4ANMA

Complex of ck2 with a cdc7 inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
328
Chain Sequence
SSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Xl413, a Potent and Selective Cdc7 Inhibitor.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords CASEIN KINASE II SUBUNIT ALPHA
total genus 113
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4anmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4anmA02
4O96A 5BYYA 1WBWA 2OFVA 3MA3A 1PXOA 5DFPA 5DR6A 4UN0C 5LVPA 4DEDA 1XKKA 4O38A 4C58A 2VO3A 3PY0A 4IC7A 5CU4A 3BYUA 5CASA 2OGVA 4Y85A 4JX7A 4XV2A 4BCOA 4EHEA 5L8LA 1BUHA 1DI9A 1H1PA 2J51A 4BDKA 3QZIA 3LCTA 4ZSJA 3G33A 3DK3A 4PNIA 3O0GA 4ZIMA 2E9PA 4PDPA 4X3FB 3D83A 4IH8A 3WILA 1YQJA 4IB1A 3NNXA 1ZLTA 2YDJA 4XV1A 2Y0AA 3NIEA 2XK8A 2QU6A 4R6VA 4RVKA 3LVPA 3UVRA 5KKRB 3M2WA 2C6LA 4L8MA 1YHSA 4G5PA 4MD8E 3REPA 2WQNA 2Z8CA 4WKQA 3FMHA 4JJRA 4IMYA 2CLXA 2FSTX 3C0GA 1XH9A 3V5TA 1ND4A 4B99A 2X2LA 2GCDA 4JX3A 3K2LA 4F6UA 5I4NA 2CGWA 1UU8A 4KIQA 4OTRA 3NIZA 3ZCLA 5AA8A 2PL0A 1FMOE 3FL4A 3DAEA 2QODA 2XIYA 4IXPA 4BFMA 5CT0A 3FAAA 1W83A 3JY9A 2H96A 4C8BA 4PF4A 4IHPA 2BAKA 1CKIA 3FMEA 3Q9WA 3ZBXA 4C34A 5HO8A 4CT2A 3KVWA 4DN5A 5J87A 2YAAA 4HZRA 4MQ1A 4G2FA 4IB5A 4ANMA 4UMRA 1NT2A 2OF2A 5DHJA 2A27A 4UB7A 5HO7A 3ORNA 4CZTA 5AJQA 5C8MA 4C3PA 4CV9A 2OW3A 3MFSA 3O71A 5AIRA 5I3RA 4RX5A 5JEBA 1Z9XA 1VJYA 3MJ2A 3R1NA 5FGKA 2I6LA 3FEGA 3W2RA 4JDHA 2JKOA 4I24A 2ZB1A 3KVXA 3MIAA 4RBLA 4V05A 2FGIA 2X6EA 4MEDA 4FV8A 5ANJA 2CMWA 4YO4A 3BU5A 4DF3A 3R7IA 3G6HA 3NW6A 4IANA 4FTJA 3ZLYA 4EQUA 5DEYA 2Z60A 5DT3A 2C30A 4R77A 4W4YA 5K5NA 2BFYA 2VWZA 4I3ZA 3R8LA 1MQ4A 3L9MA 3P08A 5CSWA 2IWIA 3I0QA 3U54A 1WVWA 5GZ8A 4O86A 1OB3A 5IQGA 3GU7A 3PA4A 5CQUA 3QCYA 3G6GA 4ACMA 4AW0A 3IW7A 4Y95A 3W8QA 2W1ZA 2JIIA 3OG7A 3QCSA 5A6OA 1V1KA 4GT3A 3RCDA 3QD4A 4QD6A 4FOBA 1OM1A 2WTIA 4YLJA 5JGAA 4YHFA 5DN3A 5HLWA 3EB0A 2YJSA 2WMUA 3UNZA 2WMXA 2HWOA 3FYKX 4EQCA 5LVOA 3E8EA 1GNGA 4G16A 4ZTLA 5C8NA 4FTIA 3UPXA 4NJDA 4ITIA 2H8HA 2C1BA 4FKIA 4QTBA 5CYIA 4G34A 4LFIA 4GKIA 5EDRA 5EKOA 4FKGA 4RWIA 3A2CA 3BLQA 3QWKA 4FTCA 3CP9A 1WMKA 3RBWA 5E8ZA 4FTTA 5CXHA 3ACKA 2JC6A 3IS5A 3ORTA 4YZNA 3TXOA 4DEBA 2PUIA 3WZKA 4H1JA 4CLJA 2GQSA 2OU7A 1ZYLA 3VO3A 3TUDA 3MVMA 2A1AB 4IAYA 4U97A 2IVSA 1SYKA 2BRMA 4BN1A 3N51A 3LZBA 3RMFA 3QQUA 4X3JA 1ZY5A 4FTQA 3R2YA 4BBMA 2ITZA 2XM8A 2R0UA 2WTKC 5IISA 2ESMA 5L2IA 3AD4A 4GUBA 3UVPA 2X7OA 4N70A 4KKHA 4GIIA 4BF2A 2G2IA 4EOKA 3PSBA 1YHVA 4PX6A 3I0OA 4YPSA 1Q61A 2C6TA 4BDJA 5C01A 3HL7A 3NW7A 2J0MB 2G15A 3L1SA 4MYGA 5HO6A 3C4CA 4BDAA 1A9UA 2VGOA 1R1WA 3FKLA 3GU5A 2VWUA 2OLCA 2QONA 5EYCA 3KN5A 4E6DA 1PF8A 3Q5IA 3F88A 1R39A 1UU3A 2CPKE 3NYOA 1K9AA 2VTPA 5JT2A 2WU6A 4XG2A 3D9VA 5EW9A 4IACA 2DWBA 1YI6A 4PP9A 4RX7A 3MYGA 4Y5HA 4D0WA 4EH6A 5JRSA 3IW4A 2QG5A 3EN6A 4FV3A 4O0VA 4A9RA 2PUPA 3KRLA 3CSVA 3KRRA 4GFOA 4H36A 3E8DA 4FZ7A 3OXTA 1NVSA 2GNHA 3FPMA 4D1SA 1UVRA 5A4QA 4RZWA 1H00A 4KUJA 5GIPE 3NUPA 2OJJA 3PRIA 2OO8X 5BUEA 4J53A 1NW1A 1V0PA 4RIXA 1JKKA 4X2NA 2QQ7A 4GL9A 5FTOA 2PVKA 4IX4A 4KNBA 2RKUA 3Q4UA 4X21A 2DUVA 5AR2A 2ZDTA 3UIMA 4D55A 2JFLA 3DNEA 4BGHA 2QU5A 4TWPA 3LQ3A 2GHGA 5K0XA 1Y57A 2PPQA 2DS1A 4NKSA 5ICPA 1TQIA 4ZSLA 3PDTA 2Y6MA 3S4QA 4YSJA 3UG1A 3SQQA 3O2MA 2QLQA 5DOSA 4BR3A 4M0ZA 3TJCA 3L9LA 4RIYA 5HVYA 3T3VA 1O6KA 2WMTA 4X3FA 4H05A 4L46A 4QMXA 5CWZA 4O7YA 4Y83A 3QD0A 5B2KA 5HE1A 4EORA 2YISA 1IRKA 1ZYSA 2GNLA 2GNGA 1ZRZA 5E9EA 4FZAB 3JS2A 5EG3A 4ZTSA 1Q41A 3VUHA 1RQQA 2YDKA 3HX4A 3MA6A 2XS0A 4FSQA 4L53A 3SRVB 3BV3A 2QO7A 3CQWA 4FR4A 2BDJA 4AZSA 2X2MA 1UKHA 3R9DA 3Q4CA 2XNNA 3DGKA 3CTHA 3LHJA 4AP7A 4AT5A 4BGQA 4IVDA 3ZUUA 2PVHA 3AG9A 4L00A 4MBLA 4MWIA 4EUTA 5FXSA 4OAUC 5F94A 5BMMA 2JKKA 2YACA 3PE1A 1KUTA 4ZS4A 1ZYJA 4B8MA 4O0YA 4A9UA 2OICA 4CMUA 5CENA 3ZSGA 4CFXA 3IG7A 1JSVA 2WXVA 1CDKA 2ITVA 5BYZA 4QQ5A 4RJ7A 1DS5A 1Y6BA 3I6UA 1J3HA 3V5QA 2NRYA 2ZMCA 5C26A 2WHBA 3QQKA 4QRCA 4WNMA 4F63A 4NU1A 3UIUA 4O7TA 1OL6A 2R7IA 1W8CA 2J5FA 4Z7HA 3FLZA 5ANOA 2CGUA 5IQCA 5AR5A 3W2SA 3UOLA 1HCKA 2BHEA 4AZEA 2ITNA 3U6HA 2C5XA 4DCAA 2E2BA 4YJSA 2VTLA 3CD3A 5A3XA 2VWBA 4KA3A 5AV2A 4V04A 1NXKA 5HE2A 4FKLA 4E8AA 2WQBA 4M12A 4NM0A 5ANKA 3PG1A 3R30A 1W98A 2W4KA 2W5BA 3GQLA 4L6QA 5L4QA 4ZTQA 3ZS5A 3ZUVA 3M1SA 2QOCA 3L8VA 4AZFA 4PDOA 4F6SA 1AD5A 3HA6A 1OIUA 4U42A 5IH4A 4EUUA 3QQLA 4XOZA 4R78A 3UE4A 3IQ7A 3V01A 1SVHA 3W16A 3EKKA 4QYHA 3CQEA 4YC6A 3JUHA 5EM7A 1MP8A 3RI1A 4X2FA 2UZLA 4NTTA 4W4VA 4U81A 2VN9A 3KXGA 2GQGA 3OW3A 5F1ZA 4KIOA 4ASXA 2P2IA 4F0FA 5A6NA 5KMJA 1UA2A 5D11A 4FBXA 2B9JA 5CU3A 2W1DA 3VJOA 3I60A 2J90A 2YZAA 4D2WA 3NUSA 4FOCA 3PG3A 4ERWA 5AUTA 3LJ2A 3TIYA 4HYHA 3UP2A 2JDOA 5JK3A 1YOJA 1OKZA 4JRNA 5AP2A 2WTWA 5AM7A 5E92A 1H24A 2XNMA 5ITAA 5LCKA 5C4LA 1Q8YA 5A4LA 2PMNX 3CEKA 3V5JA 3WYXA 4EC9A 3BEAA 5FDPA 1H28A 3CGFA 3MH3A 3BBTB 4WSQA 5AP0A 4U9AA 2RF9A 4C4JA 3F9NA 4P90A 3GUBA 4GIHA 3E3BX 4DEHA 5FXRA 4XV9A 2R3MA 3KRJA 3UOKA 3TTIA 2WTCA 4MNFA 4CQEA 4UMUA 5JSMA 4BL1A 4CEGA 3AMYA 3O51A 4ARKA 2Z7SA 3D7TB 4ZTRA 1PY5A 4I4EA 3TACA 3ANRA 5EYKA 