1P14A

Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
287
Chain Sequence
VFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRNLAARNCMVAHDFTVKIGDFGPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords insulin receptor
publication title Structural and biochemical evidence for an autoinhibitory role for tyrosine 984 in the juxtamembrane region of the insulin receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 287
sequence length 306
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1p14A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1p14A01
3ZDUA 3PVUA 3JVRA 3W16A 4M8TA 2R3JA 1REJA 5KHXA 3TUBA 4NM5A 3DQXA 2ZB1A 4FNYA 4PMSA 4RVMA 4PDOA 4M15A 1WBVA 4CCUA 2CPKE 4FUXA 3UOKA 4O0RA 4IM3A 3UZTA 1WBOA 4F1OA 5HVJA 4N57A 2VO3A 4J1RA 3OD6X 4FKLA 5CEQA 5DRBA 2V62A 4ANOA 5HNBA 1PMEA 2BAJA 4JOAA 3NDMA 5JK3A 3G15A 3QGWA 3CP9A 3QHRA 2BDWA 4OBPA 2BALA 4R1YA 4YTIA 4QMQA 5HVKA 4BL1A 2B54A 4CV8A 4RWJA 4XBUA 4QYGA 4DFNA 4O27B 2VU3A 3P78A 3F7WA 4FG8A 1OL7A 2QC6A 4HVIA 3NIZA 4YC3A 2EXCX 4XG7A 3PPZA 4EOMA 2XS0A 4M69A 2ZV9A 5EKNA 4GIHA 3BHHA 3TL8A 3PSDA 1ZARA 4BTJA 5J9ZA 2ETRA 3H4JA 3RTPA 3OWLA 2C5XA 2HYYA 3QYZA 4JR7A 2IW9A 4E6CA 5HO7A 3P9JA 3LCTA 4WKQA 1H1QA 4KKGA 4YBKA 3BLQA 3CR0A 3EFJA 3EL7A 4CZYB 4KNBA 2FO0A 3MTLA 3UQGA 3MIYA 5K9IA 2YCRA 3DFCB 3R8MA 2WTJA 3FL5A 4J8MA 1MQBA 2GQGA 3KULA 3OBJA 4A9YA 1JLUE 3R30A 3CTQA 3FMJA 4FKRA 4TPTA 2P3GX 3WZDA 4AZVA 4BC6A 3DBDA 3PVBA 5GIPE 3O8PA 2YAKA 4BICA 1OI9A 3WYYA 5DR6A 4DGNA 3ZO2A 3MY5A 5GZ9A 4ZTLA 3O8TA 3NUXA 3VWAA 3C13A 4HYIA 3W2CA 4IVBA 3HEGA 3ODZX 2PSQA 4TKSA 4U41A 5K5NA 2WEIA 4BKJA 3VBVA 3KRJA 4C36A 3P0MA 3GCPA 1H01A 4Y95A 5F20A 1XH6A 5KBQA 2HZNA 3WBLA 2QNJA 4DBXA 3ZTXA 2F2UA 4GUEA 3L8XA 1Q4LA 4I0TA 3RINA 1XH9A 3U8WA 4RWIA 4UZDA 1ZY4A 3V6RA 4EYMA 3DY7A 3QUEA 4ASZA 4QMLA 3TIZA 4ARKA 4FL2A 4BDKA 3GC9A 2QD9A 1PMUA 4OLIA 3MPAA 5TKDA 3MW1A 4M7IA 4L68A 4YBJA 4FSTA 4FV1A 3CTHA 2XJ2A 2ACXA 5K0KA 3TDVA 2B9IA 3O8UA 2W1HA 4I4FA 4K8AA 1PXOA 4PDPA 1KSWA 5DI1A 5HE0A 4O96A 2P0CA 4QTDA 1Q97A 1V0BA 5CEPA 1PRYA 1GZNA 2W1FA 1H1WA 1M17A 3TZ8A 2QOCA 4DEGA 4ACDA 4L42A 4HNFA 3D5WA 1CM8A 1SMHA 4QQJA 4YO6A 1NXKA 3KXHA 3ZC6A 3R7VA 1MQ4A 3DJ7A 3L8PA 4IX5A 4ACMA 4LUEA 3POOA 4UYNA 3R83A 3MSSA 3JY0A 4C38A 4FEWA 4IAZA 4IWDA 3VS2A 3HKOA 3QLGA 4MNEA 2R0UA 4CVAA 3VW6A 5M57A 4XH6A 4IVDA 3VO3A 4G2FA 2FB8A 3I6UA 4USEA 2YLFA 1R78A 4XYFA 4UWYA 3GU7A 4IFCA 2W5HA 4FL1A 4EORA 4YJNA 4J99A 5FEDA 4IAFA 1M2PA 3CKXA 4BCGA 3PZEA 4RA5A 3KFAA 4QMUA 4M0ZA 4CFXA 5KMNA 5KKRC 5L8LA 3COKA 4PPAA 5G6VA 4I0SA 1OM1A 2RKUA 1YHWA 4BZDA 4NTTA 2GS2A 1SM2A 3G51A 1Q8UA 3QALE 2C6MA 4CTBA 3ANRA 4FMQA 3TACA 4LL5A 1HCLA 4DFBA 3QKKA 2XIXA 4FBXA 3RP9A 4DG2E 2YM5A 2UZUE 3PIXA 3PG3A 4X2NA 3QZHA 3RK7A 3RM7A 4ZTQA 4TNBA 5ITAA 3SDJA 3SD0A 2W1DA 4CFNA 4KSQA 2QU6A 4DITA 3VHEA 1Q61A 3KMWA 4C58A 3LFNA 2ZV7A 3PJ8A 4XRLA 2QHNA 4CQGA 4MCVA 4UX9A 4DA5A 4EKKA 4IQ6A 1UV5A 4DEIA 3U4UA 4PNKA 4I5MA 1E1XA 2XNGA 4C57A 4ZAUA 3OHTA 5FEEA 4RA4A 2YJRA 3ZBXA 4OAUC 3JS2A 5KMLA 3AQVA 3FWQA 3D15A 1FVVA 4RLLA 3BKBA 2WTDA 4IBMA 5DR9A 5FTOA 4CYJA 4NWMA 5DMZA 4YZMA 5J7BA 1OL6A 2I0VA 2O5KA 5L6OA 1H25A 2YITA 4FKWA 3V01A 3NWWA 4A9RA 2XBJA 3QHWA 2QU5A 4P5QA 4RX5A 5HTBA 2I7QA 1JWHA 2E9VA 2XF0A 1GJOA 5KUPA 3VBTA 2EU9A 2ERZE 3RJCA 4FKQA 4YJQA 4RVTA 5H8BA 1E1VA 3U9NA 4L53A 3TCPA 4PNIA 4BDAA 1UVRA 4RJ3A 2EXMA 3BGQA 3SG9A 3HA6A 5DNRA 2R3OA 2NRYA 1TQPA 1WVYA 3ORNA 2F2CB 3HMOA 5DGZA 5LCKA 3G0EA 2Y4IC 5DFPA 3FUPA 3ZFXA 4LMNA 3M1SA 2GTMA 3PE2A 4FTAA 4D2WA 4DHFA 1NW1A 3AC8A 3EQPA 2XNEA 1T45A 3DFAA 5LMAA 5M4IA 2PTKA 2PUNA 4CG9A 4MD7E 4C8BA 3VBQA 5EW9A 1I44A 4QPSA 1F0QA 2ETMA 4U44A 5C03A 4FKGA 4XS2A 2J4ZA 4ZIMA 3UNZA 2YIXA 4CFFA 3FBVA 4ZJJA 1KE8A 5KKRB 4O7SA 2PVJA 4IXPA 3VBXA 2F57A 4NM3A 4DH5A 1T46A 4E3CA 5A4QA 3ELJA 4ITIA 4UMRA 4HYHA 4DG0E 3TV7A 4YLJA 3TZMA 2GFCA 4YTFA 4GFMA 3I1AA 1LP4A 5AX3A 3OT3A 3DBCA 5LVMA 2XBAA 3P7BA 2OZAB 5HO6A 3FMMA 3LCSA 1H27A 1R1WA 2PULA 3FJQE 3CQUA 5C4LA 3FLQA 5A4EA 1YOLA 4HGTA 4S2ZA 2AUHA 1M2QA 2EB3A 3FMNA 3IW6A 5HVYA 1OKZA 3Q4TA 4JIKA 5KX8A 3GCUA 4WG3A 3FQSA 5IQGA 1J1CA 2BDJA 1MRVA 3ZUVA 3OFMA 4N6ZA 3QQHA 4BIEA 4WA9A 1O9UA 2Z7RA 5CLPA 4DF3A 2UZEA 1QPCA 4I6FA 3FY2A 4GFGA 5CAQA 5IEXA 4FT0A 3ZC5A 2YM7A 5FRIA 1RQQA 5D41A 4BDJA 4TXCA 3PIZA 1BX6A 3SW7A 3TM0A 3A7GA 4GU6A 4MXXA 2OIQA 5AR2A 5LVLA 4R5SA 3HMPA 4XV1A 5EOBA 3LPBA 5JSMA 3IPHA 1G8AA 3E87A 3A4OX 2YIQA 4KA3A 2BR1A 5DOSA 1PXKA 2JGZA 3ZLSA 4FTUA 4B8MA 1JBPE 2O65A 3AMBA 3GCVA 4TRLA 3LW0A 3RPOA 2X8IA 4C37A 4CKJA 5LMKC 3AXWA 4ANQA 2C3LA 3DTCA 4KS7A 4BTMA 2G2HA 5EHLA 5DT4A 4DT8A 2SRCA 3LFQA 4KB8A 4E5WA 4ZY4A 1JAMA 5FEQA 3U87A 5BUIA 5M4CA 1R39A 3HAVA 1Q8YA 1U46A 3D7ZA 4BDDA 3ZLYA 4NW6A 3HGKA 5L3AA 2WTIA 4GUBA 4QTBA 5AV1A 4YURA 4EH9A 1Y57A 4OTDA 4GT5A 5CSPA 4IZAA 4LV5A 4RJ5A 5TR6A 3ERKA 3TZ7A 2JKOA 4TYEA 2DWBA 3QFVA 2GMXA 3MH1A 3V5QA 5HG9A 3FPQA 3VUMA 2ZM3A 5HEZA 4JAJA 4A9TA 4K77A 4GG7A 2C0OA 3BZ3A 4U45A 2WMTA 2ZDTA 3QZFA 2YCSA 4ACCA 2Y6MA 2W9FB 2VUWA 4QYYA 1RDQE 3BWJA 1IA9A 2XIKA 1XH4A 5JGAA 3HRBA 3D0EA 2YHVA 5CI7A 4H3PA 2G2IA 3FI3A 