4ANMA

Complex of ck2 with a cdc7 inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
328
Chain Sequence
SSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE II SUBUNIT ALPHA
publication title Discovery of Xl413, a Potent and Selective Cdc7 Inhibitor.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 113
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4anmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4anmA02
2FSOX 4ZSJA 1OBGA 2QOIA 2YM5A 4AF3A 3EYGA 3QHWA 4XG3A 3RHXA 5J1WA 1PXLA 3RMFA 4LQMA 3R00A 5CQUA 4ZS0A 1H01A 2GPHA 4EH2A 2FUMA 3QTIA 4FK3A 3OOMA 3UPZA 2XK6A 5CU3A 4D2RA 4C4IA 2CN8A 1YDTE 4KSQA 4C36A 3IK3A 1OL7A 4HPUE 4XG2A 4CFUA 4FTIA 3BU3A 4XV9A 4HVDA 5L8KA 4WSYA 4FEWA 3A7FA 4FOBA 2RFNA 1WBSA 2UZBA 3TNWA 2DS1A 2C5YA 3H10A 1YHVA 5DRDA 4RG0A 1OPJA 4ZMFA 4APCA 4FMQA 2BRMA 3D14A 5DEWA 1XH4A 4L45A 4GG7A 5AP2A 2FSMX 3F5GA 4YTIA 4MBLA 3FMMA 4MBJA 1NT2A 4TZRA 4JX7A 4O82A 4UMQA 2WOTA 2AUHA 2W1IA 3KB7A 4AT5A 5GIOE 2QR7A 2WMUA 1UKIA 3F5PA 1P4FA 3LOKA 4FVPA 3H0YA 3FZRA 3HV4A 4USEA 3F5UA 1PKDA 3ODZX 4BCIA 5FD2A 3DJ6A 4C0TA 4E8AA 2WQMA 4QP3A 5HE2A 3VS6A 3BU5A 4Y95A 4BI2A 3MS9A 4YURA 2WMXA 2ZV7A 3Q2JA 2R3HA 1V0PA 4DH5A 3DT1A 5HG8A 3IDCA 4NEUA 4DEAA 2W06A 3FHRA 4OTHA 3U8WA 4R77A 2CGVA 3ZBXA 1P14A 3GP0A 3JVSA 3AG9A 3QQJA 1MQBA 1AQ1A 4IX6A 3DB8A 2A2AA 3DS6A 3H0ZA 4LRJA 4NUSA 4F64A 5BUEA 4FTRA 4KBAA 5AUWA 3SW7A 4O7ZA 2QHMA 4KIOA 4W4XA 2OGVA 4JDHA 3FQHA 1FOTA 4D4RA 3QF9A 4UXQA 4YHJA 4ENXA 4I6FA 4O81A 4UWBA 2FA2A 2ITVA 4BBFA 2FGIA 2BDJA 4FL1A 1XJDA 3FLWA 3Q4ZA 4BWXA 5CU4A 5ITAA 2Y6OA 3KKVA 5DRBA 1H8FA 2ZB0A 3L9MA 3CIKA 3RCDA 4HGTA 4KUJA 3U51A 5E7RA 4DLIA 2XM9A 3WZUA 3FZPA 2EB3A 3I0OA 3OHTA 3UQGA 1JQHA 4J7BA 1XH8A 3FE3A 3LW0A 4I6HA 5AUTA 2UW7A 3BV2A 3GU4A 3OT3A 5C9CA 4D0XA 3GCQA 4U3ZA 4O27B 5EQEA 5IQIA 3FMDA 4RPVA 3OWKA 4KA3A 3HYHA 4JG8A 5CS6A 1XH6A 5AR4A 5E8XA 3ZRKA 1ZY4A 3GFWA 5I5ZA 3V8TA 1OKWA 2QQ7A 2Z7QA 1YOLA 2P3GX 1PMEA 4FSTA 4FTCA 1Y57A 4JT3A 3NUPA 4AW0A 2XK4A 3AD5A 3KVXA 1B6CB 5KBQA 5C03A 2IPXA 2YA9A 4IANA 5CSVA 4TYJA 4MF1A 1NVRA 4EL9A 4YMJA 3NAXA 4OTGA 3ZCLA 1I44A 3VJNA 4YLLA 2HZ4A 1H24A 4IM2A 2FB8A 4CKRA 3NCGA 1K9AA 4CG8A 2OW3A 2ZAZA 3DKGA 2JKKA 2XEYA 5IZFA 5HVKA 2GS6A 2QNJA 4MYGA 3POOA 1UNGA 4ZK5A 4GW8A 5J5SA 3P78A 3PVWA 3WYXA 4YTCA 3QKKA 3R7YA 4EC9A 3WILA 5DN3A 4IAZA 2HK5A 4LOPA 3MJ2A 4M0ZA 3SQQA 3CE3A 3I5ZA 4AW5A 3EQIA 2X6DA 4ALUA 4BTKA 4QMQA 2WMVA 4L46A 3I79A 3AC2A 3H9RA 3MW1A 2B54A 4GU9A 2UW4A 2DWBA 2YDJA 5H9BA 4D58A 4YZBA 2C0TA 4TYHB 3GT8A 1WBOA 4ARKA 5IH4A 3I7BA 5EI8A 3LHJA 4U42A 2QOLA 4QP6A 4O91A 4GKHA 4CV9A 4AFEA 4C4JA 4DH3A 1RW8A 5HBHA 3UDBA 4JG7A 2PZIA 3K5VA 5EK7A 4B0GA 2P55A 3V8SA 1BX6A 3HECA 2ZM1A 5D10A 4LOOA 4O7LA 4UMRA 2Z7LA 1MRUA 3GVUA 4IDVA 4XOZA 2GNIA 4TYIA 2UW3A 3LCSA 3OXZA 4RWIA 3RINA 3ZTXA 5ICPA 2RG6A 2A19B 1G3NA 2G15A 3HKOA 2QKWB 3HRCA 1KWPA 3DNDA 5EM8A 4FSZA 3C4FA 3KXZA 2IWIA 5CZIA 1MQ4A 5HTIA 5L2TA 5A14A 3PIXA 3DQWA 3FLZA 4PDYA 2X8EA 3KK8A 4FT0A 4X21A 4ZZMA 3TZ9A 2GCDA 3ORNA 2QOBA 3BGQA 3ZZEA 4R7BA 4CTCA 1SMHA 4G6OA 1GZ8A 2W5BA 5J9YA 5CT0A 1ZAOA 1YXVA 3AGMA 2O64A 3T9IA 4XS2A 1P2AA 2XNEA 4R7IA 4GG5A 4IWOA 3TCPA 4YUQA 3DLZA 1CTPE 4FIGA 2ERKA 2J9MA 2WQOA 2XUUA 2ZM3A 4ID7A 2YACA 3LE6A 3UBDA 4QMOA 4QYFA 3H9FA 4OTRA 2YFXA 2I7QA 2UW5A 4FKJA 4AU8A 4RJ7A 3RAWA 4GEOA 3BCEA 3CKWA 1CKIA 4ZTRA 2BRHA 2C5OA 1MP8A 5FQDC 5J9LA 4O7YA 4Y5HA 4L9IA 4GK3A 5E90A 5EW3A 2BCJA 2VGOA 4JQ7A 1CDKA 4XG4A 2OJIA 2UV2A 4BCFA 4O38A 4QQ5A 4UEUA 3VS1A 4MKCA 3QLFA 4ZTMA 2C0IA 4JJRA 3PP0A 4IZ7A 4QP9A 1G8AA 1OPKA 2W05A 5FRIA 2OH4A 2BHEA 3LFNA 1PMUA 5A4TA 1RJBA 2OZAA 2UZTA 4UY9A 4CVAA 2XNGA 4ZP5A 4CMUA 3SDJA 1ZWSA 5IQAA 2F7XE 2XJ0A 3NW6A 4JQ8A 3W16A 4X2NA 2JDRA 1NVQA 4QMPA 1V0BA 1REKA 4L01A 2OXYA 4NL0A 3HUCA 1Q4LA 5ANGA 3OTVA 3WI6A 4FKWA 2ZYBA 4ANNA 3OWJA 3P5KA 4ACCA 2BUJA 4P90A 1KV1A 2OXDA 1ERKA 2FSLX 3DBFA 4IZ5A 5AR5A 4CMOA 5H8BA 3UVPA 4E3CA 4Z7HA 5IKWA 3ALNA 3DBEA 3F69A 2YERA 3ULIA 4KKEA 5CEIA 3G0EA 2YIYA 5EYKA 1BUHA 3EN9A 3QRTA 3AT4A 5D7VA 5J8IA 1GZOA 2R3LA 4RQVA 3P79A 1XWSA 1GOLA 4WG5A 1ZYSA 4AUAA 2VTTA 4CNHA 5C4KA 3KN6A 3WF6A 4O21A 3R7UA 4ZJJA 4ZMEA 2E9NA 1SVGA 5FP5A 4JDJA 1U54A 3EKKA 3R0TA 1WAKA 3EQBA 1SNXA 1ZYCA 3R83A 4J98A 3QD2B 3R71A 3UZTA 4M12A 3UVRA 2VX0A 3OY3A 4O86A 2VTIA 2WMSA 3QGYA 2PVFA 3QXPA 5CXHA 2ITPA 4QPSA 5FTGA 4XRJA 5HHWA 3BX5A 4QMUA 3ZBFA 5A6OA 1SM2A 4IB0A 1ATPE 4NZWB 3OFMA 2VRXA 4UWCA 4ZJIA 2BDFA 1T46A 2C3IB 4F70A 2VWIA 4IEBA 2CKOA 2X6EA 4PMPA 4YSJA 3PZHA 3R01A 4LYNA 4RFMA 5LVOA 4FV3A 3COHA 5CTPA 3E92A 3I6WA 3NUYA 5EDQA 5B2MA 3U6IA 3LMIA 4IFGA 3AMBA 1OIYA 3EWHA 3I4BA 5EYCA 4YJOA 1OIRA 3U4UA 4AA5A 4HVGA 4KRCA 1Q8WA 5CALA 2WU6A 5LMAA 3Q96A 3N4VA 4IB1A 3R28A 2F7EE 3QQHA 1OBDA 3FQSA 4WA9A 4CFWA 4DE4A 1JPAA 3BYOA 2E9UA 3S00A 4BDAA 1OB3A 3CCNA 3Q52A 4PNIA 5FLFA 1H1WA 4GIHA 2XZSA 3MSSA 3DBQA 3KREA 2XJ2A 4V04A 3MGYA 3PXYA 2REIA 1Y6AA 5HLPA 3FPQA 3H4JA 3V3VA 2J6MA 5I3OA 2OWBA 2JIVA 4CFXA 4AFJA 3F2RA 3IDPA 4DH8A 3D4QA 3R30A 4ZY4A 3RALA 3MH1A 3P1AA 4O0UA 4UB7A 2HW7A 2YM7A 2IN6A 3AMAA 4L3LA 3HAMA 3DXQA 