3ZC6A 4JVGA 5BUIA 3MPMA 3SA0A 4TWOA 3PRFA 2H34A 2CKQA 1L3RE 3BE9A 4O0SA 4KKEA 4YHTA 3ORPA 5EHOA 2F49A 4AGCA 3U8WA 1OUKA 3U55A 4C38A 1BLXA 2R3FA 4D5KA 3BKBA 3SV0A 5BVNA 3W8LA 4I5CA 5J7BA 3NVMB 4UMTA 3GU8A 3VQUA 3WARA 1GZNA 3K54A 4M13A 2ZDUA 3CY2A 3IW6A 5CF8A 2XIRA 3OT3A 4JDIA 4DHFA 1U54B 3R7VA 5CVFA 4AN9A 5JMSA 5IMXA 3ZFYA 3CIKA 4DFLA 4NM3A 1ZOHA 4K0YA 1JKTA 2HY81 2YN8A 2QURA 5HVJA 4DH5A 4CKJA 3DA6A 3PPKA 4IX5A 1O6LA 4B7TA 5EQPA 2XNGA 4PTGA 3R7YA 5IA3A 3L9PA 2JKQA 4YNOA 2WIHA 3HV3A 1H27A 4HPTE 3KXHA 5TO8A 2CKEA 3EN5A 2QOQA 5K0KA 3TZ9A 2I7QA 2YM4A 2C3KA 3NUXA 1MUOA 2XP2A 2HZ0A 2O63A 3LCDA 4FVPA 4QMOA 3D94A 3FDNA 1FGKA 3PXZA 4G3DA 4NCTA 5HNBA 1IR3A 1KOBA 2GFCA 2VGPA 2Z7LA 3QUEA 4RFYA 2BDWA 3E8NA 4HGSA 3V5LA 4BKYA 4DCEA 3TUCA 3A8WA 3ZH8A 1LR4A 2B52A 3DK7A 4J95A 3EN7A 3A4OX 4G6LA 4CFNA 4FUXA 4W9XA 4FV6A 4AS0A 4NEUA 3UNKA 1U4DA 1UWJA 4QTEA 3I4BA 3NYXA 4XCUA 1VYZA 3TT0A 2E9UA 4FEWA 4ZXTA 5CEIA 3VS6A 4NW5A 3C5IA 2OI4X 5DG5A 3LXPA 3KULA 1Q8WA 1B6CB 4YZDA 4KS7A 3UVQA 4KRCA 2XBAA 4K77A 4FT9A 3VHEA 2PULA 3GC9A 3U9CA 3COMA 4YJQA 2O3PA 4E1ZA 3C4EA 2R2PA 1AQ1A 1OPLA 5LOHA 1BYGA 4BZNA 1OL5A 4FT0A 3QKLA 3R71A 1Y8GA 3R28A 3DFCB 3CPBA 3KMUA 1BKXA 4EYMA 3NYVA 2UW5A 5IU2A 5DT0A 5E8YA 4XP3A 1ZMUA 4YBKA 3R7UA 2AC3A 1KE6A 4ONAA 5TOZA 2JITA 3ANQA 4CZYB 1W0XC 3EFJA 3NUUA 4I6HA 4GFGA 4RIWA 3TWJA 3QA0A 4IM2A 2WTJA 2VO7A 4MXZA 5DBXA 3RPVA 4AA5A 4BB4A 5BNJA 3EWHA 1KE9A 3CD8A 4ASZA 4C4GA 4EL9A 2HAKA 5IF1A 4FV1A 4W8EA 1BX6A 2VWXA 2XKCA 4ZEGA 2BZJA 3EHAA 4J99A 1WBNA 3NVKI 2YCRA 4G3GA 2QR8A 3IO7A 2OH4A 3MH0A 5IA4A 2W4OA 4UY9A 2R3OA 2ZVAA 3AC2A 2JFMA 4CT1A 2EXMA 4CD0A 2B9IA 3PJ3A 3R21A 1FBNA 3G2FA 3WI6A 3D4QA 2PMOX 1GZOA 4QPSA 3S1HA 4PQNA 3DBDA 2ONLA 5E8TA 3UC4A 3V5PA 2OSCA 3FL5A 3O8PA 4IE9A 5IZFA 2Y4PA 1F0QA 1BMKA 4QTAA 4AZTA 5IEXA 4M14A 3RHKA 4RA5A 3I6WA 4LRKA 1XJDA 2IVTA 3ROCA 3AC8A 2WGJA 4QP7A 3MV5A 4BYJA 3ZZWA 3VUTA 1NVRA 4CFUA 4ZAUA 3A7IA 4XG3A 2VX3A 4FTUA 2Q83A 4KD1A 5FBOA 3BU3A 4FMQA 1RE8A 4K6ZA 4LOOA 2QG7A 1E1VA 5M44A 3R01A 4QMMA 4WO5A 4E5WA 4EZ7A 4MD7E 4L67A 3CTJA 4E4LA 4Z16A 3R22A 1Q8TA 3DTCA 3NUAA 4EHVA 2PE1A 4BCFA 4MXXA 2CGVA 2PSQA 4O6EA 1OIRA 2XNOA 3KRWA 5IUGA 5IQEA 2X1NA 4MTAA 1OBDA 3FQEA 4I6QA 4G3FA 2BRGA 1M52A 3CR0A 3CCNA 3MPTA 5LWNA 3KRXA 4M15A 2GNJA 4AOJA 4CG9A 4FKQA 4R5YA 3LMGA 3ROYA 3WF9A 5J1VA 3F2RA 5KMIA 3ZSHA 5AV4A 5G1XA 2VTAA 4BCIA 3POOA 4AFJA 4EWQA 4AGWA 2WZJA 5IPJA 4P4CA 4HJOA 5M4IA 2VWIA 5CF4A 4HNIA 4DBXA 4OTHA 3VF9A 4DFUA 2BALA 3DXNA 4D4SA 3R9RA 4U44A 4D2TA 2HELA 3HV6A 5K3YA 5I5ZA 3FZTA 1XBAA 5JQ5A 3DKCA 3M42A 4C4EA 5LVNA 3A99A 2ZM3A 3OCSA 5KE0A 3BBWA 4RIWB 1YXUA 4X0MA 4XUFA 2G1TA 3GB2A 2BILB 4AZVA 5CLPA 5TKDA 4GRBA 5IH5A 3FMJA 4R8QA 3UNJA 1NVQA 1PXNA 4JIAA 3M11A 3DKOA 1GIIA 4CXAA 5DIAA 2BVAA 2YLEA 1DAWA 1FINA 5AMNA 4JBPA 2OXYA 4EBVA 3K3JA 2IO6A 4HVSA 3CKXA 4HVGA 5L3AA 3COIA 1TQPA 4C2VA 4FL2A 5CAQA 2EU9A 1T46A 4JR3A 3R2BA 5HG5A 4F4PA 1LEZA 2R3NA 5E4HA 4EI4A 5KCVA 4BZDA 2YEXA 4APPA 4YLLA 2VX0A 4S2ZA 5M55A 4BGGA 2ITYA 3A62A 4JG8A 3IPHA 3HRFA 2FSLX 4MCVA 5HE0A 3TDWA 3G0EA 2WMQA 4L9IA 4O27B 4FG9A 4UMPA 2J9MA 3VWAA 4MQ2A 2BFXA 2B9HA 3V04A 4RJ5A 1YI4A 3BZ3A 2JGZA 3IW8A 4CKRA 3ZO4A 2VTIA 1XBCA 3OY1A 4XLIA 3U4UA 1PKDA 4PPBA 5GJGA 3MDYA 3O50A 2WMRA 3FQSA 2J2IB 3BLRA 4TWNA 5IH6A 4FIHA 1PXIA 2HZ4A 3Q6UA 4X7QA 2PVFA 5F95A 3PA3A 2P0CA 4QTCA 2I1MA 4QT1A 4R3RA 3FUPA 1IAHA 1PMEA 5J9YA 5ACBC 4OTIA 3V8SA 3SXFA 4CTCA 4TN6A 1JKLA 2IW9A 3ZXZA 2JBPA 3FI3A 4EJNA 1OL7A 2HENA 3WE8A 4O81A 2P2HA 3E8CA 4FV0A 4JXFA 1YXSA 2R3JA 4Y5QA 3MWUA 3VVHA 4FG8A 4YNEA 2BIYA 3WOWA 2BKKA 1YOLA 3AD5A 3NNUA 4ZP5A 2BZKB 1CSNA 2BZIB 2XYUA 3MFTA 3WBLA 1GAGA 3I5NA 3UZTA 2C5VA 3BHYA 4G17A 2J0JA 4IWOA 4X2KA 3IONA 3ORLA 3RK9A 4GFMA 5DWRA 2CKPA 2HXLA 4DFNA 3ZOSA 4JOAA 3S3IA 2B7AA 3PVUA 3A7HA 1XH7A 5M4FA 1OI9A 4E73A 3DK6A 2HCKA 4BZOA 3QRUA 3C9WA 4O7RA 3AOXA 4IEBA 5AFVA 3FC2A 2CHLA 5HIBA 4MXYA 3MVHA 4C02A 1YXTA 5AX9A 5A9UA 2WEVA 4YMJA 4NT4A 3IOKA 4MXCA 4CRSA 3WF6A 4E20A 3DZOA 4IC8A 3R7OA 5JGDA 4UMQA 2R3PA 3R8VA 4FODA 4DH1A 5DVRA 4Q5HA 3DDQA 5FM3A 3G9LX 5CF5A 2A4LA 5CEQA 2OJFE 5DLSA 3ID6C 2X8EA 4YZCA 3LLAA 4OBPA 2I0YA 3KK8A 2ITUA 2ITWA 1MRYA 2XZSA 3CKWA 2VTHA 5HG7A 2UW4A 1M7NA 3QZHA 4BHZA 5KUPA 4FKVA 4JR7A 3NPCA 3KGAA 4FIFA 2IZRA 4J97A 4ZTHA 3SW4A 4HCTA 4MF1A 4E4MA 3OXZA 2VO6A 3UOHA 3HVCA 5A46A 2PZIA 4NW6A 4Q2AA 4GU9A 4KBKA 4FV2A 4K8AA 2GDOA 4AA0A 3P1AA 4ACHA 4KIKB 2BR1A 3FY2A 3QTUA 4ZY5A 3OHTA 3SKCA 1JPAA 3Q2MA 5E8UA 1WAKA 4IJ9A 2ITXA 4DGOA 3PZEA 5FM2A 3DQXA 3S2PA 3QC4A 2IPXA 4R7IA 4CZUA 4FKTA 4BCJA 5CNNA 1FGIA 2FVDA 1REKA 4D2VA 3ZHPC 4DT8A 4I0SA 3PXKA 4DINA 4NH1A 3MB6A 3FKOA 1V0OA 4O82A 2C0TA 5AA9A 2I0HA 2SRCA 4BCQA 2B0QA 2XMYA 4USEA 2C6MA 3N4TA 2HK5A 2HZIA 3PWYA 3F5PA 2O8YA 3FHIA 4NFMA 4LYNA 3OEFX 1OKYA 4J8MA 4RGJA 5HD7A 3FC1X 3Q9XA 5LMAA 3DLSA 4XRJA 2YERA 2OH0E 2W9FB 3FKNA 2Q0NA 4RMZA 3RHXA 4DH3A 4RVMA 1BL6A 5J1WA 3WZDA 3ERKA 4O0UA 5J7HA 2EB2A 3FLWA 5L2WA 3FZOA 3QBNA 4IX3A 4WA9A 4LV8A 5KX8A 2R0IA 2QHMA 5KNJA 5LQFA 2XRWA 2VWYA 4GJ2A 3RWQA 2CJMA 3HAMA 1Q97A 3RNIA 3CTQA 3GNIB 