4ANMA

Complex of ck2 with a cdc7 inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
328
Chain Sequence
SSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CASEIN KINASE II SUBUNIT ALPHA
publication title Discovery of Xl413, a Potent and Selective Cdc7 Inhibitor.
pubmed doi rcsb
source organism Zea mays
total genus 113
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4anmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4anmA02
3IECA 2AC5A 2UZEA 2PVLA 5FEDA 4FNZA 3S2PA 3HMMA 4ANBA 4AZSA 3I5ZA 1TVOA 4FV8A 3P23A 2VTMA 5D7AA 2ESMA 5AR7A 5KMLA 2PL0A 3BLQA 4FT7A 2YABA 5HG7A 4F9CA 3R7OA 4F7LA 5ACKA 2DQ7X 3RTPA 4IVCA 3Q3BA 3QZFA 5GNKA 5JN2A 5E8WA 1XH9A 4BCKA 5IA1A 4LV5A 2KULA 3RNIA 3VF9A 3CP9A 3R1QA 4QMMA 4RIWB 3T9TA 4MXXA 5EW3A 4P4CA 4V01A 4ZEGA 3ETAA 4D4VA 3D7TB 5T68A 3S3IA 4XS2A 5CEQA 4G34A 4LMUA 3DNDA 4ZSAA 1UWJA 3KF4A 4AOIA 4PMPA 4WIHA 4KIKA 4BRXA 5AV0A 4YC6A 2IZSA 2RFEA 2SRCA 4L3PA 4QPSA 4TWNA 3R83A 4DA5A 3BYUA 3EWHA 3NGAA 3A60A 2ONLC 5EOLA 2P2HA 4A07A 3OTVA 2RFDA 3FZSA 3IOKA 3CJGA 2B7AA 3W55A 4F1MA 3UOJA 4BDKA 3GCVA 3CQWA 1SYKA 4O0WA 1B38A 2ITVA 1PXOA 4QP8A 3EQGA 4LRKA 4W4WA 2YDKA 3EN4A 4FEVA 2C0IA 3BELA 2W17A 4K2RA 3VF8A 2WMRA 4F0IA 4EZ5A 4CZTA 3AC8A 2V62A 3E87A 4QP4A 3F88A 2YZLA 2WMXA 5A4QA 2R3KA 4GG5A 3MFTA 4B9DA 5CF8A 4DG2E 1FVVA 1NT2A 3WBLA 2BDJA 1H01A 5FXQA 5HNIX 4FR4A 5AP1A 5M53A 2X6EA 4IZAA 3V01A 3E88A 4H3BA 4ARKA 2NRUA 4H1JA 3ZO4A 1OKZA 1WMKA 2W9FB 4FVPA 3H3CA 4ZTMA 4ZOGA 4JIAA 3H30A 5CAQA 5KUPA 1OL1A 2WELA 3OXZA 1K9AA 3VO3A 2F9GA 4AE9A 4CT2A 4E1ZA 4E93A 1URWA 5L2SA 5FGKA 5EOBA 3ZO3A 2OH0E 1PF8A 3PSDA 3WIGA 2OK1A 3FWQA 2GNLA 2UW6A 4RC4A 4WO5A 4BI2A 4HCVA 4DF3A 3ZSHA 2PVRA 3MY1A 4MAOA 3T9IA 3S0OA 4IADA 3COMA 4FT0A 2X9EA 3D15A 3POOA 3SLSA 2HY0A 1STCE 3Q2MA 3VRYA 3A7HA 2VGPA 5AUTA 1IA8A 3D7ZA 4OGRA 2GHGA 3KVWA 4HGLA 4QQTA 5M07A 4N6YA 4G6OA 1XWSA 4NIFB 1Q8YA 3P08A 4A9YA 3IDPA 3TNHA 4EBVA 2PUNA 4APPA 1UNGA 3RWPA 1YDTE 2J9MA 3P5KA 4NH1A 4Y8DA 5HEZA 3E8NA 1BL7A 2CLQA 4JDHA 2WU6A 3DB8A 2UW4A 4YJUA 3QALE 4E20A 1OGUA 2VWXA 3V6SA 1Q8ZA 2ZM1A 4ZTNA 3G90X 4GFMA 3OROA 4QMTA 2I0VA 2WMSA 2J4ZA 4FBXA 4WG3A 3V8WA 4RIYA 3UZRA 5CAUA 2J5FA 4GG7A 5HBHA 3VUMA 3FQHA 3QQLA 3HUCA 3Q9XA 2C5XA 4G2FA 4IDVA 2YHVA 4IH8A 4RLLA 1Q99A 4DFNA 3CQEA 3VW6A 4XLVA 4HYUA 5CF4A 3L9PA 1YDRE 3FI8A 4AZVA 3Q2JA 3KXHA 2O63A 1OZ1A 3KRXA 5DH3A 3CIKA 1YHVA 3SRVB 4YZDA 4BCGA 2Y4IC 4LOOA 4QO9A 4C57A 2GFCA 5AR5A 3PJ8A 1LUFA 4TNBA 2F7XE 4K9YA 4O0TA 4S2ZA 4DT8A 3GT8A 2JKOA 1YOLA 1OUKA 1U54A 3V5LA 3TKHA 2FVDA 2VTIA 5A46A 4C58A 4ZIMA 3R2YA 4XV2A 4YJOA 4OUCA 3O8UA 4AGCA 2WEIA 4DN5A 4G5JA 4M67A 2WD1A 4JVGA 4ANLA 2VO7A 2C30A 3T8OA 4XG8A 5ICPA 3KREA 2BAKA 4ASEA 3V6RA 3MDYA 3PJ1A 4BWKA 3FZTA 4RQKA 3F61A 3ZLXA 1OPJA 2C4GA 4G16A 3S4QA 4CFFA 4E4XA 3PWDA 1SNUA 1QPDA 5L6WL 4AGUA 4C7TA 2BIKB 4D5HA 5KMNA 3HMIA 3RALA 4ALVA 4F6SA 3WF8A 4FMQA 3TV4A 4NT4A 5CZIA 2ITUA 5AR4A 3QQKA 3JXWA 2JKQA 4PMMA 4R78A 3E8CA 2VD5A 4FEQA 4C3RA 2HZ4A 3FPMA 5CAVA 3R01A 4KB8A 2VTTA 4H3PA 2PE2A 4JQ7A 3R9DA 1WZYA 2OGVA 4BIBA 4BKJA 4BFMA 2GNFA 4V0GB 3EH9A 1U5QA 4TPTA 3PFQA 4UBAA 4AA5A 4FKGA 3LFNA 4YO6A 5AUVA 1YRPA 5EQPA 4FK3A 