3R7OA 3ZSGA 3GU5A 3C50A 4AW2A 4XG6A 4E73A 5HLWA 2F9GA 1ZYLA 2X8EA 2H9VA 1MUOA 3PVGA 4YC6A 5A9UA 4GCJA 5M07A 2RL5A 4AZEA 5ANIA 3QC9A 2A1AB 5EOLA 4AFEA 4DFYA 3HV4A 4JAIA 1R3CA 5FBNC 3V51A 2PMNX 3ZH8A 4BGHA 4O7LA 3IGGA 1P2AA 1VEBA 2YM8A 3R21A 3VIDA 3ZFYA 4BI2A 2JEDA 5FUTA 4GW8A 2P4IA 4IB1A 4V05A 3TZ9A 2C0TA 5CAOA 1PY5A 3V8TA 3QQLA 4ENXA 3A2CA 1FGKA 3KULB 2AC5A 2JKQA 3DU8A 3KVWA 3KXNA 4J95A 2BHEA 4Z55A 1VJYA 2BRMA 3C7QA 3ZUTA 2GNJA 3DDPA 3QWKA 2PVNA 2WB8A 2QR8A 2ZMDA 3PP1A 3R8LA 4APCA 3R0TA 3DKFA 1Y6AA 3FC2A 5F1ZA 4NEUA 2ITOA 3ETAA 3KA0A 4QMWA 4U6RA 3SRVB 3VRYA 4DTKA 4CFUA 3ATSA 5EDRA 2E9NA 3NZ0A 3O71A 3VNTA 2Z8CA 2UUEA 4EUUA 4QPMA 5I0BA 5CF6A 5AA9A 3FQEA 4FICA 4R3RA 2WMWA 3F5UA 3HDMA 4G1WA 4MVFA 5DIAA 5ACBC 3ZXZA 2I6LA 4FGBA 1B38A 4JDHA 5BX0A 3KF4A 2BRGA 3F66A 4ANLA 4BHZA 3G6HA 1JKLA 3P5KA 1LEZA 2I0EA 3WE8A 3UP7A 3UO5A 3BQCA 2XMYA 5GZ8A 2WHBA 3SXFA 3I6WA 2F4JA 5JFWA 1X8BA 2R5TA 4MX9A 2R2PA 3N51A 3KXGA 1OGUA 3PA3A 3R22A 4RX7A 4W8EA 2GCDA 2W1CA 3VUIA 4PDYA 2CKOA 4LYNA 4S30A 3KN5A 4LL0A 5KMJA 2XK8A 4PMTA 4D55A 1L3RE 3GBZA 3PJ3A 2ZM4A 4GJ3A 5L4QA 2OI4X 2Y9QA 2IW8A 2ITYA 2JAMA 4FSZA 2GS6A 4P5ZA 2WZJA 3C0GA 2ITUA 2WEVA 4L67A 5JZNA 1KV1A 4RJ4A 3CBLA 4V01A 4V04A 3Q6UA 1KE9A 2I0YA 3FXXA 3ID6C 1GY3A 1YWNA 2BROA 4XUFA 4LRKA 5HTIA 4GYIA 1URCA 3DAKA 2XIRA 2OH4A 3KXZA 3NNWA 2OJ9A 3VULA 2WTKB 4ZSJA 1JSUA 4MWHA 1Y91A 4HCVA 2ZM1A 4UMUA 2WNTA 2QOOA 2VX3A 4OTHA 3VUDA 1J1BA 3BHVA 3KMMA 4GVAA 3QKMA 3A60A 5D11A 5AIKA 4I1ZA 1GOLA 1WCCA 5A46A 3UVQA 3KMUA 3OW4A 5K0XA 3PXFA 4YGAA 5KZ0A 2FVDA 4FT7A 5HZNA 4I23A 4ZEGA 3FKNA 4LUDA 4XBRA 2ESMA 4B4LA 2UW3A 2CMWA 5M06A 2XH5A 2W4KA 1DI8A 3G9LX 4YJOA 3BU6A 2OJGA 2R7BA 2XP2A 3DGKA 3TKIA 3VS5A 3FYKX 3RM6A 4EONA 2WOTA 3AT4A 4RG0A 5DR2A 2VWVA 3UJGA 4P7EA 4BDEA 2UVXA 3EOCA 4IX6A 3Q6WA 4H39A 3GI3A 2UZNA 3LFSA 3KN6A 3KXXA 2WTCA 3Q9ZA 3FHRA 2J9MA 1PKGA 4QYFA 4UWCA 5E8WA 3NUYA 2X39A 2ETKA 1K2PA 3O17A 4ANSA 2X9FA 3MFSA 3RWQA 4YZDA 5AUXA 1BKXA 4FK6A 1ZYDA 4BCIA 3QXOA 3NUAA 1V0OA 4G3FA 5F4NA 5JZJA 5BYZA 5FP5A 5GNKA 1FMOE 4WO5A 4PL4A 4FV3A 4IJ9A 3AC2A 1YWVA 3BX5A 3F3TA 3O23A 3QU0A 3R2YA 4U42A 4UN0C 2RF9A 3IDPA 4F7LA 1OBDA 3OZ6A 5CXHA 4TNDA 2XCHA 2B1PA 3PXRA 5D1JA 3OCBA 4M68A 2GQRA 2YZLA 4FNZA 4Y5QA 1SVHA 3HX4A 3QGYA 2DUVA 4EHZA 4EZ5A 2PZRA 1YRPA 3CKWA 4QMNA 5KMIA 2F7EE 2OWBA 3PY3A 3EKKA 2YZAA 2FA2A 3ROCA 3OOGA 4CMOA 3RMFA 3DKGA 3NNVA 3NAXA 4OBQA 5AM7A 4DN5A 5E4HA 1JQHA 4UZHA 1WVWA 5HE2A 4BI0A 3W18A 4CNHA 3BBTB 2CN8A 4C0TA 3OCSA 5HCZA 4RC2A 2F7XE 1DM2A 3P1AA 3H0ZA 5B0XA 1IAJA 3PY1A 3PYYA 4Z3VA 3D5VA 5L2TA 4EUTA 3F2NA 4CTCA 4PTCA 4KABA 4FIIA 2B4SB 5EI8A 1G3NA 4S34A 2IZTA 4MH7A 2FSTX 3NS9A 4AT4A 4FV6A 3HECA 2XB7A 3C4ZA 4AA5A 2P2HA 1AD5A 1UA2A 4HCUA 4F0FA 2UZVA 2JC6A 2B55A 2X7FA 5HBHA 2XYNA 3CY2A 3D7TB 2UZDA 1K9AA 2XIYA 1FMKA 4FZ7A 5ANDA 4USFA 1FVRA 5CT0A 5ICPA 2A19B 3NMUF 4DCEA 3P4KA 3O96A 3D2IA 3NUPA 1URWA 3HUBA 4AZSA 3DZOA 1OL5A 3EZRA 5GZAA 4IZ5A 2CCHA 3FSKA 4A4LA 4FG7A 1LEWA 5CU0A 3ZUUA 5CS6A 5BYYA 5GJGA 3U55A 4OTQA 4QMMA 5EG3A 3RAKA 4RPVA 2R3IA 4IB3A 5IZFA 4C34A 1B6CB 4BDHA 1YI3A 3NIEA 1PJKA 4NU1A 4H58A 3NYOA 5HESA 3RPVA 4ZTMA 5A6OA 4RT7A 4WIHA 2ZMCA 2C6IA 3O0GA 5FBOA 4UALA 2O8YA 2VWXA 4DH8A 4FZAB 3EL8A 2RSVA 3HRFA 5C01A 3LMIA 1YXTA 3PWYA 3P08A 3QTIA 2VX1A 3R7IA 4L6QA 5EM5A 3SW4A 4IJPA 1UWJA 3QUPA 4FTNA 5ANJA 5HCYA 5BVKA 5BMMA 4BDCA 2C4GA 4FVRA 4FODA 2OZAA 4LGGA 5E8YA 2GU8A 4KBAA 2YWPA 3VJNA 2X6DA 1GZ8A 3BQRA 4FZFB 1WMKA 1GNGA 5AUUA 4ZSAA 3D94A 4IAKA 2VTNA 4D1XA 3UOHA 3F69A 2WTWA 3R1NA 1PKDA 3CD8A 5AP6A 3V04A 4ACGA 3LJ1A 2BFYA 4AU8A 3TJDA 2V7AA 3E3BX 3NW5A 4FV9A 3RHKA 1IEPA 2QI8A 2WOUA 3PLSA 4X3FB 4G3DA 3RBWA 3WZJA 2WMAA 4R7BA 3AD5A 5CQUA 3LJ2A 3IDBA 3EQCA 4FV8A 4L3PA 3UBDA 3MJ1A 4PWNA 2GHGA 4D1SA 4U81A 3RHXA 4X2FA 2P2IA 4FVPA 4YZBA 3GU4A 4YO4A 4WG5A 5EI2A 1LUFA 4ASEA 2W5AA 1Q8TA 3H9FA 1XHAA 3ZSHA 2C69A 3WOWA 5CSXA 3ATTA 3E3PA 1PMVA 3DA6A 2CKPA 5M4FA 5IUGA 3EN6A 4RLKA 3ZRMA 4OUCA 4JBVA 3GCQA 2WQMA 4L9IA 1ZOHA 2PUIA 3CPCA 3VF9A 5J9LA 1G8SA 1ND4A 3TDWA 4MTAA 4XV2A 1F5QA 3GOPA 3A62A 3QD4A 4I5PA 4A06A 4FTIA 4AZFA 5HLNA 2ITTA 4FSWA 4QMVA 4PPCA 3T9IA 5ACKA 5E90A 2DS1A 4WNMA 4XP2A 5IQIA 3RZFA 5J5TA 4KIQA 4EH8A 1M7QA 4FIJA 5AAFA 4ASDA 5FD2A 3R01A 4O1OA 2XK7A 2BIYA 2HAKA 4UXLA 3EFKA 3G90X 3F5GA 4BCHA 4DG3E 5JMSA 4FKUA 2QKWB 5KHWA 4BFMA 1CSNA 3ALOA 3HVCA 3UZRA 4AWIA 4HCTA 4IVCA 3VHKA 3MI9A 4IB0A 4G3CA 4RQKA 3FLYA 4K6ZA 2ZJWA 3SXRA 4AZTA 3C0IA 3LCOA 4FE2A 4RJ8A 3A8XA 3SVVA 2OO8X 3KGAA 5AR4A 4B0GA 2C6DA 4C4EA 4YLLA 4BY9E 5AWMA 2OIDA 1KOAA 4ZSEA 4DGGA 3RGFA 3MH0A 2VWZA 3IOPA 4QRCA 5F94A 5HIBA 4A9UA 4P90A 3QAME 4H3BA 3GFEA 2XKDA 1WBNA 2HOGA 3DNDA 3MVMA 3UO6A 1QCFA 2REIA 4AACA 4ZZNA 4YHFA 2C5OA 3A7JA 4FSRA 2C3KA 2NPQA 4LGHA 4FTLA 5AP4A 3MB6A 4AQCA 1YQJA 2JKKA 3F5PA 3IGOA 3SC1A 5HICA 5A54A 3DT1A 4BTKA 4GRBA 4FR4A 4ITJA 3PPJA 4O6EA 4PTGA 3A7FA 2O63A 1BYGA 3T3UA 3PP0A 4M0YA 5AR7A 4JR3A 2QO7A 3K5UA 3C5IA 3SRVA 3Q2JA 3QBNA 4GMYA 4OBOA 4GV1A 3E8DA 5CSHA 3PE1A 4HNIA 5C1QB 2QCSA 2ZAZA 3ZRKA 3NSZA 2ONLC 3WF9A 5CU6A 1J7IA 3A7IA 3V5TA 4EOSA 4A9SA 1YDTE 4FKJA 2Q83A 