3HV5A 4O2ZA 4BWKA 2PZPA 4JI9A 3P7AA 1G8SA 4J8NA 2GS7A 5C03A 3HP2A 2UW0A 1KSWA 2YCQA 3JY0A 4CLIA 4EK8A 3LCKA 4E6CA 4C4FA 2XCKA 5KBQA 4RIXB 2ZV2A 4UZHA 2CKOA 3KK9A 3COKA 3FLNC 1LP4A 1P2AA 3LPBA 4FYOA 1A06A 4YJNA 3PIZA 4LRJA 1I09A 4W9WA 3W1FA 4X6QC 4ANBA 4RZVA 1WBSA 1QMZA 1OMWA 2CDZA 5CVGA 3SHEA 4AE9A 1M7QA 2R3GA 4DGMA 4LMUA 3SOAA 4QMQA 4ALWA 3H10A 5C8KA 5B2LA 2PE0A 5FUTA 2LGCA 2C47A 3TV7A 4DH8A 4QQCA 4MBJA 3E92A 1UNLA 3NX8A 4X6RA 5AP4A 3NNVA 3LFBA 4V0GB 3PP1A 5LARA 4HVIA 5JKGA 2V7AA 1L8TA 3TV6A 1H26A 1LEWA 1NY3A 2IVUA 4G1WA 2V7OA 3QRIA 1KWPA 2UZVA 2VV9A 4TZRA 4DEEA 4FA2A 3ORXA 2NO3A 4B4LA 3DV3A 4F6WA 3EZRA 4F1TA 5CEOA 4QMPA 4WG3A 2OZAA 5HESA 3ZU7A 3Q5ZA 1Y6AA 2VWVA 4CVAA 4OT5A 3C7QA 3LMHA 5A54A 2ETRA 2BMCA 2V62A 3TI1A 4BWXA 3W32A 4FNZA 4DGNA 4FNWA 2WKMA 4JAJA 4HCUA 5EK7A 5M4UA 3AQVA 5JZNA 2GS6A 3VQHA 4CGAA 3DB8A 1WZYA 3GI3A 5AR7A 5FP6A 4RJ3A 4ZSGA 4DE4A 1U59A 3GXLA 3KC3A 4C4HA 3MESA 3HUCA 4BDFA 3CJGA 4QOXA 2BUJA 4O0XA 3ZDIA 2C6DA 4IZ5A 2XEZA 5DMZA 2RG6A 3C5UA 4C36A 5JFWA 3FLYA 3BGZA 5CXZA 1V0BA 4RX9A 5EM8A 4KWPA 2YM8A 3ET7A 4HOKA 4UWYA 4KSQA 3RINA 3OZ6A 4FC0A 4A4XA 4I92A 4BCNA 3ODZX 3FMMA 2XK7A 4FSZA 3SC1A 3GC0A 2O64A 5DT4A 4CFFA 4FL1A 4D2PA 3QYWA 5DEWA 2ITPA 5I3OA 2ZYBA 1KV2A 3RTPA 5I9WA 2VTOA 2R9SA 4E6QA 3N4UA 2UZBA 3ALOA 1XH6A 3F69A 3R8UA 3W2PA 3BHTA 4X2GA 2Y4IC 4IBMA 4TWCA 4F08A 3SVVA 5FLFA 3B8QA 3R00A 4TYJA 4EK6A 3R1YA 1J91A 5J5TA 4D4VA 1H0WA 4OTPA 4RT7A 4JG7A 2X2KA 3POZA 2W1EA 5HZNA 3FMDA 3Q6WA 3BE2A 1WBVA 4WOVA 3P5KA 5AV1A 4BVUA 4GVAA 2WQOA 1PXLA 2VTNA 1WBOA 5FEDA 5JFXA 2F9GA 3OS3A 3GBZA 3NRMA 4M97A 3T9TA 3E5AA 3OTVA 5CANA 3NW5A 3GFWA 2PVLA 3D15A 4O2PA 3FZRA 3SXRA 4BIDA 1Q4LA 3Q2JA 3ELJA 4I93A 3CPCA 2OJ9A 3MY5A 2OBJA 2C68A 2GTMA 3MFRA 3RAHA 5FWKK 2FA2A 3W2QA 3KMWA 3ZLWA 4PDYA 4G3CA 5DRBA 4WHZA 4YGAA 1XHAA 2W7XA 2OXXA 4JQ7A 1ERKA 2R3LA 1QPJA 1S9JA 4HGTA 2BHHA 3OF0A 4PMMA 4Y73A 1PKGA 4G31A 3OEZA 4RJ6A 3D0EA 4BICA 3BHHA 4FKPA 3KMMA 4A4LA 3UO4A 4BTFA 3UYSA 5ANGA 4YJPA 2I0EA 3FLSA 3QCXA 4BDEA 4G6NA 3FXWA 2QR7A 1ZOEA 3SG9A 3ZONA 5AWMA 4D4YA 3BHVA 2GHLA 4OBQA 4BTKA 3BV2A 4C37A 5EDQA 5AR3A 4Z55A 2BKZA 3P0MA 4XRLA 4AW5A 4IZAA 3LCOA 4ZY6A 5KKRC 5DA3A 4HPUE 3V6SA 2Z02A 4CSVA 2ACXA 3U87A 3MH1A 5HTBA 4BYIA 4Z3VA 5GHVA 2F4JA 3BQRA 4O21A 2YM3A 4TYHA 3P9JA 3ATSA 2C3LA 3P7CA 4DG3E 5JH6A 3HDNA 4GT5A 4U0IA 4AACA 1XO2B 1Y8YA 4KAOA 3VIDA 4XMOA 5D12A 2OJIA 3OWPA 3F82A 4BIBA 1OL2A 3DTWA 3R8PA 3UZRA 5CNOA 3P78A 3QQJA 4YZBA 5FTGA 2RL5A 3LXNA 4LOPA 4ZMEA 2ETKA 4RWKA 2WIPA 1CTPE 4UV0A 2ZM1A 2VD5A 3ZMMA 4ZLZA 4NM7A 4OLIA 2JEDA 1UU9A 2BAQA 5C1QB 2UZEA 5GIOE 1G3NA 3EH9A 4P7EA 2OIQA 4V0GA 1DAYA 2VTJA 4MXOA 4NUSA 4ZJJA 3GC8A 4H1MA 2C4GA 4WT6A 2IZSA 5GJDA 3PXFA 2W4JA 3SDJA 4EK3A 5EKNA 4HGEA 1Q24A 2A2AA 4C62A 3K5VA 3GCQA 1G5SA 4IDVA 4QP3A 5M57A 5TR6A 2UUEA 4AN3A 4G5JA 4B6LA 3O7LD 3BPRA 2PVMA 4A9YA 2NRUA 3EKNA 3BU6A 4HW7A 4A4OA 4H3BA 3QD2B 3GC7A 4YUQA 3BRBA 2XK4A 3AMBA 4ZSEA 3UO6A 5CAPA 2C6IA 1PXKA 1P5EA 2YZLA 2V5QA 2P55A 4WG4A 3UP7A 2FH9A 4JQEA 3DAJA 2XF0A 4EOMA 5DR9A 5LMKC 5AUUA 4FTLA 4USFA 2ZJWA 1CMKE 1MRUA 2WMAA 4DITA 3EQGA 5EW8A 3VUKA 3ENHA 1CM8A 4FTOA 3VS4A 4ZTMA 4WBOA 1NA7A 4C4IA 4O7VA 4GYIA 3L9NA 1ZZLA 2HW6A 2V0DA 4OBOA 4U8ZA 5FBNC 3WIKA 4CV8A 5IUIA 4JT3A 5L8KA 4MAOA 3QALE 4KBCA 4LG4A 3EN9A 2W1HA 4L68A 2BTSA 5CY3A 3T3UA 5L6PA 4CYIA 4EZ3A 3NSZA 3O8TA 3VRYA 3RK5A 3VBTA 3BYSA 1OITA 2XA4A 3RWPA 4EOPA 5AUVA 4O7SA 4LGGA 5GNKA 3Q4ZA 4F9CA 4DA5A 3HV4A 4HYUA 2OIDA 4DEGA 4C57A 3G0FA 3OMVA 4S33A 1J7UA 3JR1A 3DCVA 3EQCA 4YURA 3E7OA 4ZS0A 2YIQA 3ZFXA 4K33A 4L44A 3QD3A 3GEQA 4J7BA 4NJ3A 3WE4A 2YM6A 5E7RA 1WBPA 5AV3A 3CC6A 4MF0A 4FKJA 3FSFA 2CNQA 2PZRA 3G9NA 2G2FA 3VUGA 3T9IA 4ITHA 3G51A 1H07A 4GEOA 2IZUA 2WQEA 4FKUA 2B9FA 2X4FA 4RJ8A 5CX9A 4DFZE 1PRYA 3B2TA 4YU2A 2WD1A 3HNGA 2CCHA 3MY0A 4QQJA 5HTCA 3RAIA 4L52A 3LJ1A 3Q96A 2RG5A 2XB7A 3GCUA 4BC6A 4XG4A 4Z9LA 1DI8A 5M4CA 4FIIA 1YWVA 3OUNB 4FSTA 4G6OA 3CS9A 4RVTA 3UG2A 3PSDA 5J9LA 3QAME 2A0CX 4WNKA 2KULA 2J0LA 2R3IA 5EFQA 3NUYA 4BCGA 2Y9QA 5HVKA 1WVXA 3P4KA 5J5SA 4ALUA 4EH8A 5ANDA 3A8XA 3ENMA 3KXXA 3TNIA 3FXZA 3UMXA 5CZHA 5EQYA 3NAYA 4IFGA 4I6BA 2C5OA 4GH2A 4EK4A 3DKFA 4HGLA 3RVGA 4BDDA 3GVUA 4K1BA 4ENYA 4M69A 4KABA 5H8GA 3TTJA 5L2QA 1PJKA 4PDSA 4C59A 4XEYA 3DY7A 3AD6A 3SOCA 1Q5KA 4DAWA 4PWNA 5BYLA 4QP8A 3QHWA 4ID7A 1XWSA 5A14A 3GCVA 3QGYA 2OIBA 1J7IA 2F2UA 2JKMA 4ENXA 2UW6A 3TM0A 2HZNA 3VJNA 4CTBA 3HRCA 4FV9A 2GNIA 3VULA 4EH7A 4NWMA 4ZLOA 3UOJA 4APCA 3QQGA 3EZVA 4F7SA 4F9WA 3C4FA 3OP5A 1GIHA 4LUDA 4O83A 1FVRA 2WQMA 3QLFA 3LFSA 4K11A 3D5UA 3OWLA 5E8WA 3ZM9A 3E7VA 4L43A 1GY3A 2XBJA 3RZFA 3TDVA 4AA4A 2WELA 1VEBA 1R78A 3GCSA 3LFAA 3QL8A 4Q9SA 5H8EA 3UPZA 5M08A 4PY1A 3EL7A 3PE2A 3QF9A 4F9BA 3H9OA 2VAGA 3JYAA 4ZK5A 5EW3A 3V8WA 1S9IA 2J50A 3W33A 3UYTA 4FE2A 1U54A 2E9NA 2XEYA 1QPCA 3LKMA 1PXJA 3AGLA 1H4LA 5IA1A 1YOMA 2ZV8A 2F57A 1EH4A 3QU0A 3QX2A 4YTHA 3R8MA 1VYWA 3R9OA 2XK3A 3F6XA 3FJQE 1J1CA 3H0YA 3DB6A 3KXNA 4UYAA 1Z57A 3PPJA 4FZ6A 4G9CA 4BDBA 3TCPA 4U6RA 2YIRA 5M09A 3PSCA 3HKOA 4W8DA 4AU8A 4DTAA 1M14A 