5E8TA 4GIHA 3VS0A 3DBEA 3VUKA 5M4FA 4BCQA 2B1PA 5LWMA 3AC4A 3DK7A 3QLGA 4K33A 4NEUA 3RZBA 3Q04A 4PV0A 3VJOA 1YXXA 4G3GA 3CR0A 5LCJA 1OITA 4YNEA 2OF2A 3F3VA 4MF1A 2IN6A 2F4JA 4IAZA 4EC9A 3RHXA 3SAYA 5HVJA 3BHHA 2JDSA 4NFMA 2HK5A 2R3HA 4YPSA 4CFNA 5HBJA 3EQBA 2UW3A 3UZTA 4L6QA 3G6GA 1M2QA 4FTRA 5B2LA 4E73A 4I94A 3R7YA 4QYHA 1SZMA 5JT2A 3WOWA 5E9EA 1P2AA 4XNEA 2QR8A 5ANDA 3Q4TA 2QVSE 4P5ZA 4DITA 3C5IA 5HE3A 4A4OA 5CQWA 4C2VA 5FTQA 1R39A 3F66A 4TT7A 4V04A 3BPRA 3L1SA 1XJDA 4GJ2A 3UZPA 4UMPA 4AT4A 3NCZA 3R7EA 5E8YA 2EB3A 4B99A 2BHHA 3A4OX 3KULA 4UMTA 1P14A 1SMHA 4L45A 3RK7A 2JEDA 4FKPA 5HCZA 3F2NA 3RJCA 3NUYA 4LOPA 2CKQA 5DIAA 3PPZA 5T3QA 3E64A 1R0PA 4JDIA 4FSYA 5CU2A 5HNGA 1I44A 2BPMA 4FTUA 4YHFA 3RKBA 3UG1A 2F57A 2BKZA 3Q6UA 2ZV7A 1ZZ2A 1W8CA 4D2SA 3DY7A 3HAMA 4NM3A 4I6HA 4IB1A 4YTCA 3EN6A 2WMUA 3ZUUA 3OW3A 1DI8A 5CEKA 3VC4A 3EOCA 3ORKA 3PWYA 4X21A 3JYAA 4HGSA 4LG4A 4B8LA 3UP7A 3S1HA 4IAYA 2IPXA 5J5SA 4OR5A 3HV5A 2A27A 1DI9A 2WIHA 1BKXA 4XV9A 4KBAA 3SQQA 3OT3A 5JGAA 4FGRA 1JKTA 4RJ7A 4FICA 4IM3A 3R71A 3PE1A 2CHLA 4KIOA 3REPA 4YSJA 2VWUA 2OO8X 4AT5A 4MBLA 3RMFA 2ZOQA 4D55A 1EH4A 4ZS0A 3LM0A 4MNEB 5IMEA 2VZ6A 4NYEA 3SA0A 5L8KA 3CE3A 2X2KA 3AGMA 4D2PA 4R77A 4G3EA 3BEAA 3KN6A 3RPSA 2YIYA 2YLFA 4JRNA 4BBFA 4O86A 2BRMA 1UA2A 4C59A 5M4CA 5LARA 4ASDA 3PJ3A 4O27B 5H2UA 1NVRA 2OJGA 2W99B 5C8KA 5IQDA 2YFXA 4RJ8A 4QP6A 3QZGA 4MKCA 3ZBFA 2FSOX 3ZYAA 2QD9A 5DLSA 2J0KA 2UV2A 3R8VA 5KMOA 5FQDC 3GP0A 3GI3A 4D2RA 2OXDA 2ETMA 4M13A 2PVHA 5AR2A 5TT7A 4F63A 2CCIA 1PYXA 3DS6A 3ZZWA 1W98A 1M14A 4F64A 3H9RA 4FKRA 4IB5A 4AA0A 4DFUA 2XNNA 4PL5A 5AP3A 3C4EA 4GV1A 4YR8A 4GRBA 5IA2A 2XB7A 1WAKA 1HCLA 3AD4A 3GB2A 4NUSA 1OL6A 2RG5A 4V05A 3BV3A 4QTDA 2BDFA 2Z7QA 1CMKE 2X8IA 3ENMA 4I20A 4GK2A 4WUNA 4BKZA 5GHVA 2ZDTA 3A61A 2OJJA 5GJGA 4PDOA 3KN5A 5DFPA 4QNAA 1Y8GA 5AUUA 3CXWA 4S34A 2XJ2A 5CYIA 5D9HA 5EYKA 3RNYA 4X6QC 5EDQA 5IPJA 4TWCA 2E9OA 4IWDA 1PMNA 2GS2A 3EFKA 4F99A 4OT6A 5AV3A 1YI6A 1V0BA 5AP5A 4NCTA 3EMGA 5HD4A 3GC8A 2OZOA 1W82A 2EB2A 3PPKA 5IA5A 3ZEPA 1PY5A 4O0RA 4ENYA 1GZKA 4TN6A 2C6EA 5EW8A 4XHKB 4ZZOA 3CPCA 3R73A 3D0EA 4HGEA 3DTWA 4NW5A 4RWLA 3RWQA 4WKQA 3NMUF 3LHJA 2FGIA 3IW6A 4FNWA 4W9XA 4BYIA 3OWKA 5GJFA 5HLPA 4O0UA 4DH5A 3AGLA 2Y8OA 5FBOA 2C6DA 4GYGA 3FHIA 3F9NA 4QMXA 3UVRA 3BU5A 4XG7A 4U80A 4J8MA 3DT1A 5K0KA 4EYJA 4FOCA 4AU8A 5I9UA 2JDVA 3NAXA 3UGCA 1BL6A 4F0GA 3UMWA 4F0FA 2Y4PA 5DWRA 5H8BA 5DEYA 4RVKA 4R1YA 5DGZA 2Z2WA 4M15A 3RP9A 4P90A 5JQ5A 2WKMA 4QYFA 2E9NA 2A19B 5E92A 4D2WA 4HW7A 3LMIA 3UC4A 1YHSA 1O6YA 2JKMA 4ZTQA 4EOKA 5JZJA 5EK7A 1H08A 2I1MA 4D5KA 3FE3A 3ZRKA 4DFLA 4FIGA 3A4PA 3KXZA 4KKEA 5LMKC 2R3FA 4X3FA 3RI1A 3ZS5A 4R3PA 3FC2A 5FXSA 1KE7A 2VX0A 4FV4A 2J51A 3HDNA 3LCSA 3LFBA 1YXTA 4M7IA 3NVKI 3FKLA 3V5WA 3UNJA 3QQHA 2XK9A 3PLSA 2OJ9A 2DUVA 2FB8A 3C4XA 4FEXA 3I6WA 2FA2A 2CKEA 1J1BA 3UYTA 5IDPA 3TNWA 4EH5A 3GU8A 3UOKA 2O8YA 1M7QA 3DJ7A 4DEAA 3LM5A 4HYSA 1Q61A 4PTEA 3BWFA 4FOBA 3ID6C 2BRBA 4GK3A 5HNBA 2R4BA 1Z9XA 4UXQA 5A4LA 3EFWA 4QP3A 5HE2A 4CYIA 1FINA 2Y9QA 3UPXA 2BR1A 3RK9A 4RIXB 3BV2A 4BKYA 3AMAA 5A54A 5KBQA 5D12A 3G2FA 4FIIA 4FEUA 4LM5A 4NM7A 4MXAA 5DR6A 4A9UA 5EHOA 