2WTDA 2GNGA 4S30A 4J53A 3ZU7A 3WOWA 4CEGA 5A6NA 4DGNA 4U80A 3DDQA 5A9UA 4F7LA 3BU6A 4CRSA 3VUGA 5C1QB 4Q9ZA 3D7ZA 5HCZA 2ZDUA 4M7IA 3NZ0A 3R1QA 4YJVA 4S2ZA 4BICA 3ZONA 1Y8YA 2CLQA 1WFCA 2EUFB 5A4EA 4AA0A 3ZO1A 5IA3A 3GENA 5JSMA 2VTPA 1FVVA 3Q53A 1OI9A 1W8CA 3MPAA 4PPCA 4ASXA 2CKPA 1Q8YA 5AUZA 1O9UA 4V01A 3R9NA 4LV5A 4Q9SA 3W2OA 2B9JA 2PYWA 4KINA 5AAEA 1MRVA 3DNEA 1DAYA 3TL8A 3E64A 4OBQA 2ITYA 4HGSA 4ITJA 2ITWA 4FIJA 3V04A 3BKBA 4DT9A 1O6KA 4EOSA 3FDNA 1FGIA 3BQCA 5JRSA 1M7NA 3MDYA 3VUMA 3S4QA 3WF8A 3LFQA 3FI3A 3R21A 4MNEB 4NTTA 2UZVA 5HU3A 2GHMA 2X1NA 3TM0A 4DCEA 1M52A 4O0VA 2ZMCA 4CV8A 5LVPA 5CSHA 4W8EA 2HZNA 3ERKA 2IVSA 3BIZA 3IW7A 3LFDA 3VF9A 4BF2A 2C5VA 3SA0A 3BHTA 2JFLA 5KMOA 1OL5A 2EXMA 4FT9A 3DK6A 2BIYA 4WHZA 4GT5A 3BLRA 4FF8A 4D4VA 4J1RA 5IQCA 2R7BA 3LQ8A 3OOGA 4JL9A 2VO7A 4YJNA 3UC4A 5JH6A 1WMKA 1XH7A 1DM2A 3KRXA 1W98A 4AGCA 3KF4A 3Q2MA 3U54A 2OBJA 3HAVA 3W2SA 3QQLA 3UIXA 2HAKA 2YWVA 5J87A 5EOLA 2J0LA 5M06A 2VTJA 4ZY5A 3HP2A 3U6HA 4CKIA 3VWAA 4DH7A 2RL5A 1Q41A 3EN4A 3R22A 4FV9A 4XYFA 4BN1A 4EQUA 1UWJA 4NWMA 5E8UA 3S95A 4WBBB 2BIKB 3VBTA 1DS5A 4YLJA 4J71A 2JDOA 1YHWA 3D9VA 2Q0BA 1IASA 5FXRA 5IA0A 1PJKA 4Q5EA 3Q04A 4GJ2A 3RK5A 4MXZA 3SOCA 2XK7A 4F9CA 2YDIA 3NNXA 2XNNA 1H28A 4H36A 4NM3A 5CI6A 4I92A 1UA2A 2IVUA 2AYPA 3WF7A 2ITQA 3ZZWA 5M4CA 1J7IA 3MTFA 3D94A 3RM7A 2XEZA 4E4NA 5T3QA 5DR9A 4ZSAA 3OCBA 4CMTA 4LGDA 2VN9A 3SW4A 5AIKA 4IX4A 2GQGA 1JVPP 3HV6A 2QLUA 4ZXTA 3UNJA 4AZTA 4XLIA 2UW8A 3E3PA 4EK3A 3TTJA 2PUUA 2YISA 2OFVA 4FC0A 4XV3A 4C3PA 2WFYA 4GCJA 5AR3A 4E93A 1FMOE 1H0VA 3IPHA 3NX8A 3PY3A 4IQ6A 4LRKA 4P4CA 5CSWA 5JFVA 4E4XA 4QTCA 2VWVA 1ZARA 4O1OA 5I9ZA 5IA2A 2UVZA 3PIYA 4FKPA 4KSPA 4ALWA 3LFEA 2QODA 4I21A 5IUIA 4BTJA 3VW6A 3ZRMA 2VD5A 3II5A 5IEYA 3VS3A 4DBXA 4G3FA 4QMMA 3TZ7A 4ANMA 4FZFB 5DR6A 4D9UA 3PVUA 3C4WA 5CNNA 4K1BA 3QZGA 4MHAA 3O8TA 4DFZE 2J0IA 3C13A 3KRJA 4X6QC 5CWZA 4PWNA 4FTNA 2GFCA 3EQFA 2WU7A 5BQ0A 3SOAA 5IDPA 3MFSA 5F20A 4FTAA 2C30A 3GNIB 5AV1A 3RWPA 4BVUA 4XEYA 5M44A 3K3JA 4H3BA 3EQRA 5KO1A 3QCYA 2YIXA 5KE0A 4RX8A 4MAOA 1U46A 5JFSA 2HWOA 4KKHA 4PY1A 5K3YA 5FWKK 3ZM9A 3T3UA 1QMZA 2R0IA 4YJUA 4NH1A 4BCOA 4R7HA 4FGBA 4RFYA 3SRVB 3TNQB 4CGAA 4KIKA 4UMPA 3KCFA 5IEXA 4UX9A 2B55A 4X3FB 1GJOA 5C01A 2ITUA 5IQHA 2WNTA 4RWJA 4C58A 2WTCA 1HCLA 2GSFA 3RCJA 4FGRA 2XNBA 5EHOA 3E8EA 2R3RA 4EKKA 2F4JA 2C3KA 3W2CA 4AAAA 3M11A 5I9YA 4FVQA 3PJCA 3TZMA 2NP8A 2OJGA 4HYSA 4I4EA 5HGIA 2FVDA 3T9TA 4NKAA 3UYSA 5IA4A 4I23A 3P7AA 4N6YA 5JFXA 2W1FA 4YZNA 3ZFXA 2GNHA 3VQHA 4X2GA 3C4ZA 4GT3A 3TI1A 4BTMA 3V6RA 5KKRB 2PU8A 5FEQA 5CY3A 3BEAA 5EDRA 2HZIA 4BCNA 3L8XA 1YW2A 2G01A 5HORA 4J52A 3KXNA 4MEDA 3UOKA 4I5CA 4FK6A 5AP1A 5CF8A 1JKSA 3R9OA 1OITA 3VUDA 2BZJA 1B39A 3EN5A 3F2AA 4CQGA 4FL2A 4XP2A 2I40A 5D9HA 2XKEA 3AD6A 3P0MA 4YHFA 3R8LA 5BPYA 5AFVA 3GQIA 4QYHA 4IC7A 3V6SA 4GYIA 5A4LA 3OCGA 5B2KA 3RJCA 4I1ZA 3VC4A 3LLAA 1BLXA 3LFBA 2VO3A 3PSDA 2ZB1A 5H3QA 5KNJA 4FSNA 4RIXA 4MD7E 5HG7A 3OW3A 3E5AA 3MPTA 4XBUA 3Q4CA 3QRIA 3MPMA 1FINA 2R3PA 2ETKA 4XH6A 3V5WA 3W8LA 2VNYA 3RWQA 4TNBA 3JPVA 1CMKE 5EFQA 3NIEA 3EJ1A 3GU6A 2HWPA 4L3JA 3QWJA 3GCVA 4PDSA 3C50A 1OPLA 4A07A 3GUBA 3QCQA 1GZKA 3FZOA 2XNPA 3KQ7A 1OIQA 4B99A 3DJ5A 4A06A 2YZLA 3COIA 3OTUA 3W8QA 3EFWA 4O22A 4MNFA 3RPYA 3ID6C 3EQCA 3PJ3A 4GVJA 4X3FC 2YABA 2XA4A 2YJSA 1L8TA 4IAKA 1BYGA 3HA8A 1X8BA 5FXQA 4BGQA 1R0EA 4OT6A 5FM3A 3BYMA 1LP4A 4F1TA 5JGAA 2JLDA 4EOPA 4ZLYA 4DBNA 4BRXA 3EQGA 2HYYA 1WVXA 4NKSA 2R2PA 2GU8A 4F9YA 2WEIA 3EHAA 4NCTA 3BLQA 2XIKA 4H05A 2R0UA 3I6UA 3WZKA 4FNWA 1M2QA 3PFQA 4GMYA 4HPTE 2Y4PA 4BBMA 2WXVA 3WYYA 5EKNA 3Q9ZA 3GU8A 1IG1A 1HOWA 1PYEA 2VTNA 2XCHA 2C6EA 1J7LA 4WO5A 1YOJA 4J8MA 4O0SA 3HGKA 5CVHA 4FSMA 2Q83A 3ZDUA 5TF9A 3QCSA 4NFMA 4BC6A 4QMLA 4Z55A 3F3WA 3FLYA 3Q9XA 4TT7A 4KBCA 4FG9A 5HIEA 4TPTA 3QA0A 1OUYA 2I6LA 3R9RA 4FKRA 4K0YA 3KFAA 2I0YA 3QFVA 4MQ2A 5I9VA 5IF1A 3Q60A 2CSNA 1PXKA 3IOPA 3PZEA 4FTMA 1Q3DA 5IPJA 2W1GA 4WNOA 3LIJA 4KRDA 4AP7A 3E3BX 2W4KA 5HLWA 5HCYA 4YTHA 2W4JA 5IH6A 4YPSA 2YZAA 3F6XA 4M66A 5DPVA 3GC0A 5A4CA 3ELJA 5CF5A 2GTMA 4BIDA 5EW9A 5HBJA 3DU8A 3MFTA 5G6VA 2CKQA 1J3HA 1H1RA 3VS5A 2VTLA 3C4CA 3OC1A 4X0MA 4AE6A 3Q4UA 4YC3A 5HEZA 2XYNA 5KZIA 5KMIA 3ZO4A 1XQZA 3NWWA 3LQ3A 3ZXZA 3ZFMA 4FTLA 3CLYA 2A1AB 4FV6A 4AZWA 3W10A 3U55A 4I22A 2WTIA 4PTGA 4BCJA 4CLJA 3ZRLA 2YWPA 3R73A 2W9FB 4MD8E 3FMJA 4NCTC 4AOTA 2YIWA 2E9PA 3JVRA 3AOXA 5F95A 3EB0A 1ZRZA 2YIQA 3NYOA 4FSRA 4WNKA 3KMUA 3CD8A 4QPAA 1ZMVA 3BYVA 4LFIA 4XG9A 1SYKA 1GNGA 3O51A 3MY5A 2BAJA 4RIYB 2IJMA 4U44A 5M51A 2I0HA 4M67A 1PY5A 3HDNA 4NT4A 2W1CA 5LMKC 4IIRA 5L6PA 4YO6A 2F7ZE 2UW9A 2H34A 4FV2A 4FUYA 3UMXA 1IEPA 3QA8A 2E9VA 4RC3A 4FV5A 3E62A 3QQKA 4NM5A 4RBLA 5GZ8A 2WTKC 4MXOA 3N4TA 4RJ3A 4UYAA 2R3JA 3E8CA 5HQ0A 4L42A 2QHNA 3BWJA 4IFCA 3RAHA 2XVDA 3ZS5A 5J7BA 2OKRA 5HX8A 1UU8A 4JNWA 3OCSA 1T45A 5J79A 4IE9A 4GS6A 5DG5A 3ORTA 4PP9A 4ERWA 1JOWB 2YDKA 4AXAA 4RGJA 2BALA 4QMSA 3QTRA 3W32A 3UQFA 3NMUF 3NW7A 3PE1A 2LAVA 4XV2A 5BYYA 5L2QA 3A7HA 1UU3A 4TWOA 2WMRA 2XS0A 4RLKA 5EH0A 4OW8A 4ANOA 