2C6OA 3NEWA 5HNIX 4LI5A 3DT1A 3A7GA 4E7WA 2QOIA 1R0EA 3LW0A 5ETIA 5KZIA 3N9XA 3DBFA 1QCFA 4WUNA 4FEVA 5CI7A 1ZMVA 1E9HA 3AT3A 3ORMA 1BI7A 3RPOA 4CMTA 4OR5A 4DBNA 5CF6A 4PMTA 3BI6A 4C61A 3AT2A 3LFFA 4QYGA 3Q9ZA 4RFMA 2UZUE 3WIGA 3NZ0A 3F3TA 4IB3A 4PTCA 1IA9A 5HNGA 3E88A 2RFEA 5J9ZA 3TN8A 4ASDA 5L2TA 3OT8A 4ANSA 3F5UA 4C35A 4MD9E 4FSNA 4B9DA 2Z7QA 2G2HA 2EUFB 3FSKA 2YHVA 5B0XA 5BPYA 3C0HA 5AP3A 3ZTXA 3AC4A 3L8PA 4E26A 5CU2A 4DEAA 1SM2A 4QMNA 5GJFA 1QPDA 3UTOA 3SG8A 5M56A 4F9AA 1T45A 3UMWA 3WF7A 4E5AX 4EOIA 2C0OA 3VHKA 1E1XA 2NP8A 3FE3A 4WNOA 4YPDA 5AUZA 3RKBA 3ZM4A 3DXQA 2YWVA 4NIFA 2J7TA 5AADA 2UW3A 2ZV9A 3W2OA 3KQ7A 4CRLA 5A4EA 4Y72A 3BYVA 4M69B 5HBHA 3RPSA 2CSNA 2J0KA 1KE7A 3IDBA 5M07A 4DFXE 3Q4TA 5KHWA 1JWHA 4J52A 4MH7A 4HZSA 4WRSA 4DYMA 4RQVA 2VNWA 4AW1A 4GW8A 4M84A 3BIZA 4O0WA 2CGXA 2QI8A 4OUCA 4XG9A 4BTJA 2IJMA 4XG7A 1TVOA 1B39A 1WBTA 2J4ZA 2RFSA 3P79A 3HECA 4OTQA 3ULIA 4LQMA 1BL7A 3D5VA 3OWKA 3QWJA 4I20A 3MVJA 3QX4A 3OOGA 2P33A 2ERKA 5HBJA 3DNDA 3QRKA 4IW0A 4MBIA 4DC2A 3TUBA 1IEPA 2EWAA 3F2AA 5D41A 3PY1A 2GFSA 4QPMA 1FVVA 1O6YA 4FTMA 4PP7A 3DS6A 4ZZMA 3NCGA 2PHKA 1PHKA 2X4ZA 3U51A 3ZEPA 5CEPA 3D2KA 1F5QA 4FSUA 4R1YA 1URWA 4EONA 3MI9A 5LCJA 1OBGA 5HBEA 3ZO2A 2ITOA 3OC1A 4XJ0A 3QTXA 2Q0BA 3UGCA 4TYEA 4ZTNA 1KE8A 3HMNA 4QP9A 1FOTA 3BX5A 4YJOA 2VTMA 4AWIA 4Q9ZA 3DOGA 2QD9A 2EVAA 2UZWE 2QOFA 2YDIA 1HCLA 3TKHA 3SX9A 5J8IA 4NM5A 4KB8A 1H08A 5IMEA 1ZZ2A 2XNPA 3BWJA 5AR8A 3V8TA 4FVRA 4W4XA 3Q9YA 4EHGA 5J79A 4QMSA 4NYEA 1OL1A 4I0TA 3PJCA 4WSYA 3ZO1A 5B7VA 4O84A 3HMPA 1PMNA 2BCJA 4HYSA 3GQIA 2CN8A 4QO9A 4E4NA 1YI3A 3KF7A 3NLBA 4UYNA 1JAMA 4AF3A 1OECA 1YRPA 3HMMA 4C7TA 1H8FA 4I1ZA 3D14A 4ZJVA 2W9ZB 5E90A 1Q62A 4TY1A 1RJBA 4FG7A 4QMUA 3DJ5A 3VS2A 3ORIA 2R4BA 4FSMA 1SMHA 2UZDA 3DXPA 3GU4A 4FX3A 5BVKA 5FQDC 1ZYCA 1OIYA 1FVTA 3NAXA 3NGAA 4NIFB 4ANLA 4S34A 4C2WA 4XP2A 5L6OA 4DTBA 4J71A 1WFCA 4BCPA 3ORKA 3AMAA 5D7VA 5ACKA 3WF5A 2NNWB 3EQHA 2BRBA 2JLDA 1CKJA 3HAVA 4JS8A 4O1OA 4S31A 4U3YA 4PV0A 5G6VA 4NCTC 3TV4A 4L3LA 2XIKA 4K9YA 4LGDA 4EBWA 1J1BA 4UWCA 4O6LA 1APME 5M53A 5CSHA 4CFWA 1GOLA 2ZM4A 1B38A 1KOAA 3S95A 3EYHA 1GJOA 1XR1A 1KE5A 3ZO3A 5IA0A 4QMVA 4BKZA 3FWQA 5ETAA 3OROA 2R5TA 3TZ7A 2W99B 2JD5A 3NS9A 4ANOA 4UALA 3F3ZA 5BVOA 3FMKA 2WU7A 2CNVA 4WG5A 3LFDA 5LWMA 1JQHA 3NCZA 4H39A 4GK2A 3PJ2A 4O91A 4CFMA 3UZPA 2XRUA 4FKOA 4XYFA 4JLCA 4E3CA 4MWHA 5BVDA 4F09A 2PVNA 4DTKA 4P2KA 1A48A 2WMBA 4JDJA 2DYLA 4GJ3A 3RNYA 4D58A 4ORKA 3R1SA 3H9FA 4YC3A 4I21A 4NTSA 2UVXA 1YWRA 5EM5A 3R0TA 3F3UA 1PYEA 5CVHA 5JGBA 1OUYA 1YVJA 2PK9A 4DH7A 2FYSA 5TF9A 5I9VA 1P14A 2Y8OA 1PMVA 4K2RA 2KTYA 2R3KA 1UKIA 4QMWA 4U43A 4GV1A 4AE6A 3QHRA 4BCHA 1TQMA 3RPRA 4F9YA 4HVHA 2ZV7A 4F7NA 5KHXA 4BI2A 4EK5A 4FKSA 4TT7A 1MQBA 3PXYA 4TW9A 5DGZA 3TNQB 3V6RA 3OCTA 1UU7A 2Y4IB 3EQPA 3K3IA 4G9RA 4UXQA 5T3QA 3G15A 2J0IA 4U45A 3EJ1A 3QTWA 4XP0A 4AOIA 2OFUA 2B1PA 3O8UA 4H3PA 1H0VA 4JDKA 4AFEA 4EKLA 3TNWA 5LMKA 4FKRA 4I6FA 1Q99A 4I22A 1WVYA 3FY0A 3QTRA 4RG0A 2PTKA 3ALNA 4XNEA 3K5UA 3H4JA 2PMLX 3OCBA 4BHNA 3BEGA 3ZRLA 3OY3A 4DLIA 3D7ZA 2QCSA 3Q32A 3QCQA 4N57A 3TIZA 4I5MA 1XBBA 4QMZA 5C4KA 3N4VA 2AYPA 3GP0A 5AX3A 2CNUA 4I23A 2XVDA 3I81A 4PPCA 5EOBA 1PXMA 3BYOA 3RM7A 4RIOA 5T6KA 5HGIA 3DQWA 3C13A 1U46A 5IEVA 2B55A 4F99A 2R3RA 3LOKA 4GUEA 2OF4A 3C51A 2O5KA 4HCVA 2V22A 4R1VA 1W82A 1YDTE 4JIKA 4XLVA 3CLYA 2X7FA 1YKRA 3KKVA 1H1WA 3BELA 5FEEA 5KMMA 3KREA 3V3VA 2ZAZA 3O7LB 3Q3BA 3ZDUA 2UW8A 5EQEA 1JSTA 4KIKA 3Q04A 3EQIA 2YFXA 3C0IA 4A06A 4AT3A 4DGGA 5CALA 3ETAA 4RLLA 3RM6A 3HGKA 3W55A 5DI1A 3DJ7A 4RPVA 4AZWA 4DFYA 3U6IA 3PVBA 4IAAA 3R1QA 4JBVA 4QYFA 5CU6A 5CU0A 2GHMA 2LAVA 2GU8A 2X8DA 3MGYA 3O96A 3P23A 3QRJA 3RJCA 2X81A 4RRVA 2R64A 2GPHA 2E9VA 4L3PA 4QTDA 2PZ5A 3PXRA 5D1JA 2GTNA 1AGWA 1URCA 5HKMA 4AW2A 5IKWA 5D9HA 3MS9A 2C6EA 2EXEA 3EL8A 4FK3A 3L8XA 3ZSIA 2A19B 4OTDA 5HEZA 3F61A 2QLUA 3AXWA 3OWJA 3OUKA 5D7AA 1JNKA 1STCE 4FTRA 2W1CA 3A7FA 1UV5A 4TTHB 5HG8A 3SD0A 4QYYA 4JRVA 4D2RA 3UQFA 4U80A 2VUWA 4PL5A 1PMUA 5J95A 4BIEA 5GZAA 5FG8A 2CCIA 3ZUTA 3AC5A 4IADA 2C3IB 4UEUA 5KMOA 5CAVA 1H25A 3C50A 4L01A 4OGRA 2ZOQA 5C27A 1JKSA 3COHA 4IZYA 4B0GA 4R7BA 2W5HA 2QNJA 5IQBA 4YTCA 1YHWA 5HCYA 4EHZA 4ZOGA 2W5AA 4QMTA 4EH9A 3QUDA 4GU6A 4RC4A 3FHRA 1OKWA 3VUIA 5EYMA 2BRHA 5I9ZA 4QNYA 5CEMA 5JFVA 3RAWA 3LM5A 2JIUA 3FMLA 2F7XE 2RIOA 5H9BA 4OTFA 5F9EA 3DBEA 4G3EA 5EDPA 2YWPA 3RALA 4F70A 2RSVA 3GGFA 3I79A 3FZ1A 4BCKA 5CSPA 3LMIA 3FLQA 2JBOA 2P4IA 3QXOA 4FTNA 4M7IA 4PL4A 4O22A 3U4WA 4WRGA 1BI8A 2OK1A 3EQBA 2Y7JA 4OTGA 1ZY4A 4XHKB 3MBLA 3OW4A 5K4IA 5IEYA 3HDMA 4LOQA 4BKJA 4OTWA 1JBPE 1H1SA 1HOWA 5H3QA 4F1OA 4HYIA 4JQ8A 5DRDA 4BDCA 4ITJA 4CKIA 2C1AA 4YJRA 2XJ0A 2OG8A 4ALVA 4BTMA 4FK6A 3F5GA 2JAVA 1P4OA 4P5ZA 4NK9A 4RQKA 3GFEA 3ORZA 3PUPA 1K2PA 1M2RA 2VTTA 3CJFA 3OFMA 3HMOA 4GS6A 3KCKA 4D5HA 3MFUA 2FO0A 4FTKA 3V51A 4D9UA 1VR2A 4I94A 4FGBA 4XBUA 4CCBA 4L7SA 4EH5A 3R83A 1Q8UA 3LXKA 4MNEB 4U40A 4FKWA 5D10A 3PWDA 5DE2A 3QKKA 2WFYA 4X3FC 3D5XA 3G90X 5L8JA 2HW7A 3KY2A 2NPQA 2G9XA 3D5WA 4MKCA 4N4SA 1SVGA 1ZMWA 