3EIDA 4JT3A 4Q9ZA 4DLIA 4HZRA 2J0IA 3QXPA 4RC3A 4AOJA 3CD3A 3ORLA 4IFGA 4YNEA 3S0OA 5EW3A 4FGRA 3CQEA 1CKIA 2VNWA 4YJTA 2OXDA 2WO6A 3JPVA 4JRNA 1OB3A 4I4EA 3I5ZA 4O1PA 1H08A 4EK4A 2VTSA 5HU3A 2PU8A 1JVPP 3IQ7A 3OT8A 3IW7A 2X4FA 3COMA 3KCKA 4J53A 2YACA 4O0UA 5EFQA 3V5JA 5I4NA 3MFRA 1Z57A 4L3LA 3T3VA 2VTOA 4EEVA 4TY1A 3QTSA 3GCSA 4NJDA 3R7YA 1Z9XA 4O38A 4IIRA 4IZYA 3MFTA 2W7XA 1K3AA 2V22A 4GK2A 1XKKA 5FG8A 4EHVA 3L9MA 5B2LA 2WMSA 3R7GA 4ENYA 4GKHA 3KRXA 2QOLA 5K4JA 2WGJA 2VWBA 3EMGA 3GUBA 1FBNA 4KRCA 3F2RA 5DWRA 4EJNA 4BRXA 3BU3A 4G6NA 1FINA 5JT2A 4RBLA 5IF1A 4ZJVA 2QOQA 4YPSA 2ZYBA 3SLSA 4DEEA 4O0TA 5L8JA 4MXCA 1U5RA 2J0MB 3EQFA 4NKSA 3W32A 2F7ZE 3MIAA 4XP0A 2VTAA 1YXSA 4KS8A 3R7EA 1W98A 5DPVA 4I92A 2FSMX 2RG5A 4L7FA 4RWLA 2VD5A 3LFCA 3UQCA 3CCNA 5HU9A 3Q3BA 1PXLA 3VS4A 2VX0A 1JKTA 4YHTA 3LFDA 3QQGA 4KRDA 2PHKA 4IX4A 2UVYA 5KZIA 4GK3A 4EH7A 4C2WA 4FI1A 5DVRA 5AR5A 1PXIA 3FMLA 2V7OA 3ORKA 3WYXA 3BV2A 3ACKA 5E9EA 5HO8A 1WBPA 4W8DA 4AN2A 4JS8A 4JQEA 2WTVA 2WELA 2Y7JA 4AGWA 4CLJA 1QPJA 2ITWA 3LJ0A 3GC7A 1WBWA 4KKHA 3ZYAA 2XEZA 3IKAA 3KQ7A 3SV0A 4F6WA 5EQYA 5DA3A 3NCGA 2R3PA 2P55A 4HVDA 4JNWA 3ORPA 1XBAA 2BRNA 4CT1A 3PWDA 4I93A 4BGQA 4XV9A 4JXFA 4WUAA 1OPJA 3JR1A 5EDQA 4PV0A 3OXZA 4LV8A 2YFXA 3GNIB 4ZTRA 3LE6A 3UPZA 2O64A 4GU9A 5FM3A 1ZXEA 4ZXTA 5CI6A 5DEWA 2W4OA 3HNGA 5FXSA 2XK9A 4OW8A 3VRZA 3WARA 4DAWA 4O81A 2OF4A 1P4OA 2E2BA 2WIPA 3LCKA 4HPTE 4WD5A 5DN3A 3LLTA 4RX9A 4ZTSA 4B99A 5LQFA 3Q32A 1SZMA 2R3LA 2UW6A 2OW3A 2XYUA 3CGFA 4UBAA 5C8NA 1H1RA 4OT6A 3ZSIA 3JYAA 3HV3A 4QTAA 3HMMA 4R1VA 3S00A 3UIXA 3HV6A 5JFXA 2CSNA 2HW6A 4TWPA 3R2BA 1V0PA 2X1NA 2WMBA 3OUKA 2HZ4A 4MBLA 4K9YA 4X2GA 5K5XA 4BTFA 3I7BA 4DH3A 4E26A 4O6LA 1NVQA 2EUFB 4IMYA 1CTPE 5CEMA 3NVMB 3QTZA 1KE6A 3R6XA 3FPMA 3MVLA 1GIIA 1H1SA 2UW8A 1LPUA 5DEYA 3LQ3A 3BEAA 4JBPA 4IDVA 1S9IA 5LJJA 1YWRA 3BHTA 4F99A 5AAGA 3QZIA 5GINE 2W05A 5IDNA 1GZOA 4FTOA 3IW5A 4C7TA 3PIYA 3DTWA 4RMZA 1ZLTA 5AUZA 3C9WA 1U4DA 3MJ2A 4C4JA 2QO2A 4FTTA 4D58A 4FC0A 3RAHA 1WBTA 3DJ5A 1XJDA 4XG8A 4LFIA 5I3OA 4NM7A 3D2KA 5DT0A 2BILB 3C4CA 2J90A 4TT7A 4EL9A 1YXVA 3G5DA 5BVNA 4XMOA 3QWJA 4XJ0A 2PVFA 3F7ZA 2YN8A 5AP3A 3UP2A 3V5PA 2W4JA 1Y8YA 3W2PA 1UNHA 2OJFE 2YM6A 3CJGA 2X7GA 5JFVA 2QOFA 3OMVA 4FV7A 4UMTA 2GSFA 3NW7A 3LVPA 3PXKA 3VC4A 4AOIA 4EOLA 5CNOA 3BRBA 4GKIA 3Q04A 3EQHA 3U6JA 3D7TA 3CTJA 2WMRA 4CKRA 1ZZ2A 3TT0A 4ANNA 2Z2WA 2UZBA 2JDVA 2YM4A 3DV3A 4GS6A 4KBKA 3VS6A 4CT2A 4PP9A 4C3FA 4HVGA 3AC4A 4JX7A 1ZY5A 4CRSA 4U9AA 1PXPA 2G1TA 2QO9A 4FTCA 2UW4A 2OLCA 3LFAA 4XX9A 3AT3A 5IH5A 2ZVAA 3ZHPC 4YU2A 1GAGA 3OVVA 2YIYA 4AGUA 2C6TA 4DLJA 3AG9A 3MB7A 4D5KA 4O7TA 3ZFMA 4EI4A 5C8KA 3FLWA 5DG5A 3QRIA 4LRMA 5E8SA 5D9HA 4FIGA 1JPAA 3FL4A 4O91A 4I5HA 5L2SA 3F5XA 3FMKA 4WRGA 4C35A 4E4LA 4EJ7A 4E6DA 2YDKA 5AV3A 3Q4CA 2GQSA 3HMIA 2Z7QA 4FV2A 1GIJA 2PWLA 4IAAA 4ZY6A 3COHA 4I6QA 3BI6A 1XH7A 5JEBA 1NVRA 3F88A 3OG7A 3W55A 4AA4A 4W4VA 3TNWA 2HY0A 1OL1A 2C30A 3JVSA 3NPCA 4BDGA 2P33A 3EYHA 5A4LA 4G5JA 4D9TA 3Q5IA 5BVWA 4AOTA 5CF4A 3B2WA 4JBOA 1PXMA 3BYUA 3DXNA 2PPQA 1MRYA 1BUHA 4B6LA 4UV0A 3CC6A 3RCJA 5JQ5A 2B9HA 4S32A 3TI1A 3FMHA 3L8SA 4FKTA 4RQVA 4FUYA 4JVGA 5EM7A 5L2WA 2HW7A 2XA4A 2ITVA 1MP8A 3MH2A 4FTJA 4AE6A 3DXPA 4X3FA 5I9VA 2RGPA 5IH6A 2XIZA 1OIQA 2Y4IB 2Y4PA 3R9OA 2XNMA 4DH7A 5HLPA 2IG7A 3LKMA 4G5PA 5CYIA 4DEDA 3L9PA 4NSTA 4MF0A 5FTGA 1HOWA 4ORKA 3P79A 1QMZA 2GTNA 4AZWA 4E6AA 1ZMWA 3DKCA 3MV5A 2JFLA 2VRXA 3TNPC 4A07A 4LOOA 2WKMA 4X0MA 4D4RA 4F9BA 3N9XA 5IQAA 4M66A 5L8KA 3BPRA 2BFXA 4MXZA 3FY0A 3QTXA 5HI2A 5FLFA 1VYWA 3RK5A 2HZIA 4UY9A 3RKBA 3OY3A 2RFDA 4HGSA 2G01A 1XQZA 4QYHA 5DRDA 3FDNA 1XWSA 4J98A 4V0GB 4ZOGA 4RJ7A 4DINA 2A4LA 4DGOA 2PYWA 3C0HA 1OBGA 2CDZA 4QMYA 4FYOA 5HD4A 2XK3A 4BDFA 4BKYA 3QC4A 2HELA 3ANQA 5EQPA 2WXVA 1KOBA 5HG7A 4EHGA 4M12A 3MBLA 4EC8A 4Y46A 4S31A 4RRVA 2QOIA 3ZS5A 3U6HA 3NUUA 3OWPA 3BE9A 4O2ZA 2GS7A 4O7ZA 5KMMA 4L3JA 4XOZA 4MQ2A 5CEKA 2QR7A 1IASA 3H9OA 2W1IA 3HUCA 5HG5A 2JIIA 4RVLA 2OXXA 4PY1A 1BL6A 3R00A 4G9RA 2G9XA 3FAAA 4J8NA 1DS5A 2UW5A 4MD8E 2OIBA 2ZB0A 2YISA 4ZTNA 4QMXA 4LI5A 1W83A 3HDNA 4JG6A 4L45A 3ORIA 4PL3A 2NP8A 3SHEA 3UZPA 4BIBA 5DT3A 2Q0BA 3W1FA 4DCAA 3ZRLA 3RNYA 2GNGA 3T8OA 3IONA 3MPMA 4IAIA 5EKOA 1ZYJA 5HD7A 2OF2A 3R9DA 4AGDA 1WZYA 4J97A 4WNOA 4AAAA 3GFWA 1JNKA 3NYVA 3SX9A 4GK4A 3PSCA 3ZLWA 5M09A 4AN9A 2R3FA 1H4LA 1W82A 2IVVA 3PVWA 5M44A 4P4CA 4WOVA 2BAQA 1W0XC 4QT1A 3ZMMA 4ID7A 3FV8A 3PJ1A 2ZV2A 2R0IA 2W96B 3QCQA 4OTIA 4UXQA 3UODA 3R04A 2WMXA 1YDRE 4C3PA 4C4HA 2NRUA 5IH4A 2BZKB 1UU7A 4BCKA 3AGMA 3E8CA 3R71A 4PX6A 4F64A 4FG9A 1NA7A 2FSOX 2V0DA 2JKMA 1Z5MA 5BNJA 1Q41A 4Q9SA 5HE3A 3G2FA 3HA8A 3MESA 3ORZA 5EYMA 3KRLA 4QQTA 2XK4A 4PMPA 3ITZA 3DZQA 2HCKA 1CKJA 2R3HA 3I60A 3NYNA 3DPKA 2R3QA 4FKVA 4JDIA 3N4UA 3MA3A 1DAWA 4XV3A 2X9EA 2I1MA 5E8TA 4BBFA 5IEYA 2EXEA 4LM5A 4U7ZA 2R7IA 3TUCA 3AT2A 4CYIA 4IWOA 4D1ZA 5I5ZA 3BYMA 1OITA 4BIDA 2R3GA 1IRKA 4R78A 3MA6A 4KBCA 3VAPA 4XG3A 4BYJA 4NCTC 4AXAA 3OTVA 4WHZA 5CWZA 4DYMA 2J0JA 5FM2A 4BCNA 3DK6A 3E64A 4Z7GA 4BYIA 4CCBA 2WD1A 5EM8A 3UVRA 5AMNA 4X6QC 3GU8A 3QTRA 