2PHKA 3WIKA 1G8SA 5LVNA 3W8LA 2CNQA 3HNGA 4Q5EA 2XNPA 3SW4A 4MQ2A 4XMOA 2DWBA 2W5BA 3MH0A 3QCXA 3ZLWA 5G1XA 5JRQA 5CALA 3V5QA 2OJFE 5E1SA 1U5RA 2PZRA 3JVRA 2C6KA 4FTJA 4DHFA 4JX3A 5CU0A 4CKJA 3D2KA 3TUBA 3UO6A 2XCHA 4CG9A 3KA0A 4F09A 1L3RE 4NK9A 5GIPE 2JIIA 4QPMA 4CG8A 4KBKA 1YOMA 2BIYA 1WBPA 4XRLA 3GCSA 4QMQA 1NVQA 3NEWA 4YSMA 2HAKA 4B8MA 4UB7A 4C38A 4UV0A 1JNKA 1M52A 4C2WA 4O1PA 4E6QA 3OZ6A 1T46A 2ITNA 3QRIA 3D5XA 4JQEA 4FL1A 2PUPA 4G5PA 2OW3A 3DTCA 4KWPA 5L8JA 3VW8A 5FP6A 4YJRA 5EYDA 3R00A 2Y6OA 4YTIA 4LGHA 1CKJA 3Q53A 5FTOA 3C0HA 4FKQA 4FSTA 4CRSA 5JK3A 1YWRA 1KOBA 3ZSGA 2Q83A 5L4QA 2RFNA 3GU5A 2G2IA 2PMOX 2QOFA 5HQ0A 5LVMA 3MPTA 4AACA 4C4EA 5LMAA 5KE0A 3VBVA 4QP2A 3W2SA 1XR1A 4OBPA 1Q8WA 2ZVAA 3F5UA 4IQ6A 4BDJA 3DK3A 4II5A 5BVEA 3DDQA 4FK6A 3VHKA 3QGYA 4EH4A 3AT2A 3DBQA 2GNGA 3PXZA 5M4UA 5KZIA 3L9MA 3TV7A 1PHKA 4XEYA 2RFSA 2UZLA 5CSHA 4LGGA 4ZS4A 5BUEA 3ZFMA 2YLEA 5HTCA 4KKHA 4M0YA 3QCSA 3PP1A 2B9JA 2B55A 1HCKA 3V04A 4QMSA 4O7LA 4R3RA 4MWHA 3BZ3A 4TWPA 1OKWA 3EFLA 3UQGA 1UV5A 2YM3A 3PA5A 4ZLOA 2WQBA 5CY3A 3IW5A 3CGOA 4ZY6A 5EI8A 1KE6A 4KS7A 3QC4A 4IJPA 5ETIA 5HO6A 4QRCA 3PDTA 4HYHA 3PA4A 5BUJA 5IA4A 4IMYA 4MF0A 3C4FA 3VNTA 4C3FA 1CDKA 4F4PA 3U8WA 1H26A 5LJJA 5M09A 3DV3A 3TZ9A 2X39A 3O50A 3BQRA 3FAAA 3LFAA 4I5PA 3CQUA 4EK6A 4HPUE 2YIRA 4BCNA 1FVRA 5IA0A 5HO8A 3QRUA 5E8ZA 4JBQA 5K5NA 4EHGA 3ZOSA 5DOSA 3LFCA 5EI6A 3NIEA 2UVZA 4HNFA 3M1SA 2BMCA 3PRIA 1Q62A 4NTSA 3E8DA 3NYOA 5IUIA 3FI3A 2PPQA 3WZDA 5KCVA 3PY1A 4GKHA 1H1SA 3VUGA 5A6NA 3GCPA 1RJBA 2G15A 3P79A 4JNWA 5KNJA 3COKA 2VNWA 2YCRA 4UN0C 4C61A 4IAFA 3DZQA 3FMEA 4RLKA 4GIIA 2VN9A 3HVCA 5LVLA 3NLBA 4YLKA 4F9WA 4CCUA 4BTKA 3R0TA 1YW2A 3MESA 2ZV8A 2XEZA 1GZNA 3PVWA 4CTCA 3EQCA 3W2QA 2QQ7A 3CPBA 4O7ZA 3EQDA 5HVYA 3AD5A 3ZH8A 1KV2A 4DCEA 4QNYA 1W7HA 3FQSA 2OU7A 1H1WA 5AX9A 3V5TA 4IX6A 3PIYA 3R21A 4JDJA 3MPMA 3BHUA 4W8EA 5M08A 5FD2A 5FEQA 1MQ4A 4BC6A 3LMHA 3ZU7A 2BZIB 3A99A 3MWUA 2R3LA 4QYYA 2LAVA 2YZAA 4IXPA 5HX8A 3PE2A 4TYEA 3OF0A 4RPVA 4QT1A 4L52A 1GZ8A 2ITTA 2VNYA 4DH7A 1XBAA 3G0FA 5CF5A 4DTKA 2O64A 3EHAA 4XG9A 1PXIA 1WBOA 1P5EA 4UXLA 1DS5A 1JQHA 1QPEA 2V7OA 3NZ0A 5AV2A 3UIXA 1PYEA 1OKYA 5BYLA 3ZRLA 4W4YA 1JBPE 4EH2A 3HKOA 4ZXTA 3KRWA 4QTEA 5ANIA 4Y46A 3UYSA 2O2UA 4LQMA 3O71A 4QQJA 5F1ZA 3LIJA 1ZYLA 5TE0A 3ZDIA 3QTRA 5K3YA 5EYCA 3R63A 4FTIA 3FPQA 1Q5KA 3CEKA 5KMKA 1Z57A 2VO3A 5D10A 3MGYA 3MYGA 5AR3A 3PXQA 3Q4ZA 2YM7A 3LMGA 4GK4A 4MWIA 5EQEA 4PDPA 1YXUA 2IW8A 3CY2A 3C7QA 4WSQA 3FL5A 1OMWA 4JXFA 4TZRA 3H9OA 4OBQA 5IUHA 2JBOA 2PMLX 3SGCA 3I4BA 4OAVB 4FZ7A 5A3XA 2J90A 3ZEWA 3Q9YA 2BFYA 1LP4A 4FKVA 1JPAA 4JT3A 4D4RA 2VAGA 4IAIA 2Q0BA 5GZ8A 4FIJA 1JOWB 4RX8A 1Q97A 1B39A 1BI8A 2PZIA 3V5JA 2HELA 3IGGA 5JFVA 5DI1A 4JJRA 4WT6A 4B7TA 3QF9A 2OI4X 4FNXA 4I21A 4PQNA 4D28A 3R2BA 1WBVA 3IQ7A 2VWZA 1NXKA 3UMXA 4IVDA 3A8WA 4EH3A 4O0YA 3E7VA 4AE6A 3ZC5A 3ORXA 4FKJA 4M3QA 5M55A 1UWHA 4PP9A 3ZSIA 3ROYA 2JD5A 2ZV2A 5BMSA 4BIDA 3BQCA 3RPYA 2UZOA 5LXMA 3C50A 2V7AA 2B9IA 2YERA 4BHZA 3NUPA 2WO6A 4L00A 2GNIA 4YURA 3R7GA 4PDSA 3RAIA 3GQLA 4FZFB 4DGMA 4IM2A 5E4HA 4GVJA 4ANMA 1YI3A 4BI1A 4DCAA 2XJ1A 3O8TA 4BGQA 3ZM9A 3K5UA 4FTMA 5B0XA 