2PVNA 4N0SA 3RK9A 4X2FA 2X4ZA 3TKIA 1ZYJA 2W96B 3HV3A 3Q9YA 4WUAA 3WZDA 4Z16A 2VX1A 4DTBA 3ORPA 2AC3A 3VNTA 2HCKA 5FEDA 1BI8A 1ZLTA 3FMEA 4PL5A 2WZJA 4UXLA 5FP6A 5HO6A 3S3IA 2O65A 2HENA 3MVJA 5M55A 3FC2A 3M1SA 4OBOA 4IC8A 5EI6A 5KBRA 3IECA 5JZJA 2O0UA 1W84A 3TDVA 3F3UA 5CEPA 3IKAA 3GBZA 5ANOA 1QPCA 4B9DA 3FLQA 4GJ3A 1GY3A 4FTKA 4ITIA 5BVKA 3UZPA 4C34A 2QO2A 3EFKA 4I41A 4CRLA 1VZOA 5AA8A 3QQGA 2ESMA 2ZJWA 4CG9A 2J90A 4XLVA 3FSFA 3PWYA 2Z7RA 3C4XA 4IVCA 3FXZA 3QU0A 5CLPA 3KN5A 1E1VA 3DAKA 4FNYA 4FIIA 5A46A 2A4LA 2O8YA 3QUDA 3QUEA 5EYDA 4XP3A 4YPDA 1IAHA 3F7ZA 3NYXA 4A4LA 1WVWA 3OS3A 4DINA 1GIHA 4FR4A 5E92A 3RM6A 4R5YA 3NUAA 3GXLA 2YM8A 3QD3A 4I5PA 4UYNA 4RC4A 5BUIA 2PZ5A 5JRQA 3PXKA 3SXFA 2Z60A 2HY81 3E88A 3HRFA 4N6ZA 1KOAA 3MJ1A 5IMXA 4L44A 3LQ5A 3VS4A 5JGBA 2W7XA 4CYJA 5M07A 1M2RA 3COKA 1H1QA 4E6CA 4L00A 3BYUA 2JBOA 5ANKA 5G1XA 1Q62A 4QTBA 4CFNA 3CP9A 3DCVA 4AZFA 3G2FA 3H9OA 1YXUA 5GJFA 1LEZA 3VJOA 2J0KA 4W9XA 4S31A 3KXMA 3QZFA 4M68A 4NM0A 4G3CA 3C0HA 3BLHA 3P9JA 3KRWA 3DJ7A 5ANDA 4DEHA 3PXQA 1WBTA 3PXRA 2JC6A 3FI2A 3FEGA 3KULB 4QP7A 3KU2A 2B4SB 3N51A 2PPQA 4RIWB 4GFOA 4AN2A 4RT7A 5CXZA 5M56A 1J7UA 5E4HA 5CEOA 3N9XA 3PRIA 3OUKA 5E8YA 1UNLA 3RI1A 4FA2A 4FKUA 4O84A 1PXMA 3V5PA 3B2TA 1BI7A 2G1TA 2PUNA 5FTQA 4E73A 3O23A 4Y5QA 5K0XA 4RWKA 3DKFA 2DUVA 1STCE 4IB3A 5CX9A 3ZXTA 1YHSA 2QLQA 4PPBA 5IQFA 2VAGA 4ZLZA 2VO6A 4OTIA 4AN9A 4ZJVA 4QP4A 5E8WA 3MIAA 4D1ZA 4R3CA 4BYJA 5M57A 3DAEA 3R7EA 1VYWA 2VTMA 3KL8A 1YI3A 2JBPA 1YDRE 2H9VA 3QKMA 1EH4A 3R6XA 3O96A 3SKCA 1YOMA 3CQUA 2XBAA 3H3CA 4TYHA 4XV1A 4FZAB 5CF4A 3LJ1A 1Q61A 5CEKA 3VUKA 4WOVA 4EUTA 3V5JA 3OROA 4K2RA 4DTAA 2QG7A 5BYLA 1Y6BA 4RLLA 2C6KA 2PSQA 3FLSA 4FG8A 4FBXA 2UUEA 3MN3A 3HMOA 2W9ZB 1H27A 4FKTA 4IAIA 5BMSA 4GK2A 4HZRA 1YXXA 2WEVA 4RA4A 4LL5A 2C3JA 5ACKA 3G33A 1OM1A 4K18A 3PA4A 4FTQA 2XKCA 2BVAA 4GVAA 2FYSA 2XP2A 4FOCA 2QO7A 3RAKA 3LXNA 3A7GA 2CCIA 4EHEA 3NRMA 3D5XA 4C61A 2Q0NA 2WELA 4FKGA 2XBJA 2P4IA 4D2PA 5JMSA 3LCKA 3TWJA 2FO0A 5J9ZA 3BI6A 2XK8A 4FYOA 2GHLA 4DN5A 3CGFA 4U5JA 2QG5A 2W4OA 2JKQA 3O71A 3QD0A 2WMWA 4AGWA 2GDOA 3QHRA 5FXSA 4MXXA 1JSVA 1Z9XA 1CKPA 4AX8A 4RWLA 3D5WA 5LWNA 4Y85A 4M69B 3IS5A 4MXCA 2HIWA 3V8WA 4DG2E 4RZVA 3HV5A 2PVKA 4FYNA 1Q97A 3HVCA 2C4GA 3DPKA 3MH3A 3OXIA 3W2QA 1RQQA 3UP7A 1NVSA 2X9FA 4S32A 1PKGA 3QRKA 2WOUA 4K77A 4TWPA 4BKZA 5CT7A 4JDKA 5HZNA 3R7OA 4BCGA 4F7JA 3VS0A 4QP1A 3ZDIA 5FEEA 3AD4A 2GMXA 3AT3A 5EHLA 4DH1A 1G8SA 1JBPE 4U0IA 3ROCA 3COMA 4BFMA 4D1SA 5DEYA 5A3XA 4EYMA 4L68A 3HL7A 4CZTA 4BI1A 1SVHA 4JVGA 1NW1A 5GZ9A 2BKZA 4CT2A 3L1SA 4KS7A 4HCVA 4FNXA 3CXWA 3TV7A 5CAUA 1JKLA 3UE4A 4MH7A 3CBLA 4C3RA 1Q5KA 4JDIA 5EG3A 4EHZA 4OAUC 1J91A 4CYIA 2WMQA 4O1PA 4FVRA 2BILB 5HCXA 3SHEA 1M7QA 3PLAE 4UMTA 3FQEA 4EONA 2WAJA 3L9NA 4H3QA 4NIFB 4OLIA 5ANJA 3RKBA 3ZC6A 4BZDA 2Y6MA 4V05A 1IAJA 4QP2A 3R02A 3LFCA 4K6ZA 2WPAA 3PVBA 2C6LA 3ZHPC 4A9SA 4QTDA 3ZO3A 4L52A 5HKMA 5CEMA 3M2WA 3U6JA 4HYIA 3O2MA 4JBVA 4ERKA 3LXPA 1F5QA 4AZEA 4UMUA 1OGUA 3NS9A 4LGGA 3JS2A 4GU6A 1Q8ZA 3V01A 3QQUA 4I94A 2YLFA 2WMTA 2PVMA 1OKVA 3IDBA 4DAWA 2B9HA 3ALOA 1BL7A 4NFNA 4K9YA 4XHKB 5AWMA 1YWNA 1KE8A 3KRRA 3GCPA 4IZAA 5DMZA 2OJ9A 3C1XA 4UALA 5KMNA 5AAFA 4PP7A 5HVJA 5M08A 4IH8A 4MTAA 4DTKA 4FI1A 1URWA 3BHVA 4UZDA 4A9RA 4O7WA 2PY3A 3R04A 4KD1A 2VTOA 3R2BA 4RFZA 2NNWB 5HIBA 5DWRA 5LARA 4M15A 1TKIA 2I0VA 1VJYA 3ORXA 4W4VA 3R8PA 3RVGA 3GOKA 4GKIA 3FKOA 3PSCA 5HI2A 4C38A 4EYJA 4DF3A 1FQ1B 5AUYA 4G9RA 3ETAA 3GI3A 2RGPA 4A7CA 1UKHA 4AW1A 5BNJA 3IOKA 1PMNA 3L8SA 1GIIA 4EH8A 3O17A 4C33A 5K9IA 2IW6A 3ITZA 1V0OA 2J51A 4U8ZA 4Y73A 2BROA 4PDOA 2UZNA 5AJQA 1PMVA 2OLCA 1Q8UA 4YSMA 3DFCB 3NNUA 5CYIA 4D4SA 2PL0A 3I81A 1OL6A 3GFEA 5IU2A 4NU1A 1U5RA 4FT7A 2PHKA 5TKDA 5KMLA 3P08A 4OTDA 4R3PA 4V0GB 1OL1A 4Y72A 4WNMA 3HDMA 1JNKA 5HBEA 5C8KA 1FBNA 3HZTA 3C4EA 5LWMA 5ANEA 3Q5IA 2HXQA 2VWUA 3ROYA 4JR7A 3ENHA 3ZEWA 3A7JA 3EN6A 4DC2A 5K5XA 1QPJA 5HESA 3Q32A 4FIHA 4FSWA 3LCTA 4F7NA 1FGKA 4IWQA 2JDTA 4PDPA 4L7FA 4E4MA 3CGOA 5J1VA 3NYNA 3NW5A 4O2PA 4RZWA 4F99A 2J5FA 4D2WA 4EOMA 2X8IA 3P23A 2NRYA 2V22A 3HNGA 3V5TA 3VQUA 2JAVA 4YP8A 5D1JA 3UTOA 4CXAA 3EZVA 3PPJA 4WUNA 4RVMA 3UO5A 4A9YA 3EQHA 4YTFA 4G6LA 4C4GA 5FM2A 4BL1A 2BZKB 3LJ0A 3Q3BA 3ORMA 4YZ9A 2IW8A 4EH6A 3PLSA 3POZA 3QX2A 4FODA 4QNAA 4DGMA 2OZOA 2KULA 4YZMA 4OAVB 4CFFA 4FTTA 3E87A 1IR3A 1R1WA 3LKMA 4E26A 3AC8A 3DOGA 3FL5A 4J8NA 5M53A 1NY3A 1KE9A 3NNWA 3OWLA 5E91A 3ZH8A 3UG2A 4D55A 3ORLA 2HOGA 2PWLA 4QMTA 4RX9A 3MY1A 3RZFA 4YJSA 1V1KA 2BPMA 3I1AA 2EXEA 4D2SA 2I0EA 1XBBA 2OI4X 4HGLA 3KXHA 4IX3A 4O2ZA 4TWNA 3TJCA 3MESA 4F1OA 5H2UA 4D0WA 2YIRA 4MNEA 1QCFA 3WZJA 4ENYA 3UNKA 4RQKA 1YVJA 4YO4A 2VWYA 2WTVA 2ZV8A 4P5QA 4AN3A 3NLBA 3FL4A 2XB7A 3DXNA 3QAME 4G34A 4IJPA 4IHPA 4JRVA 2WKMA 4J95A 4LG4A 5IDNA 4N57A 2ITXA 3V5LA 2VO0A 1CM8A 1H1SA 1CKJA 2ZM4A 3PTGA 3DKCA 1JSTA 5C27A 4EOKA 3WE8A 4CFMA 1ZY5A 4U45A 3DZQA 1YWVA 1O6LA 2C6IA 1JKTA 2F57A 2VWZA 3C51A 4MXAA 5HTCA 5EI2A 5IQEA 2J7TA 5HNBA 4EH9A 3A4OX 2QOOA 2HZ0A 2Y4IB 3D0EA 4I0RA 4TW9A 4N4SA 4WNPA 5CZHA 3UNZA 