5A4CA 4TYEA 3KGAA 4EK4A 3TNQB 1Y57A 4D55A 4KB8A 1NA7A 1FGIA 3FXXA 3TNHA 3S4QA 2YJSA 3A7IA 4RWIA 4BCJA 1OKZA 2YDKA 2UZEA 3KVWA 2YAKA 5CNNA 3VS6A 5IA3A 2PUUA 1GZ8A 2OF4A 5A4QA 4MHAA 2IG7A 3CJGA 1UU9A 2FSOX 4H36A 3OCBA 3UG1A 4NTSA 4F0IA 1Y6BA 4CG9A 3PIZA 1OL7A 4KUJA 3K3IA 5E8TA 3ZO2A 2C69A 3JXWA 1PMNA 3R1QA 4DBNA 3QCQA 1G5SA 2ZV9A 5C27A 3P23A 3ZXTA 4BBEA 4O1PA 1U46A 3WBLA 5HU9A 4BTKA 2V22A 4NJ3A 3OF0A 4BIEA 3KREA 3KULA 3POOA 1YI6A 2ETRA 4ZK5A 3MA6A 3ROYA 4C4FA 2I0YA 2X4FA 4O81A 3VIDA 4DBXA 4EH8A 3GNIB 4L9IA 5CU3A 5EFQA 5CASA 3DLZA 4EORA 5CALA 4KSQA 3UP7A 1KWPA 4D2PA 5CF6A 2HXLA 5I5ZA 5AM6A 3U6IA 2WQBA 4TYGA 1TQMA 1OM1A 1XBAA 4YTIA 1FMOE 4HZSA 1XH7A 3KRXA 4GG5A 4EI4A 1ZOGA 4I5HA 1WFCA 5AP2A 3FSFA 3I5ZA 2B9HA 3DXPA 4R6VA 4TYHB 3RALA 4HNIA 3ZS5A 2QI8A 3FMHA 1OECA 1H0VA 4ZTSA 5IQIA 1GIHA 5CU6A 1OL1A 4IC8A 4MD9E 3OHTA 3RMFA 4XUFA 4DA5A 4I93A 5IU2A 4X3JA 2QOBA 4C4GA 1XR1A 5DR9A 3PRIA 4O7VA 3FZSA 2YITA 2VWBA 4IFCA 4JNWA 3PYYA 2XJ0A 4R8QA 4BGQA 1PXNA 3HZTA 5CAOA 3BYMA 3WZEA 5A6NA 2VO3A 3R7UA 2W7XA 2JIVA 4GW8A 3MI9A 1DI9A 1GY3A 1WBNA 5ETCA 5FG8A 4RIXA 4E7WA 5KHXA 4R7BA 2GHLA 3PPJA 4O7NA 4PDYA 5KE0A 4FNZA 1BX6A 4Q9ZA 3CEKA 2OZAB 4GL9A 4EH7A 3AC4A 4AGDA 2WHBA 1NVQA 2RGPA 5GZAA 4CYIA 4AU8A 5M4IA 4RBLA 1WBOA 3BCEA 4ASXA 4F09A 2VTMA 3WZUA 5AEPA 2OI4X 2VGOA 3K5VA 3OY3A 5CSPA 3KXGA 4H3QA 5HO8A 2R3MA 4F9YA 4ZXTA 1PY5A 5C03A 5HTIA 2RG6A 5KMIA 3EN4A 5BVWA 5FEQA 3V6SA 5KMKA 4V05A 4UMPA 5A54A 4OAUC 3SV0A 3HV5A 2UZTA 1YXVA 5DGZA 2A27A 4A9YA 2PVJA 3F6XA 3GENA 3GC9A 2UW3A 1FQ1B 1KV1A 4F1TA 2QHNA 3FMNA 3ERKA 3LOKA 3IW8A 2X8DA 1O9UA 4OUCA 5HBHA 1GJOA 3VQHA 3FYKX 4U3ZA 1BLXA 4MYGA 3RNYA 2XBAA 4AT3A 3LE6A 4FSTA 5D41A 2XNGA 2F2UA 2AC3A 2C6OA 2WNTA 4YHFA 3UIUA 2BRMA 4D2TA 3LAUA 1JKSA 1Y8YA 2WU7A 5C8KA 2C5NA 3ZC6A 1OPJA 2J5FA 4EHGA 3QRIA 5IUGA 3DA6A 3SQQA 3LM5A 4I4FA 2BALA 3QTUA 5BVEA 4LOQA 4DHFA 2OJJA 2R7IA 1H27A 4QPMA 3ZLXA 3R7EA 4CD0A 4IJPA 5CQWA 3CC6A 3E64A 4N70A 4ARKA 1P14A 5E8VA 2XNMA 4ANSA 3TI1A 1GAGA 2WIPA 3R22A 2WMBA 3SW7A 3SAYA 4DEEA 4V0GA 2C0OA 3BKBA 4EUTA 3C13A 3IS5A 2CCHA 4L6QA 4F9BA 4ZY4A 3W16A 4IX3A 4YC6A 2G2IA 4OTWA 2X8IA 4GK4A 4AGCA 3QXOA 4M67A 3HP2A 3JY0A 4E1ZA 3ZRMA 4C36A 4ZSAA 2CJMA 4ZLYA 5J9YA 4WBOA 2IZRA 3VNTA 5DN3A 3SRVA 4BCQA 4OTHA 5F20A 4OTPA 1E1XA 3TJCA 3OOMA 5CANA 5IDNA 4QT1A 4NWMA 3MIYA 4JVGA 4M69B 3QRTA 2UZOA 3G0FA 4MXOA 1WMKA 3IW6A 3UQFA 2XYUA 3PPKA 4KS7A 2OSCA 3M11A 4D5KA 4S33A 4OTIA 3F5XA 3P7BA 4W4XA 3BYSA 4QTAA 4RVLA 4EQCA 3UYSA 2WFYA 3FXWA 2F49A 1QPJA 2JDVA 4A9RA 4HGSA 5M07A 2R0UA 3LFEA 4GK3A 3UP2A 3DDPA 5JKGA 5EKNA 4WUAA 1YOLA 3A8XA 1ZY4A 5FRIA 2Z02A 3HA6A 4L52A 1UKIA 3BV2A 3DFCB 2VRXA 3ZCLA 3P4KA 3NPCA 3VAPA 1ZAOA 2WMQA 1CSNA 3RVGA 5DR2A 2JKKA 4FSZA 4BDJA 4JAJA 5AIKA 5HNBA 3PIXA 3WIKA 2B9FA 3K2LA 3QZHA 4TN6A 3T8OA 4IX4A 4KKGA 5EG3A 3UO5A 1IA9A 1WCCA 2XYNA 2GCDA 3AC1A 4GT4A 5ANEA 3RCDA 2QOQA 2UZBA 2HZNA 2CGVA 3HLLA 5J5TA 5EKOA 5BVOA 4B8MA 2W1FA 4KRDA 2UUEA 1KE9A 3RK5A 3O8UA 2J0KA 5HTBA 3AC2A 4AW1A 3H0YA 2QU5A 1XWSA 2XJ2A 3KU2A 4XG2A 2I6LA 2OU7A 5DEWA 4QTBA 4RIOA 3DTCA 4C3RA 4E73A 4EYJA 2XA4A 3MVLA 4FSMA 4IAKA 4BCHA 3UOKA 4IIRA 2WZJA 1OKWA 2Z60A 3PVWA 2W4KA 4OT6A 5AWMA 1TQPA 4FV1A 4K77A 4LQMA 4CKIA 2OGVA 3EYHA 2YIYA 3OY1A 3SOCA 4YJUA 2C0IA 3VS0A 4F1OA 1M2PA 1L3RE 2GTMA 4OTRA 4Y5HA 3AGLA 3ZH8A 3EH9A 3MJ1A 3VUTA 5GZ8A 5FUTA 1RJBA 4M12A 5J9ZA 3KQ7A 1QCFA 3OEZA 5J7HA 5F94A 4KA3A 5AP3A 5FTQA 2BZHB 3D2KA 2C6LA 1Q8ZA 3FKOA 3PVGA 4J95A 4LV5A 3REPA 3RJCA 3WE4A 3N4VA 4AA4A 5ANOA 3F2NA 4YJNA 3ATSA 2WO6A 2CMWA 4FF8A 3CJFA 1O6KA 3W33A 4F1MA 1WZYA 4EK3A 5JN2A 4YHTA 4L3LA 