4MNEA 5TE0A 2IN6A 2R7BA 4HNFA 3RZBA 3OBGA 4ZJIA 2WAJA 4L3JA 4A9TA 3LJ0A 4F7LA 3MPAA 1FQ1B 3I1AA 4QP6A 4RIYB 3KA0A 4E5BA 3OBJA 2YM5A 3EIDA 3HP5A 3Q53A 5CEKA 5M51A 3W10A 1PXPA 4X2JA 4EOQA 3U6JA 2YITA 4F7JA 2ZB0A 4AAAA 3LCSA 2ONLC 5AP5A 1YXXA 1XH5A 1IA8A 4IAKA 1YXVA 3SRVA 3UIBA 4D28A 4FT5A 4FV4A 2GS2A 3RAKA 4LL5A 2RGPA 4R3CA 5EHLA 3Q52A 3SGCA 1OPKA 4N6YA 1Q3WA 3QTIA 3G5DA 5FRIA 4TYHB 4AN2A 5HU3A 3FZSA 2RFNA 1M2PA 3O23A 4RX8A 2WMWA 3EYGA 4IVAA 3TNHA 3O17A 4ACGA 3MN3A 2JDRA 2QKRA 4GSBA 4BDIA 2GSFA 2XM9A 4A07A 5ANEA 4Z7GA 3H3CA 5LVMA 1ZARA 3LFCA 4TL0A 3KB7A 4S30A 4O7WA 1H1QA 5LVLA 4D2SA 2GQRA 4FV7A 4EOLA 4U3ZA 4YTFA 4IQ6A 1MRVA 4ZZNA 4KS8A 2PWLA 4IJPA 3ZLXA 3VF8A 4QP2A 4FF8A 4FSRA 4EOJA 2VTRA 2WMSA 2DQ7X 3GU6A 2WTVA 4D4RA 3MTLA 5EOLA 4LRMA 3MSSA 2E9OA 2I40A 3FV8A 3IECA 5DNRA 1OPJA 3ULZA 3R9NA 5AP6A 5ETFA 2C0IA 3TZMA 3DJ6A 4BBFA 2PUNA 3QKMA 3GOPA 4O0RA 1R3CA 3ACJA 2W1GA 3KXMA 4MHAA 3BWFA 2XNBA 3PVGA 3B8RA 4E4XA 4FZDB 1JSUA 5A4CA 4YTIA 2FSOX 1SZMA 4RVLA 4TNBA 4Y8DA 4U5JA 2XYNA 5HICA 2XKEA 3WZJA 2WPAA 4FIGA 3EFWA 2HIWA 5HG9A 3VBQA 5IUHA 3IW5A 3NR9A 2BDFA 4ACDA 2QOLA 1QL6A 2X6DA 3A4PA 2VWWA 4WUAA 2F2CB 5FDXA 2WOUA 4EC8A 4PMSA 2BZHB 4LV5A 3TG1A 4JBQA 2IG7A 1FPUA 4EKKA 2V55A 3VUMA 5DH3A 3QYZA 2PMIA 3ITZA 3LQ5A 2Z7RA 3R7GA 2WMVA 4IM0A 5EM6A 4DFBA 3SW7A 1K3AA 5HD4A 2IZTA 2FB8A 4YBJA 2PE2A 5KMNA 2UW9A 4ZMFA 4CMOA 2XKDA 2O65A 4RWLA 4R7HA 3RPYA 3EMGA 3KU2A 4NFNA 4DEIA 5IDPA 2VNYA 3AC1A 3GENA 3PIYA 1GZKA 1OVEA 1XH8A 4H3QA 3PJ8A 3EQDA 2C5YA 3NDMA 4N6ZA 4F64A 4GCJA 4OAVB 4M68A 1GIJA 5BQ0A 5AAFA 4KIPA 5KZ0A 3CY3A 5HIDA 3F3VA 3W18A 2CLQA 1JOWB 4NSTA 5IG1A 2W05A 2Z2WA 3KF4A 2PZYA 3L8SA 5AEPA 5DPVA 5AM6A 5B2MA 2WO6A 2OZOA 3VNTA 3VW6A 5IA2A 2ZMDA 4E93A 5HQ0A 3BGPA 1VZOA 1ZOGA 2W06A 2XJ2A 3PA5A 5I9YA 4GMYA 4AOTA 4GK3A 2QOHA 3F2NA 3VS3A 4FSYA 5JQ8A 4YO6A 3F66A 4FIEA 3THBA 2REIA 4TRLA 4R5SA 2QHNA 2QOKA 3PFQA 4IAFA 3PVWA 4TYGA 3DAKA 3KXZA 4TYIA 2BRNA 2B53A 1RDQE 1X8BA 2YIWA 3CBLA 3MJ1A 4O1PA 5DR2A 2XUUA 4C33A 3KULB 4R3PA 1REJA 2ITQA 5HHWA 4E6AA 2WB8A 3FYJX 4ANNA 4CFVA 5AUXA 3F3WA 3MVLA 4MXAA 1YDSE 2OZAB 4A7CA 5KBRA 4QMLA 2B4SB 2Y6OA 3ZEWA 5ANIA 4BCMA 4KBAA 5EH0A 3MIYA 4FICA 4FVQA 3HRBA 5BVFA 4USDA 3NMUF 2VTSA 2QO9A 5CSXA 1IAJA 2VZ6A 4PRJA 3QLGA 2X0GA 2W1IA 2XIZA 2VX1A 3H30A 4UXLA 3ZBFA 5JZJA 5DYJA 4YJTA 1ZAOA 3HMIA 3MH2A 3OTUA 2PVRA 4CG8A 4GG5A 4AGUA 4O7NA 3GCPA 4IX6A 3H9RA 4PMPA 3QTQA 3CXWA 3ZC5A 3PYYA 5HE3A 5CZIA 3QFVA 3ATTA 4JBOA 3MB7A 4ZY4A 3R6XA 4LMNA 5E91A 4IVCA 4XG6A 1LUFA 2B54A 2R3QA 3JPVA 5K5XA 2IW6A 3BGQA 4WD5A 4XV3A 2HOGA 4FZFB 4N0SA 5JFSA 4FNXA 3VBVA 4P5QA 5EI8A 5CAUA 3FI4A 1TKIA 2WNTA 5E8VA 2VU3A 3R63A 5H2UA 5FTQA 5FP5A 4IDTA 5HCXA 2JAMA 1CKPA 2X39A 2W0JA 4ZZOA 3E87A 4FIJA 3TKIA 3RP9A 1P4FA 1SNUA 4AGDA 4FT7A 3RK7A 5JRQA 4FNYA 3FMNA 3Q60A 5K4JA 5T68A 4QPAA 1GZ8A 3VRZA 5L2SA 5AP7A 4RFZA 2ERZE 3FBVA 5HLNA 3R04A 4LUEA 3E93A 3ZYAA 2PY3A 3DKGA 4FV5A 4YJUA 4UWBA 1OKVA 4QP4A 4TNDA 5AAGA 3D7TA 3HYHA 4FGRA 4FEQA 3LM0A 3QGWA 4AUAA 2WOTA 4O7ZA 5IQIA 3MTFA 4DT9A 4FI1A 2CN5A 3EFLA 2YCFA 4YHJA 5AR4A 3S00A 2XKFA 3VBWA 4WBBB 4YC8A 5L6WL 2BIKB 2OJGA 3UJGA 3PJ1A 4RJ4A 4ZSAA 2YIYA 5I9UA 2GMXA 2PVJA 4EOSA 2PYWA 3VBYA 2JDSA 2PUUA 3IGGA 2ETMA 3KFAA 3ODYX 4YZ9A 2G01A 3R73A 4U79A 3TNPC 3QZFA 4D1ZA 3FQHA 5AAEA 4M67A 4F0GA 4LGHA 3R02A 3OD6X 3DBQA 4D9TA 3C1XA 2WTDA 3AT4A 2PVYA 3WZEA 4EH2A 3QA8A 1G8AA 3PLSA 5C9CA 4FTAA 2QKWB 2FUMA 4TKSA 3DLZA 3E3PA 4A9SA 3PLAE 2UZNA 3I7CA 3PIXA 5HORA 4MK0A 4V01A 5BVWA 3U9NA 5IQFA 2JDTA 3HA8A 3EN4A 2YCSA 4IFCA 4GT4A 2W96B 3OOMA 4CCUA 2WTKB 3E64A 5HTIA 1W7HA 5LXMA 2C3JA 4II5A 4PTEA 3RCJA 3E63A 3TJDA 5FXQA 5IA5A 4XS2A 4BI0A 2HWPA 3HEGA 1JVPP 3FI2A 4BRXA 4LM5A 1OGUA 1Q3DA 1PYXA 4ZLYA 2XJ1A 3F7WA 2UZTA 4JG6A 4EJ7A 2VRXA 2VTQA 2EXCX 3FPQA 4AT4A 3LFEA 4BWPA 4J96A 2F7ZE 2AUHA 5BMSA 3R9HA 5BVEA 1ATPE 1XH4A 4FL3A 3TEIA 3C4WA 5E1EA 2YAKA 4F65A 3SLSA 4QP1A 1Y91A 4DG2E 4RC2A 3LXLA 3SAYA 4C3FA 5CS6A 4GYGA 2XH5A 3CE3A 1SNXA 3UDBA 3WF8A 4I0RA 5AIKA 5FD2A 3LIJA 4JNWA 3HLLA 3QUPA 3WZUA 5AP1A 5BUJA 3F5XA 2C6KA 5A4TA 2QVSE 5K9IA 4ACCA 3PXQA 1DM2A 3QQFA 4AXAA 5F20A 4BY9E 2O0UA 4QMYA 5EI6A 5HLPA 4I4FA 3DU8A 4EZ5A 1UNGA 2I0VA 3IK3A 3NNWA 4IAIA 1QPEA 3VS1A 3CQUA 4C0TA 4L42A 3DBCA 4D1XA 4PUZA 2UZOA 3OVVA 3LFNA 4XOYA 4GKHA 5HU9A 3JVRA 2HYYA 5CAOA 2XK9A 3VBXA 1W84A 3E62A 5HCZA 3B2WA 3CGOA 2AC5A 4DGLC 4J98A 4M3QA 4YLKA 1H01A 4KSPA 2X8IA 3IGOA 2BPMA 4MVFA 3BCEA 5EI2A 4IVBA 3FI8A 3SXSA 4M8TA 4UZDA 4LL0A 2BROA 3PPZA 3VS5A 1J7LA 4FUYA 2QO2A 3PTGA 5LJJA 1OZ1A 2HXQA 5CT7A 4H58A 2JIVA 3QQHA 2O2UA 4AX8A 3VC4A 3V5WA 5F4NA 1WCCA 2X9FA 4NZWB 1UWHA 3QZGA 4MX9A 1ZXEA 2H9VA 4L7FA 4BDHA 5GZ9A 4FYNA 1YW2A 3D2IA 3LQ8A 2FSMX 2X9EA 3UC3A 4KKGA 3BLHA 3BYMA 2WEIA 1H1RA 4UBAA 3KL8A 3QC9A 4XH6A 3R8ZA 4CYJA 2OKRA 3IDCA 3LE6A 1R0PA 4AQCA 4I5HA 5HI2A 1F3MC 3NUNA 4FSWA 4WNPA 4Y46A 3FXXA 3BQCA 3ZXTA 5M06A 4PL3A 3PP0A 3VUDA 5LMBA 4IB0A 4BDGA 3VS0A 1SVEA 2OXDA 3EQFA 3OCGA 4TXCA 4YR8A 4I41A 3A60A 2JDVA 2XIXA 3LAUA 3DPKA 3LFQA 3UBDA 4O7LA 2QOBA 3QTZA 4IWQA 4B8LA 3HV7A 4KINA 3ZFMA 