3VN9A 4HNIA 3A99A 3M42A 4X2JA 3DZOA 2RFDA 2YLEA 3C0IA 4OBPA 5DE2A 3ATSA 5AA9A 3UOJA 5JK3A 3CTJA 4L43A 4RIOA 5D41A 4TRLA 4FKIA 4QNYA 2PULA 1XKKA 1W82A 4QMWA 4TYEA 2X2MA 2QOFA 1H4LA 2J0JA 4EJNA 2RIOA 3A8XA 2XKFA 2PZYA 1RE8A 4E20A 2R3MA 4BCMA 4I4FA 3D2KA 3TEIA 1VYZA 3T3VA 1Q99A 2PE0A 3AC4A 5C4LA 1ZYDA 4QMZA 4PMTA 4M3QA 1ZMUA 3JR1A 4HZSA 4UWYA 3H30A 4PTCA 2IZUA 4U3YA 5BX0A 3MH2A 3ULZA 2BR1A 4MVFA 4AOJA 2H6DA 3DK7A 4EEVA 3NVMB 3G6HA 4QTAA 1R3CA 3MBLA 3O7LB 1ZZLA 4HGEA 1AGWA 4FICA 4KABA 3E8DA 3UIMA 3FZ1A 2R7IA 3GC7A 4K33A 4AS0A 5J7HA 2IG7A 1OVEA 2C5XA 2P2IA 3HLLA 4QPMA 2NPQA 3E93A 4R3RA 3F2NA 5IQDA 2VU3A 4EKLA 4O7RA 3JY9A 4ZAUA 3FMKA 5AP0A 1LR4A 4JAIA 4C8BA 4CFVA 2OIBA 2IZRA 4KS8A 5I3RA 3JYAA 1WZYA 4YNEA 3HX4A 4IW0A 2CGWA 4ASEA 4BCQA 1P4OA 3FHIA 4NJDA 3LFSA 4UZHA 4QT1A 4AZSA 3FY2A 5AP7A 1ZOHA 3CTHA 3PVGA 4F09A 2IZSA 4C62A 4M97A 3TT0A 5IISA 3OXTA 5I9XA 2JIIA 4MBIA 3QQFA 2W1HA 4EHVA 3TTIA 5F9EA 5DVRA 4E6DA 3ZFYA 2RFSA 5CAOA 4QTEA 2VWXA 3TIYA 3ORKA 2ZVAA 4IWDA 2CNVA 3RBWA 3VF8A 2OIQA 2UZOA 2ZMDA 2F2UA 3BWFA 2GQRA 2Y4IC 1TVOA 4NJ3A 4P5ZA 4ZTNA 3GU5A 2J5EA 3AXWA 4NYEA 3K5UA 3SRVA 5DOSA 5ANIA 2F49A 2VGPA 4E6QA 1PRYA 5FDXA 3ATTA 4U40A 4DEIA 2CN5A 4BY9E 3WARA 3BHUA 4G2FA 3NPCA 3OD6X 4X3FA 4K11A 3LXLA 1H25A 2JIUA 2PZPA 3OF0A 4GSBA 2E9OA 4DCAA 5M4IA 4A4XA 3K2LA 4IAYA 4AE9A 5KMKA 5AUUA 5BVWA 3LCDA 1H00A 1U4DA 4M13A 5HNGA 4BI0A 2OJFE 5IMEA 2OXXA 3L8VA 5I0BA 2KTYA 2XF0A 4YZCA 4CD0A 3SC1A 1WBPA 5CI7A 2O5KA 2ONLA 2CJMA 2WHBA 2W1ZA 4D5HA 2UW0A 3DAJA 3GC8A 3MH0A 5HOAA 5I9WA 4ALVA 5IUHA 3VRZA 2WQEA 5EM7A 3FI8A 4JIKA 4EQMA 2QKRA 5E1SA 4FTJA 4JX3A 4TXCA 3WF9A 1PXNA 4PQNA 4U6RA 3SXSA 4D2VA 3U9CA 3W18A 4G3EA 1W0XC 3FMLA 4G6NA 4X7QA 3W2PA 5AV3A 5ETAA 4MXYA 2G2HA 4CQEA 2C6MA 4EWHA 4WT6A 3QD4A 4G5PA 4HYUA 3W33A 1WBNA 1SNUA 2PTKA 2X7FA 3VUHA 4B6LA 1PW2A 3MWUA 4QMNA 3BBTB 2QO9A 5FG8A 2QURA 3F9NA 4C2VA 5K5NA 2R64A 2ITTA 5DI1A 4GFGA 4RJ8A 4C57A 4BKJA 2WMAA 3MFRA 4QMYA 4CZUA 4EJ7A 1MUOA 3EQDA 3BZ3A 4BGGA 3QTUA 4B7TA 4H1MA 4GV1A 2H8HA 3MV5A 4GRBA 4ZSLA 2R3OA 4H39A 4BIEA 5LOHA 4ASZA 2UW6A 4LRMA 1YRPA 4ONAA 2E2BA 4RJ5A 4USFA 3BGPA 3D7TB 5HE3A 4DFXE 3OEFX 4H1JA 4BHNA 4FKVA 3R1YA 3ZLXA 5KMJA 3NUUA 2GQSA 4G9CA 4YJTA 4EUUA 1CSNA 4IX5A 2C3LA 1L3RE 3UPXA 3PYYA 3AMYA 2H96A 3CJGA 3PG3A 3EH9A 3RZBA 3C7QA 3S1HA 3PRFA 1TQIA 1YXSA 1KE5A 2Z2WA 3UIBA 1LEWA 5AMNA 5FBNC 4IVDA 3EYHA 3B8RA 4FZ6A 4W9WA 5CNOA 2WB8A 2ONLC 2YCRA 3QTQA 5HO8A 3UO4A 2R9SA 1DAWA 3BRBA 1W7HA 2OF4A 3F66A 3GQLA 5LQFA 5KKRC 4FIFA 2B1PA 3KY2A 3AGLA 4CKJA 3SLSA 2PVRA 3HA6A 3R9HA 3CKXA 1J1BA 4DHFA 1IA9A 3MVLA 4EQCA 3F3TA 3FSKA 2W5AA 3FJQE 3LFAA 3MI9A 5E1EA 3Q4TA 4N70A 3TNIA 2V0DA 4RSSA 5HTBA 5LMKA 4CTBA 5BVEA 5C8NA 4EOOA 1PF8A 3AC3A 2PE2A 3R63A 3UODA 3P7CA 4W8DA 2GNFA 3CPBA 3ZLSA 3WE4A 1NA7A 1QPEA 4CT1A 3ZO2A 4Y46A 3A61A 4JS8A 3UP2A 4O0XA 3OBJA 3LLTA 4I24A 2B52A 1REJA 3NUNA 3QZHA 4J99A 5AP3A 5EW8A 2F9GA 2QOQA 4EK5A 2RFEA 3NUXA 4BDJA 3P4KA 4OUCA 3W1FA 2PK9A 2C0OA 2XNMA 4UBAA 3EFLA 4XBRA 2YITA 3SD0A 4AGUA 4FEVA 4FL3A 3U4WA 2YN8A 2Y0AA 3PXFA 2PMIA 3SG8A 4IAFA 4OTPA 3OP5A 4DLJA 2PMLX 3E7VA 4KBKA 2ITOA 5GZAA 4FSQA 4GT4A 2V62A 3RPRA 5F94A 4YR8A 5HG9A 2BRBA 4O0RA 5T68A 2OF2A 3RP9A 2XJ1A 4ZZOA 5L8LA 3MA6A 3MB6A 3ODYX 3NSZA 2X81A 2OH0E 3BE2A 2OFUA 2ERZE 3KVWA 4F6WA 3GCSA 3BEGA 3ZSHA 3F61A 3FMHA 4FUXA 4G31A 4KIPA 4TKSA 4U7ZA 2VUWA 4GL9A 5AX3A 4F0GA 4QMXA 4AZVA 1IRKA 5L2IA 4IACA 4OTWA 3MTLA 5JFWA 2C6TA 5DT4A 4DT8A 4FZDB 3DTWA 4QO9A 4E1ZA 2B7AA 1U59A 3PSBA 2V55A 4ZTQA 2XIRA 4PMMA 4A9UA 4F63A 5JEBA 5JQ8A 5GHVA 3CQEA 2C47A 4JR3A 2PUIA 1BL6A 5AP4A 2OK1A 3VW8A 3U87A 4LUDA 3F3ZA 4JIAA 4EK4A 5I9UA 3D5UA 1XHAA 1SVEA 5FTOA 2X2KA 1YWRA 2Y7JA 2X7OA 3VAPA 3KMWA 4RIYA 4IM3A 3HMIA 2WGJA 3G90X 3VS2A 4W4YA 1OMWA 4ZTSA 3NVKI 3DBCA 3MVMA 2GNLA 3VO3A 3DB6A 1E9HA 4ZIMA 2PMNX 5CSPA 4EI4A 4USDA 4HJOA 4O6LA 3G9LX 5E8SA 4E5BA 4FV4A 5JN2A 4RVLA 4BHZA 1E1XA 5FGKA 4C59A 1K2PA 3NIZA 2ZV2A 4HOKA 2VV9A 3MYGA 4FKSA 5EM5A 2JFMA 2CLXA 3HMNA 2R4BA 5LVNA 4EK8A 5ETFA 2GTNA 4I93A 2C6DA 3BPRA 5CQWA 1K3AA 2P0CA 5EDPA 4BZOA 3IO7A 3F7WA 2CNQA 3JUHA 2WIPA 2LGCA 3FZTA 4PPAA 3R8ZA 3RNIA 2ITNA 4ITHA 4MCVA 5CAPA 3O0GA 5E8TA 3R8UA 3EN7A 4E4LA 5L8JA 4DFBA 1JWHA 4WKQA 2NO3A 1A48A 5AAGA 4BDKA 3QTZA 4BWKA 3RNYA 1UVRA 5HX6A 4WG3A 4F9WA 3PA3A 4NW6A 2CNUA 3UO6A 1PXIA 3OY1A 4S33A 2ZV9A 4L6QA 5CANA 4MD9E 4ZTHA 2WTWA 4Q2AA 4C4FA 4D9TA 3ORZA 2YAKA 3ET7A 2OO8X 4DGLC 4JG6A 4BDCA 2YCFA 3AC5A 3GGFA 1OL2A 3FKLA 1DI9A 5EKOA 3E63A 4G3GA 4YBKA 3G6GA 4I5MA 5HE1A 3ZEPA 5CAQA 4CCBA 2C6OA 5HE0A 5H8GA 4ZS4A 2XH5A 4JBOA 4F6UA 4EOLA 4F08A 3Q6WA 2CMWA 1FVRA 2O63A 4RX7A 1OECA 3HMMA 5DFPA 2X2LA 4DEGA 1JSUA 2HW6A 5I4NA 3OUNB 3PJ2A 2RKUA 4G17A 3CR0A 2HY0A 5IA1A 5TT7A 1UU7A 3VBYA 3LM0A 1QPDA 3SVVA 4RRVA 5GNKA 4TN6A 5AR2A 4DEBA 2WIHA 3CY3A 4IM0A 3VS7A 4ZSGA 4FKOA 4KNBA 4LUEA 2GFSA 5H8EA 3TZ8A 4FT3A 2W1DA 1VR2A 3FYJX 5E8ZA 4GUEA 4GUBA 1M17A 3W2RA 3PDTA 3TKUA 3VHEA 3DTCA 3QXOA 5AUVA 3ENMA 2G2FA 4JAJA 4ZEGA 2XRUA 4EBVA 5L4QA 3KULA 5K4IA 3D15A 3Q9WA 4C35A 4RIWA 2X8DA 4C3FA 3D2IA 3LVPA 2O2UA 5LVLA 