1YI4A 5M51A 2YA9A 4ALWA 4PTEA 5FWKK 3UOJA 5BVOA 4D5HA 3OS3A 3H0YA 3QA8A 4EQCA 2Y6OA 3II5A 4B9DA 5JRSA 1IA8A 3O50A 4F9CA 2ZDUA 5A3XA 2XUUA 4KINA 5CVGA 3PZHA 2UV2A 4F7NA 4IHPA 3WZUA 5A4TA 5J79A 1REKA 4I21A 4K2RA 4I6BA 4MD9E 4I3ZA 2B0QA 3ENMA 3I5NA 4I6HA 2XRWA 3ZBFA 4BI1A 2FSLX 2QOHA 2R64A 4MWIA 3VUKA 2R3NA 2X2LA 4NTSA 1APME 2PZYA 2H34A 4J96A 4BCJA 4OR5A 4CKIA 4X2JA 1O6KA 3DNEA 1Q5KA 2W1ZA 3UVPA 3THBA 1VYZA 4JDKA 4FKPA 3DBQA 5BUJA 4HGEA 4BBEA 4GYGA 5ANEA 3FI2A 3P23A 3R9NA 3P7CA 2HY81 2IVTA 1FGIA 2OJJA 2PVKA 2WQEA 4LGDA 4FKSA 4MBJA 5H9BA 4AF3A 3BU5A 2BHHA 2IZSA 4EH4A 3CQWA 2VTJA 4FTMA 1XR1A 1HCKA 4QP9A 5EYKA 4D4VA 3DXQA 2PUPA 2BZIB 3E5AA 5JN2A 5BYLA 4W4XA 3WIGA 2GNIA 4U3ZA 3C51A 3WF7A 4CLIA 4YZCA 5E8VA 3ZEWA 3KY2A 2XJ1A 3R8VA 2RG6A 3IW4A 4EQMA 4HVSA 3LM5A 4FL3A 3K3JA 3F3UA 4WUNA 4DT9A 4EBVA 3UNKA 4FOCA 3GOKA 3QCSA 3ZZEA 2ITQA 4XLIA 4O0XA 2C1BA 3QRKA 2C6LA 5CU4A 4IE9A 2PVMA 1SNUA 3KKVA 5AUWA 3GT8A 1UWHA 2WMUA 2CKQA 1JSVA 5FTQA 3EN4A 4XEYA 4G6OA 2VTIA 4DE4A 1JKKA 3I0OA 3QCXA 3Q96A 4ERWA 3T9TA 2OBJA 4RIWB 1Q24A 1KE5A 3POZA 3DBFA 4PP7A 4Z7HA 2PL0A 4GT4A 3OF0A 2O0UA 4HVHA 2VTQA 2GFSA 4IH8A 4PPBA 3D5UA 3VUGA 3W10A 3OCTA 3RALA 2JFMA 4MXYA 4JBQA 4E8AA 2I0HA 1IG1A 2JIVA 2QKRA 3PRIA 5I9UA 1SVGA 3SGCA 2C1AA 5FXRA 3TNQB 4DH1A 5AV2A 3UG2A 4MAOA 3BHUA 4C4IA 3A99A 4YNOA 4EOPA 2HK5A 3ZONA 4BCQA 5AUYA 1Q3WA 4IW0A 4C2VA 3IOKA 1I09A 3QLFA 2B9JA 1Q8WA 3LOKA 5IA0A 4DGMA 3NLBA 5FDXA 3V3VA 3OBGA 3MY1A 4YTCA 3DB6A 2W5BA 2NO3A 4MXAA 3LCDA 4R8QA 5H2UA 3DAJA 4FZDB 5JFSA 3EQIA 4M84A 4ZJIA 4HPUE 4M97A 4F7JA 1OIYA 1UKHA 3V5WA 4QP6A 3WILA 4EOKA 1CMKE 3G0FA 3QD0A 3TUDA 5ETIA 3UIMA 3SG8A 3K2LA 3DJ6A 4Z9LA 4F08A 3QQUA 4G34A 5GJFA 4EK6A 4H05A 3QL8A 2IVSA 4UB7A 5EHYA 5T68A 3Q9XA 5BUEA 3D5XA 1DI9A 5LWNA 3DK7A 4FTKA 4O7RA 3PLAE 1U54B 3BEGA 2PVLA 3K54A 4YPDA 3FI4A 2DYLA 1KUTA 4O0WA 3QCYA 3UOLA 3F3WA 2V55A 3ACJA 2V5QA 2FYSA 1STCE 3QD3A 4M67A 2BAKA 2BRHA 3UQFA 4XG4A 5CY3A 4W4WA 2XNPA 3VUHA 3F6XA 5JRQA 3VQUA 4BCFA 3ULZA 4F09A 3NVKI 4QNAA 3NCZA 4D2RA 5M08A 1B39A 1H8FA 4KSPA 3Q2MA 3E92A 4HW7A 3JUHA 4FSUA 4B8LA 3MY0A 2BPMA 4XHKB 3UPXA 4C02A 3I4BA 4CZTA 1Q62A 5E8UA 3VBYA 3SAYA 5IQEA 1F3MC 4QP3A 1H24A 5BVFA 2CNVA 5K3YA 2PUUA 3R7UA 3H30A 4IDTA 4NL0A 4YSJA 3GEQA 4ACHA 4E4XA 4QMPA 4QMZA 2XKEA 4Y85A 5D10A 2IZUA 2VWWA 4XCUA 3WI6A 4DEHA 5BMSA 3ZLXA 2BCJA 2QOBA 2ITXA 3OWKA 4ZTHA 4YJRA 2VZ6A 4I22A 5L2IA 5LVPA 4C62A 3OTUA 4MEDA 4Q2AA 3VJOA 3Q52A 3MVHA 4XP3A 4EWHA 4CGAA 1LR4A 4DC2A 3WE4A 3K3IA 3ZM4A 2X6EA 1M7NA 4X6RA 3WF5A 1VR2A 2J50A 2UZTA 3GP0A 5C8MA 3PXZA 3KU2A 1JKSA 1P5EA 3FKLA 1CDKA 4MXOA 3DLSA 4K11A 2Y8OA 3E63A 4JQ7A 3S1HA 4DTAA 5I9YA 1W84A 4IANA 2CHLA 4RIXB 3HP2A 5FXQA 5L6WL 3TIYA 4NKAA 2PMIA 3MGYA 4N70A 5AA8A 3LLAA 2GPHA 2RFSA 3LIJA 4UMPA 4D2VA 2GDOA 4NK9A 3QUDA 4FTRA 1OVEA 4QTCA 3BGPA 2BTSA 3R8PA 5HE1A 4AS0A 4QOXA 4V0GA 3MDYA 4FF8A 4D4YA 2XCKA 4E5AX 4DTBA 3TJCA 2XNNA 1UU8A 2JIUA 4OTGA 3BLHA 4EH5A 1YI6A 2E9PA 3CIKA 4QO9A 4QQCA 3W2SA 1H1PA 3KB7A 4PDSA 2XKCA 4AX8A 4D0WA 1WFCA 4EZ3A 5IQCA 4H3QA 5IQBA 3PXQA 2W0JA 3VUTA 1RE8A 3L1SA 1M14A 1OL2A 3M42A 3A7HA 3TEIA 3S2PA 3EN7A 3UIUA 4F9AA 3KXMA 2O3PA 2PK9A 3NR9A 3TG1A 3ZO1A 3TNHA 4Z16A 3RWPA 3QZGA 4G16A 4J52A 4BBMA 3HAMA 4BF2A 3KCFA 2J5EA 3NRMA 4L44A 3KK9A 5CAVA 2NNWB 2W1EA 5K4IA 4JG8A 5HQ0A 3UC4A 4CFVA 5F9EA 1ZWSA 1YDSE 4Y8DA 2WFYA 2J0KA 3VBWA 1ZRZA 3CS9A 5J95A 4YZNA 2VWUA 4IAYA 5BQ0A 2CGWA 4G17A 4ASXA 1PXNA 3BCEA 4NUSA 4IC8A 2VNYA 1J7LA 4IADA 4PF4A 3LFBA 2WQBA 5LMKA 2E9UA 3EWHA 4G3EA 3QRTA 2XVDA 4YC8A 4X2KA 3RPSA 3PSBA 3QA0A 3V8WA 4EH2A 5J1WA 4UMQA 3A61A 4PUZA 3NW6A 1PW2A 1P14A 4HZSA 5I9XA 3GXLA 2GHMA 4RFMA 4WRSA 4QYEA 3U54A 2VTPA 5ANKA 1NY3A 2UZOA 3RAIA 2BKZA 2X4ZA 2YM3A 2QQ7A 3EQGA 3BHYA 2VGOA 4YTHA 1ZYSA 5FGKA 3FLSA 2C47A 3SXSA 3R28A 4GVJA 4IX3A 4CD0A 2XM9A 1E9HA 1XO2B 1TQIA 3V6SA 4EOOA 4TL0A 5AR3A 4IM2A 3DOGA 3S4QA 1A48A 4FEVA 5IISA 2F49A 1PMNA 3FMEA 2VO7A 2ERKA 1H0VA 2B7AA 1QPEA 2J2IB 3C5UA 1ZYCA 1ZZLA 3EH9A 4MBIA 4O0VA 4OTRA 3S95A 5A14A 4TTHB 3D83A 3PG1A 4PQNA 5G1XA 2PMLX 3TV6A 5CAUA 5CF5A 5CASA 3AGLA 1ZOEA 2QHMA 5KBRA 3R1QA 3DB8A 4YSMA 3BBWA 4O21A 4BHNA 4YP8A 3NUSA 2WQNA 4TWCA 3UO4A 5FQDC 1ZMVA 2ITPA 4NH1A 3OC1A 1BI8A 3L8VA 4GIIA 1ATPE 5CAPA 1MRUA 3EQBA 3Q4UA 5TT7A 5EI6A 2CLXA 3BGZA 4F4PA 3NGAA 5B7VA 4AFJA 4L46A 4RFZA 3N4TA 5AM6A 5EDPA 4F63A 3V5LA 3QF9A 2OSCA 3CLYA 3BV3A 4OTPA 1H07A 2W9ZB 2VO6A 5M55A 3W8LA 2IO6A 4D2TA 5CEOA 3DKOA 4FIFA 3PY0A 2YIWA 3VS1A 3PUPA 5LARA 1BI7A 3M2WA 3UGCA 5DYJA 3OP5A 4RX8A 3F2AA 1PYXA 3H10A 4MQ1A 2VTMA 3LFFA 4KUJA 4CEGA 1R0PA 3E8NA 2XRUA 4JJRA 2JDTA 4DFXE 3BYOA 1YHSA 3LM0A 2UW9A 2XK6A 3CE3A 3I7CA 3O2MA 4KIKA 4MF1A 1YKRA 4L01A 4OT5A 4R7HA 5C27A 4EK3A 4NIFB 4RFYA 3UYSA 3H9RA 4JL9A 4TN6A 4XOYA 1NT2A 1ZOGA 4AUAA 3UYTA 2Y0AA 3CXWA 2VTTA 3PPKA 4F70A 1TVOA 4X7QA 1FQ1B 1JSTA 2KTYA 3FZOA 3O7LB 3QX4A 4NFNA 3ZU7A 4YJPA 5HX6A 4OTWA 3PJCA 5DLSA 4FOBA 4CSVA 5C26A 1OPKA 3FSFA 3RNIA 3OXIA 3AD6A 2EVAA 2ITNA 3FXWA 4K33A 2UVZA 3QQKA 4LRJA 2BVAA 4BZOA 4FEXA 1BL7A 2XNOA 2YERA 4I0RA 3RZBA 3V8SA 3BIZA 4J71A 2C0IA 4D0XA 3IK3A 4BCPA 5IEVA 