5EFQA 3P0MA 4RA4A 3A7IA 3MA6A 1SVHA 3DDPA 3UOHA 4JRVA 4OAUC 1U46A 3AG9A 5CI7A 4S31A 2GMXA 2C6TA 3QRKA 3RAWA 2OIDA 3NSZA 1J7IA 4J1RA 4DFXE 2YWVA 1UKIA 4QMLA 4NU1A 5DBXA 3P7BA 3DNEA 3HDMA 1TQPA 3MH1A 1GIIA 3TTIA 1CSNA 4F70A 5IISA 3ATSA 2F2CB 1XKKA 3UOLA 2XK7A 3AMBA 4MXOA 5CAOA 3VUHA 2JFMA 2IW6A 4G3DA 2HXLA 3MW1A 4IIRA 2XYNA 2HWPA 2P55A 1OKVA 3FYKX 4GU6A 4RJ6A 3VQHA 3OY1A 3TZ8A 5GJDA 4EONA 4EEVA 2YEXA 1OECA 1M7NA 4PMSA 4R3CA 3VS5A 5FDXA 1MUOA 4GVAA 4P5QA 4BDIA 5C1QB 2B0QA 3GU6A 2XS0A 2Z7SA 4H36A 3W33A 3ZXZA 4JOAA 4YZ9A 4A4XA 4CQGA 5TKDA 3TDWA 3QAME 4MX9A 3F82A 3MN3A 2OWBA 4JIKA 3DGKA 2RF9A 3QTZA 1WCCA 4GFOA 2OIQA 1AD5A 3G9LX 1ERKA 5AP2A 4UY9A 4Z55A 2BDWA 3LFQA 4XLIA 4QTAA 4JG8A 1J7UA 2NRYA 5F95A 2XVDA 5HZNA 2CJMA 4Y95A 4C4HA 3LE6A 4JLCA 5DR9A 1H27A 4GH2A 2I7QA 5M56A 4J96A 4WNKA 3FDNA 2CNVA 4O22A 3OOMA 4ZSJA 4M69A 5E1EA 4RMZA 2O0UA 3U54A 4ZK5A 3NUNA 2WMWA 5KKRB 3NS9A 1TQMA 3PUPA 3F5GA 3QTIA 3UIBA 4WG5A 1ZYJA 4FZ6A 3W8QA 3HV3A 1O6LA 1ZMUA 4FL2A 3HECA 5CNNA 3ORZA 3GU7A 4WSYA 2X0GA 3OY3A 2UW5A 4H39A 4F9BA 5E8SA 4LFIA 4EOQA 1KUTA 3OCGA 2Q0NA 2CPKE 3OP5A 4TYHA 2WXVA 2BROA 4A9TA 4MBIA 4HVGA 3LQ3A 2PMNX 5I3OA 1CM8A 3DCVA 3BGZA 4JDKA 3OCTA 4PL3A 3GFWA 3R28A 1KE8A 4F6UA 1Q24A 1OIUA 3ITZA 3LCOA 3N51A 2XIZA 4O96A 4QQCA 5F20A 2JC6A 4FSZA 3O7LB 1LPUA 5L3AA 5FM2A 4PY1A 5AA8A 3D14A 1ZMWA 3GXLA 3K3JA 4HYIA 4X2JA 1ZYDA 4YJNA 3N4TA 4KIKB 4RGJA 4CLJA 4U97A 4DFZE 4XX9A 2O3PA 3KKVA 4XYFA 3ORNA 3BE2A 4O7TA 1ZMVA 4EH8A 4F6WA 4CMTA 5HE0A 5HU9A 4FA2A 4OTFA 4LV8A 4L01A 3P7AA 1YHWA 4C34A 3OBJA 5IH4A 5KX8A 4FV0A 5DHJA 3FLNC 5FP5A 4TYIA 4EOPA 5AJQA 4L42A 2RG6A 5M51A 5FDPA 5L2WA 2XIXA 2WU7A 3QKKA 4FT5A 5BVKA 2ZM3A 2XK8A 2VGOA 2XA4A 4X2FA 3R7IA 2J6MA 4TRLA 2XIRA 3UVPA 1V1KA 2IWIA 3F5XA 4EOSA 1SVGA 3EQIA 3RAHA 3KCKA 2XP2A 3QCYA 3L9NA 2R7IA 3DPKA 3EJ1A 2GNJA 4FKUA 4YZCA 5DEWA 4CEGA 3UE4A 2R0IA 4BGHA 5L2QA 4EH9A 2QHNA 4FKWA 4MD9E 3TKUA 3VS2A 2QG5A 5CSVA 4D1SA 4FL3A 4MEDA 4E4MA 3QUEA 1MRYA 2RSVA 4YGAA 3EFJA 5ANOA 3PSCA 1V0OA 4O7YA 3POZA 2OXYA 4Z7GA 3D2IA 2OXXA 3OHTA 2OG8A 3E3PA 4I5CA 4LYNA 4MHAA 4BDHA 5I4NA 2PZPA 3ACKA 4RX9A 3CJFA 5IKWA 3M2WA 4RSSA 3NAYA 3PG3A 1RE8A 1XH4A 5LQFA 3KK8A 4HVSA 4KIQA 3B2WA 4H05A 4FTAA 2J7TA 3DAKA 4DE4A 3GC7A 5DPVA 2IVVA 3L8XA 2XKEA 5AEPA 2BRHA 3ZCLA 4CTBA 4J52A 3HUBA 1FGIA 2XZSA 3QRJA 2YWPA 2GQSA 3QUPA 3FUPA 4O6LA 3IGOA 3PPJA 2C1BA 4WNPA 2WTJA 3A62A 4LUDA 1PXPA 2XF0A 4IWPA 3PG1A 4X2KA 3DFCB 3L8VA 4HGTA 4PNIA 3K3IA 4DLIA 3KMUA 2ZB1A 4FV7A 2B52A 3QGWA 2QU6A 3SD0A 3UG2A 4O7RA 4R7BA 4Q9SA 2YJRA 5CS6A 3EN7A 3LLAA 3Q52A 3UTOA 3OXIA 5EM8A 2CNUA 3VN9A 4QMWA 4KBCA 4XJ0A 3GC9A 3KRJA 5IQIA 1KSWA 3QWKA 4Y5QA 3U55A 4YZNA 4FKIA 4FG7A 4O7SA 3K2LA 4RIYB 3GCQA 2GS6A 4R7IA 3SDJA 2X7OA 2NO3A 4L8MA 4AA4A 3I7BA 2BTSA 5CT0A 3LXPA 5JGDA 5J9YA 3BCEA 3I79A 4BCMA 4ZTRA 4DLJA 4LL5A 5KMIA 3PLAE 4J95A 5K4JA 2X7FA 3R04A 4DGLC 2VWWA 2YM4A 4BYJA 3TJCA 3P4KA 3QFVA 5AA9A 4ASZA 4C37A 2WMAA 4FYOA 5CT7A 2F7ZE 1PKDA 2UZUE 1YOJA 3EQHA 5ETFA 3DFAA 3QXPA 4KD1A 5AR8A 3TNQB 2JLDA 2XKFA 5CSWA 4DG0E 1AQ1A 3E62A 1U54B 5EI2A 3HMPA 3VUDA 4APCA 2VO6A 5A4CA 5JFSA 4WUAA 1BLXA 4HCTA 2PVMA 4KNBA 3DAJA 4MXZA 3NUXA 4FSNA 