1R39A 3I0QA 4MF0A 5AM7A 2JEDA 1S9JA 5DA3A 4II5A 2O3PA 3PG1A 4I20A 3GB2A 4QQJA 4BDIA 4IMYA 2BAQA 4RC2A 3TN8A 3BBWA 4EZ5A 4Z3VA 1WBVA 5KUPA 1WBWA 2DQ7X 3QGWA 4JI9A 5AP5A 4EH7A 1PXOA 2YM6A 3PPZA 5DHJA 5BMMA 4FSUA 4XMOA 3TIZA 3UC3A 3VUIA 3QTSA 5KCVA 1LPUA 4PX6A 3O7LD 3PA5A 5C8MA 4AT3A 5A54A 3A7IA 4YLKA 3GCUA 3LAUA 4ACGA 4Q5HA 4R8QA 4BR3A 3CY2A 4KKGA 2CCHA 1W83A 4MQ1A 3LPBA 4TL0A 3ACJA 3NNVA 4MX9A 5CU6A 2VTSA 2NRUA 3CC6A 5KMMA 2OG8A 4IB5A 1YKRA 4D5KA 5FBOA 4OGRA 3ZM4A 4FKQA 1M14A 3TV4A 1OKZA 3DDPA 5K4JA 4PTEA 2V5QA 4QD6A 2QONA 1A06A 2YM3A 2G2IA 4FV1A 3CJFA 1APME 3PY0A 5TR6A 4ANLA 3IW6A 3FYKX 4C02A 2JKMA 4ACMA 4YBJA 5AEPA 5FDPA 2QC6A 3G0FA 1B38A 3PP1A 2OZAB 1VEBA 2VTAA 2CDZA 4AG8A 3AT2A 4K8AA 4L67A 1KUTA 4O7SA 3IQ7A 4EWQA 4XUFA 4F4PA 4DGOA 4I3ZA 4PMSA 2VTHA 3FI4A 3TUCA 1OUKA 5J95A 1Q8TA 3VIDA 4XG6A 3BGZA 2BAKA 1Z57A 3FAAA 4HCTA 1H08A 3THBA 3U9NA 3EKNA 5KZ0A 4PV0A 4C7TA 1I09A 3CTQA 5DH3A 3OCTA 4I6QA 5DNRA 1A9UA 5K0KA 4M69A 3F3VA 5IUGA 4XG8A 1BMKA 4L8MA 3IW4A 5DYJA 3CD3A 3F5XA 4O0WA 2XM8A 4BDFA 1TQMA 3OMVA 4JBQA 5T6KA 2BHHA 3E8NA 4ANSA 5FUTA 2J4ZA 3QTXA 3QZIA 5TOZA 2DYLA 1ZYLA 3B2WA 1U54B 4AWIA 2VX3A 2XIZA 4DITA 1IA8A 3R2YA 4Y8DA 3R1SA 3LMGA 5D11A 5GJDA 4QP8A 2CGUA 1MRYA 2BFXA 2GS7A 2X7GA 2EVAA 3DK3A 5LCJA 4LM5A 3VULA 4WG4A 5KHXA 3VBXA 4EHGA 5AV0A 4C2WA 4FEXA 4KIQA 4F6SA 3C5IA 1ZMWA 4JRNA 1FMKA 3GEQA 2WMBA 3MA3A 4FT5A 1NXKA 3VBQA 2B9FA 2GNJA 4AACA 1ZXEA 5DGZA 3AQVA 3IGOA 4ANQA 4M0YA 4BDDA 1YDSE 3ACKA 3VVHA 5EOBA 3C0GA 3ZUTA 4NIFA 1KE6A 5BVDA 3SG9A 5IA5A 2V7OA 4QQCA 4RVTA 4YJQA 2CPKE 4B4LA 3BQRA 4H3PA 5EYMA 2IVVA 3EIDA 3EFJA 4F0FA 2ETMA 3CS9A 4TYGA 4H58A 3ZSGA 5HICA 5L6WL 3REPA 3RPVA 2UZDA 2UZWE 2UZLA 3LCOA 4OTFA 4A4OA 3ZOSA 4FNZA 4PF4A 2X0GA 4OTQA 4QYEA 3LMHA 2W0JA 3VUTA 1O6YA 3K54A 5AP6A 4O0YA 4BGHA 1GAGA 4I0TA 4YHTA 2PVHA 4BDBA 1SZMA 4DFLA 2BFYA 4DYMA 3HV7A 5LMBA 5EQPA 4EORA 3FWQA 3GU7A 5D12A 5AM6A 5HD7A 5CENA 3UIUA 3ORIA 2RSVA 2UVYA 4FTUA 3R9DA 4E5WA 4TNDA 3IW8A 2XKDA 4LMNA 4YC8A 4R5SA 3V51A 2OIDA 4FEQA 3KC3A 3DKOA 4MK0A 4F9BA 2JAMA 2X9EA 4BDHA 4P2KA 3OEZA 1S9IA 2JD5A 1Y91A 1AD5A 4ORKA 5CVFA 4QQTA 4S34A 1YI4A 2PVLA 4HCUA 2B0QA 4WSQA 3TUDA 4D2TA 5B7VA 3FUPA 4GK4A 1XO2B 4RA5A 4O6EA 1J1CA 2XCKA 5HNIX 2R3KA 1WVYA 3OVVA 2VWWA 4JLCA 5B0XA 1RDQE 4DFNA 3UVQA 4DG0E 3VRYA 4AA4A 3RTPA 3UQCA 2SRCA 3G9NA 2VZ6A 4KB8A 4RJ6A 2A27A 3IGGA 4R1YA 4F9AA 4XNEA 3DXPA 5IQGA 3ZUVA 3R1NA 4NW5A 4F1MA 4X6RA 5M4FA 1XBCA 2PVYA 3NAYA 4X3JA 5M4UA 4XJ0A 3KA0A 2XYUA 3GC9A 4F0IA 4ANBA 4PL3A 3JY0A 3N4UA 4MWIA 1WCCA 3DQXA 5AX9A 3SXRA 2WQNA 4V0GA 5DR2A 3FLNC 3KRLA 3AC1A 4AGDA 4U43A 5CU2A 3I60A 3NDMA 4IBMA 3FC1X 4HYHA 3R7VA 3RPSA 2RG5A 1QL6A 4O0TA 2JKOA 3PWDA 1JLUE 3G51A 3EQPA 4EH4A 4CCUA 5CASA 2VWBA 3R7IA 1M2PA 2R3NA 2B9IA 4PRJA 3SGCA 4IVAA 4M84A 3BHYA 3RGFA 5DLSA 4O7VA 4CZYB 3L9PA 4KAOA 4BCHA 3LXKA 3TKHA 2C1AA 5AR8A 5AADA 3UGCA 4FEUA 4YZDA 4EK6A 4O7TA 2IW9A 2R3FA 4FKLA 4DEDA 3RPOA 1PHKA 2PZRA 2HXLA 4EZ3A 4BCKA 3S2PA 3SV0A 3I5NA 5CEQA 2BRNA 3OBGA 5DBXA 4DFUA 4M14A 2FSTX 3IW5A 4E6AA 1DI8A 3BV3A 2G9XA 3DA6A 1Y8GA 2EXCX 4NSTA 5KHWA 3S0OA 1XH9A 3I7CA 3MFUA 3VHKA 4QOXA 4R78A 4U9AA 5JT2A 1ZOGA 2W17A 2WD1A 3O8UA 3SAYA 4FIEA 4WRSA 1PYXA 5A4QA 1PXJA 5BYZA 3VBVA 1JKKA 3DV3A 1ND4A 5ETCA 3UYTA 2YM4A 1Z5MA 4AT4A 3KEXA 1KSWA 3UOHA 3FBVA 4YNOA 2CGXA 4RJ4A 3ZMMA 2WQBA 4APPA 4DA5A 4JQEA 4C37A 3TUBA 5EHYA 4HVIA 3LFFA 3QBNA 4FV0A 1UU9A 3ZUUA 4JOAA 5AR7A 4IVBA 4OR5A 2W5HA 2QOCA 2P2HA 3BYSA 3TV6A 4BZNA 4BB4A 4YGAA 3HP5A 3FY0A 3QUPA 4GFMA 3A60A 4WIHA 4D4YA 2C1BA 4FV7A 5HO7A 2QVSE 5B2LA 3BHHA 2OU7A 5CVGA 2UZUE 3A8WA 3UJGA 3UOLA 3CPCA 4QYYA 4HVHA 4ZZNA 2R3GA 2ETRA 4I6BA 1HCKA 5ACBC 5TE0A 4E7WA 4IAAA 5CAVA 3OT8A 4QRCA 5IH5A 3QKLA 3UG1A 1KOBA 4R1VA 4TTHB 2R5TA 4EH3A 1H07A 3FXXA 2VTRA 3IONA 3RAIA 5IEVA 3OWPA 5D7AA 2JDSA 1P5EA 3HEGA 4EOJA 4BTFA 4Z7GA 4NM7A 3MY0A 5L6OA 5M09A 4FV8A 2I1MA 3O50A 2JITA 3PJ8A 3VBWA 4HW7A 5L2WA 2XMYA 4RX5A 2QOKA 2J2IB 4C4EA 3WZEA 1OKYA 5BUJA 2QI8A 2UVXA 4IADA 4AW2A 4J97A 1Q3WA 2BDWA 3IG7A 3EZRA 3ZLYA 3PY1A 4U97A 3QRUA 5HVYA 3P86A 1OZ1A 2WTJA 4U81A 4UV0A 4B8MA 4EOIA 5GIPE 4XP0A 3C9WA 3KF7A 4LGHA 4MWHA 1FPUA 1KE7A 2ACXA 3KMMA 4YJRA 5HLNA 5J5TA 4BWPA 1YXTA 2V7AA 4TY1A 2C5NA 3G5DA 3QYZA 2IO6A 3L9LA 4QMVA 2XIXA 2QCSA 4LV8A 5L2SA 1OIUA 4C4HA 3NCZA 4PNKA 2OICA 4KWPA 3FV8A 5L3AA 4BIBA 3F82A 4LL0A 2J50A 2GS2A 3ZSIA 5DT0A 3QC9A 4BDGA 4FX3A 2QD9A 5CF6A 4ASDA 3A62A 4BYIA 3CQWA 4KIKB 5LJJA 4NTSA 4W4WA 2QU5A 4IDTA 3LM5A 3RHKA 2QU6A 3WIGA 1ZZ2A 2J0MB 2Z8CA 3QALE 2BZIB 4I0SA 2F2CB 4AOIA 4CLIA 4E5AX 4ACDA 2W1EA 5GINE 5F4NA 4ZSEA 2YCSA 2AC5A 1G5SA 4WBOA 2ZOQA 5HG5A 2YJRA 2XIYA 3QYWA 4L3PA 3QCXA 3HUBA 1XBAA 4XG7A 4EZ7A 3OZ6A 2BZHB 2C68A 1TQPA 4Z9LA 3A4PA 5LVMA 2W99B 4IXPA 3TNHA 3QRJA 4O7NA 3C5UA 3G15A 2Z7SA 5C26A 4M8TA 3RK7A 4O96A 2JDVA 1R0PA 3BE9A 3QC4A 4PUZA 1PXPA 1FVTA 4DG3E 4LOQA 2JGZA 3UMWA 3ZC5A 5CU0A 2YHVA 4B8LA 4F7SA 3KXXA 5LCKA 5IQBA 3CEKA 3MVHA 2BTRA 4R6VA 3V5QA 2BTSA 3Q5ZA 1XR1A 2BMCA 3R7GA 3ANRA 3O8PA 3T8OA 1U5QA 3NUSA 4U41A 3NGAA 4QYGA 3ZLWA 4LI5A 3E7OA 3NEWA 