4BDAA 3WYYA 4LRMA 4U7ZA 2JBOA 3V5PA 3Q2JA 4QYGA 2W1GA 3GC8A 4XX9A 3QA0A 3GU8A 3VBQA 4YBKA 3DB6A 3EQHA 4EH5A 3AC3A 1APME 4O86A 4UZHA 1Q3WA 5TKDA 4G5JA 1TVOA 3MA3A 3ZSHA 4JRNA 2OICA 4CZUA 3NYXA 4LMNA 4OR5A 4BGHA 4JDIA 4MNEB 4BCFA 1VYZA 3RAIA 2YWPA 5L3AA 3HMPA 4XV2A 4DEHA 3FE3A 2PHKA 5L2QA 5K5NA 2ZM3A 3RZFA 5TF9A 1E9HA 3PXKA 3ULZA 5DA3A 3LZBA 2QG5A 5K0KA 4UZDA 4E5WA 5FLFA 2BRBA 5J87A 2EB3A 2EB2A 4IANA 4C33A 2YAAA 5CU4A 4XNEA 5IQDA 3P79A 1KUTA 4HVSA 2W1IA 5CEMA 5IA5A 2OJIA 3R9HA 3QCYA 4I41A 2YHVA 3KMWA 3T9TA 5M56A 3ZFYA 2BZJA 5DI1A 2UVXA 5EYKA 5KBRA 4NL0A 2OFUA 4IAYA 1K3AA 4M84A 4R7IA 2CGUA 2IWIA 4FTRA 4AFJA 5AADA 5JRSA 2PVKA 4LRKA 4AF3A 3FI3A 1YDSE 4YJRA 2BDFA 2HZ4A 2RIOA 3WOWA 2GS7A 2ZV7A 2BUJA 4U81A 1OPKA 2GNFA 4XP2A 4IB0A 4JQ7A 4DINA 1YHVA 4I1ZA 5HIBA 5M4FA 4FTCA 5GHVA 3EQIA 3ORPA 4JBQA 3IOPA 3IDPA 3RWQA 3KN6A 4B6LA 4C59A 3OUNB 3DGKA 1H28A 4FT0A 3UO4A 2C47A 4EBWA 2OW3A 2W5HA 4JX7A 3TXOA 4ASDA 3R9OA 3DJ7A 4B9DA 2VX3A 3ZHPC 4HVHA 5I9YA 2A0CX 3QKKA 2GNHA 3MBLA 1JKTA 1Z57A 3HUBA 2HZIA 2F7XE 3NUSA 3O17A 5I9ZA 2C3LA 3OTUA 1JBPE 1OIYA 1U59A 2RFSA 3BHYA 4WT6A 5LQFA 4KIKB 3UC4A 1DI8A 2BAKA 3V51A 1WBTA 5BMMA 4BDCA 4Z3VA 3P9JA 3VC4A 2XNPA 3CE3A 3OUKA 4D58A 5IQFA 3T3VA 5HGIA 4BVUA 1W83A 4PTEA 4ID7A 3FDNA 1ZOHA 4CFMA 2GMXA 3F2AA 4YPSA 2QO7A 1BL6A 3GEQA 3I1AA 2O0UA 5BX0A 3BHUA 4E6CA 3BQRA 3BU3A 2CN5A 3HA8A 1H0WA 5JGBA 5L6OA 5HIEA 1M17A 3C4ZA 4QTEA 1WVXA 4GU6A 4PQNA 2B55A 2QCSA 1YW2A 3QQUA 4O27B 5KMOA 4FKVA 2Y4IC 2DQ7X 2HYYA 2HK5A 4FIEA 5JMSA 4L68A 4F70A 5HE3A 5EQEA 4XV1A 5FEDA 4F6UA 3F3TA 3PJ2A 4FEXA 3JVRA 5CSHA 2CGXA 3Q5IA 1P4FA 3E92A 5J1VA 5CSXA 4B99A 4RFMA 4WUNA 2QONA 3E7VA 3HV6A 1PXIA 3S95A 5AUTA 3SC1A 2XK7A 3WF5A 5HOAA 2XIYA 2WOTA 4O7ZA 3R73A 4GKHA 5DWRA 1CDKA 3UIXA 4FUXA 3BRBA 4UV0A 2GQRA 4R77A 4EKKA 4C35A 1YHSA 4K6ZA 2RKUA 2ITUA 1URCA 3A99A 3KN5A 4CV9A 4ZY5A 1Y6AA 2X2LA 3UJGA 2UW9A 3FSKA 4GSBA 4M0ZA 4AP7A 2BTRA 4JX3A 1DM2A 3B8QA 2PZRA 4J98A 4GT5A 5M44A 3VHEA 3UE4A 3AGMA 3GOKA 2QKWB 3S3IA 2V5QA 1FPUA 3KKVA 4O84A 2OF2A 4LOPA 5DLSA 5ACKA 3BWFA 2PULA 5HG7A 3KXZA 4GVAA 4NCTC 3KVXA 3VF9A 2R3PA 3DJ5A 3IECA 2WEIA 4F0GA 5DH3A 5BVNA 4GIIA 3MV5A 4MQ1A 4DFUA 2I0VA 3Q6UA 5CWZA 4MWIA 3LVPA 3V5QA 5C1QB 2Q0BA 2WTIA 4ZSGA 3FAAA 3ROCA 4F65A 1IRKA 4CFUA 3BGZA 4IVBA 2HENA 3A2CA 2PVNA 4EEVA 1REJA 2XIZA 4B8LA 4GUBA 2XKCA 2IZTA 3VRYA 3MPTA 1WAKA 2ZMDA 3L1SA 3N51A 3H9RA 4XG4A 5E8YA 4FKOA 2W5AA 4OAVB 4ERKA 1IR3A 2O65A 3VS2A 2PZ5A 2BIKB 4PWNA 4P90A 5HVKA 1A48A 5LCKA 2WTVA 4IX6A 3GU5A 5E9EA 3CIKA 4JDHA 4BHZA 2PUPA 3HUCA 4U0IA 4JRVA 4L42A 4JJRA 1OKYA 4BKJA 2UZUE 3E8CA 5JQ8A 4UX9A 3MIAA 4CXAA 3FMMA 3QKMA 4R3RA 2NO3A 3AQVA 3QTRA 4TKSA 4ZTMA 3F3VA 4BI0A 5JGAA 5H8EA 5JZNA 2PYWA 1S9IA 3RHKA 4AX8A 3UC3A 4APCA 1H4LA 3FYJX 1YOJA 5A4TA 3BWJA 4RIWA 3FC1X 3U87A 3R7YA 2P33A 3GCSA 3UTOA 4UMRA 3Q96A 4BBMA 1PXPA 3FXZA 4BTFA 4FTIA 5L4QA 4JL9A 4FT3A 2YEXA 2YN8A 3LHJA 4XBUA 4F08A 1ZARA 2WMWA 4CNHA 4I0TA 2JDSA 2ZM1A 3Q2MA 5DR6A 1F0QA 4IVDA 4ACDA 2XH5A 2OXXA 1BMKA 4EQUA 4K8AA 3G9NA 5BVDA 4GT3A 4PMMA 1UU3A 5J9LA 3MVHA 1CTPE 3ZM4A 1K9AA 4I6QA 2EXMA 4FVPA 3FQSA 5DFPA 3R71A 4FKSA 5HCZA 2J0LA 4FL2A 3PIYA 5F95A 2C30A 1H26A 3T3UA 2WELA 4ZIMA 3WF9A 2BZIB 4IB1A 3QLGA 4RRVA 3KB7A 5E91A 4E4MA 3D7TA 3SX9A 4B7TA 1NT2A 4IEBA 5D9HA 3TV4A 4UBAA 4QYYA 2YIRA 3D9VA 3MY5A 2G1TA 2HWOA 4DYMA 4EL9A 3TV6A 3DKOA 4DT9A 2OIQA 3M42A 4GU9A 2X6EA 4DT8A 1OBDA 3SHEA 3LLTA 5IA2A 1WVWA 1ZZ2A 2Y8OA 2GHGA 2IJMA 4FNXA 3A7FA 4UWYA 4NIFB 4AE9A 3EQBA 2IW8A 2PMOX 3PXRA 5CAUA 3UOLA 1O6YA 2E9VA 3OROA 2X81A 1OZ1A 4ZS4A 2DS1A 4UALA 1W8CA 2YABA 4NZWB 