4LGDA 2XMYA 3MPAA 4QMYA 3KRLA 2XK4A 1IEPA 4BZOA 3RPVA 1JSTA 1CKPA 2P3GX 2W1DA 1IASA 3BGQA 3GEQA 3QX4A 4ALUA 1XH8A 3PZEA 4TNDA 2YM5A 4DFBA 3LXNA 2QODA 1RW8A 2ZJWA 4IM0A 4MK0A 2C5OA 2J0JA 4RJ5A 3JS2A 4U41A 2OF4A 3F6XA 4FSQA 4IX3A 5ETAA 2C6MA 4F9YA 4AP7A 4IANA 1ATPE 4AW2A 2X4FA 4I3ZA 5TF9A 5J1WA 4EBWA 3LJ0A 2H96A 2ZB0A 4JBVA 5CANA 1DAYA 2RGPA 2JITA 2YISA 3NNVA 4RWJA 1PJKA 5IMXA 4Q2AA 4ANSA 3VULA 1KWPA 5BNJA 4N0SA 2WNTA 4TXCA 1Y6AA 5HG9A 3W18A 3R8ZA 4EYMA 4F1TA 2QCSA 4FV5A 4ORKA 4L9IA 1S9IA 3ACJA 4IWQA 1XBBA 3MVHA 5BUIA 4U7ZA 3ZTXA 4X3JA 4FV9A 2W0JA 4GSBA 4BICA 2C6LA 2ACXA 3FLQA 4NWMA 2X6DA 4QYEA 2VU3A 2VTRA 3UNZA 3F3TA 2X1NA 3L8PA 5BPYA 4W9WA 3U87A 4YZMA 4RX5A 4HZSA 3ZC6A 4RT7A 4Y5HA 3M11A 4ITJA 3B8QA 2E2BA 3KF7A 5C4KA 2OZAA 3ZLYA 4BDCA 4BWPA 2PK9A 4IBMA 5HORA 4WBOA 3IW8A 4CVAA 3A7GA 5K4IA 4F65A 1Q8TA 1PXNA 2W06A 2EXCX 2YJSA 2R7BA 3D83A 5DMZA 3O51A 4G9RA 3VUTA 3HP2A 4AW1A 4ZJJA 4FVQA 4M68A 2ONLA 4G3CA 4FI1A 3ORTA 1Q8UA 4E6AA 3SOAA 3VQUA 1QPJA 4GFGA 4OW8A 3WE8A 5JKGA 4IWOA 4XOZA 4EHEA 2ITXA 4ERKA 4ZP5A 5A4TA 4UYNA 2W5HA 4ALWA 3UDBA 4N6ZA 1E1VA 3KULB 5IF1A 4D0WA 2FSMX 1H00A 3KGAA 3MS9A 3R8PA 1S9JA 4S32A 3SKCA 1H1PA 2VTAA 3TJDA 2UZBA 5CEMA 2QO2A 3BGPA 4F7SA 3B2TA 2QOLA 4FV1A 3VAPA 2BRNA 1G8AA 2WTIA 1XH6A 3KMMA 2NP8A 2V22A 4JG7A 4ZSGA 4TW9A 2X2LA 3AOXA 3CD8A 4CFUA 3E7OA 3I0QA 5FM3A 3HV4A 1WBTA 1JSVA 4FSUA 4CMOA 1BX6A 4BDAA 2YM6A 2R3PA 3BHTA 4EJNA 4ZSEA 3Q6WA 4IB0A 4DAWA 4E5BA 1Y57A 1YWNA 4IDTA 4O0VA 2VTHA 4O0XA 2G2HA 4NZWB 2V55A 4IJ9A 3H4JA 3PXFA 1MP8A 4MXYA 4WG4A 5EDPA 4AUAA 4AZEA 2JIVA 3NDMA 3O0GA 3O96A 3QLFA 4O2PA 4U44A 5LOHA 3PY3A 5M57A 3HMNA 3TXOA 3U51A 5AAEA 2W1HA 5C26A 3BWJA 2GQGA 1PXJA 4AT3A 4FX3A 4X7QA 3NUSA 3MFSA 3VS3A 3NW7A 2EU9A 5CXHA 2UVYA 5J79A 4C35A 4GCJA 1YKRA 5ETCA 2PVJA 4C4IA 4LOQA 4EK5A 4Y72A 4QQ5A 4E5WA 1OIQA 4IVBA 5IG1A 3FZOA 2GNHA 3EL7A 4C8BA 2IVSA 4EC8A 3BYOA 4ZJVA 5KKRC 5HG5A 1VYZA 5EYMA 3N9XA 4FIHA 2QONA 4DEBA 1H0VA 4IW0A 5CQUA 4IZ5A 4ID7A 2IJMA 3Q96A 4EWHA 3BU6A 5JRSA 3VIDA 4W8DA 2C3JA 4MD8E 4Y83A 2UZVA 3HYHA 4DBXA 3T3UA 1IRKA 4BCOA 5A4EA 4O2ZA 2R3QA 5EKOA 4HVIA 4PX6A 4KKGA 1JSUA 2OICA 3HA8A 4K8AA 5E7RA 1SM2A 3IO7A 4XBRA 3RINA 4ANOA 2AYPA 4FUYA 1A06A 4YNOA 3LJ2A 5LCKA 4ASXA 3SG8A 3OEZA 1E9HA 3G33A 5CASA 1FPUA 2XYUA 3QYZA 2P4IA 4BTMA 3QBNA 2EXEA 1KOAA 4UMUA 4ITHA 1CTPE 3LLTA 5FBNC 5L2TA 1M17A 3ORMA 3QA8A 2VUWA 3EYGA 4CZUA 4EHZA 2GQRA 3SG9A 3FXZA 3TG1A 2JKKA 3TZMA 2XKCA 2F7EE 2Z60A 2PWLA 2WIPA 3KC3A 5ANKA 3NR9A 2RL5A 3F3WA 2P33A 2WTWA 3PJCA 2F2UA 2VTLA 5AUZA 1J1CA 2ZYBA 5DR2A 2ITWA 4XH6A 3VRZA 3LCDA 2J2IB 2GFSA 3MY5A 5BYZA 4EQCA 4U9AA 1OPLA 4EQUA 4ZY4A 2H8HA 4YHTA 3JY0A 4JX7A 4FEWA 3GCUA 3F3ZA 1URCA 1XH7A 3CTQA 1L8TA 4H58A 4O21A 3UBDA 3DKCA 4BTFA 4I5HA 4UALA 2ZV9A 3BU3A 1JWHA 3DOGA 4USDA 3MFUA 4AZFA 2R3RA 4CNHA 4C4GA 1RDQE 2YIWA 1A9UA 3BEGA 3UQFA 3MSSA 2ZMDA 5L6PA 4FT9A 4FV3A 4JG6A 4U43A 4I92A 2P2IA 4EI4A 3SW7A 3IONA 3W1FA 3I60A 4ZSLA 3G15A 4X3FB 1GAGA 2WZJA 4AOTA 2QO7A 3CY3A 5J87A 2X4ZA 4G6NA 4JR3A 2HZIA 5J9ZA 3G51A 4FODA 1VR2A 2EXMA 3OEFX 2PZ5A 1APME 4OTHA 5IQGA 1VJYA 4FKTA 4YMJA 1IR3A 4PUZA 4JI9A 3R9HA 4M84A 4FSWA 3QL8A 3U6IA 4KSQA 3PJ2A 