1JAMA 4D28A 4FSYA 4JXFA 5E8VA 4G1WA 4FZ7A 2XK3A 2R3QA 2YCQA 3TG1A 2VTQA 3UZRA 3KGAA 4Y83A 3FMNA 4NK9A 2R3IA 2ZDTA 3FKNA 4L7SA 2C69A 4P7EA 2IZTA 4GH2A 3WIKA 4EC8A 4EH5A 4RIXB 1R78A 3SX9A 3CSVA 4ZOGA 4G3DA 5AV2A 4PL4A 4GIIA 3FZSA 3EL7A 4DEEA 1H0WA 3WF5A 4ZLOA 3P7BA 2BKKA 3DLSA 4BDEA 3DY7A 2XNOA 3PJ1A 1KV2A 5KX8A 4FE2A 2QR8A 3L8PA 2IVTA 4IWPA 3PE2A 4I5HA 5DIAA 1GZNA 4L53A 5BVFA 2OJJA 5E9EA 3BELA 2WO6A 4HVSA 3OG7A 4FTOA 1H26A 4WRGA 3QLGA 3QTWA 4TWCA 5EM6A 5GJGA 3ZYAA 3W55A 3JXWA 4XX9A 3A2CA 4G5JA 3NR9A 5HU9A 2X4FA 3R8VA 4IZYA 3DGKA 3HMPA 3OW4A 4FG7A 3D83A 2PVJA 3EL8A 3DBDA 4DFYA 2ITZA 5HD4A 2YAAA 4ZY6A 3FPMA 3MB7A 2YEXA 1UV5A 5ETIA 3QWKA 3TDWA 4ACHA 5HIDA 5TO8A 2Y8OA 3QL8A 3EMGA 3PXZA 5JGDA 4G16A 3D7TA 5JQ5A 3TJDA 1YQJA 3GOPA 2CHLA 4OT5A 2CKEA 4EOQA 2Y9QA 3D5VA 4XOYA 3EOCA 3ANQA 1F0QA 3K3IA 2RF9A 3F88A 4WD5A 2VNWA 2XK9A 3KK9A 1ZOEA 1GIJA 3MIYA 2FH9A 1LUFA 4BCPA 3PIZA 4GYGA 4JBPA 4YU2A 2A0CX 2Z02A 4AQCA 1YI6A 3HRBA 3KXGA 5AIRA 4A9TA 5JKGA 5EQYA 5IG1A 1UNHA 3LJ2A 5CSXA 1Q24A 3KCKA 4UN0C 1UWHA 3PPKA 5LXMA 5DT3A 3Q6UA 2WTKB 4YJPA 5F1ZA 1XH5A 4ZTLA 3TNPC 4BKYA 4CSVA 4DGGA 4O83A 4RVKA 4D1XA 5BVNA 2PUPA 4IJ9A 2XRWA 2B53A 2GHGA 4EBWA 4XCUA 2X39A 2EB2A 4RMZA 4X2KA 1H1PA 2BRGA 5JZNA 4BBEA 5AV4A 2OSCA 2P33A 3TACA 4F65A 3NYVA 3PUPA 4HNFA 4YC6A 5AUXA 3WBLA 3R8MA 1URCA 3DFAA 1F3MC 2EU9A 4U79A 3TXOA 4XRLA 5BVOA 3FXWA 2QOHA 3QX4A 4J96A 2UZEA 2EWAA 3LZBA 2PMOX 1BKXA 2HELA 3B8QA 2PE1A 4LMUA
chains in the Genus database with same CATH superfamily
2FSOX 4ZSJA 1OBGA 2QOIA 2YM5A 4AF3A 3EYGA 3QHWA 4XG3A 3RHXA 5J1WA 1PXLA 3RMFA 4LQMA 3R00A 5CQUA 4ZS0A 1H01A 2GPHA 4EH2A 2FUMA 3QTIA 4FK3A 3OOMA 3UPZA 2XK6A 5CU3A 4D2RA 4C4IA 2CN8A 1YDTE 4KSQA 4C36A 3IK3A 1OL7A 4HPUE 4XG2A 4CFUA 4FTIA 3BU3A 4XV9A 4HVDA 5L8KA 4WSYA 4FEWA 3A7FA 4FOBA 2RFNA 1WBSA 2UZBA 3TNWA 2DS1A 2C5YA 3H10A 1YHVA 5DRDA 4RG0A 1OPJA 4ZMFA 4APCA 4FMQA 2BRMA 3D14A 5DEWA 1XH4A 4L45A 4GG7A 5AP2A 2FSMX 3F5GA 4YTIA 4MBLA 3FMMA 4MBJA 1NT2A 4TZRA 4JX7A 4O82A 4UMQA 2WOTA 2AUHA 2W1IA 3KB7A 4AT5A 5GIOE 2QR7A 2WMUA 1UKIA 3F5PA 1P4FA 3LOKA 4FVPA 3H0YA 3FZRA 3HV4A 4USEA 3F5UA 1PKDA 3ODZX 4BCIA 5FD2A 3DJ6A 4C0TA 4E8AA 4DDIA 2WQMA 4QP3A 5HE2A 3VS6A 3BU5A 4Y95A 4BI2A 3MS9A 4YURA 2WMXA 2ZV7A 3Q2JA 2R3HA 1V0PA 4DH5A 3DT1A 5HG8A 3IDCA 4NEUA 4DEAA 2W06A 3FHRA 4OTHA 3U8WA 4R77A 2CGVA 3ZBXA 1P14A 3GP0A 3JVSA 3AG9A 3QQJA 2IEWA 1MQBA 1AQ1A 4IX6A 3DB8A 4O4EA 2A2AA 3DS6A 3H0ZA 4LRJA 4NUSA 4F64A 5BUEA 4FTRA 4KBAA 5AUWA 3SW7A 4O7ZA 2QHMA 4KIOA 4W4XA 2OGVA 4JDHA 3FQHA 1FOTA 4D4RA 3QF9A 4UXQA 4YHJA 4ENXA 4I6FA 3PFYA 4O81A 4UWBA 2FA2A 2ITVA 4BBFA 2FGIA 2BDJA 4FL1A 1XJDA 3FLWA 3Q4ZA 4BWXA 5CU4A 5ITAA 2Y6OA 3KKVA 5DRBA 1H8FA 2ZB0A 3L9MA 3CIKA 3RCDA 4HGTA 4KUJA 3U51A 5E7RA 4DLIA 2XM9A 3WZUA 3FZPA 2EB3A 3I0OA 3OHTA 3UQGA 1JQHA 4J7BA 1XH8A 3FE3A 3LW0A 4I6HA 5AUTA 2UW7A 3BV2A 3GU4A 3OT3A 5C9CA 4D0XA 3GCQA 4U3ZA 1TFFA 4O27B 5EQEA 5IQIA 3FMDA 4RPVA 3OWKA 4KA3A 3HYHA 4JG8A 5CS6A 1XH6A 5AR4A 5E8XA 3ZRKA 1ZY4A 3GFWA 5I5ZA 3V8TA 1OKWA 2QQ7A 2Z7QA 1YOLA 2P3GX 1PMEA 4FSTA 4FTCA 1Y57A 4JT3A 3NUPA 4AW0A 2XK4A 3AD5A 3KVXA 1B6CB 5KBQA 5C03A 2IPXA 2YA9A 4IANA 5CSVA 4TYJA 4MF1A 1NVRA 4EL9A 4YMJA 3NAXA 4OTGA 3ZCLA 1I44A 3VJNA 4YLLA 2HZ4A 1H24A 4IM2A 2FB8A 4CKRA 3NCGA 1K9AA 4CG8A 2OW3A 2ZAZA 3DKGA 2JKKA 2XEYA 5IZFA 5HVKA 2GS6A 2QNJA 4MYGA 3POOA 1UNGA 4ZK5A 4GW8A 5J5SA 3P78A 3PVWA 3WYXA 4YTCA 3QKKA 3R7YA 4EC9A 3WILA 5DN3A 4IAZA 2HK5A 4LOPA 3MJ2A 4M0ZA 3SQQA 3CE3A 3I5ZA 4AW5A 3EQIA 2X6DA 4ALUA 4BTKA 4QMQA 2WMVA 4L46A 3I79A 3AC2A 3H9RA 3MW1A 2B54A 4GU9A 2UW4A 2DWBA 2YDJA 5H9BA 4D58A 4YZBA 2C0TA 4TYHB 3GT8A 1WBOA 4ARKA 5IH4A 3I7BA 5EI8A 3LHJA 4U42A 2QOLA 4QP6A 4O91A 4GKHA 4CV9A 4AFEA 4C4JA 4DH3A 1RW8A 3AKKA 5HBHA 3UDBA 4JG7A 2PZIA 3K5VA 5EK7A 4B0GA 2P55A 3V8SA 1BX6A 3HECA 2ZM1A 5D10A 4LOOA 4O7LA 4UMRA 2Z7LA 1MRUA 3GVUA 4IDVA 4XOZA 2GNIA 4TYIA 2UW3A 3LCSA 3OXZA 4RWIA 3RINA 3ZTXA 5ICPA 2RG6A 2A19B 1G3NA 2G15A 3HKOA 2QKWB 3HRCA 1KWPA 3DNDA 5EM8A 4FSZA 3C4FA 3KXZA 2IWIA 5CZIA 1MQ4A 5HTIA 5L2TA 5A14A 3PIXA 3DQWA 3FLZA 4PDYA 2X8EA 3KK8A 4FT0A 4X21A 4ZZMA 3TZ9A 2GCDA 3ORNA 2QOBA 3BGQA 3ZZEA 4R7BA 4CTCA 1SMHA 4G6OA 1GZ8A 2W5BA 5J9YA 5CT0A 1ZAOA 1YXVA 3AGMA 2O64A 3T9IA 4XS2A 3TMOA 1P2AA 2XNEA 4R7IA 4GG5A 4IWOA 3TCPA 4YUQA 3DLZA 1CTPE 4FIGA 2ERKA 2J9MA 2WQOA 2XUUA 2ZM3A 4ID7A 2YACA 3LE6A 3UBDA 4QMOA 4QYFA 3H9FA 4OTRA 2YFXA 2I7QA 2UW5A 4FKJA 4AU8A 4RJ7A 3RAWA 4GEOA 3BCEA 3CKWA 1CKIA 4ZTRA 2BRHA 2C5OA 1MP8A 5FQDC 5J9LA 4O7YA 4Y5HA 4L9IA 4GK3A 5E90A 5EW3A 2BCJA 2VGOA 4JQ7A 1CDKA 4XG4A 2OJIA 2UV2A 4BCFA 4O38A 4QQ5A 4UEUA 3VS1A 4MKCA 3QLFA 4ZTMA 2C0IA 4JJRA 3PP0A 4IZ7A 4QP9A 1G8AA 1OPKA 2W05A 5FRIA 2OH4A 2BHEA 3LFNA 1PMUA 5A4TA 1RJBA 2OZAA 2UZTA 4UY9A 4CVAA 2XNGA 4ZP5A 4CMUA 3SDJA 1ZWSA 5IQAA 2F7XE 2XJ0A 3NW6A 4JQ8A 3W16A 4X2NA 2JDRA 1NVQA 4QMPA 1V0BA 1REKA 4L01A 2OXYA 4NL0A 3HUCA 1Q4LA 5ANGA 3OTVA 3WI6A 4FKWA 2ZYBA 4ANNA 3OWJA 3P5KA 4ACCA 2BUJA 4P90A 1KV1A 2OXDA 1ERKA 2FSLX 3DBFA 4IZ5A 5AR5A 4CMOA 5H8BA 3UVPA 4E3CA 4Z7HA 5IKWA 3ALNA 3DBEA 3F69A 2YERA 