1J7LA 4PPBA 3AXWA 3OXZA 3GU7A 4MNFA 3F5UA 2IZSA 3EZRA 4JG7A 4KIOA 4YJQA 3Q4ZA 1OPLA 2R64A 2W9ZB 3PPZA 5E7RA 3ZU7A 2ZB0A 4RFZA 4LMUA 4YJPA 2PE0A 5HCXA 1U54B 3PZHA 4ITJA 1M7NA 3TUBA 2YIQA 3E62A 2C4GA 3QTQA 3EFWA 3EYGA 4U40A 4O91A 5EI6A 4MBJA 1DS5A 3H3CA 1IA8A 4B0GA 2UZNA 4RJ5A 4TXCA 4MKCA 2WIHA 3QHWA 4FG8A 5HG5A 4G17A 1IAHA 4E6DA 3KRJA 2WOUA 5K4JA 5AUZA 3D2IA 2HCKA 3FI2A 3FHIA 4LOOA 3RCJA 2JLDA 3NUXA 4XHKB 4HYHA 3VUMA 4QP3A 5E8ZA 5H3QA 1R39A 4I6HA 1G8AA 4YJOA 4HCUA 3CQEA 4FSQA 3L8PA 4FOCA 2LGCA 2XF0A 2W06A 5CZHA 4RIYB 4FKPA 4IFGA 4UXQA 4XLVA 5HVJA 3G33A 3PJ8A 1UU8A 2PVLA 4G6OA 5CS6A 5HU3A 3HAVA 2Y4IB 3BPRA 4QRCA 3EZVA 4GH2A 3HV3A 4U80A 4CQEA 2P3GX 5AP7A 4IMYA 4CCUA 2G9XA 4FR4A 3ZRLA 2FVDA 1M2QA 5JQ5A 3R2YA 4GKIA 4FBXA 2W4OA 3R2BA 3DU8A 2J4ZA 4M7IA 1YI4A 3RPRA 3QUPA 4CFVA 2PUNA 3DZOA 1JSVA 3UBDA 2C0TA 3S0OA 3COKA 4WNOA 1KOBA 3DT1A 3C4EA 4YNEA 3NDMA 4YPDA 4JBVA 2QVSE 5DEYA 3LCOA 4MXYA 3V8SA 4MF1A 2P2HA 3EQRA 3QTXA 2W1CA 4J8MA 5CTPA 1NXKA 3D4QA 1Q99A 3EWHA 4RX5A 3HECA 2XCHA 5KZ0A 4UN0C 5T6KA 4EWQA 2J2IB 1ND4A 3VJOA 2RFNA 4H1MA 4C61A 4AZWA 2CNUA 1H08A 2VTRA 3PY1A 4IB5A 3NVKI 4CLJA 2GFSA 4O7RA 1KV2A 3F66A 4E4NA 3PJ3A 4FGRA 3N4TA 3F7WA 5IH4A 4Y83A 3TZ8A 2XKDA 4G5PA 3DBFA 4L00A 4O21A 4PRJA 4R5YA 4RMZA 4XP0A 4ZTRA 5JGDA 4L44A 1PW2A 3B2WA 1YWRA 1LR4A 1QPDA 2B7AA 4M97A 1P5EA 3LQ8A 4MBLA 2X7FA 4NK9A 4IAAA 4J97A 4DCEA 4C58A 5KMJA 1JSTA 3DOGA 3P7CA 2BR1A 1TQIA 2R2PA 3QTWA 2V62A 3AT2A 4FEVA 4PP9A 3F69A 3LMHA 5BQ0A 2YM7A 4ALVA 3PTGA 2HELA 3IO7A 4FK6A 4ZSEA 3KA0A 3W55A 4J99A 2XUUA 4C4IA 3R01A 4FEQA 3KF7A 4YO4A 5DOSA 3CD8A 2GNIA 5A46A 1P4OA 2CNQA 2HY0A 4BTMA 3QRUA 2PE1A 2W4JA 5IF1A 4FODA 5DBXA 2XNNA 3OEFX 4MWHA 4JBOA 3V6RA 3EFLA 3H0ZA 4X2FA 1LUFA 2ITYA 2VUWA 4FC0A 5JFXA 3O2MA 3LJ2A 4S32A 5LOHA 5HZNA 4DGNA 3ZDIA 5GJGA 3R83A 3DTWA 5EM6A 5H9BA 3P78A 4FSWA 3VULA 4KBCA 3KL8A 2QHMA 2W1EA 4I5CA 3FLNC 4AQCA 2YWVA 1XBCA 1ZXEA 3R1SA 4EHZA 3E3PA 2BZKB 4F9CA 5L2WA 3HVCA 4OLIA 3R0TA 4DH3A 1KE5A 4CZYB 3SOAA 5M4UA 4TWNA 4DGGA 3PSDA 3MS9A 4EK8A 3LFSA 4YSJA 3DKFA 4JQEA 5EH0A 3NCZA 2Y6MA 4C3FA 4CMOA 4ANBA 1FVRA 5IH5A 4AN3A 4HVDA 3HKOA 5I0BA 2J7TA 3BBTB 3CS9A 2BRNA 5HHWA 2ZYBA 3O8PA 2PMNX 2YM5A 1SNUA 3CTJA 4O0XA 5HNGA 4X6QC 2ACXA 4IM0A 3W1FA 4XH6A 4IZ7A 1FGKA 1TKIA 1MRVA 4IACA 1OIRA 2CKEA 5CX9A 3FMKA 4QMNA 3HL7A 4AW0A 5M09A 3WYXA 4TW9A 4OW8A 5EHOA 5KO1A 4TYHA 3PXZA 4EH2A 3Q4UA 2CSNA 4IXPA 2E9PA 4J53A 4XS2A 4USFA 1R0EA 3R7VA 1OL5A 3RGFA 2H6DA 2ZOQA 3BE9A 1DAWA 3PA4A 4RQVA 1UU7A 1J91A 4IQ6A 5IH6A 2H8HA 3G5DA 4GJ2A 1RW8A 4MD8E 3KMMA 1JAMA 2YM6A 4C0TA 4D0WA 2VO0A 1XH8A 4CTCA 4KABA 1V1KA 4GV1A 3OP5A 4JR3A 1OB3A 3Q3BA 1OVEA 2PPQA 3CCNA 3R30A 2OZAA 3DNDA 4W9WA 4AZVA 2FH9A 3MFUA 3FLQA 4WNKA 3UVQA 3ZO3A 2KTYA 3A7HA 2V7OA 5IA1A 2R3NA 2R3IA 3GCVA 4QMQA 5AUWA 3ODZX 4RJ4A 3JY9A 4G9RA 2ONLA 1WBPA 4LI5A 4NSTA 5B2MA 5AX9A 3QFVA 3GT8A 3W10A 4I21A 2NRUA 3ZTXA 4ENXA 1PKDA 1MQBA 2WTWA 3NCGA 2DYLA 4IZ5A 5AR3A 2FSMX 2PMIA 3HRBA 1BKXA 5E8WA 3QF9A 3WILA 4CSVA 5HTCA 5KUPA 3Q9YA 3KCKA 4LG4A 3MWUA 3H30A 4A4OA 2Q0NA 4FGBA 5LMKA 2FUMA 2XNEA 4IAIA 5C8NA 3AMAA 3GGFA 5CLPA 4F6SA 2YM8A 1DAYA 4PDSA 1J7UA 2CHLA 1UA2A 3EKKA 2QD9A 4NT4A 5IISA 4DE4A 5BPYA 4UWBA 1NVSA 3D0EA 4XBRA 4G34A 3W2QA 4C38A 2JDOA 1LEZA 3SLSA 2VTNA 4TZRA 3TZMA 4ZY6A 4EKLA 4U44A 3PSCA 4U45A 1AGWA 2H96A 2YJRA 3LXLA 1ZMVA 3WI6A 1PF8A 3CKXA 4BL1A 4HOKA 3L8XA 4YHJA 4EOPA 3JVSA 3UPZA 3UYTA 3FQEA 1JWHA 1M14A 2P0CA 2IVTA 3GVUA 4IDVA 3PXYA 3RPOA 4X0MA 3FZRA 4KS8A 2QODA 3BIZA 3MPAA 2XNOA 4YP8A 3F2RA 4OTQA 2VWZA 5FEEA 4NM5A 4ZZOA 4MK0A 5ICPA 2ETKA 2IZUA 1Q97A 1QPEA 1YXUA 