4QMOA 3TKUA 3E93A 4RGJA 4H1MA 5HG8A 4TWNA 4L7SA 2VN9A 4DFZE 2HZ0A 4O0SA 4U3YA 3B8QA 3OXTA 4JIAA 4P2KA 4RJ6A 5CVFA 1PXJA 3C4XA 3PRFA 5KE0A 4EOQA 4RIOA 2IJMA 4Q5EA 4FEQA 3UNJA 4FK3A 3ULIA 3QKLA 2R3MA 4GG5A 2OJIA 5CALA 1RJBA 2YEXA 1JOWB 1ZMUA 1OKVA 1YXXA 3R8UA 4TYHB 1OECA 4EOIA 4N0SA 1WAKA 4YR8A 2OICA 5AX9A 5AIRA 5J5SA 4HJOA 3EN5A 5ANGA 4FKOA 3KVXA 3OOMA 4ANBA 4O7YA 5LVOA 4CRLA 4FNXA 4BR3A 4NCTA 3FC1X 1A06A 4EC9A 3OY1A 4RIWA 3W2OA 5TF9A 3LZBA 3NNXA 4LOQA 4CFMA 2EB2A 2VV9A 5LXMA 3UIBA 3W2RA 3KC3A 3S3IA 3SQQA 5BVDA 5CT7A 4GH2A 5ETAA 4BGGA 3H3CA 4R7IA 3NEWA 3ET7A 2QOKA 3F82A 1YOMA 4GT3A 5CU3A 5E8ZA 5JQ8A 2HIWA 3EQRA 3U51A 5M4UA 5DBXA 3GU6A 3R9RA 4JRVA 2YAAA 4FSYA 5AJQA 3PJ2A 3IO7A 5J7HA 2PZPA 1YVJA 4ONAA 2GNHA 2VTLA 3EB0A 4FT3A 4UEUA 4KIOA 1PHKA 5KNJA 3Q60A 3K5VA 4RWKA 5EHOA 2CGVA 4ALUA 4R3PA 4Y5HA 3HMNA 4M14A 4YJUA 5CENA 1H0WA 4E93A 3EFWA 2JBOA 2OKRA 4TW9A 4WBOA 4CMUA 4A4OA 4YJSA 3GC8A 5HKMA 2C3IB 2IWIA 3FZRA 3WF8A 4C61A 4O7VA 3AOXA 1SYKA 4A7CA 3QRJA 5CEIA 3UTOA 1P4FA 4I20A 3RPYA 3ZXTA 4ZP5A 3AMYA 2RIOA 2CLQA 2IN6A 4QNYA 2JLDA 2OGVA 2R4BA 5A6NA 4RIYA 2HWPA 4ZS0A 2QLUA 4GSBA 3PFQA 3UC3A 4O22A 2FGIA 5HHWA 3WIKA 4DGLC 1Y6BA 1U54A 3KRWA 4AT3A 4BCOA 5D7VA 1OKYA 4FV0A 4TYGA 3AC3A 2Z7SA 4BB4A 4QP4A 2IZRA 4K18A 2QURA 5B2KA 3OCGA 1L8TA 2H8HA 4XG2A 3UG1A 2HENA 4R5YA 3SA0A 1DAYA 3HLLA 4QMSA 1Q3DA 3TTIA 3UMXA 5AP0A 4ZZOA 3FXZA 4BKZA 2RFNA 4IWQA 2BUJA 4X3JA 3U9CA 2OXYA 4E4NA 4GFOA 4AP7A 3OROA 3IS5A 1S9JA 2BIKB 5T6KA 5HBJA 1M2RA 4C3RA 5CVHA 4TWOA 4DFUA 4ZLYA 3F3ZA 5HORA 2YLEA 3QTUA 2UZWE 2YJSA 3O7LD 4FV5A 4QD6A 4EH6A 1YOJA 2WU7A 4U97A 4F7SA 4QP2A 4BVUA 4F0IA 5CQWA 3QRUA 2WMVA 3HRCA 4XLVA 5AP2A 4BDIA 5LVNA 1UU9A 2CN5A 1OUKA 3I79A 3C4EA 4WSYA 2IVUA 5JKGA 2J0LA 4ZMFA 2YCQA 3QTQA 5EM6A 3B2TA 1J3HA 1ERKA 5H3QA 3C1XA 1UU3A 2QVSE 1Q8ZA 2WU6A 4OGRA 4MKCA 3FLZA 4BZNA 1UNGA 2B52A 3EYGA 2VWYA 2YWVA 2HXQA 4F9WA 2X81A 3ODYX 4HOKA 4EHEA 4LQMA 5CZHA 3ZOSA 2PE0A 2G2FA 3HYHA 3Q4ZA 4W4YA 2PVRA 5ETFA 1J91A 5DHJA 5HNGA 3PA4A 1YW2A 3TN8A 2Z7LA 2LGCA 4BDBA 2W06A 1AGWA 4UYAA 5EYCA 2PMOX 2YABA 2WIHA 2WTKC 3E7VA 4RVKA 2UZLA 4U79A 5AFVA 1OMWA 3HP5A 3Q9YA 3ZZWA 4FEUA 3ENHA 3KEXA 4M69B 2A2AA 2BRBA 3FZPA 4O7WA 4HGLA 3GQIA 4RIXA 4O83A 4EYJA 3ORTA 3A8WA 4ZZMA 5AV4A 5JH6A 2VGPA 5IA1A 2EWAA 5BPYA 3FHIA 4KWPA 3CSVA 1SNXA 4TZRA 1R0EA 4EZ7A 5AEPA 4CV9A 4AA0A 3Q9WA 3TKHA 2JD5A 2WAJA 3TTJA 2J6MA 2WQOA 4CQEA 3ORMA 4NFMA 4CG8A 1OIUA 4O86A 3ZDIA 4JDJA 4Y72A 1RW8A 5IUIA 4TYIA 2Z02A 5J87A 3JXWA 3LMHA 4O82A 4U5JA 5DH3A 3EJ1A 4MYGA 1KV2A 4YMJA 5GIOE 4X21A 2C5YA 2OFVA 5IMXA 2XZSA 4QP8A 5IQDA 3F61A 3GVUA 4KAOA 4IACA 3FQHA 5CSWA 5EH0A 4BWXA 3PTGA 4L52A 3PXYA 5I3RA 5CF8A 2WPAA 4FSMA 3FEGA 4FNWA 5AUVA 3E62A 3E8EA 3LXNA 2FUMA 3OEZA 2AYPA 3VW8A 2PE2A 1AQ1A 2VWIA 2C6EA 3HV7A 4ZMEA 2YIRA 2H6DA 3WF6A 5IA4A 4JG7A 2PZ5A 2GHLA 2B53A 5CZIA 4C59A 3AD4A 2QG5A 4R6VA 1J7UA 3VS3A 2JDSA 4QTEA 4KD1A 2RFEA 3QD2B 4HYUA 2B9FA 4XNEA 3R8ZA 3E7OA 4QQ5A 5HTCA 2ZOQA 5KO1A 4ERKA 2JBPA 3DLZA 3FYJX 2Q0NA 3MN3A 2XNBA 2A0CX 4M3QA 5EK7A 2H96A 1IAHA 4F1MA 1PYEA 2DQ7X 4NM0A 2BDFA 5CTPA 3CGOA 4Y83A 1BMKA 2ITZA 3IG7A 4FV4A 4JQ8A 4QPAA 5IQFA 2G15A 4O7NA 2WMQA 5GJDA 4G9CA 5A4CA 4AGCA 5FP6A 3LHJA 5J8IA 3BYSA 2BZJA 3MFUA 2J51A 4D28A 5M53A 3R1SA 2GNFA 4FVQA 2PE1A 4L8MA 5F95A 3W2QA 2VAGA 3DBEA 4FZ6A 5D12A 2O2UA 4FX3A 4Y73A 3UDBA 2E9OA 2PVYA 2XJ0A 4E6QA 5ETCA 2X2KA 2VO0A 4E5BA 4MHAA 2C68A 2CKEA 3FLNC 3KL8A 4FIEA 2QG7A 2W1GA 5TO8A 1V1KA 4F6SA 4XG9A 4MNEB 3ZCLA 2OFUA 5C4KA 4CZUA 2VTHA 4QP1A 3DCVA 3ZO4A 4KIPA 4AT5A 2OU7A 5J1VA 3MH3A 3O51A 4K1BA 3R9HA 4U0IA 3AC5A 4EBWA 1H00A 3G6GA 1TKIA 3OUNB 5IA3A 5IA2A 4PRJA 4BN1A 3U6IA 4E7WA 4WBBB 2GNLA 4NT4A 5E7RA 2CGXA 3HZTA 3D4QA 3LXLA 3MWUA 4AW5A 5HOAA 4YJVA 5L2QA 4ZY5A 4KIKB 4PMMA 4IVAA 2JDOA 4WG4A 3MTFA 4GEOA 3KK8A 1G5SA 5AV0A 2AC3A 2R9SA 1GZKA 3EKNA 3LFEA 4F0GA 4YUQA 3CJFA 5TE0A 2R3RA 3NUNA 1QL6A 3FE3A 3P7AA 3GGFA 4ZK5A 3W8QA 4XRJA 1O6YA 5ANOA 3FZ1A 3Q53A 1WVXA 2HXLA 4JX3A 3VQHA 3GC0A 2XKFA 2KULA 4FSNA 4BCMA 5J9YA 2W99B 4CMTA 3EZVA 3BYVA 3EN9A 4WT6A 4L00A 4L43A 3LXPA 3C4WA 2YDIA 4HYSA 5AP5A 2IW6A 2LAVA 3SOAA 5IKWA 4M13A 3B8RA 3MPTA 1NVSA 4J7BA 3QX2A 4UWBA 4D4SA 2PY3A 3SKCA 5AAEA 4NZWB 3CPBA 4R77A 4GL9A 1O6LA 5IG1A 1UKIA 1VZOA 3QQJA 4ZSGA 3JY9A 3VN9A 5L6PA 3NAYA 2X0GA 3QYWA 2W17A 2JAVA 3DK3A 4EQUA 3EQDA 5I9WA 4IZ7A 5KCVA 4U8ZA 5B2MA 2BZHB 3NYXA 5AP7A 3F9NA 2QLQA 3R73A 4N4SA 4F9YA 4JI9A 3CEKA 4G3GA 2ONLA 4NIFA 5CANA 3HV5A 1OIRA 2QONA 3KRRA 4I94A 3ZEPA 1YXUA 5IMEA 4G31A 3KF7A 4NW5A 4IC7A 5CU2A 2CCIA 3DDQA 3FZSA 3WZKA 4D2SA 4PL5A 5AR8A 3R63A 4S33A 4C33A 4FSQA 4R3CA 4D9UA 4LMUA 5JGDA 4E20A 5H8EA 4YLKA 4RZVA 4RC4A 4BWPA 1BLXA 5HCXA 2I40A 3A4PA 4IEBA 3WZEA 2Z60A 2A27A 5HIEA 3ZM9A 3EHAA 3I81A 5C9CA 3DAEA 4X3FC 5BVEA 5HX8A 1M52A 3NNUA 5D7AA 3TNIA 4ITHA 5AP1A 1U5QA 3BE2A 4C4FA 4USDA 3UMWA 3AC1A 2XEYA 3LXKA 5M56A 4DBNA 4Q5HA 1Q99A 4A4XA 4KKEA 4U43A 1OPLA 3D9VA 4APPA 5IU2A 3SOCA 1A9UA 1KE7A 2J7TA 1KWPA 3M11A 4LG4A 1TQMA 4ZSLA 4F65A 2X2MA 3BLRA 4K0YA 4C4GA 4CXAA 5E92A 4TYHA 4EKLA 3QTWA 2PZIA 4WNPA 5IA5A 4W9WA 3P86A 5KMKA 