3ULIA 4KKEA 5CEIA 3G0EA 2YIYA 1ST0A 5EYKA 1BUHA 3EN9A 3QRTA 3AT4A 5D7VA 5J8IA 1GZOA 2R3LA 4RQVA 3P79A 1XWSA 1GOLA 4WG5A 1ZYSA 4AUAA 2VTTA 4CNHA 5C4KA 3KN6A 3WF6A 4O21A 3R7UA 4ZJJA 4ZMEA 2E9NA 1SVGA 5FP5A 4JDJA 1U54A 3EKKA 3R0TA 1WAKA 3EQBA 1SNXA 1ZYCA 3R83A 4J98A 3QD2B 3R71A 3UZTA 4M12A 3UVRA 2VX0A 3OY3A 4O86A 2VTIA 2WMSA 3QGYA 2PVFA 3QXPA 5CXHA 2ITPA 4QPSA 5FTGA 4XRJA 5HHWA 3BX5A 4QMUA 3ZBFA 5A6OA 1SM2A 4IB0A 1ATPE 4NZWB 3OFMA 2VRXA 4UWCA 4ZJIA 2BDFA 1T46A 2C3IB 4F70A 2VWIA 4IEBA 2CKOA 2X6EA 4PMPA 4YSJA 3PZHA 3R01A 4LYNA 4RFMA 5LVOA 4FV3A 3COHA 5CTPA 3E92A 3I6WA 3NUYA 5EDQA 5B2MA 3U6IA 3LMIA 4IFGA 3AMBA 1OIYA 3EWHA 3I4BA 5EYCA 4YJOA 1OIRA 3U4UA 4AA5A 2X0QA 4HVGA 4KRCA 1Q8WA 5CALA 2WU6A 5LMAA 3Q96A 3N4VA 4IB1A 3R28A 2F7EE 3QQHA 1OBDA 3FQSA 4WA9A 4CFWA 4DE4A 1JPAA 3BYOA 2E9UA 3S00A 4BDAA 1OB3A 3CCNA 3Q52A 4PNIA 5FLFA 1H1WA 4GIHA 2XZSA 3MSSA 3DBQA 3KREA 2XJ2A 4V04A 3MGYA 3PXYA 2REIA 1Y6AA 5HLPA 3FPQA 3H4JA 3V3VA 2J6MA 5I3OA 2OWBA 2JIVA 4CFXA 4AFJA 3F2RA 3IDPA 4DH8A 3D4QA 3R30A 4ZY4A 4QDVA 1G8KA 3RALA 3MH1A 3P1AA 4O0UA 4UB7A 2HW7A 2YM7A 2IN6A 3AMAA 4L3LA 3HAMA 3DXQA 2WTDA 2GNGA 4S30A 4J53A 3ZU7A 3WOWA 4CEGA 5A6NA 4DGNA 4U80A 3DDQA 5A9UA 4F7LA 3BU6A 4CRSA 3VUGA 5C1QB 4Q9ZA 3D7ZA 5HCZA 2ZDUA 4M7IA 3NZ0A 3R1QA 4YJVA 4S2ZA 4BICA 3ZONA 1Y8YA 2CLQA 1WFCA 2EUFB 5A4EA 4AA0A 3ZO1A 5IA3A 3GENA 2A98A 5JSMA 2VTPA 1FVVA 3Q53A 1OI9A 1W8CA 3MPAA 4PPCA 4ASXA 2CKPA 1Q8YA 5AUZA 1O9UA 4AQKA 4V01A 3R9NA 4LV5A 4Q9SA 3W2OA 2B9JA 2PYWA 4KINA 3W0NA 5AAEA 1MRVA 3DNEA 1DAYA 3TL8A 3E64A 4OBQA 2ITYA 4HGSA 4ITJA 2ITWA 4FIJA 3V04A 3BKBA 4DT9A 1O6KA 4EOSA 3FDNA 1FGIA 3BQCA 5JRSA 1M7NA 3MDYA 3VUMA 3S4QA 3WF8A 3LFQA 3FI3A 3R21A 4MNEB 4NTTA 2UZVA 5HU3A 2GHMA 2X1NA 3TM0A 4DCEA 1M52A 4O0VA 2ZMCA 4CV8A 5LVPA 5CSHA 4W8EA 2HZNA 3ERKA 2IVSA 3BIZA 3IW7A 3LFDA 3VF9A 4BF2A 2C5VA 3SA0A 3BHTA 2JFLA 5KMOA 1OL5A 2EXMA 4FT9A 3DK6A 2BIYA 4WHZA 4GT5A 3BLRA 4FF8A 4D4VA 4J1RA 5IQCA 2R7BA 3LQ8A 3OOGA 4JL9A 2VO7A 4YJNA 3UC4A 5JH6A 1WMKA 1XH7A 5BV3A 1DM2A 3KRXA 1W98A 4AGCA 3KF4A 3Q2MA 4I6LA 3U54A 2OBJA 3HAVA 3W2SA 3QQLA 3UIXA 2HAKA 2YWVA 5J87A 5EOLA 2J0LA 5M06A 2VTJA 4ZY5A 3HP2A 3U6HA 4CKIA 3VWAA 4DH7A 2RL5A 1Q41A 3EN4A 3R22A 4FV9A 4XYFA 4BN1A 4EQUA 1UWJA 4NWMA 5E8UA 3S95A 4WBBB 2BIKB 3VBTA 1DS5A 4YLJA 4J71A 2JDOA 1YHWA 3D9VA 2Q0BA 1IASA 5FXRA 5IA0A 1PJKA 4Q5EA 3Q04A 4GJ2A 3RK5A 4MXZA 3SOCA 2XK7A 4F9CA 2YDIA 3NNXA 2XNNA 1H28A 4H36A 4NM3A 5CI6A 4I92A 1UA2A 2IVUA 2AYPA 3WF7A 2ITQA 3ZZWA 5M4CA 1J7IA 3MTFA 3D94A 3RM7A 2XEZA 4E4NA 5T3QA 5DR9A 4ZSAA 4QDEA 3OCBA 4CMTA 4LGDA 2VN9A 3SW4A 5AIKA 4IX4A 2GQGA 1JVPP 3HV6A 2QLUA 4ZXTA 3UNJA 4AZTA 4XLIA 2UW8A 3E3PA 4EK3A 3TTJA 2PUUA 2YISA 2OFVA 4FC0A 4XV3A 4C3PA 2WFYA 4GCJA 5AR3A 4E93A 1FMOE 1H0VA 3IPHA 3NX8A 3PY3A 4IQ6A 4LRKA 4P4CA 5CSWA 5JFVA 4E4XA 4QTCA 4MUQA 2VWVA 1ZARA 4O1OA 5I9ZA 5IA2A 2UVZA 3PIYA 4FKPA 4KSPA 4ALWA 3LFEA 2QODA 4I21A 5IUIA 4F78A 4BTJA 3VW6A 3ZRMA 2VD5A 3II5A 5IEYA 3VS3A 4DBXA 4G3FA 4QMMA 3TZ7A 4ANMA 4FZFB 5DR6A 4D9UA 3PVUA 3C4WA 5CNNA 4K1BA 3QZGA 4MHAA 3O8TA 4DFZE 2J0IA 3C13A 3KRJA 4X6QC 5CWZA 4PWNA 4FTNA 2GFCA 3EQFA 2WU7A 5BQ0A 3SOAA 5IDPA 3MFSA 5F20A 4FTAA 2C30A 3GNIB 5AV1A 3RWPA 4BVUA 4XEYA 5M44A 2X0OA 3K3JA 4H3BA 3EQRA 5KO1A 3QCYA 2YIXA 5KE0A 4RX8A 4MAOA 1U46A 5JFSA 2HWOA 4KKHA 4PY1A 5K3YA 5FWKK 3ZM9A 3T3UA 1QMZA 2R0IA 4YJUA 4NH1A 4BCOA 4R7HA 4FGBA 4RFYA 3SRVB 3TNQB 4CGAA 4KIKA 4UMPA 3KCFA 5IEXA 4UX9A 2B55A 4X3FB 1GJOA 5C01A 2ITUA 5IQHA 2WNTA 4RWJA 4C58A 2WTCA 1HCLA 2GSFA 3RCJA 4FGRA 2XNBA 5EHOA 3E8EA 2R3RA 4EKKA 2F4JA 2C3KA 3W2CA 4AAAA 3M11A 5I9YA 4FVQA 3PJCA 3TZMA 2NP8A 2OJGA 4HYSA 4I4EA 5HGIA 2FVDA 3T9TA 4NKAA 3UYSA 5IA4A 4I23A 3P7AA 4N6YA 5JFXA 2W1FA 4YZNA 3ZFXA 2GNHA 3VQHA 4X2GA 3C4ZA 4GT3A 3TI1A 4BTMA 3V6RA 5KKRB 2PU8A 5FEQA 5CY3A 3BEAA 5EDRA 2HZIA 4BCNA 3L8XA 1YW2A 2G01A 5HORA 4J52A 3KXNA 4MEDA 3UOKA 4I5CA 4FK6A 5AP1A 5CF8A 1JKSA 3R9OA 1OITA 3VUDA 2BZJA 1B39A 3EN5A 3F2AA 4CQGA 4FL2A 4XP2A 2I40A 5D9HA 3BL7A 2XKEA 3AD6A 3P0MA 4YHFA 3R8LA 5BPYA 5AFVA 3GQIA 4QYHA 4IC7A 3V6SA 4GYIA 5A4LA 3OCGA 5B2KA 3RJCA 4I1ZA 3VC4A 3PUFC 3LLAA 1BLXA 3LFBA 2VO3A 3PSDA 2ZB1A 5H3QA 5KNJA 4FSNA 4RIXA 4MD7E 5HG7A 3OW3A 3E5AA 3MPTA 4XBUA 3Q4CA 3QRIA 3MPMA 1FINA 2R3PA 2ETKA 4XH6A 3V5WA 3W8LA 2VNYA 3RWQA 4TNBA 3JPVA 1CMKE 5EFQA 3NIEA 3EJ1A 3GU6A 2HWPA 4L3JA 3QWJA 3GCVA 4PDSA 3C50A 1OPLA 4A07A 3GUBA 3QCQA 1GZKA 3FZOA 2XNPA 3KQ7A 1OIQA 4B99A 3DJ5A 4A06A 2YZLA 3COIA 3OTUA 3W8QA 3EFWA 4O22A 4MNFA 3RPYA 3ID6C 3EQCA 3PJ3A 1W2CA 4GVJA 2YABA 2XA4A 4X3FC 2YJSA 1L8TA 2XALA 4IAKA 1BYGA 3HA8A 1X8BA 5FXQA 4BGQA 1R0EA 4OT6A 5FM3A 3BYMA 1LP4A 4F1TA 5JGAA 2JLDA 4EOPA 4ZLYA 4DBNA 4BRXA 3EQGA 2HYYA 1WVXA 4NKSA 2R2PA 2GU8A 4F9YA 4DHZA 2WEIA 3EHAA 4NCTA 3BLQA 2XIKA 4H05A 2R0UA 3I6UA 3WZKA 4FNWA 1M2QA 3PFQA 4GMYA 4HPTE 2Y4PA 4BBMA 2WXVA 3WYYA 5EKNA 3Q9ZA 3GU8A 1IG1A 1HOWA 1PYEA 2VTNA 2XCHA 2C6EA 1J7LA 4WO5A 1YOJA 4J8MA 4O0SA 3HGKA 5CVHA 4FSMA 2Q83A 3ZDUA 5TF9A 3QCSA 4NFMA 4BC6A 4QMLA 4Z55A 3F3WA 3FLYA 3Q9XA 4TT7A 4KBCA 4FG9A 5HIEA 4TPTA 3QA0A 1OUYA 