4WOVA 3U9CA 5BUJA 1RE8A 2R4BA 4YUQA 3SA0A 4W4VA 4L8MA 1YXTA 4ZJVA 3M1SA 1YXXA 5CXHA 3UNJA 5B7VA 3C0HA 3AG9A 5CVHA 3TDVA 4FYOA 4L01A 4A06A 4CKRA 1OKVA 3U4WA 4EK5A 2OBJA 3BV3A 4FKGA 2WMAA 4AG8A 4AN2A 4FV2A 4AAAA 3COIA 3I0OA 4ITIA 1OI9A 3PY3A 2QOKA 1JVPP 2F9GA 1MQ4A 3PWDA 4L53A 3FWQA 3COMA 3V8TA 3PSBA 4M69A 3UMWA 4YMJA 4MEDA 5K3YA 2F57A 4A7CA 3AC5A 4EOQA 3SGCA 4IAZA 3Q4CA 1YOMA 4NKAA 3AMYA 3E7OA 3ZLSA 5AP0A 5BMSA 2IPXA 2ZDUA 4LYNA 1ZLTA 3VS7A 5CAPA 2NRYA 5EYCA 1CKJA 1KE7A 3RWPA 4D1SA 2RG5A 3H4JA 4EH3A 4FV6A 3QYZA 2ESMA 3A61A 2CPKE 2YCRA 1Q41A 3I7BA 2SRCA 3BHVA 3LFNA 4Y73A 4RGJA 2EXEA 3FV8A 2XRWA 4WD5A 1OBGA 1PMEA 3DDQA 5L6PA 4A9SA 3CPCA 4BZNA 4DEBA 2GTNA 3AOXA 2WKMA 4YZNA 3G9LX 4C02A 3FL5A 3GOPA 4E4XA 1AQ1A 3G90X 4BYJA 2O2UA 3R21A 4E6AA 3W2CA 4DG2E 5AUUA 5FDPA 3FLWA 4NKSA 1OIQA 2I40A 3OCTA 2IW6A 3C0GA 4QD6A 4UY9A 2V7AA 4FG9A 4Y72A 1H1WA 5IQGA 2VWUA 2VTHA 4RX8A 2QR8A 4OTFA 4F7SA 4X7QA 3BGPA 3E93A 3SXSA 3QCXA 3E88A 2QOOA 3V5LA 3MVJA 4BFMA 1SYKA 4ANQA 1LEWA 2X4ZA 3GFWA 4FEWA 2CNVA 1R3CA 4X3FC 4G3CA 2FB8A 4D2VA 3FLYA 3QWJA 3LCDA 4KBAA 3C4CA 4GRBA 5AP1A 2NP8A 4D0XA 5AA8A 1E1VA 2BCJA 4BCPA 4QTCA 5AR4A 3BU5A 2JIIA 4G31A 3QTZA 4TNBA 3BHTA 3ZBXA 3R8UA 4A4LA 3ZLYA 1Q8WA 5HORA 4AZTA 1RQQA 3CKWA 3UVRA 4U41A 3RAKA 5AP6A 3PG3A 3PRFA 3QWKA 4I24A 5CEQA 4KNBA 3RKBA 2CGWA 3GXLA 1B6CB 3V3VA 2O5KA 2RFDA 4FVRA 3ZXZA 1QL6A 4YZ9A 4IJ9A 3ZZEA 1H24A 4NH1A 2QLUA 4IWPA 3WARA 3PP1A 3FLZA 4D9TA 4U43A 4ORKA 3M2WA 2VTPA 2VN9A 3RBWA 1ZRZA 3DAEA 5A3XA 4R1YA 4WA9A 2P2IA 4J8NA 1I09A 4BCMA 4EOLA 5JZJA 2QC6A 5GNKA 2E2BA 5IQEA 3R8LA 2O8YA 3V04A 3A4OX 3BZ3A 3OVVA 3VUKA 4DTKA 3OXTA 5I9VA 5ACBC 3IONA 4QP4A 3MDYA 4Y8DA 2X2MA 2C5VA 4GEOA 2XEYA 4NFMA 1U4DA 2BILB 4WG4A 5ANJA 4H3BA 4I22A 4QMTA 1R0PA 4MNEA 3VBXA 4BB4A 3TUCA 4BR3A 3FL4A 3QD2B 3UOJA 5EI2A 4L7FA 3UODA 3BYVA 2X0GA 4CLIA 4R78A 4BDBA 2VO6A 5IA4A 1MUOA 4KBKA 3DKGA 3D15A 4MAOA 4RWJA 4OBOA 3DNEA 1JQHA 4FKIA 2JDTA 2J5EA 3FZPA 3Q9ZA 1QPCA 5D11A 3HMNA 3G6GA 3OC1A 3B8RA 3QX4A 3WZDA 5JFWA 4EOJA 5HX8A 3C5UA 1R78A 3ENMA 3LJ1A 3CD3A 3QZGA 3QD0A 4A4XA 3GUBA 1XHAA 2B54A 2PE2A 2O63A 5CSWA 4TY1A 4G6NA 4S2ZA 5F9EA 4D4VA 4XG7A 4BIBA 4EJ7A 2R0IA 4R1VA 4C4JA 3OW4A 3MH0A 4MD7E 4FTMA 4DFZE 4FTNA 1H1QA 1H25A 3KY2A 4CG8A 2JFMA 5L6WL 3R6XA 3MESA 1W7HA 3AD4A 4ZOGA 4D2RA 2FA2A 4FNYA 5IUHA 2YCQA 3FPMA 2BROA 3PP0A 3E5AA 3OOGA 3WZKA 4D4YA 4ACGA 4HVGA 4GUEA 3KF4A 4LGHA 3TM0A 1Q8UA 2GFCA 4G3DA 5EM7A 3ZFXA 4QYFA 3QD3A 5DNRA 4DH5A 2BPMA 1PHKA 2F7ZE 2C6DA 4FUYA 4KIKA 4YBJA 4I20A 5IQAA 3QZFA 2GS6A 2OK1A 5CEIA 4ZAUA 3EQFA 2YDJA 4D5HA 4FMQA 3PA5A 5HIDA 4I92A 4LUDA 3R7OA 3TNIA 2PWLA 5LJJA 1AD5A 3IQ7A 2IVSA 3E63A 3HV7A 4ANNA 3NAXA 3RP9A 4QYEA 3FZTA 4RX7A 2FGIA 3KRWA 2PK9A 4O0SA 3SG8A 3VVHA 4FTLA 4MQ2A 4WSYA 5A9UA 4JG8A 5EHYA 4PNKA 5TR6A 4IHPA 3RI1A 3SVVA 3PWYA 5E90A 3ORZA 5LVLA 3BU6A 4H3PA 5AAGA 3U51A 2WTKC 3R1YA 1Q24A 5L2TA 5LMBA 2FO0A 3ZLWA 5CF8A 2BRGA 3OD6X 5LWNA 5A4LA 4C7TA 4GIHA 4PL4A 2PU8A 3QA8A 4CCBA 1Q4LA 3CR0A 5FGKA 3G2FA 3VUIA 2W9FB 4FVQA 4L46A 5D7AA 4ZEGA 2QQ7A 3BBWA 3ORIA 2VAGA 4D1ZA 3NMUF 5EQYA 5JK3A 4EONA 4UWCA 2VX1A 3DFAA 3DY7A 2YZLA 4D28A 4PMSA 2R3QA 3VS4A 4XRLA 1REKA 2HY81 2W0JA 4FSYA 3VHKA 4F9WA 4C2VA 3CBLA 4DN5A 2GNLA 1H1SA 2CLQA 5B0XA 4FTTA 3I4BA 4RZWA 2JIUA 2GQGA 2ZVAA 2PY3A 1PKGA 4FTJA 4HYSA 3MTFA 2QU6A 4XG8A 5GZ9A 4CRSA 2ZB1A 5C4LA 5KMMA 4FIJA 4YR8A 4GFGA 4I5PA 4DGLC 3UOHA 3QQLA 4NTTA 4B4LA 2YM3A 4ALWA 1HOWA 3BX5A 4I0SA 3W2SA 2VGPA 3PVUA 4PL3A 3ALOA 2AUHA 3FI8A 5KX8A 5CEOA 3Q9XA 5AV4A 2XVDA 4CV8A 2CKQA 3CTHA 4Z9LA 3CQWA 4ZTLA 1MP8A 4E3CA 3HAMA 2PVHA 4EOOA 