2YCFA 3VS6A 1SVEA 4FZAB 5DT3A 3TNIA 4I0TA 5F94A 3PA3A 3DBCA 3WI6A 4JBPA 4FTKA 3MB7A 5EG3A 5HCYA 2CCHA 5B2MA 5AV1A 3HV7A 3ZFYA 3ZRMA 3CSVA 1OI9A 1E1XA 2C5VA 3P1AA 3IDCA 5I9ZA 4BBEA 4CFMA 1ZYSA 2V5QA 4E4LA 3A2CA 3UO5A 3KL8A 5EDRA 2Y7JA 2EWAA 4ZJIA 4A9RA 2G01A 3QXOA 4D4YA 4I22A 3ORPA 5C8NA 2BFXA 3DB6A 5LVOA 3LFFA 5D1JA 4BCHA 4D9UA 2WQMA 3EKKA 3Q60A 5T6KA 2W7XA 1P4OA 2GSFA 3AT4A 3P7CA 3HV6A 4RX7A 5D7VA 3RAKA 4DBNA 3FHRA 4FV6A 5HGIA 2HIWA 5K9IA 2J5EA 4GUBA 4O6EA 4EK8A 1ZARA 3P86A 2Y0AA 3C0IA 3WE4A 5C03A 3ALOA 4CKRA 3P9JA 1QPCA 1BI7A 4U8ZA 4BY9E 3NYNA 4KS8A 5IU2A 5CVFA 4DEHA 4ZZNA 5K5XA 2QC6A 5JH6A 4GW8A 4JAJA 4X2GA 4DGGA 3MTLA 3F3UA 2JIUA 4IVAA 2IVUA 4L46A 2JDOA 3VS4A 4QMOA 3WF9A 4CMUA 4DEDA 4CGAA 5C8MA 2YN8A 4DINA 4AX8A 1PXMA 2BILB 5BMMA 3S95A 3C0GA 1NW1A 1JVPP 3R22A 3AC1A 5CU3A 1GIJA 2GPHA 1WVXA 4GUEA 4JAIA 4MTAA 4YLLA 5DA3A 4FZDB 2C0OA 3IW7A 3PTGA 3QHRA 4UYAA 3QD3A 3ZUTA 5JMSA 4EOLA 3DU8A 3EQRA 3KQ7A 4FT3A 3R6XA 4BCPA 1HOWA 1UU8A 4UWCA 5HTBA 2WFYA 2HZ0A 4NKAA 4UX9A 4AXAA 5EHLA 4ZLYA 3WZUA 2PU8A 3FMMA 4R1VA 2YACA 3ULIA 5BYYA 5DVRA 4RFZA 4M8TA 2IZRA 3CBLA 2J50A 3CC6A 4FTQA 4KINA 2HW7A 2IVTA 3BBTB 5HG8A 4ANNA 5M06A 2ERZE 4Z3VA 2ZAZA 1NY3A 4YU2A 2YIXA 5K0XA 3QD2B 1J91A 3FKOA 1X8BA 4FNYA 5L6OA 2UW7A 4AQCA 3JVSA 3T3VA 4B6LA 5CTPA 2WGJA 3FLZA 4FTOA 3EQPA 3UC3A 4I6BA 4AWIA 2WMVA 2X2MA 3KU2A 1K3AA 5AM6A 5IH5A 4AN3A 4N70A 5IEVA 3RBWA 1XH5A 4IFCA 3NNWA 4D9TA 2CGVA 3UPZA 1P4FA 3V3VA 1ZYCA 4DTAA 3C5UA 3U9NA 3RCJA 4BDBA 1DM2A 3SV0A 2HCKA 4ACDA 5JGBA 4CV8A 3FY2A 4ENXA 3V8SA 4RIWA 4XOYA 1O6KA 3ORLA 3RM7A 3D7TA 4QMUA 3LQ5A 1FVTA 1ZXEA 2PULA 4I4FA 2PYWA 3QTWA 5IQBA 3FMHA 5KMMA 3OFMA 3KB7A 1FQ1B 1WBNA 3R1YA 4IZ7A 4JR7A 3AXWA 3ZO1A 4USFA 1F3MC 4CKIA 3D94A 2PE0A 2R3MA 3PYYA 3OD6X 2VWBA 5BQ0A 4YZBA 2BVAA 1ZY4A 3PVGA 4YLJA 2WMQA 2WPAA 5IA3A 4EJ7A 2GDOA 2BAJA 2WTVA 4FTTA 3H10A 2ITQA 1WBWA 3FZ1A 3NNUA 3QTXA 2B54A 1BYGA 4IX5A 4O0SA 2QKRA 3RHKA 4RQVA 3MH2A 3ZFXA 4BTJA 2W1FA 4NSTA 5AIKA 3QHWA 4C36A 5KBRA 4WNOA 4Y73A 3DBFA 2JDRA 3OT8A 4D2VA 4E6CA 5IEXA 1F5QA 2ITPA 4K1BA 1FBNA 3UODA 2OFUA 4WA9A 1UNLA 4MQ1A 3RGFA 1UU3A 4CD0A 3VBYA 4I0SA 2XRWA 4BDFA 2A0CX 2X7GA 4J53A 4Z16A 3W16A 2BTRA 4LUEA 4QYGA 4E4NA 4FUXA 5HCXA 4A7CA 2OBJA 2OLCA 3FI2A 4KSPA 3UIMA 5CEPA 4L3LA 5EM5A 5LMKA 5J1VA 2X81A 2B53A 5GINE 5BVWA 2JBPA 2FYSA 4G9CA 3OWJA 4D1ZA 3MJ2A 4EQMA 3HRCA 4YJTA 3NUAA 1QCFA 3OG7A 5EW9A 4IHPA 4K77A 4BHNA 3EZVA 1H0WA 2WHBA 2WTCA 4L3JA 2QOBA 3E8EA 3NYVA 4P2KA 4PF4A 5FG8A 3R02A 5HBEA 4BZNA 3UQCA 3QQGA 5E8VA 4ZTSA 3RPOA 2PTKA 3V8TA 3PXRA 3WZKA 3TUDA 2XBJA 3MVLA 3TT0A 2FSLX 2H6DA 4IAKA 2I0YA 3IPHA 2UW0A 4QTBA 3VHEA 5IQAA 3NIZA 3L9LA 4IE9A 4BDGA 4CSVA 3MY0A 2H34A 1OUYA 3D5WA 3FI4A 4ITIA 4EH6A 4FIEA 1JKSA 4P7EA 4NIFA 3QCQA 4IX4A 5FWKK 4UEUA 1I09A 2GS7A 1H1QA 5DN3A 4O83A 4WNMA 2VTQA 2ITZA 4WHZA 3V51A 1H8FA 5A14A 2B9HA 1PW2A 5DT0A 5HIEA 4JS8A 3QC9A 2C1AA 2XK6A 2PSQA 2GTNA 4EZ3A 1PKGA 5IQFA 4L44A 3SHEA 3HL7A 5CSXA 3CKWA 3BRBA 2PUIA 3BYMA 3N4VA 4MH7A 4S33A 3F5PA 3ODYX 3BIZA 3C4ZA 2WOTA 2OIBA 2XIYA 2G1TA 3WZEA 4ACCA 4F1OA 1OBDA 4XG2A 4ERWA 1G3NA 3QQFA 5LVPA 3ANQA 4MXCA 2BKKA 1H1RA 4GS6A 3QWJA 4ACHA 4PDYA 