3G9NA 4TYJA 4YZ9A 4B7TA 3ORXA 4ZS4A 2XM8A 4AE9A 3ZO3A 2C3JA 3RVGA 3VS0A 4ZLZA 5JGBA 5GHVA 5H8GA 2ZV8A 4F6UA 2VTRA 3PDTA 4DFLA 4U40A 4QP7A 4AW0A 2OZOA 1YHVA 4AG8A 4EH3A 5EYDA 3TV4A 1QPDA 1H26A 1OZ1A 3W33A 3L9NA 3IECA 5E1SA 3FZTA 3KREA 5LCJA 4ANMA 4O2PA 1CKPA 2FH9A 4G6LA 4JLCA 3QQFA 4AN3A 3BELA 5AUTA 3ROYA 3TXOA 2YCFA 4DEBA 3F3VA 4LOPA 5HGIA 4FA2A 4ALVA 5I9ZA 3FI8A 3D14A 2C5VA 2QODA 3C4FA 2UW0A 4O0YA 3GENA 4I41A 4RIYB 1XBCA 4CFWA 5IPJA 5HIDA 1UNLA 2C6KA 3VVHA 4IM0A 3RI1A 5LMBA 4U80A 3LAUA 4RZWA 3EFLA 5IDPA 5DE2A 3TWJA 5E91A 3RAWA 1FPUA 3N4VA 3COIA 2CJMA 2UW7A 1EH4A 3OWJA 3R1YA 1XH5A 3OW3A 4IWPA 3L9LA 4OTFA 2X8DA 2CNQA 4WSQA 4H1JA 5CSVA 1FOTA 4AW1A 1Y8GA 2OH0E 2X7OA 3MVJA 5CX9A 4NJ3A 4FTQA 1IR3A 4FT9A 4RSSA 4ZLOA 1XH8A 4W9XA 4E1ZA 4E4MA 1OKWA 2BTRA 2JITA 2PVHA 3LQ5A 4QMTA 3REPA 4H36A 3RPRA 2OK1A 2BMCA 3DQWA 3DS6A 5IUHA 5EW8A 4I5CA 5LWMA 3FKOA 4O84A 1SVEA 2C5NA 5TOZA 2JDRA 3PA5A 4I24A 3BWFA 1FVTA 3E88A 4N6YA 1ZAOA 4EK5A 2J5FA 2IPXA 4BWKA 1XBBA 3FMDA 4F1TA 3CY3A 1GIHA 5LOHA 2CNUA 3HL7A 5E1EA 1W7HA 3U4WA 5HBEA 2C6OA 1PF8A 4EOJA 3RK9A 1W8CA 3Q5ZA 3IDCA 3GQLA 4FIHA 5AADA 4EK8A 4FYNA 1WBSA 4EWQA 3MS9A 4MK0A 4IB5A 4II5A 5T3QA 4FT5A 5IQHA 2HWOA 2R3KA 4NYEA 3I0QA 3R02A 3OEFX 5CNNA 3G33A 3LMGA 3UE4A 3AMAA 4MNFA 5FDPA 5EQEA 3MYGA 2BKKA 2YDJA 4D2PA 5KMOA 1OUYA 4GJ2A 3IW8A 3RCDA 3ALNA 3LQ8A 3VF8A 3NX8A 5CXZA 3GB2A 4DEAA 5E8XA 1U59A 4YHJA 1H28A 3VS7A 4OAVB 4FKIA 4WNKA 2CGUA 2OG8A 5HNIX
chains in the Genus database with same CATH superfamily
3ZDUA 3PVUA 3JVRA 3W16A 4M8TA 2R3JA 1REJA 5KHXA 3TUBA 4O4BB 4NM5A 3DQXA 2ZB1A 4FNYA 4PMSA 4RVMA 4PDOA 4M15A 1WBVA 4CCUA 2CPKE 4FUXA 3UOKA 4O0RA 4IM3A 3UZTA 1WBOA 4F1OA 5HVJA 4N57A 2VO3A 4J1RA 3OD6X 4FKLA 5CEQA 5DRBA 2V62A 4ANOA 5HNBA 1PMEA 2BAJA 4JOAA 3NDMA 5JK3A 3G15A 3QGWA 3CP9A 3QHRA 2BDWA 4OBPA 2BALA 4R1YA 4YTIA 4QMQA 5HVKA 4BL1A 2B54A 4CV8A 4RWJA 4XBUA 3O5AA 4QYGA 4DFNA 3W0QA 4O27B 2VU3A 3P78A 3F7WA 4FG8A 1OL7A 2QC6A 4HVIA 3NIZA 4YC3A 2EXCX 4XG7A 3PPZA 4EOMA 2XS0A 4M69A 2ZV9A 5EKNA 4GIHA 3BHHA 3TL8A 3PSDA 1ZARA 4BTJA 5J9ZA 2ETRA 3H4JA 3RTPA 3OWLA 2C5XA 2HYYA 3QYZA 4JR7A 2IW9A 4E6CA 5HO7A 3P9JA 3LCTA 4WKQA 1H1QA 4KKGA 4YBKA 3BLQA 3CR0A 3EFJA 3EL7A 4CZYB 4KNBA 2FO0A 3MTLA 3UQGA 3MIYA 5K9IA 2YCRA 3DFCB 3R8MA 2WTJA 3FL5A 4J8MA 1MQBA 2GQGA 3KULA 3OBJA 4A9YA 1JLUE 3R30A 3CTQA 3FMJA 4FKRA 4TPTA 2P3GX 3WZDA 4AZVA 4BC6A 3DBDA 3PVBA 1OGYA 3O8PA 5GIPE 2YAKA 4BICA 1OI9A 3WYYA 5DR6A 4DGNA 3ZO2A 3MY5A 5GZ9A 4ZTLA 3O8TA 3NUXA 4O4EA 3VWAA 3C13A 4HYIA 3W2CA 4IVBA 3HEGA 3ODZX 2PSQA 4TKSA 4U41A 5K5NA 2WEIA 4BKJA 3VBVA 3KRJA 4C36A 3P0MA 3GCPA 1H01A 4Y95A 5F20A 1XH6A 5KBQA 2HZNA 3WBLA 2QNJA 4DBXA 3ZTXA 2F2UA 4GUEA 3L8XA 1Q4LA 4I0TA 3RINA 1XH9A 3U8WA 4RWIA 4UZDA 1ZY4A 3V6RA 4EYMA 3DY7A 3QUEA 4ASZA 4QMLA 3TIZA 4ARKA 4FL2A 4BDKA 3GC9A 2QD9A 1PMUA 4OLIA 3MPAA 5TKDA 3MW1A 4M7IA 4L68A 4YBJA 4FSTA 4FV1A 3CTHA 2XJ2A 2ACXA 5K0KA 3TDVA 2B9IA 3O8UA 2W1HA 4I4FA 4K8AA 1PXOA 4PDPA 1KSWA 5DI1A 5HE0A 4O96A 2P0CA 4QTDA 1Q97A 1V0BA 5CEPA 1PRYA 1GZNA 2W1FA 1H1WA 1M17A 3TZ8A 2QOCA 4DEGA 4ACDA 4L42A 4HNFA 3D5WA 1CM8A 1SMHA 4QQJA 4YO6A 1NXKA 3KXHA 3ZC6A 3R7VA 1MQ4A 3DJ7A 3L8PA 4IX5A 4ACMA 4LUEA 3POOA 4UYNA 3R83A 3MSSA 3JY0A 4C38A 4FEWA 4IAZA 4IWDA 3VS2A 3HKOA 3QLGA 4MNEA 2R0UA 4CVAA 3VW6A 5M57A 4XH6A 4IVDA 3VO3A 4G2FA 2FB8A 3I6UA 4USEA 2YLFA 1R78A 4XYFA 4UWYA 3GU7A 4IFCA 2W5HA 4FL1A 4EORA 4YJNA 4J99A 5FEDA 4IAFA 1M2PA 3CKXA 4BCGA 3PZEA 4RA5A 3KFAA 4QMUA 4M0ZA 4CFXA 5KMNA 5KKRC 5L8LA 3COKA 4PPAA 5G6VA 4I0SA 1OM1A 2RKUA 1YHWA 4BZDA 4NTTA 2GS2A 1SM2A 3G51A 1Q8UA 3QALE 2C6MA 4CTBA 4QDVA 3ANRA 4FMQA 3TACA 4LL5A 1HCLA 4DFBA 3QKKA 2XIXA 4FBXA 3RP9A 4DG2E 2YM5A 2UZUE 3PIXA 3PG3A 4X2NA 3QZHA 3RK7A 3RM7A 4ZTQA 2AEGA 4TNBA 5ITAA 3SDJA 3SD0A 2W1DA 4CFNA 4KSQA 2QU6A 4DITA 3VHEA 4DDIA 1Q61A 3KMWA 4C58A 3LFNA 2ZV7A 3PJ8A 4XRLA 2QHNA 4CQGA 4MCVA 4UX9A 4DA5A 4EKKA 4IQ6A 1UV5A 4DEIA 3U4UA 4PNKA 4I5MA 1E1XA 2XNGA 4C57A 4ZAUA 3PUFC 3OHTA 5FEEA 4RA4A 2YJRA 3ZBXA 4OAUC 3JS2A 5KMLA 3AQVA 3FWQA 3D15A 1FVVA 4RLLA 4O4DA 3BKBA 2WTDA 4IBMA 5DR9A 5FTOA 4CYJA 4NWMA 5DMZA 4YZMA 5J7BA 1OL6A 2I0VA 2O5KA 5L6OA 1H25A 2YITA 4FKWA 3V01A 3NWWA 4A9RA 2XBJA 3QHWA 2QU5A 4P5QA 4RX5A 5HTBA 2I7QA 1JWHA 2E9VA 2XF0A 1GJOA 5KUPA 3VBTA 2EU9A 2ERZE 3RJCA 4FKQA 4YJQA 4RVTA 5H8BA 1E1VA 3U9NA 4L53A 3TCPA 4PNIA 4BDAA 1UVRA 4RJ3A 2EXMA 3BGQA 3SG9A 3HA6A 5DNRA 2R3OA 2NRYA 1TQPA 1WVYA 3ORNA 2F2CB 3HMOA 5DGZA 5LCKA 3G0EA 2Y4IC 5DFPA 3FUPA 3ZFXA 4LMNA 3M1SA 2GTMA 3PE2A 4FTAA 4D2WA 4DHFA 1NW1A 3AC8A 3EQPA 2XNEA 1T45A 3DFAA 5LMAA 5M4IA 2PTKA 2PUNA 4CG9A 4MD7E 4C8BA 3VBQA 5EW9A 1I44A 4QPSA 1F0QA 2ETMA 4DHJA 4U44A 5C03A 4FKGA 4XS2A 3ML1A 2J4ZA 4ZIMA 3UNZA 2YIXA 4CFFA 3FBVA 4ZJJA 1KE8A 5KKRB 4O7SA 2PVJA 4IXPA 3VBXA 2F57A 4NM3A 4DH5A 1T46A 4E3CA 5A4QA 3ELJA 4ITIA 4UMRA 4HYHA 4DG0E 3TV7A 4YLJA 3TZMA 2GFCA 4YTFA 4GFMA 3I1AA 1LP4A 5AX3A 3OT3A 3DBCA 5LVMA 2XBAA 3P7BA 2OZAB 5HO6A 3FMMA 3LCSA 1H27A 1R1WA 2PULA 3FJQE 3CQUA 5C4LA 3FLQA 5A4EA 1YOLA 4HGTA 4S2ZA 2AUHA 1M2QA 2EB3A 3FMNA 3IW6A 5HVYA 1OKZA 3Q4TA 4JIKA 5KX8A 3GCUA 