3FUPA 2IN6A 5J7BA 2X9EA 1YDTE 3ACKA 5TE0A 3V8WA 4H05A 5DT4A 3RAWA 3BGQA 3ID6C 2F2CB 3NSZA 1S9JA 2C6EA 3DK6A 4ZSLA 4BCIA 2QKRA 4Q2AA 3ITZA 5K4IA 1KE8A 1V0BA 3OW3A 4DH8A 3KXHA 1Z5MA 3P86A 4FK3A 5M06A 2JAMA 4P2KA 4F99A 4X3FB 3PZEA 2A19B 3B2TA 3EIDA 4NW6A 4W4WA 2VTAA 4TPTA 3ANQA 4KINA 3FMEA 2J50A 3DAJA 4WBBB 3DPKA 4J71A 5DPVA 1W84A 4CVAA 2BVAA 3TKIA 4O38A 4OBQA 4O83A 3JPVA 3D5WA 5DRDA 4YURA 3CSVA 1W98A 3U8WA 2WB8A 5FQDC 1ATPE 3C5IA 4FV5A 3FBVA 3ACJA 2B53A 3IDBA 3VBYA 2JBPA 4QP9A 4D2WA 3MH2A 3VJNA 3VN9A 2C1BA 1W0XC 3OT3A 4QQTA 3U9NA 5I9WA 4F7NA 2C68A 4IWOA 3GI3A 3P7AA 4PNIA 4QP2A 2FSLX 2WQEA 4A9TA 3O7LB 2XIRA 5A4EA 4EWHA 4C37A 2VNWA 3IW5A 3QLFA 3MTLA
chains in the Genus database with same CATH superfamily
3Q60A 5ANGA 4WKQA 3GC7A 5FXQA 4FV7A 3TACA 4X2GA 4QO9A 3DKCA 3HP5A 3QL8A 5CT0A 4HW7A 5M51A 4R3CA 4P7EA 2PVFA 2UW5A 3QC9A 2XKEA 5E1SA 1IASA 2BDWA 4DEAA 1GOLA 3A7GA 2E9UA 4TRLA 2OXYA 4DFNA 1XBBA 2J51A 4WRSA 5BYYA 4UMUA 2W05A 2IW9A 3PFYA 3PE2A 4XG6A 3FY0A 4IWDA 3UVPA 4XOYA 5GIOE 3HRCA 4FICA 2XB7A 2NPQA 3QUEA 4V04A 3MPMA 3JUHA 1F5QA 3W32A 5CSVA 3T9IA 4FTKA 4DH1A 2AC5A 3MVMA 4O0UA 4GCJA 2VTSA 4O1OA 4NM0A 3LCSA 3GB2A 5EI8A 3KK9A 4HCTA 3HMMA 3PE1A 4W8DA 5L2SA 1IAJA 1OL6A 3LQ5A 4U8ZA 4CQGA 4CZTA 5BUEA 2BHHA 3CGFA 2R5TA 2B52A 5FBOA 2VTQA 4NIFA 2OFVA 3EOCA 2C5XA 3MN3A 3R28A 4G3EA 4BBFA 3BELA 4EH4A 5HEZA 4Z7HA 2C3IB 3S00A 4NM3A 2VV9A 2W1DA 5FXSA 5M55A 3RPYA 4O2PA 4BDHA 4DH7A 4FSUA 4FZDB 3EQPA 4ACCA 4FKRA 5J8IA 3EN9A 1FOTA 2X2KA 4U9AA 4FA2A 4CKJA 4XG9A 2QO2A 4HZRA 4IADA 3ORTA 3OWPA 2BIYA 4HGEA 5I3RA 4OTDA 4E26A 3F3WA 4XJ0A 3UIBA 1FBNA 3DJ6A 4Z16A 4IB3A 1Q61A 1U54A 1PXOA 4I23A 1VLRA 4XEYA 4C2WA 5D7VA 4F4PA 4FT5A 4Y85A 2OH4A 2R7BA 4M0YA 3DXNA 3V01A 4M68A 3RM6A 4ANOA 1NY3A 2ERKA 2Y9QA 3I5NA 3I6WA 1PRYA 1SVHA 2ITVA 4EOSA 4AN9A 3CTQA 3R8VA 4G16A 3VUDA 3GCPA 4A9UA 5A6OA 4K11A 1Y91A 4FV3A 3R1NA 4QNYA 3PXFA 4R5SA 3TKUA 3DLSA 5JEBA 4EOIA 4NM7A 4JDKA 4TYIA 3KXMA 3KFAA 3ET7A 2ZV2A 2YERA 2YISA 4GMYA 3NIEA 3W2OA 3OCGA 4G3GA 5JH6A 4YJSA 2B9JA 3QCSA 1R1WA 3E3BX 5JT2A 5LCJA 2ZV8A 5JFVA 3DBQA 4YO6A 2BFXA 5IUIA 3TEIA 4BCOA 3EQGA 4AGWA 1ZZLA 4GYGA 4IBMA 4RIYA 3VBWA 5JRQA 1PXMA 4QQ5A 2WTKB 4PF4A 4ERWA 2XKFA 3QAME 3IK3A 4BWPA 1T46A 3BYOA 4FKQA 1J3HA 1YHWA 3OT8A 2OJ9A 5D10A 5FP6A 1M7QA 2IVVA 5KMNA 3PFQA 3F5PA 3EFKA 3FKLA 3DCVA 3HX4A 1H8FA 4AW2A 3EL8A 2XK6A 5AIRA 4QMXA 2UVZA 2OJGA 2BAJA 1YDRE 2QOLA 2UZVA 3W2PA 4DITA 5BUIA 4RA5A 1JPAA 4TT7A 4EH6A 4DCAA 4NYEA 4BI2A 2QG7A 3SW4A 3Q53A 3Q6WA 4QMZA 2V0DA 2B4SB 4J96A 4CYJA 4F0FA 3GQLA 3GCQA 4YZBA 3OZ6A 3PUPA 1OITA 2ERZE 4FV4A 3UG2A 3UZPA 3W18A 3IKAA 3ZBFA 4MF0A 3MJ2A 3RHXA 4E8AA 4RT7A 3D83A 3NYOA 3QX2A 4ZP5A 4MVFA 5I9XA 4A07A 1SVEA 2WEVA 4HNFA 3ZUVA 4PDPA 5L2IA 2XK8A 4HJOA 1SM2A 5EDRA 4RVTA 4L45A 5EYDA 3R02A 4CGAA 3K54A 2XK9A 4O2ZA 3MFRA 5IEXA 4FEUA 4RJ3A 4V01A 2FYSA 5HVYA 3VRZA 5HCYA 2XANA 3DQWA 1YI3A 2R3GA 4FI1A 4AZEA 5J1WA 5IMEA 3QQFA 2CLXA 3DS6A 5HE0A 3HNGA 3QYWA 3DK3A 5AV0A 2PMLX 5C01A 2XS0A 4M14A 3N9XA 1GIJA 5BVKA 4NCTA 3MFTA 2WQMA 2CDZA 4G9CA 2W96B 2B0QA 4DFLA 4JS8A 3RM7A 5K9IA 5CZIA 2UW6A 5J95A 5E92A 5AA9A 1W82A 2CKPA 3H9FA 3AT3A 5HNIX 3OG7A 4BZDA 5HQ0A 5E8UA 2Y4PA 4Y95A 3NVMB 3CQUA 4FJVA 2VWXA 1UNLA 3EB0A 4AA5A 3A8WA 3F88A 5FBNC 3FMDA 4EOMA 5FP5A 3LFQA 3FZOA 3W2RA 5ITAA 4O0TA 1PXJA 5E1EA 1PYEA 4II5A 3O96A 3KULB 4OGRA 5AMNA 2J0MB 5L8JA 4LL0A 1ZY5A 4DEDA 2QOIA 2YCSA 4EBVA 5AUYA 5LXMA 1Z9XA 4NU1A 5KKRC 1J7IA 3COHA 3LCKA 3V5WA 4TTHB 5DIAA 3LQ3A 4UB7A 3MH3A 3HGKA 2B1PA 2I0HA 4NJDA 4ENYA 2UW4A 1KE6A 2VTJA 4TWOA 3TN8A 3TTJA 5M53A 4O7LA 3D14A 1VYWA 