3OCSA 2R3NA 5E90A 4K6ZA 3SRVA 4FIFA 1R1WA 1G5SA 3GGFA 3PRFA 2XRUA 4OTRA 3QX2A 2R64A 2WAJA 3BX5A 4FSRA 2IO6A 1OBGA 4NCTC 5L8LA 3DXNA 2REIA 1FOTA 3FZPA 4G6LA 1R3CA 5EH0A 5HI2A 4LRJA 4B4LA 5LWNA 3QTSA 1K2PA 2ZMCA 2R3JA 2W5AA 2VV9A 2HOGA 3DA6A 3EZRA 4NM0A 3FMNA 5DT4A 4F9AA 2WTDA 4QP9A 3EIDA 3ORIA 4LL0A 4AFJA 2W9ZB 3MV5A 3ZLSA 4GU9A 4UZHA 4EZ7A 2PY3A 2UZDA 3GVUA 3BI6A 4CRLA 3SX9A 1ZLTA 3D5VA 4FG9A 4QP7A 1LR4A 3KXXA 3OS3A 4CXAA 5FLFA 2BZKB 2XK3A 4RJ3A 4AFEA 3CLYA 4XBUA 3D5UA 3G0EA 3GUBA 3WILA 2OKRA 2YM8A 2VTSA 3QTUA 5CEIA 4HJOA 3W2OA 3CKXA 3DQWA 1MRUA 5GIOE 2PVFA 3MVMA 5J7HA 3DK6A 2OSCA 2YCSA 4TL0A 3OOGA 4YBKA 5HKMA 4AN2A 2I40A 5HX6A 5IDNA 5JFXA 1YVJA 3PY0A 3GENA 1YXSA 1TQIA 2IW9A 2BZHB 2RKUA 3MVJA 3II5A 3QRTA 4KRDA 4V0GA 3VUIA 5AIRA 3QD0A 4JQ8A 3VJNA 2C5YA 5GZ9A 5KHXA 3MA3A 4X3FC 1VEBA 3DAEA 4PTGA 5FTGA 3ODZX 4X6RA 3WYXA 4DTBA 5HD7A 3LJ1A 5CI6A 2W96B 4CV9A 5TR6A 4EUTA 2C6OA 2W4KA 4I93A 2WB8A 3E3BX 3TKIA 2QO9A 4YBJA 4AOJA 4EK4A 2HW6A 2Z7LA 4NTTA 3TACA 4AG8A 4X0MA 3TEIA 4PWNA 4GT3A 4RFMA 2X9FA 3SXFA 4KA3A 3VBXA 5CZHA 3AMYA 2QNJA 1H24A 1YWVA 3G5DA 2PMIA 3OTUA 3CTHA 3Q9WA 4EKKA 2QOOA 3ELJA 1PMVA 3I7CA 3Q9ZA 4QMZA 4DFYA 4RZVA 3IS5A 3KXNA 2Y6MA 1GY3A 1OIYA 3NNXA 4OBOA 3I1AA 3FYJX 1JKKA 3NRMA 2JFLA 4BWXA 4M69B 4L53A 4PPBA 5CEOA 5I9VA 5ANGA 3PXKA 4E7WA 2VX1A 3I81A 2X8EA 3OBGA 3PVBA 5J5TA 2QOCA 2PE1A 4ZAUA 5CXZA 4M66A 5J9LA 1UVRA 3E93A 3KY2A 3O8PA 3ZO2A 5JZNA 1Z5MA 3ZDUA 4YJSA 2XCKA 3R9RA 3O2MA 3LFEA 4G3FA 4X2NA 3OWLA 4OTPA 4O7WA 4C3PA 2FH9A 2YA9A 3CD3A 2GCDA 3EYHA 5ANJA 4ZTLA 5H8EA 3UIUA 5J7BA 3VS7A 3WZJA 3UNKA 4Q5HA 2PUUA 4TYHB 3HGKA 5IEYA 3R1NA 2CLXA 4IC8A 4EOOA 1IAJA 3C13A 5AFVA 2XM8A 2E9UA 3O23A 4GMYA 3OXTA 5AM7A 1F0QA 1H07A 4R5YA 5HVKA 3U6HA 5HICA 4RC2A 2O65A 4TKSA 2BZJA 4AZTA 3VS1A 2ZDUA 5CSPA 3FMKA 1Q3WA 3PXYA 3PIZA 4PMTA 3FLWA 3ZUVA 5G6VA 4E6DA 2R3IA 3EN5A 2HYYA 2ETKA 3NUUA 2QLQA 3GBZA 4QD6A 3ZZEA 2QG7A 3QQJA 4LI5A 2QOQA 3I0OA 1MQBA 2A4LA 3HA6A 3NW6A 4RG0A 3TDVA 2QHMA 4CYJA 2XEYA 4I6QA 4TYJA 3OUKA 5DYJA 4MNEA 2YCQA 3WYYA 5CX9A 2QR7A 5J95A 3CCNA 3C4WA 3FXXA 3KXGA 1OL5A 4W4VA 4DH1A 2OJIA 1U59A 4UZDA 4O7NA 3TI1A 3TIYA 1OB3A 4FKOA 3NX8A 4TWOA 3TIZA 1FMOE 5EM6A 4IFGA 1DAWA 5HESA 2H9VA 3TL8A 3RPRA 2YITA 5M44A 5H3QA 3QU0A 3LW0A 1YQJA 5AUWA 4BCFA 4YP8A 3CS9A 3KRRA 3WF6A 3O7LD 3HP5A 2UW9A 3JPVA 2XNBA 5E8XA 4EL9A 4AN9A 2CSNA 3GQIA 3LOKA 3R1SA 3ROCA 4OTDA 1PXLA 4AGDA 4ZLZA 1PRYA 4U0IA 5DG5A 4L7SA 5BX0A 2ITYA 1GOLA 2W05A 3TUCA 2R0UA 4D2TA 1O9UA 2P0CA 3QQUA 4RC3A 3BLHA 3GU4A 2WMTA 1Q3DA 2CN5A 2RIOA 4RFYA 4PNKA 4WOVA 3UP2A 2CKPA 3VVHA 3RK5A 2R9SA 4YTFA 5HHWA 1W0XC 2G9XA 2JAMA 4FC0A 1ND4A 5FUTA 3UVQA 3FBVA 1FGKA 2GHMA 3AC5A 2OH4A 4EH7A 5AP6A 3HZTA 2AUHA 3R8MA 1AGWA 3Q4CA 5F4NA 4Z7HA 3DKGA 5B7VA 2XM9A 4NFNA 3TNPC 4RVMA 4CLIA 4CQEA 4AW5A 2B4SB 4AW0A 3DXPA 3RM6A 1YDSE 5J8IA 3TCPA 4RJ4A 4BZDA 5HU3A 3S00A 4NJ3A 3NCGA 4J97A 5IQEA 3E5AA 2VTJA 1FMKA 3FEGA 4BR3A 1OL7A 3MFRA 4O84A 2XUUA 1Q41A 3PIXA 3R8LA 2CGUA 3U9CA 5HIDA 3R7VA 5IQHA 5E91A 4DGNA 3IDBA 3LXKA 5I9XA 4CCBA 2QOHA 1OIRA 2HZNA 2QI8A 5B2KA 1ZWSA 2JAVA 4WBBB 3PP0A 2HXQA 3FL4A 3THBA 3W10A 4DEGA 2B9FA 2NPQA 4FTNA 3F2AA 2CN8A 3Q32A 