4IZ7A 2ITTA 1YWNA 2R3HA 1JLUE 4JAIA 4M66A 4IAZA 2YABA 3UO5A 3OXIA 4RC3A 3VW8A 4U7ZA 4QYEA 2YM7A 1YDRE 4O0TA 4XX9A 3FZPA 3IOPA 4IM3A 2C5NA 3MY1A 3LLTA 3PZHA 4IIRA 3EOCA 3AC3A 2X7GA 3H0ZA 5EHYA 1U5RA 5KMKA 5IQHA 3I5ZA 4YSMA 5IDNA 3ZLSA 3QRTA 4QQTA 3A7JA 1M17A 2J5EA 4RWJA 1XQZA 4CQGA 3KEXA 2XCHA 5FEQA 4W4WA 3QTSA 1Q8ZA 2YLFA 4JL9A 3S0OA 3C4ZA 4YP8A 5IQDA 3UODA 5GINE 5E8SA 3TL8A 5KO1A 3AGMA 3GOKA 2BAJA 2OWBA 1I44A 4HVDA 3F7ZA 2F7EE 3P86A 2HY0A 2XK6A 2XNEA 2J6MA 4YZMA 5I9XA 4CNHA 4AG8A 1IG1A 1FMKA 2EB3A 3QXPA 4BBEA 5HIEA 4UX9A 3RGFA 3VS7A 3JVSA 4WIHA 3NYNA 1PW2A 3EFKA 5AUYA 5HOAA 5EYDA 4KRDA 5BX0A 4K18A 3VAPA 1ZYDA 3DZQA 5E8XA 4DLJA 4ERKA 4EOOA 2YA9A 2P3GX 2W1FA 4NL0A 3TZ8A 3JXWA 4EH4A 2H6DA 1ZWSA 2PU8A 4GK4A 1KV1A 2BTRA 3UQGA 4GVJA 1U5QA 4ANQA 3ZRMA 4BI1A 2UVYA 4F1MA 2GNFA 3ZZEA 2UV2A 3GT8A 4PPAA 5E1SA 1O9UA 3I7BA 4EYJA 5CQWA 4EH3A 2W17A 4QNAA 2UVZA 1UNHA 4J1RA 3VN9A 4EWHA 5HX6A 5AUWA 3IKAA 3EQRA 3WYYA 1Z5MA 3HZTA 3C4XA 4F0IA 4OT6A 3UQCA 3MW1A 3HUBA 4RSSA 2YJRA 4FEUA 4TPTA 4FT3A 5AV0A 5KMLA 3DDPA 3DFAA 2QC6A 4YJVA 3KCFA 3PY3A 4I5PA 4IWPA 5CTPA 4OW8A 2IW8A 4D0XA 4NKAA 3P7BA 2IVVA 3ZRKA 2VO0A 4FEXA 3R7EA 5CSVA 2QOOA 4M0YA 5TT7A 4ASEA 4IWDA 4L45A 5H8BA 3TKUA 4C3RA 4RA4A 3W2CA 5IQAA 4GG7A 3NWWA 5ETCA 3T8OA 3UIXA 4Q5EA 2UW7A 4U41A 3A61A 1IASA 4S32A 4RLKA 4PNKA 1RW8A 4EEVA 1LPUA 5HX8A 4EQMA 2RFDA 2C69A 3KN6A 5I0BA 3IDPA 4DG0E 1OIQA 4XBRA 3BHUA 5JN2A 3II5A 2YIXA 4XG8A 5CI6A 1M2QA
chains in the Genus database with same CATH superfamily
4O96A 5BYYA 1WBWA 2OFVA 3MA3A 1PXOA 5DFPA 5DR6A 4UN0C 5LVPA 4DEDA 1XKKA 4O38A 4C58A 2VO3A 3PY0A 4IC7A 5CU4A 3BYUA 5CASA 2OGVA 4Y85A 4JX7A 4XV2A 4BCOA 4EHEA 5L8LA 1BUHA 1DI9A 1H1PA 2J51A 4BDKA 3QZIA 3LCTA 4ZSJA 3G33A 4DHZA 3DK3A 4PNIA 3O0GA 2X0PA 4ZIMA 2E9PA 4PDPA 4X3FB 3D83A 4IH8A 3WILA 1YQJA 4IB1A 3NNXA 1ZLTA 2YDJA 4XV1A 2Y0AA 3NIEA 2XK8A 2QU6A 4R6VA 4RVKA 3LVPA 3UVRA 5KKRB 3M2WA 2C6LA 4L8MA 1YHSA 4G5PA 4MD8E 3REPA 2WQNA 2Z8CA 4WKQA 3FMHA 4JJRA 4IMYA 2CLXA 2FSTX 3C0GA 1XH9A 3V5TA 1ND4A 4B99A 2X2LA 2GCDA 4JX3A 3K2LA 4F6UA 5I4NA 2CGWA 1UU8A 4KIQA 4OTRA 3NIZA 3ZCLA 5AA8A 2PL0A 1FMOE 3FL4A 3DAEA 2QODA 2XIYA 4IXPA 4BFMA 5CT0A 3FAAA 1W83A 3JY9A 2H96A 4C8BA 4PF4A 4IHPA 2BAKA 1CKIA 3FMEA 3Q9WA 3ZBXA 4C34A 5HO8A 4CT2A 3KVWA 4DN5A 5J87A 2YAAA 4HZRA 4MQ1A 4G2FA 4IB5A 4ANMA 4UMRA 1NT2A 2ZFYA 2OF2A 4AXCA 5DHJA 2A27A 4UB7A 5HO7A 3ORNA 4CZTA 5AJQA 5C8MA 4C3PA 4CV9A 2OW3A 3MFSA 3O71A 5AIRA 5I3RA 4RX5A 5JEBA 1Z9XA 1VJYA 3MJ2A 3R1NA 5FGKA 2I6LA 3FEGA 3KIOC 3W2RA 4JDHA 2JKOA 4I24A 2ZB1A 3KVXA 3MIAA 4RBLA 4V05A 2FGIA 2X6EA 4MEDA 4FV8A 5ANJA 2CMWA 4YO4A 3BU5A 4DF3A 3R7IA 3G6HA 3NW6A 4IANA 4FTJA 4O4FA 3ZLYA 4EQUA 5DEYA 2Z60A 5DT3A 2C30A 4R77A 4W4YA 5K5NA 2BFYA 2VWZA 4I3ZA 3R8LA 1MQ4A 3L9MA 3P08A 5CSWA 2IWIA 3I0QA 3U54A 1WVWA 5GZ8A 4O86A 1OB3A 5IQGA 3GU7A 3PA4A 5CQUA 3QCYA 3G6GA 4ACMA 4AW0A 3IW7A 4Y95A 3W8QA 2W1ZA 2JIIA 3OG7A 3QCSA 5A6OA 1V1KA 4GT3A 3RCDA 3QD4A 4QD6A 4FOBA 1OM1A 2WTIA 4YLJA 5JGAA 4YHFA 5DN3A 5HLWA 3EB0A 2YJSA 2WMUA 3UNZA 2WMXA 2HWOA 3FYKX 4EQCA 5LVOA 3E8EA 1GNGA 4G16A 4ZTLA 5C8NA 4FTIA 3UPXA 4NJDA 4ITIA 2H8HA 2C1BA 4FKIA 4QTBA 5CYIA 4G34A 4LFIA 4GKIA 5EDRA 5EKOA 4FKGA 4RWIA 3A2CA 3BLQA 3QWKA 4FTCA 3CP9A 1WMKA 3RBWA 5E8ZA 4FTTA 5CXHA 3ACKA 2JC6A 3IS5A 3ORTA 4YZNA 3TXOA 4DEBA 2PUIA 3WZKA 4H1JA 4CLJA 2GQSA 2OU7A 1ZYLA 3VO3A 3TUDA 3MVMA 2A1AB 4IAYA 4U97A 2IVSA 1SYKA 2BRMA 4BN1A 3N51A 3LZBA 3RMFA 3QQUA 4X3JA 1ZY5A 4FTQA 3R2YA 4BBMA 2ITZA 2XM8A 2R0UA 2WTKC 5IISA 2ESMA 5L2IA 3AD4A 4GUBA 3UVPA 2X7OA 4N70A 4KKHA 4GIIA 4BF2A 2G2IA 4EOKA 3PSBA 1YHVA 4PX6A 3I0OA 4YPSA 1Q61A 2C6TA 4BDJA 5C01A 3HL7A 3NW7A 2J0MB 2G15A 3L1SA 4MYGA 5HO6A 3C4CA 4BDAA 1A9UA 2VGOA 1R1WA 3FKLA 3GU5A 2VWUA 2OLCA 2QONA 5EYCA 3KN5A 4E6DA 1PF8A 3Q5IA 3F88A 1R39A 1UU3A 2CPKE 3NYOA 1K9AA 2VTPA 5JT2A 2WU6A 4XG2A 3D9VA 5EW9A 4IACA 2DWBA 1YI6A 4PP9A 4RX7A 3MYGA 4Y5HA 2IF8A 4D0WA 4EH6A 5JRSA 3IW4A 2QG5A 3EN6A 4FV3A 4O0VA 4A9RA 2PUPA 3KRLA 3CSVA 3KRRA 4GFOA 4H36A 3E8DA 4FZ7A 3OXTA 1NVSA 2GNHA 3FPMA 4D1SA 1UVRA 5A4QA 4RZWA 1H00A 4KUJA 5GIPE 3NUPA 2OJJA 3PRIA 2OO8X 5BUEA 4J53A 1NW1A 1V0PA 4RIXA 1JKKA 4X2NA 2QQ7A 4GL9A 5FTOA 2PVKA 4IX4A 4KNBA 2RKUA 3Q4UA 4X21A 2DUVA 5AR2A 2ZDTA 3UIMA 4D55A 2JFLA 3DNEA 4BGHA 2QU5A 4TWPA 3LQ3A 2GHGA 5K0XA 1Y57A 2PPQA 2DS1A 4NKSA 5ICPA 1TQIA 4ZSLA 3PDTA 2Y6MA 3S4QA 4YSJA 3UG1A 3SQQA 3O2MA 4JMQA 4MUQA 2QLQA 5DOSA 4BR3A 4M0ZA 3TJCA 3L9LA 4RIYA 5HVYA 3T3VA 1O6KA 2WMTA 4X3FA 4H05A 4L46A 4QMXA 5CWZA 4O7YA 4Y83A 3QD0A 5B2KA 5HE1A 4EORA 2YISA 1IRKA 1ZYSA 2GNLA 2GNGA 1ZRZA 5E9EA 4FZAB 3JS2A 5EG3A 4ZTSA 1Q41A 3VUHA 4AAYA 1RQQA 2YDKA 3HX4A 3MA6A 2XS0A 4FSQA 4L53A 3SRVB 3BV3A 2QO7A 3CQWA 4FR4A 2BDJA 4AZSA 2X2MA 1UKHA 3R9DA 3Q4CA 2XNNA 3DGKA 3CTHA 3LHJA 4AP7A 4AT5A 4BGQA 4IVDA 3ZUUA 2PVHA 3AG9A 4L00A 4MBLA 4MWIA 4EUTA 5FXSA 4OAUC 5F94A 5BMMA 2JKKA 2YACA 3PE1A 1KUTA 4ZS4A 1ZYJA 4B8MA 4O0YA 4A9UA 2OICA 4CMUA 5CENA 3ZSGA 4CFXA 3IG7A 1JSVA 2WXVA 1CDKA 2ITVA 5BYZA 4QQ5A 4RJ7A 2X0QA 1DS5A 1Y6BA 3I6UA 1J3HA 3V5QA 2NRYA 2ZMCA 5C26A 2WHBA 