3LXPA 3ML1A 2PL0A 5EOLA 5FDXA 4IZAA 3ZFMA 4EC8A 2Q83A 3BEAA 1UWHA 4O0YA 4OT5A 3BEGA 3WE8A 4ASEA 3BLQA 4QPSA 3Q4TA 3ORKA 3QXPA 5C4KA 3D5UA 1VEBA 5BVFA 5TT7A 4FZ6A 2OO8X 4K1BA 3NX8A 4M13A 4E5BA 2OJFE 4JI9A 2X8EA 5CNOA 3O51A 4O0VA 3TDWA 5AV2A 5KMLA 3UO6A 4DG3E 1H1RA 4LV7A 3NW5A 2EXCX 3EKNA 4CFXA 5EQPA 4DLIA 3QHRA 2YLEA 3R04A 4EUUA 1L8TA 3AC8A 3L9NA 4DEIA 4IW0A 3OWKA 2EWAA 3TKHA 1GZNA 3LJ0A 4RIXB 4BTJA 3QKLA 3QZIA 2Z2WA 5E8XA 4ANLA 2OKRA 3ZSIA 3UMXA 4FIHA 1F3MC 1H01A 2BMCA 3RPVA 3LM0A 1G3NA 4QOXA 1RDQE 1Q8YA 5CU2A 4RFYA 4CT2A 3CGOA 2BDJA 4YJTA 3ZZWA 5KCVA 1IEPA 1PMVA 1P2AA 1UWJA 1SVGA 5HBJA 5TO8A 2A1AB 4QP8A 3SXFA 3C4XA 2YZAA 3ORXA 4GFOA 4G2FA 4CEGA 3E8DA 3ZO4A 1Q3DA 3ELJA 3DQXA 3GBZA 4D4RA 3JS2A 3I7CA 4GFMA 4MX9A 3V5JA 1PYXA 4UMTA 3A4PA 5LVMA 2VTTA 3UZTA 2YFXA 1T45A 2J0JA 2R3RA 3O8TA 5EW3A 2BFYA 4XP3A 5KZIA 4AT5A 4FTOA 3AKLA 4YZMA 4TL0A 4FG7A 3OBJA 4GJ3A 4YSMA 5D1JA 3MYGA 3UQGA 3E87A 4FL1A 2H34A 4AE6A 3OS3A 4K9YA 2ITOA 4FTUA 4IM3A 4ZTQA 4BN1A 1PJKA 1YQJA 5KHWA 5M08A 4KAOA 3IG7A 3TG1A 4ZLOA 3LFBA 3TT0A 4I94A 4FKLA 4AWIA 4ZTNA 4DGOA 1B39A 2GDOA 1UNHA 1YKRA 2HIWA 3E8EA 4RJ8A 3QGYA 4RX9A 5EDPA 1WBVA 4IAFA 2XK4A 5G6VA 4J1RA 5FXRA 2VTIA 4DAWA 3QQJA 4PV0A 2REIA 3WIGA 3O7LD 4DFYA 3UDTA 5HE2A 4DTAA 1ZOEA 3FHRA 3NNWA 2JKMA 1JKLA 4FE2A 2I0EA 2XIXA 4W9XA 4UYNA 3R8PA 1KSWA 2OZOA 3IGGA 3NS9A 4IH8A 3CPBA 1Q8TA 2ITWA 3AD5A 2UVYA 4S31A 3VS3A 1XJDA 4IM2A 3LLAA 4IX5A 4MXCA 2R9SA 4MTAA 4E5AX 2XRUA 4GG7A 4PY1A 4V0GB 4BIDA 4AOIA 1M2RA 3ZONA 4Y5QA 2YCFA 5E4HA 1YXSA 4BDFA 3LPBA 4AOJA 4H1JA 3DBEA 4EQMA 3NIZA 5G1XA 4QTDA 4Z55A 3I6UA 2WMRA 3NGAA 2QURA 4BCNA 4BDDA 3C4FA 4C57A 1HCLA 3SRVB 4RG0A 4O6EA 4RZVA 3LW0A 5AX3A 4CMUA 1U5RA 4H58A 2OH0E 3VBTA 3WF6A 1NW1A 1ZYCA 2E9OA 4LFIA 4EHEA 2A2AA 1X8BA 2WTJA 3UIMA 2XAOA 4ASZA 4K33A 3GU6A 3KXNA 4O0RA 3KC3A 3OMVA 3VBVA 3GP0A 4MH7A 1V0PA 5IZFA 4I0RA 1ZMWA 1ZYLA 4BICA 4E6QA 4ZZNA 5T3QA 3U6HA 2R3HA 2BTSA 4FTAA 3NAYA 4JXFA 3ZUTA 3U4UA 2XEZA 2YM4A 4FIFA 4S30A 4O6LA 2C6KA 2ITPA 3MGYA 4FOBA 4L67A 2WMVA 4D1XA 3A62A 3QALE 4QQCA 5I4NA 4TWPA 3RK7A 3C4WA 4X2JA 5AAEA 1B38A 3QC4A 3K3JA 5DVRA 3TUDA 2E9NA 2JD5A 4FSNA 4FT7A 3RZBA 4BDEA 5B2KA 5JFSA 4QPAA 3ZEPA 2ZDTA 3ZEWA 4F6WA 3ZOSA 2X7GA 3FKNA 3GU4A 3GCUA 3WF7A 2HAKA 4U42A 5M57A 3V5TA 4PUZA 2VZ6A 4DG0E 5IG1A 2RF9A 4HPUE 4H39A 2Z7SA 3R8MA 1OIUA 4QMMA 3BE2A 1JSUA 3BYUA 4W4YA 4NUSA 3DV3A 5EHLA 5EK7A 4O82A 3F3ZA 4MBIA 4RWKA 5AR2A 3UQCA 2LAVA 4ITHA 1XH9A 2Y7JA 1LPUA 4KD1A 2RL5A 3FMLA 5C9CA 4TWCA 1GIIA 3A60A 4YTHA 4AOTA 3C50A 4E93A 3EQDA 1XH6A 3UDBA 3HYHA 3Q9WA 3W0MA 4FNWA 4RLLA 4WNPA 1PXLA 3ULIA 4BDIA 3OTVA 1UV5A 2P55A 2R3LA 3HV4A 4YZCA 2F7EE 2UW0A 3EFJA 4RC3A 3QUDA 2C6MA 3OXIA 1KOAA 3EN5A 1OUKA 4X2KA 1ERKA 3EL7A 3VW6A 2OXDA 2W5BA 3IW4A 5HICA 4C4EA 4YTCA 5KKRB 2BAQA 5F4NA 4RJ7A 4EYMA 1QMZA 4Y46A 1W2FA 1YVJA 4HYUA 2WU6A 1G8SA 4N57A 1PXKA 2UZDA 3EHAA 1V0OA 2JEDA 4UXLA 1ZYDA 4YLKA 4PL5A 4C8BA 4J7BA 2Z8CA 4X6RA 3ANRA 2R3FA 3ENHA 5CEPA 1OGYA 1XKKA 3KXXA 4WNMA 2PVYA 5AUVA 3PJ1A 5H8GA 4CFWA 4GVJA 4R3PA 2YDIA 4QYHA 5AM7A 5AR7A 4L7SA 3NUNA 3W0QA 4GS6A 3DBCA 4BCGA 2JKOA 5BYLA 4HCVA 3E8NA 2CKOA 2XBJA 1GZKA 5IMXA 4I6BA 1ZWSA 1ZYSA 1JKKA 3IDCA 5HO6A 2WQOA 4EHVA 4ZJJA 3L9MA 3WZJA 3NNXA 2I7QA 3DB8A 4FV8A 4L3JA 4ACMA 5CY3A 4J52A 2VTLA 3L8SA 4ZTHA 3RAHA 3TIZA 5CAQA 4KRCA 4DEGA 2QOFA 3FY2A 4R7HA 3I0QA 3LCTA 3VQUA 3BLRA 3HDNA 4F7LA 4IC7A 4F63A 2KULA 3LXKA 4RPVA 4YC8A 3NZ0A 1VJYA 4I3ZA 5A14A 4P5ZA 4G6LA 4EJNA 3BHHA 2C6IA 2G15A 4FKUA 4N6YA 4CTBA 4O4BB 5AUXA 2BHEA 3NUUA 3Q32A 2EVAA 1H07A 5CEKA 3P5KA 2CCIA 4BKYA 3UGCA 2VTOA 3HRFA 3MB7A 3LMIA 