4WG3A 3FQSA 5IQGA 1J1CA 2BDJA 1MRVA 3ZUVA 3OFMA 3AKKA 4N6ZA 3QQHA 4BIEA 4WA9A 1O9UA 2Z7RA 5CLPA 4DF3A 2UZEA 1QPCA 4I6FA 3FY2A 4GFGA 5CAQA 5IEXA 4FT0A 3ZC5A 2YM7A 5FRIA 1RQQA 5D41A 4BDJA 4TXCA 3PIZA 1BX6A 3SW7A 3TM0A 3A7GA 4GU6A 4MXXA 2OIQA 5AR2A 5LVLA 4R5SA 3HMPA 4XV1A 5EOBA 3LPBA 5JSMA 3IPHA 1G8AA 3E87A 3A4OX 2YIQA 4KA3A 2BR1A 5DOSA 1PXKA 2JGZA 3ZLSA 4FTUA 4B8MA 1JBPE 2O65A 3AMBA 3GCVA 4TRLA 3LW0A 3RPOA 2X8IA 4C37A 4CKJA 5LMKC 3AXWA 4ANQA 2C3LA 3DTCA 4KS7A 4BTMA 2G2HA 5EHLA 5DT4A 4DT8A 2SRCA 3LFQA 4KB8A 4E5WA 4ZY4A 1JAMA 5FEQA 3U87A 5BUIA 5M4CA 1R39A 3HAVA 1Q8YA 1U46A 3D7ZA 4BDDA 3ZLYA 4NW6A 3HGKA 5L3AA 2WTIA 4GUBA 4QTBA 5AV1A 4YURA 4EH9A 1Y57A 4OTDA 4GT5A 5CSPA 4IZAA 1TFFA 4LV5A 4RJ5A 5TR6A 3ERKA 3TZ7A 2JKOA 4TYEA 2DWBA 3QFVA 2GMXA 3MH1A 3V5QA 5HG9A 3FPQA 3VUMA 2ZM3A 5HEZA 4JAJA 4A9TA 4K77A 4GG7A 2C0OA 3BZ3A 4U45A 2WMTA 2ZDTA 3QZFA 2YCSA 4ACCA 2Y6MA 2W9FB 2VUWA 4QYYA 1RDQE 3BWJA 1IA9A 2XIKA 1XH4A 5JGAA 3HRBA 3D0EA 2YHVA 5CI7A 4H3PA 2G2IA 3FI3A 3R7OA 3ZSGA 3GU5A 3C50A 4AW2A 4XG6A 4E73A 5HLWA 4F78A 2F9GA 1ZYLA 2AQXA 2X8EA 2H9VA 1MUOA 3PVGA 4YC6A 5A9UA 4GCJA 5M07A 2RL5A 4AZEA 5ANIA 3QC9A 4FJVA 2A1AB 5EOLA 4AFEA 4DFYA 3HV4A 4JAIA 1R3CA 5FBNC 3V51A 2PMNX 3ZH8A 4BGHA 4O7LA 3IGGA 1P2AA 1VEBA 2YM8A 3R21A 3VIDA 3ZFYA 4BI2A 2JEDA 5FUTA 4GW8A 2P4IA 4IB1A 4V05A 3TZ9A 2C0TA 5CAOA 1PY5A 3V8TA 3QQLA 4ENXA 3A2CA 1FGKA 3KULB 2AC5A 2JKQA 3DU8A 3KVWA 3KXNA 4J95A 2BHEA 4Z55A 1VJYA 2BRMA 3C7QA 3ZUTA 2GNJA 3DDPA 3QWKA 2PVNA 2WB8A 2QR8A 2ZMDA 3PP1A 3R8LA 4APCA 3R0TA 3DKFA 1Y6AA 3FC2A 5F1ZA 4NEUA 2ITOA 3ETAA 3KA0A 4QMWA 4U6RA 3SRVB 3VRYA 4DTKA 4CFUA 3ATSA 5EDRA 2E9NA 3NZ0A 3O71A 3VNTA 2Z8CA 2UUEA 4EUUA 4QPMA 5I0BA 5CF6A 5AA9A 3FQEA 4FICA 4R3RA 2WMWA 3F5UA 3HDMA 4G1WA 4MVFA 5DIAA 5ACBC 3ZXZA 2I6LA 4FGBA 1B38A 4JDHA 5BX0A 3KF4A 2BRGA 3F66A 4ANLA 4BHZA 3G6HA 1JKLA 3P5KA 1LEZA 2I0EA 3WE8A 3UP7A 3UO5A 3BQCA 2XMYA 5GZ8A 2WHBA 3SXFA 3I6WA 2F4JA 5JFWA 1X8BA 2R5TA 4MX9A 2R2PA 3N51A 3KXGA 1OGUA 3PA3A 3R22A 4RX7A 4W8EA 2GCDA 2W1CA 4QEBA 3VUIA 4PDYA 2CKOA 4LYNA 4S30A 3KN5A 4LL0A 5KMJA 2XK8A 4PMTA 4D55A 1L3RE 3GBZA 3PJ3A 2ZM4A 4GJ3A 5L4QA 2OI4X 2Y9QA 2IW8A 2ITYA 2JAMA 4FSZA 2GS6A 4P5ZA 2WZJA 3C0GA 2ITUA 2WEVA 4L67A 5JZNA 1KV1A 4RJ4A 3CBLA 4V01A 4V04A 3Q6UA 1KE9A 2I0YA 3FXXA 3ID6C 1GY3A 1YWNA 2BROA 4XUFA 4LRKA 5HTIA 4GYIA 1URCA 3DAKA 2XIRA 2OH4A 3KXZA 3NNWA 2OJ9A 3VULA 2WTKB 4ZSJA 1JSUA 4MWHA 1Y91A 4HCVA 2ZM1A 4UMUA 2WNTA 2QOOA 2VX3A 4OTHA 3VUDA 1J1BA 3BHVA 3KMMA 4GVAA 3QKMA 3A60A 5D11A 5AIKA 4I1ZA 1GOLA 1WCCA 5A46A 3UVQA 3KMUA 3OW4A 5K0XA 3PXFA 4YGAA 5KZ0A 2FVDA 4FT7A 5HZNA 4I23A 4ZEGA 3FKNA 4LUDA 4XBRA 2ESMA 4B4LA 2UW3A 2CMWA 5M06A 2XH5A 2W4KA 1DI8A 3G9LX 4YJOA 3BU6A 2OJGA 2R7BA 2XP2A 3DGKA 3TKIA 3VS5A 3FYKX 3RM6A 4EONA 2WOTA 3AT4A 4RG0A 5DR2A 2VWVA 3UJGA 4P7EA 4BDEA 2UVXA 3EOCA 4IX6A 3Q6WA 4H39A 3GI3A 2UZNA 3P5JC 3LFSA 3KN6A 3KXXA 2WTCA 3Q9ZA 3FHRA 2J9MA 1PKGA 4QYFA 4UWCA 5E8WA 3NUYA 2X39A 2ETKA 1K2PA 3O17A 4ANSA 2X9FA 3MFSA 3RWQA 4YZDA 5AUXA 1BKXA 4FK6A 1ZYDA 4BCIA 3QXOA 3NUAA 1V0OA 4G3FA 5F4NA 5JZJA 5BYZA 5FP5A 5GNKA 1FMOE 4WO5A 4PL4A 4FV3A 4IJ9A 3AC2A 1YWVA 3BX5A 3F3TA 3O23A 3QU0A 3R2YA 4U42A 4UN0C 2RF9A 4QDEA 3IDPA 4F7LA 1OBDA 3OZ6A 3PFYA 5CXHA 4TNDA 2XCHA 2B1PA 3PXRA 5D1JA 3OCBA 4M68A 2GQRA 2YZLA 4FNZA 4Y5QA 1SVHA 3HX4A 2XANA 3QGYA 2DUVA 4EHZA 4EZ5A 2PZRA 1YRPA 3CKWA 4QMNA 5KMIA 2F7EE 2OWBA 3PY3A 3EKKA 2YZAA 2FA2A 3ROCA 3OOGA 4CMOA 3RMFA 3DKGA 3NNVA 3NAXA 4OBQA 5AM7A 4DN5A 5E4HA 1JQHA 4UZHA 1WVWA 5HE2A 4BI0A 1G8JA 3W18A 4CNHA 3BBTB 2CN8A 4C0TA 3OCSA 5HCZA 4RC2A 2F7XE 1DM2A 3P1AA 3H0ZA 5B0XA 1IAJA 3PY1A 3PYYA 4Z3VA 3D5VA 5L2TA 4EUTA 3F2NA 4CTCA 4PTCA 4KABA 4FIIA 2B4SB 5EI8A 1G3NA 4S34A 2IZTA 4MH7A 2FSTX 3NS9A 4AT4A 4FV6A 3HECA 1G8KA 2XB7A 3C4ZA 4AA5A 2P2HA 1AD5A 1UA2A 4HCUA 4F0FA 2UZVA 2JC6A 2B55A 2X7FA 5HBHA 2XYNA 3CY2A 3D7TB 2UZDA 1K9AA 2XIYA 1FMKA 4FZ7A 5ANDA 4USFA 1FVRA 5CT0A 5ICPA 2A19B 3NMUF 4DCEA 3P4KA 3O96A 3D2IA 3NUPA 1URWA 3HUBA 4AZSA 3DZOA 1OL5A 3EZRA 5GZAA 4IZ5A 2CCHA 1W2CA 3FSKA 4FG7A 4A4LA 1LEWA 5CU0A 3W0OA 3ZUUA 5CS6A 5BYYA 5GJGA 3U55A 4OTQA 4QMMA 5EG3A 3RAKA 4RPVA 2XAMA 2R3IA 4IB3A 5IZFA 4C34A 1B6CB 4BDHA 1YI3A 3NIEA 1PJKA 4NU1A 4H58A 3NYOA 5HESA 3RPVA 4ZTMA 5A6OA 4RT7A 4WIHA 2ZMCA 2C6IA 3O0GA 5FBOA 4AAYA 4UALA 2O8YA 2VWXA 4DH8A 4FZAB 3EL8A 2RSVA 3HRFA 5C01A 3LMIA 1YXTA 3PWYA 3P08A 3QTIA 2VX1A 3R7IA 4L6QA 5EM5A 3SW4A 4IJPA 1UWJA 3QUPA 4FTNA 5ANJA 5HCYA 5BVKA 5BMMA 4BDCA 2C4GA 4FVRA 4FODA 2OZAA 4LGGA 5E8YA 2GU8A 4KBAA 2YWPA 3VJNA 2X6DA 1GZ8A 3BQRA 4FZFB 1WMKA 1GNGA 5AUUA 4ZSAA 3D94A 4IAKA 2VTNA 4D1XA 3UOHA 3F69A 2WTWA 3R1NA 1PKDA 3CD8A 5AP6A 3V04A 4ACGA 3LJ1A 2BFYA 4AU8A 3TJDA 2V7AA 3E3BX 3NW5A 4FV9A 3RHKA 1IEPA 2QI8A 2WOUA 3PLSA 4X3FB 4G3DA 3RBWA 3WZJA 2WMAA 4R7BA 3AD5A 5CQUA 3LJ2A 3IDBA 3EQCA 4FV8A 4L3PA 3UBDA 3MJ1A 4PWNA 2GHGA 4D1SA 4U81A 3RHXA 4X2FA 2P2IA 4FVPA 4YZBA 3GU4A 4YO4A 4WG5A 5EI2A 1LUFA 4ASEA 2W5AA 1Q8TA 3H9FA 1XHAA 3ZSHA 2C69A 3WOWA 5CSXA 3ATTA 3E3PA 1PMVA 3DA6A 2CKPA 5M4FA 5IUGA 3EN6A 4RLKA 3ZRMA 4OUCA 4JBVA 3GCQA 2WQMA 4L9IA 1ZOHA 2PUIA 