3QQKA 4QRCA 4WNMA 4F63A 4NU1A 3UIUA 4O7TA 1OL6A 2R7IA 1W8CA 2J5FA 4Z7HA 3FLZA 5ANOA 2CGUA 5IQCA 5AR5A 3W2SA 3UOLA 1HCKA 2BHEA 4AZEA 2ITNA 3U6HA 2C5XA 4DCAA 2E2BA 4YJSA 2VTLA 3CD3A 5A3XA 2VWBA 4KA3A 5AV2A 4V04A 1NXKA 5HE2A 4FKLA 4E8AA 2WQBA 4M12A 4NM0A 5ANKA 3PG1A 3R30A 1W98A 2W4KA 2W5BA 3GQLA 4L6QA 5L4QA 4ZTQA 3ZS5A 3ZUVA 3M1SA 2QOCA 1W2FA 3L8VA 4AZFA 4PDOA 4F6SA 1AD5A 3HA6A 5BV3A 1OIUA 4U42A 5IH4A 4EUUA 3QQLA 4XOZA 4R78A 3UE4A 3IQ7A 3V01A 1SVHA 3W16A 3EKKA 4QYHA 3CQEA 4YC6A 3JUHA 5EM7A 1MP8A 3RI1A 4X2FA 2UZLA 4NTTA 4W4VA 4U81A 2VN9A 3KXGA 2GQGA 3OW3A 5F1ZA 4KIOA 4ASXA 2P2IA 4F0FA 5A6NA 5KMJA 1UA2A 5D11A 4FBXA 2B9JA 5CU3A 2W1DA 3VJOA 3I60A 2J90A 2YZAA 4D2WA 3NUSA 4FOCA 3PG3A 4ERWA 5AUTA 3LJ2A 3TIYA 4HYHA 3UP2A 4FJVA 2JDOA 5JK3A 1YOJA 1OKZA 4JRNA 5AP2A 2WTWA 5AM7A 5E92A 1H24A 2XNMA 5ITAA 5LCKA 5C4LA 1XMLA 1Q8YA 5A4LA 2PMNX 3CEKA 3V5JA 3WYXA 4EC9A 3BEAA 5FDPA 1H28A 3CGFA 3MH3A 3BBTB 4WSQA 5AP0A 4U9AA 2RF9A 4C4JA 3F9NA 4P90A 3GUBA 4GIHA 3E3BX 4DEHA 5FXRA 4XV9A 2R3MA 3KRJA 3UOKA 3TTIA 2WTCA 4MNFA 4CQEA 4UMUA 5JSMA 4BL1A 4CEGA 3AMYA 3O51A 4ARKA 2Z7SA 3D7TB 4ZTRA 1PY5A 4I4EA 3TACA 3ANRA 5EYKA 3ZC6A 4JVGA 5BUIA 3MPMA 3SA0A 4TWOA 3PRFA 2H34A 2CKQA 1L3RE 3BE9A 4O0SA 4KKEA 4YHTA 3ORPA 5EHOA 2F49A 4AGCA 3U8WA 1OUKA 3U55A 4C38A 1BLXA 2R3FA 2NYAA 4D5KA 3BKBA 3SV0A 5BVNA 3W8LA 4I5CA 5J7BA 3NVMB 4UMTA 3GU8A 3VQUA 3WARA 1GZNA 3K54A 4M13A 2ZDUA 3CY2A 3IW6A 5CF8A 2XIRA 3OT3A 4JDIA 4DHFA 1U54B 3R7VA 5CVFA 4AN9A 5JMSA 5IMXA 3ZFYA 3CIKA 4DFLA 4NM3A 1ZOHA 4K0YA 1JKTA 2HY81 2YN8A 2QURA 5HVJA 4DH5A 4CKJA 3DA6A 2XARA 3PPKA 4IX5A 1O6LA 4B7TA 5EQPA 2XNGA 4PTGA 3R7YA 5IA3A 3L9PA 2JKQA 4YNOA 2WIHA 3HV3A 1H27A 4HPTE 3KXHA 5TO8A 2CKEA 3EN5A 2QOQA 5K0KA 3TZ9A 2I7QA 2YM4A 2C3KA 3NUXA 1MUOA 2XP2A 2HZ0A 2O63A 3LCDA 4FVPA 4QMOA 3D94A 3FDNA 1FGKA 3PXZA 4G3DA 4NCTA 5HNBA 1IR3A 1KOBA 2GFCA 2VGPA 2Z7LA 3QUEA 4RFYA 2BDWA 3E8NA 4HGSA 3V5LA 4BKYA 4DCEA 3TUCA 3A8WA 3ZH8A 1LR4A 2B52A 3DK7A 4J95A 3EN7A 3A4OX 4G6LA 4CFNA 4FUXA 4W9XA 4FV6A 4AS0A 4NEUA 3UNKA 1U4DA 1UWJA 4QTEA 3I4BA 3NYXA 4FRFA 4XCUA 1VYZA 3TT0A 2E9UA 4FEWA 4ZXTA 5CEIA 3VS6A 4NW5A 3C5IA 2OI4X 5DG5A 3LXPA 3KULA 1Q8WA 1B6CB 4YZDA 4KS7A 3UVQA 4KRCA 2XBAA 4K77A 4FT9A 3VHEA 2PULA 3GC9A 3U9CA 3COMA 4YJQA 2O3PA 4E1ZA 3C4EA 2R2PA 1AQ1A 1OPLA 5LOHA 1BYGA 4BZNA 1OL5A 4FT0A 3QKLA 3R71A 1Y8GA 3R28A 3DFCB 3CPBA 3KMUA 1BKXA 4EYMA 3AKJA 3NYVA 2UW5A 5IU2A 5DT0A 5E8YA 4O4BB 1ZMUA 4XP3A 4YBKA 3R7UA 2AC3A 1KE6A 4ONAA 5TOZA 2JITA 3ANQA 4CZYB 1W0XC 3EFJA 3NUUA 4I6HA 4GFGA 4RIWA 3TWJA 3QA0A 4IM2A 2WTJA 2VO7A 4MXZA 5DBXA 3RPVA 4AA5A 4BB4A 5BNJA 3EWHA 1KE9A 3CD8A 4ASZA 4C4GA 4EL9A 2HAKA 5IF1A 4FV1A 4W8EA 1BX6A 2VWXA 2XKCA 4ZEGA 2BZJA 3EHAA 4J99A 1WBNA 3NVKI 3W0NA 2YCRA 4G3GA 2QR8A 3IO7A 2OH4A 3MH0A 5IA4A 2W4OA 4UY9A 2R3OA 2ZVAA 3AC2A 2JFMA 4CT1A 2EXMA 4CD0A 2B9IA 3PJ3A 3R21A 1FBNA 3G2FA 3WI6A 3D4QA 2PMOX 1GZOA 4QPSA 3S1HA 3NFGB 4PQNA 3DBDA 2ONLA 5E8TA 3UC4A 3V5PA 2OSCA 3FL5A 3O8PA 4IE9A 5IZFA 2Y4PA 1F0QA 1BMKA 4QTAA 4AZTA 5IEXA 4M14A 3RHKA 4RA5A 3I6WA 4LRKA 1XJDA 2IVTA 3ROCA 3AC8A 2WGJA 4QP7A 3MV5A 4BYJA 3ZZWA 3VUTA 1NVRA 4CFUA 4ZAUA 3A7IA 4XG3A 2VX3A 4FTUA 2Q83A 4KD1A 5FBOA 3BU3A 4FMQA 1RE8A 4K6ZA 4LOOA 2QG7A 1E1VA 5M44A 3R01A 4QMMA 4WO5A 4E5WA 4EZ7A 4MD7E 4L67A 3CTJA 4E4LA 4Z16A 3R22A 1Q8TA 3DTCA 3NUAA 4EHVA 2PE1A 4BCFA 4MXXA 2CGVA 2PSQA 4O6EA 1OIRA 2XNOA 3KRWA 5IUGA 5IQEA 2X1NA 4MTAA 1OBDA 3FQEA 4I6QA 4G3FA 2BRGA 1M52A 3CR0A 3CCNA 3MPTA 5LWNA 3KRXA 4M15A 2GNJA 4AOJA 4CG9A 4FKQA 4R5YA 3LMGA 3ROYA 3WF9A 5J1VA 3F2RA 5KMIA 3ZSHA 5AV4A 5G1XA 2VTAA 4BCIA 3POOA 4AFJA 4EWQA 4AGWA 2WZJA 5IPJA 4P4CA 4HJOA 5M4IA 2VWIA 5CF4A 4HNIA 4DBXA 4OTHA 3VF9A 4DFUA 2BALA 3DXNA 4D4SA 3R9RA 4U44A 4D2TA 2HELA 3HV6A 5K3YA 5I5ZA 3FZTA 1XBAA 5JQ5A 3DKCA 3M42A 4C4EA 5LVNA 3A99A 2ZM3A 3OCSA 5KE0A 3BBWA 4RIWB 1YXUA 4X0MA 4XUFA 2G1TA 3GB2A 2BILB 4AZVA 5CLPA 5TKDA 4GRBA 5IH5A 3FMJA 4R8QA 3UNJA 1NVQA 1PXNA 4JIAA 3M11A 3DKOA 1GIIA 4CXAA 5DIAA 2BVAA 2YLEA 1DAWA 1FINA 5AMNA 4JBPA 2OXYA 4EBVA 3K3JA 2IO6A 4HVSA 3CKXA 4HVGA 5L3AA 3COIA 1TQPA 4C2VA 4FL2A 5CAQA 2EU9A 1T46A 4JR3A 3R2BA 5HG5A 4F4PA 1LEZA 2R3NA 5E4HA 4EI4A 5KCVA 4BZDA 2YEXA 4APPA 4YLLA 2VX0A 4S2ZA 5M55A 4BGGA 2ITYA 3A62A 4JG8A 1W2CA 3IPHA 3HRFA 2FSLX 4MCVA 5HE0A 3TDWA 3G0EA 2WMQA 4L9IA 4O27B 4FG9A 4UMPA 2J9MA 3VWAA 4MQ2A 2BFXA 2B9HA 3V04A 4RJ5A 1YI4A 3BZ3A 2JGZA 3IW8A 4CKRA 3ZO4A 2VTIA 2XALA 1XBCA 3OY1A 4XLIA 3U4UA 1PKDA 4PPBA 5GJGA 3MDYA 3O50A 2WMRA 3FQSA 2J2IB 3BLRA 4TWNA 5IH6A 4FIHA 1PXIA 2HZ4A 3Q6UA 4X7QA 2PVFA 5F95A 3PA3A 2P0CA 4QTCA 4LV7A 2I1MA 4QT1A 4R3RA 3FUPA 1IAHA 1PMEA 5J9YA 5ACBC 4OTIA 3V8SA 3SXFA 4CTCA 4TN6A 1JKLA 2IW9A 3ZXZA 2JBPA 3FI3A 4EJNA 1OL7A 2HENA 3WE8A 4O81A 2P2HA 3E8CA 4FV0A 4JXFA 1YXSA 2R3JA 4Y5QA 3MWUA 3VVHA 4FG8A 4YNEA 2BIYA 3WOWA 2BKKA 1YOLA 3AD5A 3NNUA 4ZP5A 2BZKB 1CSNA 2BZIB 2XYUA 3MFTA 3WBLA 1GAGA 3I5NA 3UZTA 2C5VA 3BHYA 4G17A 2J0JA 4IWOA 4X2KA 3IONA 3ORLA 4O4EA 3RK9A 4GFMA 5DWRA 2CKPA 2HXLA 4DFNA 3ZOSA 4JOAA 3S3IA 2B7AA 3PVUA 3A7HA 1XH7A 5M4FA 1OI9A 4E73A 3DK6A 2HCKA 