3MFSA 4FKJA 2Z7LA 4LRJA 3TNPC 4F7JA 3NLBA 3QD4A 5L8LA 4EK6A 5HI2A 4USEA 2J6MA 4JIAA 5HO7A 5LMAA 2VNYA 3G0EA 4FIGA 1SMHA 1JNKA 4OTGA 3KRRA 1H1PA 3JR1A 2JITA 2QOCA 1MRUA 4UYAA 4XMOA 5LVPA 2VU3A 2VWYA 4IZYA 1M52A 2EU9A 4BF2A 4DFBA 5GINE 2Y0AA 2HW6A 3GC0A 4FV0A 4RVKA 2WAJA 3CLYA 3Q04A 3HMIA 2G01A 2DUVA 2ITNA 5EYMA 4CFFA 4I5MA 4WIHA 3IGOA 3PG1A 4YGAA 5HX6A 4PTGA 4YC3A 4BC6A 2G2FA 5IKWA 1OGUA 3KK8A 3K5UA 4HGTA 3TIYA 5IQCA 1JOWB 4EZ5A 3QBNA 4ONAA 2HXQA 2ZMCA 2WD1A 4XYFA 2PVRA 5EM8A 3CP9A 4WG3A 4EZ3A 2PZIA 5HLWA 4YLJA 4BCKA 4F9AA 3W0NA 3DZQA 5CAVA 1I44A 2JFLA 5J79A 3UNKA 3EMGA 3D94A 2PTKA 3II5A 2C1AA 3MB6A 4MXZA 4AFEA 3THBA 2WXVA 2XIKA 3AT4A 5HKMA 3R7IA 4DTBA 5GIPE 1BI7A 5CI6A 5AAFA 5IEYA 4BRXA 4HYIA 4RLKA 3ORMA 3AD6A 5M4CA 4U79A 3ZMMA 5IA0A 3EQCA 3QRJA 2QO9A 4PMPA 3G51A 2YA9A 3AMBA 3MY1A 3PA3A 4AZFA 5KBQA 3BLAA 3KMUA 3MY0A 3VW8A 5IQBA 5CT7A 4JMQA 4XV3A 4BI1A 5EOBA 2VWIA 5DE2A 4DLJA 4FZ7A 3QRKA 1BYGA 3NYNA 5ETIA 3RTPA 3R9RA 3D5XA 4DGMA 1XO2B 5CENA 5I9UA 3ZO1A 4ZMFA 2I1MA 2BKKA 1WVYA 2XMYA 3IW7A 5DMZA 1W2CA 4PDOA 2UW8A 4E4LA 4Q5HA 3F61A 4O22A 4TYJA 4WHZA 2H9VA 4KIQA 3EN6A 3P1AA 3FQHA 1UNGA 1WBWA 3LFAA 3C1XA 3PJCA 5IQHA 3NNUA 2NNWB 4KKEA 4WSQA 4YJVA 3FJQE 3C7QA 3I81A 4KKHA 3PLSA 3NRMA 5ANIA 4JBPA 5CVFA 4LGDA 3UPXA 1A9UA 3ZYAA 2PVMA 4C34A 4D4SA 2AYPA 4RWLA 1EH4A 3VS5A 3HMOA 3LKMA 2GS2A 1FVVA 3JYAA 2GNGA 3LFCA 4QQJA 4XOZA 1MRYA 4ZS0A 3UZRA 4JIKA 2OIBA 4FZFB 4JT3A 4OBPA 4ZZMA 1BL7A 2C3JA 2YIWA 5AP5A 5HLPA 1SNXA 3NW6A 4K0YA 2O64A 4AS0A 1Q62A 3TWJA 5AV1A 2JC6A 3SD0A 3OWJA 3MSSA 3TCPA 4QMLA 4IVCA 4LUEA 1U5QA 4FX3A 3NUPA 4RC4A 4PTCA 3NFGB 1A06A 2X7OA 3PXQA 5E8SA 5HD7A 4DF3A 1FMKA 1FINA 1XH4A 3OFMA 4BJJA 3LXNA 2J90A 5CI7A 5LVNA 4QMWA 3NWWA 5ANDA 3GQIA 3S1HA 2RSVA 2O3PA 1SZMA 3KCFA 3O50A 4FV9A 4N0SA 1YWNA 5FM3A 3PDTA 2ITTA 3FMJA 3P08A 2WMUA 3F9NA 3L9PA 1H00A 4BGGA 5BV3A 3R9NA 4JDJA 2QOHA 4Q9SA 2JGZA 5D12A 3F3UA 3LMGA 4HVIA 3ZDUA 3POZA 4TNDA 4CMTA 3R63A 4IE9A 4MXXA 5K0XA 1GNGA 1Y8GA 5H2UA 4I4EA 5IPJA 2B9IA 5DHJA 1GZOA 4WO5A 3TL8A 2C6TA 5AR5A 5CYIA 5B2LA 3R9DA 5FTOA 4BKZA 3RNIA 5CU0A 1BI8A 4EOKA 4QMVA 5ANKA 5DT0A 4O96A 2CN8A 2R3JA 1Q5KA 3H10A 2BKZA 3I60A 4M66A 4IDTA 2PZYA 2P4IA 4AXAA 3A7JA 1J1BA 2UZLA 2R3OA 4O0WA 3VS1A 2WMSA 3HDMA 2JDRA 3CY2A 3D7ZA 4K18A 1XQZA 1WBSA 4PPAA 4X3FA 4LGGA 4P4CA 3H9OA 2EUFB 3EN7A 4IWQA 4QMOA 3FZ1A 2JAVA 4ZSJA 2XP2A 2GNJA 2IO6A 4C4HA 4N6ZA 4QP6A 2VD5A 2UZWE 3BQCA 4PX6A 4M8TA 4FIIA 5EDQA 2PSQA 1ZMUA 2R3KA 5DG5A 1JLUE 4ACHA 4QDVA 5DYJA 4RIWB 4U6RA 2X1NA 3TTIA 5HD4A 4WG5A 4NFNA 2W1ZA 3DXQA 4LM5A 3RPSA 4O7TA 2J0IA 4MXAA 4G3FA 3BI6A 5AFVA 3NR9A 4BWXA 3AKJA 4DHZA 3PLAE 4CRLA 4NW5A 1LP4A 2A4LA 1YRPA 2XCKA 2ZJWA 1OL2A 4FSRA 4BYIA 2ETMA 4JG6A 4O7WA 3U54A 3NNVA 1CKPA 5FWKK 4RQKA 2YLFA 4AAYA 3EJ1A 5CF4A 2UV2A 3WF8A 5BYZA 1YWVA 2W1HA 4O7YA 5T68A 4HPTE 5H8BA 2HOGA 1IG1A 4JOAA 5AP4A 1FVTA 2XK3A 4DC2A 2VX0A 3Q5ZA 3G15A 4EZ7A 5ETAA 1UKHA 3C9WA 3QQKA 3D7TB 4E20A 4EH9A 3UNZA 3L9LA 3KRLA 4ZJIA 2WMXA 2XM8A 3FLSA 3QTIA 2XM9A 4AT4A 5BNJA 4I6FA 4ZMEA 1VR2A 2C5OA 4XCUA 4GK2A 4L3PA 5F1ZA 4QMUA 5LARA 3VWAA 4CT1A 4KIPA 5TOZA 3W8LA 4XLIA 3F5GA 3DBDA 3IOKA 4QMSA 4MCVA 3ZC5A 2PUIA 5HESA 2WPAA 5J5SA 4RC2A 3O71A 3NUYA 3ZRKA 5EW9A 1CMKE 3R8ZA 4ANMA 2J9MA 2W99B 2VWVA 2JKQA 3ETAA 4U3YA 4YZDA 2XZSA 3TV7A 3VF8A 5HG8A 2OLCA 4O7SA 3FI4A 4YTFA 4U97A 2ZM4A 4FL3A 5AV3A 4AUAA 4X21A 2Y6OA 4AZSA 3QQGA 3MH1A 3OWLA 4KSPA 4S34A 2QLQA 2IVUA 2ZAZA 4G1WA 4RVMA 4XV9A 4JLCA 3TJDA 3W8QA 5LVOA 3OBGA 1CKIA 3U6JA 3SKCA 3TNWA 2PZPA 4AGUA 2V55A 1BUHA 2ITZA 3NEWA 2ONLC 5DRBA 4BDGA 2ITQA 4JAIA 5HE1A 4AA0A 