2I6LA 3R9RA 4FKRA 4K0YA 3KFAA 2I0YA 3QFVA 4MQ2A 5I9VA 5IF1A 3Q60A 2CSNA 1PXKA 3IOPA 3PZEA 4FTMA 1Q3DA 5IPJA 2W1GA 4WNOA 3LIJA 4KRDA 4AP7A 1W2DA 2W4KA 3E3BX 5HCYA 5HLWA 4YTHA 2W4JA 5IH6A 4YPSA 2YZAA 3F6XA 4M66A 5DPVA 3GC0A 5A4CA 3ELJA 5CF5A 2GTMA 4BIDA 5EW9A 5HBJA 3DU8A 3MFTA 5G6VA 2CKQA 1J3HA 1H1RA 3VS5A 2VTLA 3C4CA 3OC1A 4X0MA 4AE6A 3Q4UA 4YC3A 5HEZA 2XYNA 5KZIA 5KMIA 3ZO4A 1XQZA 3NWWA 3LQ3A 3ZXZA 3ZFMA 4FTLA 3CLYA 2A1AB 4FV6A 4AZWA 3W10A 3U55A 4I22A 2WTIA 4PTGA 4BCJA 4CLJA 3ZRLA 2YWPA 3R73A 2W9FB 4MD8E 3FMJA 4NCTC 4AOTA 2YIWA 2E9PA 3JVRA 3AOXA 5F95A 3EB0A 3UDZA 4DHIB 1ZRZA 2YIQA 3NYOA 4FSRA 4WNKA 3KMUA 3CD8A 4QPAA 1ZMVA 3BYVA 4LFIA 4XG9A 1SYKA 1GNGA 3O51A 3MY5A 2BAJA 4RIYB 2IJMA 4U44A 5M51A 2I0HA 4M67A 1PY5A 3HDNA 4NT4A 2W1CA 3W0RA 5LMKC 4IIRA 5L6PA 4YO6A 2F7ZE 2UW9A 2H34A 4FV2A 4FUYA 3UMXA 1IEPA 3QA8A 2E9VA 4RC3A 4FV5A 3E62A 3QQKA 4NM5A 4RBLA 5GZ8A 2WTKC 4MXOA 3N4TA 4RJ3A 4UYAA 2R3JA 3E8CA 5HQ0A 4L42A 2QHNA 3BWJA 4IFCA 3RAHA 2XVDA 3ZS5A 5J7BA 2OKRA 5HX8A 1UU8A 4JNWA 3OCSA 1T45A 5J79A 4IE9A 4GS6A 5DG5A 3ORTA 4PP9A 4ERWA 1JOWB 2YDKA 4AXAA 4RGJA 2BALA 4QMSA 3QTRA 3W32A 3UQFA 3O5AA 3NMUF 3NW7A 3PE1A 2LAVA 4XV2A 5BYYA 5L2QA 3A7HA 1UU3A 4TWOA 2WMRA 2XS0A 4RLKA 5EH0A 4OW8A 4ANOA 2PVNA 4N0SA 3RK9A 4X2FA 2X4ZA 3TKIA 1ZYJA 2W96B 3HV3A 3Q9YA 4WUAA 3WZDA 4Z16A 2VX1A 4DTBA 3ORPA 2AC3A 4AXDA 3VNTA 2HCKA 5FEDA 1BI8A 1ZLTA 3FMEA 4PL5A 2WZJA 4UXLA 5FP6A 5HO6A 3S3IA 2O65A 2HENA 3MVJA 5M55A 3FC2A 3M1SA 4OBOA 4IC8A 5EI6A 5KBRA 3IECA 5JZJA 2O0UA 1W84A 3TDVA 3F3UA 5CEPA 3IKAA 3GBZA 5ANOA 1QPCA 4B9DA 3FLQA 4GJ3A 1GY3A 4FTKA 4ITIA 5BVKA 3UZPA 4C34A 2QO2A 3EFKA 4I41A 4CRLA 1VZOA 5AA8A 3QQGA 2ESMA 2ZJWA 4CG9A 2J90A 4XLVA 3FSFA 3PWYA 2Z7RA 3C4XA 4IVCA 3FXZA 3QU0A 5CLPA 3KN5A 1E1VA 3DAKA 4FNYA 4FIIA 5A46A 2A4LA 2O8YA 3QUDA 3QUEA 5EYDA 4XP3A 4YPDA 1IAHA 3F7ZA 3NYXA 4A4LA 1WVWA 3OS3A 4DINA 1GIHA 4FR4A 5E92A 3RM6A 4R5YA 3NUAA 4AXCA 3GXLA 2YM8A 3QD3A 4I5PA 4UYNA 4RC4A 5BUIA 2PZ5A 5JRQA 3PXKA 3SXFA 2Z60A 2HY81 3E88A 3HRFA 4N6ZA 3BL9A 1KOAA 3MJ1A 5IMXA 4L44A 3LQ5A 3VS4A 5JGBA 2W7XA 4CYJA 5M07A 1M2RA 3COKA 1H1QA 4E6CA 4L00A 3BYUA 2JBOA 5ANKA 5G1XA 1Q62A 4QTBA 4CFNA 3CP9A 3DCVA 4AZFA 3G2FA 3H9OA 1YXUA 5GJFA 1LEZA 3VJOA 2J0KA 4W9XA 4S31A 3KXMA 3QZFA 4M68A 4NM0A 4G3CA 3C0HA 3BLHA 3P9JA 3KRWA 3DJ7A 5ANDA 4DEHA 3PXQA 1WBTA 3PXRA 2JC6A 3FI2A 3FEGA 3KULB 4QP7A 3KU2A 2B4SB 3N51A 2PPQA 4RIWB 4GFOA 4AN2A 4RT7A 5CXZA 5M56A 1J7UA 5E4HA 5CEOA 3N9XA 3PRIA 3OUKA 5E8YA 1UNLA 3RI1A 4FA2A 4FKUA 4O84A 1PXMA 3V5PA 3B2TA 1BI7A 2G1TA 2PUNA 5FTQA 4E73A 3O23A 4Y5QA 5K0XA 4RWKA 3DKFA 2DUVA 1STCE 4IB3A 5CX9A 3ZXTA 1YHSA 2QLQA 4PPBA 5IQFA 2VAGA 4ZLZA 2VO6A 3BLAA 4OTIA 4AN9A 4ZJVA 4QP4A 5E8WA 3MIAA 4D1ZA 4R3CA 4BYJA 5M57A 3DAEA 3R7EA 1VYWA 2VTMA 3KL8A 1YI3A 2JBPA 1YDRE 2H9VA 3QKMA 1EH4A 3R6XA 3O96A 3SKCA 1YOMA 3CQUA 2XBAA 3H3CA 4TYHA 3TYKA 4XV1A 4FZAB 5CF4A 3LJ1A 1Q61A 5CEKA 3VUKA 4WOVA 4EUTA 3V5JA 3W0SA 3OROA 4K2RA 4DTAA 2QG7A 5BYLA 1Y6BA 4RLLA 2C6KA 2PSQA 3FLSA 4FG8A 4FBXA 2UUEA 3MN3A 3HMOA 2W9ZB 1H27A 4FKTA 4IAIA 5BMSA 4GK2A 4HZRA 1YXXA 2WEVA 4RA4A 4LL5A 2C3JA 5ACKA 3G33A 1OM1A 4K18A 3PA4A 4FTQA 2XKCA 2BVAA 4GVAA 2FYSA 2XP2A 4FOCA 2QO7A 3RAKA 3LXNA 3A7GA 2CCIA 4EHEA 3NRMA 3D5XA 4C61A 2Q0NA 2WELA 4FKGA 2XBJA 2P4IA 4D2PA 5JMSA 3LCKA 3TWJA 2FO0A 5J9ZA 3BI6A 2XK8A 4FYOA 2GHLA 4DN5A 3CGFA 4U5JA 2QG5A 2W4OA 2JKQA 3O71A 3QD0A 2WMWA 4AGWA 2GDOA 3QHRA 5FXSA 4MXXA 1JSVA 1Z9XA 1CKPA 4AX8A 4RWLA 3D5WA 5LWNA 4Y85A 3AKLA 4M69B 3IS5A 4MXCA 2HIWA 3V8WA 4DG2E 4RZVA 3HV5A 2PVKA 4FYNA 2NYAA 1Q97A 3HVCA 2C4GA 3DPKA 3MH3A 3OXIA 3W2QA 1RQQA 3UP7A 1NVSA 2X9FA 4S32A 1PKGA 3QRKA 2WOUA 4DDGA 4K77A 4TWPA 4BKZA 5CT7A 4JDKA 5HZNA 3R7OA 4BCGA 4F7JA 3VS0A 4QP1A 3ZDIA 5FEEA 3AD4A 2GMXA 2XANA 3AT3A 5EHLA 3NFFB 4DH1A 1G8SA 1JBPE 4U0IA 3ROCA 3COMA 4BFMA 4D1SA 5DEYA 5A3XA 4EYMA 4L68A 3HL7A 4CZTA 4BI1A 1SVHA 4JVGA 1NW1A 5GZ9A 2BKZA 4CT2A 3L1SA 4KS7A 4HCVA 4FNXA 3CXWA 3TV7A 5CAUA 1JKLA 3UE4A 4MH7A 3CBLA 4C3RA 1Q5KA 4JDIA 5EG3A 4EHZA 4OAUC 1J91A 4CYIA 2WMQA 4O1PA 4FVRA 2BILB 5HCXA 3SHEA 1M7QA 3PLAE 4UMTA 3FQEA 4EONA 2WAJA 3L9NA 4H3QA 4NIFB 4OLIA 5ANJA 3RKBA 3ZC6A 4BZDA 2Y6MA 4V05A 1IAJA 4AAYA 4QP2A 4LV7A 3R02A 3LFCA 4K6ZA 2WPAA 3PVBA 2C6LA 4O4DA 3ZHPC 4A9SA 4QTDA 3ZO3A 4L52A 5HKMA 5CEMA 3M2WA 3U6JA 4HYIA 3O2MA 4JBVA 4ERKA 3LXPA 1F5QA 4AZEA 4UMUA 1OGUA 3NS9A 4LGGA 3JS2A 4GU6A 1Q8ZA 3V01A 3QQUA 4I94A 2YLFA 2WMTA 2PVMA 1OKVA 3IDBA 4DAWA 2B9HA 3ALOA 1BL7A 4NFNA 4K9YA 4XHKB 5AWMA 1YWNA 1KE8A 3KRRA 3GCPA 4IZAA 5DMZA 2OJ9A 3C1XA 4UALA 5KMNA 5AAFA 4PP7A 5HVJA 5M08A 4IH8A 4MTAA 4DTKA 4FI1A 1URWA 3BHVA 4UZDA 4A9RA 4O7WA 2PY3A 3R04A 4KD1A 2VTOA 3R2BA 4RFZA 2NNWB 5HIBA 5DWRA 5LARA 4M15A 1TKIA 2I0VA 1VJYA 3ORXA 4W4VA 3R8PA 3RVGA 3GOKA 4GKIA 3FKOA 3PSCA 5HI2A 4C38A 4EYJA 4DF3A 1FQ1B 5AUYA 4G9RA 3ETAA 3GI3A 2RGPA 4A7CA 1UKHA 4AW1A 5BNJA 3IOKA 1PMNA 3L8SA 1GIIA 4EH8A 3O17A 4C33A 5K9IA 2IW6A 3ITZA 1V0OA 2J51A 4U8ZA 4Y73A 2BROA 4PDOA 2UZNA 5AJQA 1PMVA 2OLCA 1Q8UA 4YSMA 3DFCB 3NNUA 5CYIA 4D4SA 2PL0A 3I81A 1OL6A 3GFEA 5IU2A 4NU1A