4BZOA 3QRUA 3C9WA 4O7RA 3AOXA 4IEBA 5AFVA 3FC2A 2CHLA 5HIBA 4MXYA 3MVHA 4C02A 1YXTA 5AX9A 5A9UA 2WEVA 4YMJA 4NT4A 3IOKA 4MXCA 4CRSA 3WF6A 4E20A 3DZOA 4IC8A 3R7OA 5JGDA 4UMQA 2R3PA 3R8VA 4FODA 4DH1A 5DVRA 4Q5HA 3DDQA 5FM3A 3G9LX 5CF5A 2A4LA 5CEQA 2OJFE 5DLSA 3ID6C 2X8EA 4YZCA 3LLAA 4QDEA 4OBPA 2I0YA 3KK8A 2ITUA 2ITWA 1MRYA 2XZSA 3CKWA 2VTHA 5HG7A 2UW4A 1M7NA 3QZHA 4BHZA 5KUPA 4FKVA 4JR7A 3NPCA 3KGAA 4FIFA 2IZRA 4J97A 4ZTHA 3SW4A 4HCTA 4MF1A 4E4MA 3OXZA 2VO6A 3UOHA 3HVCA 5A46A 2PZIA 4NW6A 4Q2AA 4GU9A 4KBKA 4FV2A 4K8AA 2GDOA 4AA0A 3P1AA 4ACHA 4AXDA 3ML1A 4KIKB 2BR1A 3FY2A 3QTUA 4ZY5A 3OHTA 3SKCA 1JPAA 3Q2MA 5E8UA 1WAKA 4IJ9A 2ITXA 4DGOA 3PZEA 5FM2A 3DQXA 3S2PA 3QC4A 2IPXA 4R7IA 4CZUA 4FKTA 4BCJA 5CNNA 1FGIA 2FVDA 1REKA 4D2VA 3ZHPC 4DT8A 4I0SA 3PXKA 4DINA 4NH1A 3MB6A 3FKOA 1V0OA 4O82A 2C0TA 5AA9A 2I0HA 2SRCA 4BCQA 2B0QA 2XMYA 4USEA 2C6MA 3N4TA 2HK5A 2HZIA 3PWYA 3F5PA 2O8YA 3FHIA 4NFMA 4LYNA 3OEFX 1OKYA 4J8MA 4RGJA 5HD7A 3FC1X 3Q9XA 5LMAA 3DLSA 4XRJA 2YERA 2OH0E 2W9FB 3FKNA 2Q0NA 4RMZA 3RHXA 4DH3A 4RVMA 1BL6A 5J1WA 3WZDA 3ERKA 4O0UA 5J7HA 2EB2A 3FLWA 5L2WA 3FZOA 3QBNA 4IX3A 4WA9A 4LV8A 5KX8A 2R0IA 2QHMA 5KNJA 5LQFA 2XANA 2XRWA 2VWYA 4GJ2A 3RWQA 2CJMA 3HAMA 1Q97A 3RNIA 3CTQA 3GNIB 3HV5A 4O2ZA 4BWKA 2PZPA 1G8KA 4JI9A 3P7AA 1G8SA 4J8NA 2GS7A 5C03A 3HP2A 2UW0A 1KSWA 2YCQA 3JY0A 4CLIA 4EK8A 3LCKA 4E6CA 4C4FA 4I6LA 2XCKA 5KBQA 4RIXB 2ZV2A 4UZHA 2CKOA 3KK9A 3COKA 3FLNC 1LP4A 3AKLA 1P2AA 3LPBA 4FYOA 1A06A 4YJNA 3PIZA 4LRJA 1I09A 4W9WA 3W1FA 4X6QC 4ANBA 4RZVA 1WBSA 1QMZA 1OMWA 2CDZA 5CVGA 3SHEA 4AE9A 1M7QA 2R3GA 4DGMA 4LMUA 3SOAA 4QMQA 4ALWA 3H10A 5C8KA 5B2LA 2PE0A 5FUTA 2LGCA 2C47A 3TV7A 4DH8A 4QQCA 4MBJA 3E92A 1UNLA 3NX8A 4X6RA 5AP4A 3NNVA 3LFBA 4V0GB 3PP1A 5LARA 4HVIA 5JKGA 2V7AA 1L8TA 3TV6A 1H26A 1LEWA 1NY3A 2IVUA 4G1WA 2V7OA 3QRIA 1KWPA 2UZVA 2VV9A 4TZRA 4DEEA 4FA2A 3ORXA 2NO3A 4B4LA 3DV3A 4F6WA 3EZRA 4F1TA 5CEOA 4QMPA 4WG3A 2OZAA 5HESA 3ZU7A 3Q5ZA 1Y6AA 2VWVA 4CVAA 4OT5A 3C7QA 3LMHA 5A54A 2ETRA 2BMCA 2V62A 3TI1A 4BWXA 3W32A 4FNZA 4DGNA 4FNWA 2WKMA 4JAJA 4HCUA 5EK7A 5M4UA 3AQVA 5JZNA 2GS6A 3VQHA 4CGAA 3DB8A 1WZYA 3GI3A 5AR7A 5FP6A 4AXFA 4RJ3A 4ZSGA 4DE4A 1U59A 3GXLA 3KC3A 4C4HA 3MESA 3HUCA 4BDFA 3CJGA 4QOXA 2BUJA 4O0XA 3ZDIA 2C6DA 4IZ5A 2XEZA 5DMZA 2RG6A 3C5UA 4C36A 5JFWA 3FLYA 3BGZA 5CXZA 1V0BA 4RX9A 5EM8A 4KWPA 2YM8A 3ET7A 4HOKA 4UWYA 4KSQA 3RINA 3OZ6A 4FC0A 4A4XA 4I92A 4BCNA 3ODZX 3FMMA 2XK7A 4FSZA 3SC1A 3GC0A 2O64A 5DT4A 4CFFA 4FL1A 4D2PA 3QYWA 5DEWA 2ITPA 5I3OA 2ZYBA 1KV2A 3RTPA 4AQKA 5I9WA 2VTOA 2R9SA 4E6QA 3N4UA 2UZBA 3ALOA 1XH6A 3F69A 3R8UA 3W2PA 3BHTA 4X2GA 2Y4IC 4IBMA 4TWCA 4F08A 3SVVA 5FLFA 3B8QA 3R00A 4TYJA 4EK6A 3R1YA 1J91A 5J5TA 4D4VA 1H0WA 4OTPA 4RT7A 4JG7A 2X2KA 3POZA 2W1EA 5HZNA 3FMDA 3Q6WA 3BE2A 1WBVA 4WOVA 3P5KA 5AV1A 4BVUA 4GVAA 2WQOA 1PXLA 2VTNA 1WBOA 5FEDA 5JFXA 2F9GA 3OS3A 3GBZA 3NRMA 4M97A 3T9TA 3E5AA 3OTVA 5CANA 3NW5A 3GFWA 2PVLA 3D15A 4O2PA 3FZRA 3SXRA 4BIDA 1Q4LA 3Q2JA 3ELJA 4I93A 3CPCA 2OJ9A 3MY5A 2OBJA 2C68A 2GTMA 3MFRA 3RAHA 5FWKK 2FA2A 3W2QA 3KMWA 3ZLWA 4PDYA 4G3CA 5DRBA 4WHZA 4YGAA 1XHAA 2W7XA 2OXXA 4JQ7A 1ERKA 2R3LA 3W0RA 1QPJA 1S9JA 4HGTA 2BHHA 3OF0A 4PMMA 4Y73A 1PKGA 4G31A 3OEZA 4RJ6A 3D0EA 4BICA 3BHHA 4FKPA 3KMMA 4A4LA 3UO4A 4BTFA 2XAMA 3UYSA 5ANGA 4YJPA 2I0EA 3FLSA 3QCXA 4BDEA 4G6NA 3FXWA 2QR7A 1ZOEA 3SG9A 3ZONA 5AWMA 4D4YA 3BHVA 2GHLA 4OBQA 4BTKA 3BV2A 4C37A 5EDQA 5AR3A 4Z55A 2BKZA 3P0MA 4XRLA 4AW5A 4IZAA 3LCOA 4ZY6A 5KKRC 5DA3A 4HPUE 3V6SA 2Z02A 4CSVA 2ACXA 3U87A 3MH1A 5HTBA 4BYIA 4Z3VA 5GHVA 2F4JA 3BQRA 4O21A 2YM3A 4TYHA 3P9JA 3ATSA 2C3LA 3P7CA 4DG3E 5JH6A 2AQXA 3HDNA 4GT5A 4U0IA 4AACA 1XO2B 1Y8YA 4KAOA 3VIDA 4XMOA 5D12A 2OJIA 3OWPA 3F82A 4BIBA 1OL2A 3DTWA 3R8PA 3UZRA 5CNOA 3P78A 3QQJA 4YZBA 5FTGA 2RL5A 3W0SA 3LXNA 4LOPA 4ZMEA 2ETKA 4RWKA 2WIPA 1CTPE 4UV0A 2ZM1A 2VD5A 3ZMMA 4ZLZA 4NM7A 4OLIA 2JEDA 1UU9A 2BAQA 5C1QB 2UZEA 5GIOE 1G3NA 3EH9A 4P7EA 2OIQA 4V0GA 1DAYA 2VTJA 4MXOA 4NUSA 4ZJJA 3GC8A 4H1MA 2C4GA 4WT6A 3UDTA 2IZSA 5GJDA 3PXFA 2W4JA 3SDJA 4EK3A 3BL7A 5EKNA 4HGEA 1Q24A 2A2AA 4C62A 3K5VA 3GCQA 1G5SA 4IDVA 4QP3A 5M57A 5TR6A 2UUEA 4AN3A 4G5JA 4B6LA 3O7LD 3BPRA 2PVMA 4A9YA 2NRUA 3EKNA 3BU6A 4HW7A 4A4OA 3UDZA 4H3BA 3QD2B 3GC7A 4YUQA 3BRBA 2XK4A 3AMBA 4ZSEA 3UO6A 5CAPA 2C6IA 1PXKA 1P5EA 2YZLA 2V5QA 2P55A 4WG4A 3UP7A 2FH9A 4JQEA 3DAJA 2XF0A 4EOMA 5DR9A 5LMKC 5AUUA 4FTLA 4USFA 2ZJWA 1CMKE 1MRUA 2WMAA 4DITA 3EQGA 5EW8A 3VUKA 3ENHA 1CM8A 4FTOA 3VS4A 4ZTMA 4WBOA 1NA7A 4C4IA 4O7VA 4GYIA 3L9NA 1ZZLA 2HW6A 2V0DA 4OBOA 4U8ZA 5FBNC 3WIKA 4CV8A 5IUIA 4JT3A 5L8KA 4MAOA 3QALE 4KBCA 4LG4A 3EN9A 2W1HA 4L68A 2BTSA 5CY3A 3T3UA 5L6PA 4CYIA 4EZ3A 3NSZA 3O8TA 3VRYA 3RK5A 3VBTA 3BYSA 1OITA 2XA4A 3RWPA 4EOPA 5AUVA 4O7SA 4LGGA 5GNKA 3Q4ZA 4F9CA 4DA5A 3HV4A 4HYUA 2OIDA 4DEGA 4C57A 3G0FA 3OMVA 4S33A 1J7UA 3JR1A 3DCVA 3EQCA 4YURA 3E7OA 4ZS0A 2YIQA 3ZFXA 4K33A 4L44A 3QD3A 3GEQA 4J7BA 4NJ3A 3WE4A 2YM6A 5E7RA 1WBPA 5AV3A 3CC6A 4MF0A 4FKJA 3FSFA 2CNQA 2PZRA 3G9NA 2G2FA 3VUGA 3T9IA 4ITHA 3G51A 1H07A 4GEOA 2IZUA