4WRGA 4D2SA 1OMWA 3C51A 5AR8A 3FPQA 4RJ6A 5CXZA 4BDKA 5CVGA 3LFDA 3GFEA 3SDJA 1J1CA 4PP7A 1PMUA 5L8KA 3ZM9A 4JR7A 3QGWA 4UMQA 3ORNA 2Z7QA 3LFFA 3VO3A 4QP7A 5IEVA 2OIDA 5GJDA 5LWMA 4MUQA 4LV8A 5HBEA 2RFEA 5LMKC 2GU8A 4APPA 3AKKA 2BRHA 3QQHA 4AW5A 4F64A 3Q52A 4M3QA 5FM2A 4YU2A 5HLNA 4Q5EA 4DFXE 3BL7A 2VO7A 3CY3A 1ZYJA 4FZAB 3TZ9A 2OG8A 4FYNA 3ZSGA 3ATTA 3CXWA 5EW8A 2HW7A 5GJFA 3SG9A 4Z7GA 3O0GA 3PVBA 3ZUUA 3C0IA 3I79A 4LL5A 4X2NA 5I3OA 5CF5A 4BY9E 5EM5A 3L8VA 3ORLA 4P5QA 3F7ZA 3R7GA 4W8EA 1HCKA 5DT3A 4EC9A 5FD2A 5C26A 4ZLZA 5IDPA 3ODYX 2UW7A 5FTGA 4YLLA 2X9FA 4XRJA 3VUGA 4CFNA 2YIXA 1XH5A 4C62A 2XJ1A 4ALUA 2VWWA 2IF8A 3D5VA 3BLHA 4RSSA 3TZ7A 2Z7RA 3DK7A 3N4UA 1O6LA 5CQUA 4UEUA 3RINA 2FSTX 2F4JA 4FT9A 4U5JA 3NUAA 5C8MA 4BWKA 3HEGA 5AJQA 3MW1A 2C3KA 1URWA 3IPHA 4AACA 5K5XA 4NEUA 3FEGA 4K2RA 3DAKA 2OWBA 4RA4A 4IVAA 2GPHA 3F82A 4GYIA 2GHMA 3P0MA 2X6DA 3FC2A 2XNBA 2ITXA 4FKTA 4HGLA 3SXRA 3U55A 4QMPA 2HWPA 3OCSA 4PPCA 2HZ0A 1K2PA 5HG9A 2G2HA 2WTDA 4D9UA 2DWBA 5ETFA 4M15A 4C3PA 3QTSA 2GQSA 1UVRA 2WMTA 4FTQA 1NVRA 1CM8A 3PY0A 5JSMA 4N4SA 1OUYA 1STCE 4FKWA 4QNAA 3NW7A 3LIJA 4BHNA 3NYVA 5KNJA 2W17A 4BZOA 3QU0A 1G8KA 3VUHA 2QR7A 2YACA 4YNOA 4USDA 3S2PA 2WTCA 2GSFA 3R00A 3ALNA 4QMYA 4PMTA 2WGJA 4L43A 2C5YA 4QP1A 3G6HA 3RK9A 1VZOA 2WQNA 4XG3A 3KEXA 2QNJA 2X39A 3O23A 4JQ8A 4KWPA 5A4CA 4TYEA 3KGAA 4EK4A 3TNQB 1Y57A 4D55A 4KB8A 1NA7A 1FGIA 3FXXA 3TNHA 3S4QA 2YJSA 3A7IA 4RWIA 4BCJA 2YDKA 1OKZA 2A98A 2UZEA 3KVWA 2YAKA 5CNNA 3VS6A 5IA3A 2PUUA 1GZ8A 2OF4A 5A4QA 4MHAA 2IG7A 3CJGA 1UU9A 2FSOX 4H36A 3OCBA 3UG1A 4NTSA 4F0IA 1Y6BA 4CG9A 3PIZA 1OL7A 4KUJA 3K3IA 5E8TA 3ZO2A 2C69A 3JXWA 1PMNA 3R1QA 4DBNA 3QCQA 1G5SA 2ZV9A 5C27A 3P23A 3ZXTA 4BBEA 4O1PA 1U46A 3WBLA 5HU9A 4BTKA 2V22A 4NJ3A 3OF0A 4BIEA 3KREA 3KULA 3POOA 1YI6A 2ETRA 4ZK5A 3MA6A 3ROYA 4C4FA 2I0YA 2X4FA 4O81A 3VIDA 4DBXA 4EH8A 3GNIB 4L9IA 5CU3A 5EFQA 5CASA 3DLZA 4EORA 5CALA 3NFFB 4KSQA 3UP7A 1KWPA 4D2PA 5CF6A 2HXLA 5I5ZA 5AM6A 3U6IA 2WQBA 4TYGA 1TQMA 1OM1A 1XBAA 4YTIA 1FMOE 4HZSA 1XH7A 3KRXA 4GG5A 4EI4A 1ZOGA 4I5HA 1WFCA 5AP2A 3FSFA 3I5ZA 2B9HA 3DXPA 4R6VA 4TYHB 3RALA 4HNIA 3ZS5A 2QI8A 3FMHA 1OECA 1H0VA 4ZTSA 5IQIA 1GIHA 1TFFA 5CU6A 1OL1A 4IC8A 4MD9E 3OHTA 3RMFA 4XUFA 4DA5A 4I93A 5IU2A 4X3JA 2QOBA 4C4GA 1XR1A 5DR9A 3PRIA 4O7VA 3FZSA 2YITA 2VWBA 4IFCA 4JNWA 3PYYA 2XJ0A 4R8QA 4BGQA 1PXNA 3HZTA 5CAOA 3BYMA 3WZEA 5A6NA 2VO3A 3R7UA 2W7XA 2JIVA 4GW8A 3MI9A 1DI9A 1GY3A 1WBNA 5ETCA 5FG8A 4RIXA 4E7WA 5KHXA 4R7BA 2GHLA 3PPJA 4O7NA 4PDYA 5KE0A 4FNZA 1BX6A 4Q9ZA 3CEKA 2OZAB 4GL9A 4EH7A 3AC4A 4AGDA 2WHBA 1NVQA 2RGPA 5GZAA 4CYIA 4AU8A 5M4IA 4RBLA 1WBOA 3BCEA 4ASXA 4F09A 2VTMA 3WZUA 5AEPA 2OI4X 2VGOA 3K5VA 3OY3A 5CSPA 3KXGA 4H3QA 5HO8A 2R3MA 4F9YA 4ZXTA 1PY5A 5C03A 5HTIA 3O5AA 2RG6A 5KMIA 3EN4A 5BVWA 5FEQA 3V6SA 5KMKA 4V05A 4UMPA 5A54A 4OAUC 3SV0A 3HV5A 2UZTA 1YXVA 5DGZA 2A27A 4A9YA 2PVJA 3F6XA 3GENA 3GC9A 2UW3A 1FQ1B 1KV1A 4F1TA 2QHNA 3FMNA 3ERKA 3LOKA 3IW8A 2X8DA 1O9UA 4OUCA 5HBHA 1GJOA 3VQHA 3FYKX 4U3ZA 1BLXA 2XALA 4MYGA 3RNYA 2XBAA 4AT3A 3LE6A 4FSTA 5D41A 2XNGA 2F2UA 2AC3A 2C6OA 2WNTA 4YHFA 3UIUA 2BRMA 4D2TA 3LAUA 1JKSA 1Y8YA 2WU7A 5C8KA 2C5NA 3ZC6A 1OPJA 2J5FA 4EHGA 3QRIA 5IUGA 3DA6A 3SQQA 3LM5A 4I4FA 2BALA 3QTUA 5BVEA 4LOQA 4DHFA 2OJJA 2R7IA 1H27A 4QPMA 3ZLXA 3PUFC 3R7EA 4CD0A 4IJPA 5CQWA 3CC6A 3E64A 4N70A 4ARKA 1P14A 5E8VA 2XNMA 4ANSA 3TI1A 1GAGA 2WIPA 3R22A 2WMBA 3SW7A 3SAYA 4DEEA 4V0GA 2C0OA 3BKBA 4EUTA 3C13A 3IS5A 2CCHA 4L6QA 4F9BA 4ZY4A 3W16A 4IX3A 4YC6A 2G2IA 4OTWA 2X8IA 4GK4A 4AGCA 3QXOA 4M67A 3HP2A 3JY0A 4E1ZA 3ZRMA 4C36A 4ZSAA