3CPCA 3VF9A 5J9LA 1G8SA 1ND4A 3TDWA 4MTAA 3TMOA 4XV2A 1F5QA 3GOPA 3A62A 3QD4A 4I5PA 4A06A 4FTIA 4AZFA 5HLNA 2ITTA 4FSWA 4QMVA 4PPCA 3T9IA 5ACKA 5E90A 2DS1A 4WNMA 4XP2A 5IQIA 3RZFA 5J5TA 4KIQA 4EH8A 1M7QA 4FIJA 5AAFA 4ASDA 5FD2A 3R01A 4O1OA 2XK7A 2BIYA 2HAKA 4UXLA 3EFKA 3G90X 3F5GA 4BCHA 4DG3E 5JMSA 4FKUA 2QKWB 5KHWA 4BFMA 1CSNA 3ALOA 3HVCA 3UZRA 4DDGA 4AWIA 4HCTA 4IVCA 3VHKA 3MI9A 4IB0A 4G3CA 4RQKA 3FLYA 4K6ZA 2ZJWA 3SXRA 4AZTA 3C0IA 3LCOA 4FE2A 4RJ8A 3A8XA 3SVVA 2OO8X 3KGAA 5AR4A 4B0GA 2C6DA 4C4EA 4YLLA 4BY9E 5AWMA 2OIDA 1KOAA 4ZSEA 4DGGA 3RGFA 3MH0A 2VWZA 3IOPA 4QRCA 5F94A 5HIBA 4A9UA 4P90A 3QAME 4H3BA 3GFEA 2XKDA 1WBNA 2HOGA 3DNDA 3MVMA 3UO6A 1QCFA 2REIA 4AACA 4ZZNA 4YHFA 2C5OA 3A7JA 4FSRA 2C3KA 2NPQA 2X0PA 4LGHA 4FTLA 5AP4A 3MB6A 4AQCA 1YQJA 2JKKA 3F5PA 3IGOA 3SC1A 5HICA 5A54A 3DT1A 4BTKA 4GRBA 4FR4A 4ITJA 3PPJA 4O6EA 4PTGA 3A7FA 2O63A 1BYGA 3T3UA 3PP0A 4M0YA 5AR7A 4JR3A 2QO7A 3K5UA 3C5IA 3SRVA 3Q2JA 3QBNA 4GMYA 4OBOA 4GV1A 3E8DA 5CSHA 3PE1A 4HNIA 5C1QB 2QCSA 2ZAZA 3ZRKA 3NSZA 2ONLC 3WF9A 5CU6A 1J7IA 3A7IA 3V5TA 4EOSA 4A9SA 1YDTE 4FKJA 2Q83A 3EIDA 4JT3A 4Q9ZA 4DLIA 4HZRA 2J0IA 3QXPA 4RC3A 4AOJA 3CD3A 3ORLA 4IFGA 4YNEA 3S0OA 5EW3A 4FGRA 3CQEA 1CKIA 2VNWA 4YJTA 2OXDA 2WO6A 3JPVA 4JRNA 1OB3A 4I4EA 3I5ZA 4O1PA 1H08A 4EK4A 2VTSA 5HU3A 2PU8A 1JVPP 3IQ7A 3OT8A 3IW7A 2X4FA 3COMA 3KCKA 4J53A 2YACA 4O0UA 5EFQA 3V5JA 5I4NA 3MFRA 1Z57A 4L3LA 3T3VA 2VTOA 4EEVA 4TY1A 3QTSA 3GCSA 4NJDA 3R7YA 1Z9XA 4O38A 4IIRA 4IZYA 3MFTA 2W7XA 1K3AA 2V22A 4GK2A 1XKKA 5FG8A 4EHVA 3L9MA 5B2LA 2WMSA 3R7GA 4ENYA 4GKHA 3KRXA 2QOLA 5K4JA 2WGJA 2VWBA 3EMGA 3GUBA 1FBNA 4KRCA 3F2RA 5DWRA 4EJNA 4BRXA 3BU3A 4G6NA 1FINA 5JT2A 4RBLA 5IF1A 4ZJVA 2QOQA 4YPSA 2ZYBA 3SLSA 4DEEA 4O0TA 5L8JA 4MXCA 1U5RA 2J0MB 3EQFA 4NKSA 3W32A 2F7ZE 3MIAA 4XP0A 2VTAA 1YXSA 4KS8A 3R7EA 1W98A 5DPVA 4I92A 2FSMX 2RG5A 4L7FA 4RWLA 2VD5A 3LFCA 3UQCA 3CCNA 5HU9A 3Q3BA 1PXLA 3VS4A 2VX0A 1JKTA 4YHTA 3LFDA 3QQGA 4KRDA 2PHKA 4IX4A 2UVYA 5KZIA 4GK3A 4EH7A 4C2WA 4FI1A 5DVRA 5AR5A 4LV7A 1PXIA 3FMLA 2V7OA 3ORKA 3WYXA 3BV2A 3ACKA 5E9EA 5HO8A 1WBPA 4W8DA 4AN2A 4JS8A 4JQEA 2WTVA 2WELA 2Y7JA 4AGWA 4CLJA 3KIOC 1QPJA 2ITWA 3LJ0A 3GC7A 1WBWA 4KKHA 3ZYAA 2XEZA 3IKAA 3KQ7A 3SV0A 4F6WA 5EQYA 5DA3A 3NCGA 2R3PA 2P55A 4HVDA 4JNWA 3ORPA 1XBAA 2BRNA 4CT1A 3PWDA 4I93A 4BGQA 4XV9A 4JXFA 4WUAA 1OPJA 3JR1A 5EDQA 4PV0A 3OXZA 4LV8A 2YFXA 3GNIB 4ZTRA 3LE6A 3UPZA 2O64A 4GU9A 5FM3A 1ZXEA 4ZXTA 5CI6A 5DEWA 2W4OA 3HNGA 5FXSA 2XK9A 4OW8A 3VRZA 3WARA 4DAWA 4O81A 2OF4A 1P4OA 2E2BA 2WIPA 3LCKA 4HPTE 4WD5A 5DN3A 3LLTA 4RX9A 4ZTSA 4B99A 5LQFA 3Q32A 1SZMA 2R3LA 2UW6A 2OW3A 2XYUA 3CGFA 4UBAA 5C8NA 1H1RA 4OT6A 3ZSIA 3JYAA 3HV3A 4QTAA 3HMMA 4R1VA 3S00A 3UIXA 3HV6A 5JFXA 2CSNA 2HW6A 4TWPA 3R2BA 1V0PA 2X1NA 2WMBA 3OUKA 2HZ4A 4MBLA 4K9YA 4X2GA 5K5XA 4BTFA 3I7BA 4DH3A 4E26A 4O6LA 1NVQA 2EUFB 4IMYA 1CTPE 5CEMA 3NVMB 3QTZA 1KE6A 3R6XA 3FPMA 3MVLA 1GIIA 1H1SA 2UW8A 1LPUA 5DEYA 3LQ3A 3BEAA 4JBPA 4IDVA 1S9IA 5LJJA 1YWRA 3BHTA 4F99A 5AAGA 3QZIA 5GINE 2W05A 5IDNA 1GZOA 4FTOA 3IW5A 4C7TA 3PIYA 3DTWA 4RMZA 1ZLTA 5AUZA 3C9WA 1U4DA 3MJ2A 4C4JA 2QO2A 4FTTA 4D58A 4FC0A 3RAHA 1WBTA 3DJ5A 1XJDA 4XG8A 4LFIA 5I3OA 4NM7A 3D2KA 5DT0A 2BILB 3C4CA 2J90A 4TT7A 4EL9A 1YXVA 3G5DA 5BVNA 4XMOA 3QWJA 4XJ0A 2PVFA 3F7ZA 2YN8A 3W0SA 5AP3A 3UP2A 3V5PA 2W4JA 1Y8YA 3W2PA 1UNHA 2OJFE 2YM6A 3CJGA 2X7GA 5JFVA 2QOFA 3OMVA 4FV7A 4UMTA 2GSFA 3NW7A 3LVPA 3PXKA 3VC4A 4AOIA 4EOLA 5CNOA 3BRBA 4GKIA 3Q04A 3EQHA 3U6JA 3D7TA 3CTJA 2WMRA 4CKRA 1ZZ2A 3TT0A 4ANNA 2Z2WA 2UZBA 2JDVA 2YM4A 3DV3A 4GS6A 4KBKA 3VS6A 4CT2A 4PP9A 4C3FA 4HVGA 3AC4A 4JX7A 1ZY5A 4CRSA 4U9AA 1PXPA 2G1TA 2QO9A 4FTCA 2UW4A 2OLCA 3LFAA 4XX9A 3AT3A 5IH5A 2ZVAA 3ZHPC 4YU2A 1GAGA 3OVVA 2YIYA 4AGUA 2C6TA 4DLJA 3AG9A 3MB7A 4D5KA 4O7TA 3UDZA 3ZFMA 4EI4A 5C8KA 3W0RA 3FLWA 5DG5A 3QRIA 4LRMA 5E8SA 5D9HA 4FIGA 1JPAA 3FL4A 4O91A 4I5HA 5L2SA 3F5XA 3FMKA 4WRGA 4C35A 4E4LA 4EJ7A 4E6DA 2YDKA 5AV3A 3Q4CA 2GQSA 3HMIA 2Z7QA 4FV2A 1GIJA 2PWLA 4IAAA 4ZY6A 3W0PA 3COHA 4I6QA 3BI6A 1XH7A 5JEBA 1NVRA 3F88A 3OG7A 3W55A 4AA4A 4W4VA 3TNWA 2HY0A 1OL1A 2C30A 3JVSA 3NPCA 4BDGA 2P33A 3EYHA 5A4LA 4G5JA 4D9TA 3Q5IA 5BVWA 4AOTA 5CF4A 3B2WA 4JBOA 1PXMA 3BYUA 3DXNA 2PPQA 1MRYA 1BUHA 4B6LA 4UV0A 3CC6A 3RCJA 1W2DA 5JQ5A 2B9HA 4S32A 3TI1A 3FMHA 3L8SA 4FKTA 4RQVA 4FUYA 4JVGA 5EM7A 5L2WA 2HW7A 2XA4A 2ITVA 1MP8A 3MH2A 4FTJA 4AE6A 3DXPA 4X3FA 5I9VA 2RGPA 5IH6A 2XIZA 1OIQA 2Y4IB 2Y4PA 3R9OA 2XNMA 4DH7A 5HLPA 2IG7A 3LKMA 4G5PA 5CYIA 4DEDA 3L9PA 4NSTA 4MF0A 5FTGA 1HOWA 4ORKA 3P79A 1QMZA 2GTNA 4AZWA 4E6AA 1ZMWA 3DKCA 3MV5A 2JFLA 2VRXA 3TNPC 4A07A 2XALA 4LOOA 2WKMA 4X0MA 4D4RA 4F9BA 3N9XA 5IQAA 4M66A 5L8KA 3BPRA 2BFXA 4MXZA 3FY0A 3QTXA 5HI2A 5FLFA 1VYWA 3RK5A 2HZIA 4UY9A 3RKBA 3OY3A 2RFDA 4HGSA 2G01A 1XQZA 4QYHA 5DRDA 4BJJB 3FDNA 1XWSA 4J98A 4V0GB 4ZOGA 4RJ7A 4DINA 2A4LA 4DGOA 2PYWA 3C0HA 1OBGA 2CDZA 4QMYA 4FYOA 5HD4A 2XK3A 4BDFA 4BKYA 3QC4A 2HELA 3ANQA 5EQPA 2WXVA 1KOBA 5HG7A 4EHGA 4M12A 3MBLA 4EC8A 4Y46A 4S31A 4RRVA 2QOIA 3ZS5A 3U6HA 3NUUA 3OWPA 3BE9A 4O2ZA 2GS7A 4O7ZA 5KMMA 4L3JA