1V0PA 4K18A 4RRVA 5KZ0A 2QOKA 3DKOA 2XH5A 3MB6A 3R9OA 4D1XA 4FGBA 4AS0A 3ZMMA 2W1CA 3GOPA 4IC7A 4U3ZA 1UU9A 2BHEA 2EVAA 2UW8A 3KXMA 1J7LA 5IH6A 4OTIA 4C02A 5HLNA 3C51A 2UZTA 4IAAA 4ZMEA 4KAOA 2PVNA 3QYWA 1VYWA 3BLRA 2YDIA 5HIBA 3CGFA 3RVGA 3ZHPC 1WFCA 2PZYA 2NNWB 2V0DA 2YIQA 4QMVA 3ANRA 4HVHA 4IACA 5EKNA 3U4UA 1A48A 3G6HA 4U81A 1CKIA 5AADA 3DKFA 3Q4UA 2IZTA 1WVYA 3MBLA 4GKIA 4FKSA 3V5PA 4D58A 3MH3A 4J7BA 5I9WA 5KHWA 1IAHA 3WF7A 3NW5A 5KO1A 1PMEA 4JBOA 5AUXA 2Z02A 5IZFA 3EN9A 3U4WA 5I3RA 4EHVA 1UNHA 4ZMFA 1KV1A 1ZY5A 4GEOA 4HOKA 4KIPA 4XV1A 3ULZA 3WF5A 4HCUA 3MI9A 3HX4A 1H25A 4YHJA 4EOMA 4D0XA 3OW4A 4NW6A 3TWJA 1Q4LA 3BE9A 4XP2A 3FLYA 4UMRA 5CF6A 2WTKB 4YJPA 2YDJA 4RIXA 3ERKA 2JGZA 4IEBA 5L2IA 2VRXA 1T45A 2AC3A 3G9NA 1Y6BA 4UWBA 3OC1A 1R0EA 3KCFA 4DEEA 4E26A 5M4IA 3BHVA 4QOXA 5AX3A 4YPDA 1H4LA 2R3OA 4C0TA 4WRGA 4BN1A 3COHA 4DGOA 4FKLA 5I9YA 3FMLA 1QL6A 5H8GA 5F9EA 4I6FA 1XHAA 1GIHA 3BKBA 2HENA 3ZONA 2J0IA 4XG4A 3OWPA 2I6LA 5CENA 4R6VA 4A9SA 2GTMA 2ITOA 4I41A 3QUDA 1ZRZA 4M12A 4XG6A 5CWZA 1JKLA 5BVDA 4I24A 5LMBA 4U40A 4K11A 2WQEA 4N4SA 4TTHB 1KE5A 1VZOA 4FF8A 4WD5A 4RWIA 2VX3A 3R7UA 4EOIA 2HWOA 3CTJA 2OZAB 3JY9A 2PVKA 1PXKA 2IZUA 4IZYA 5HOAA 4M97A 2YAAA 2W1ZA 2CDZA 2DYLA 5HO7A 2Z7RA 3SXSA 4MYGA 2QOIA 3LZBA 4L43A 2W4OA 2OFVA 3LPBA 2I0HA 2R2PA 4J98A 4YJQA 4BIEA 3Q5IA 1J3HA 4CFXA 4OTGA 3KMWA 4L68A 4OLIA 4WRSA 4OTQA 4YTHA 3TZ7A 4RVTA 3A8XA 4LRMA 1ZOEA 1ZOGA 4FSMA 4QP1A 4NL0A 4MVFA 2C3IB 1GNGA 4HZRA 3FXWA 2C69A 4EUUA 2WQNA 4DH8A 5CAPA 3SVVA 4NJDA 3FSKA 3OCBA 2JDTA 1KE9A 4UWYA 4E3CA 3QTQA 2PVYA 5AWMA 3H9FA 4NM5A 5C4LA 2VTPA 4Q9ZA 2J0MB 2XIKA 4TY1A 3UJGA 5HE1A 2A2AA 4HVDA 2E9VA 4XG3A 4E5AX 3QD4A 4U6RA 3FKNA 5DRBA 3HRBA 1PMUA 2C3LA 2FSTX 3IK3A 3FY0A 4FG8A 4FTCA 4RIOA 4MNFA 4BCJA 1XQZA 5D41A 4PPCA 3LFDA 4EKLA 3LKMA 4O91A 4BDDA 4R5SA 3EL8A 3W32A 3ZM4A 2R5TA 2BALA 2CGXA 3AC3A 3FLSA 3QZHA 4BGGA 4BVUA 5IUGA 3FSFA 5H9BA 3EB0A 4YC8A 3QZIA 3LAUA 5EHYA 2VO0A 4RA5A 1B6CB 4I1ZA 2O5KA 2J0LA 5CU6A 2EUFB 5FXRA 2YAKA 5JQ8A 3KEXA 2WEVA 4I23A 2E9PA 4FVRA 2BAQA 2W1IA 3MIYA 3LFSA 4BB4A 3IOPA 3NPCA 2IG7A 2UZWE 4EK3A 3IW4A 4U42A 3PSBA 4PRJA 4AAAA 5CU4A 5TO8A 3HLLA 3RZFA 4D4SA 4ANQA 4O82A 5AUYA 4C4JA 2QU5A 4R8QA 4U3YA 3EQFA 4U79A 4I0RA 5FEEA 4O81A 3OUNB 4J8NA 4U5JA 3TTJA 4O38A 3FZRA 4QPAA 3AC2A 4G17A 3E63A 4GL9A 3ZBXA 5ANEA 3JR1A 1M2PA 2DS1A 1JLUE 3U6JA 3L8SA 1TKIA 5TOZA 3LCKA 3ZXTA 4MCVA 4ACMA 4ZY5A 4XUFA 2UZNA 4RWKA 4C4FA 4YJVA 5DE2A 1GJOA 1U4DA 4PL4A 5BVNA 3ALNA 3QA0A 4G31A 3IG7A 3HRFA 1ZOHA 3R8UA 4GJ3A 5AP7A 3KFAA 3H0ZA 4F7JA 3TN8A 2Y4IB 3DLSA 4O7VA 5ITAA 3R30A 3SOCA 5AV4A 1MRVA 4F08A 2A1AB 2BCJA 3VBQA 2QURA 3C1XA 3VBWA 3FMDA 4M0ZA 4AZWA 4F7NA 5AAFA 4MD7E 4HNIA 3NWWA 3A7JA 4U45A 2WQOA 3OVVA 1NVSA 3C4CA 3B8RA 3BYVA 3FQEA 1BUHA 4DEIA 3HAVA 4XV3A 1UU7A 3EKNA 4B0GA 3HEGA 4Z9LA 2I0EA 2C5NA 3LCTA 3DXQA 3E92A 3KVXA 3AT3A 3GFEA 1YI4A 3WARA 4OTWA 1RQQA 5AP0A 2VWYA 1IG1A 2VWVA 4ACGA 3ET7A 2XNOA 4C62A 1W84A 3DZOA 3F2RA 2HY81 4L67A 3GC0A 5DNRA 4DH3A 3FC1X 4EORA 3BBWA 3C9WA 5JEBA 4A06A 3SC1A 4DT9A 3MJ1A 1OVEA 3I5NA 4I5MA 2XNGA 4R7HA 4I4EA 2Z8CA 5DRDA 1YXVA 5A9UA 5CVGA 1M2RA 1SNXA 2LGCA 2BUJA 5KMJA 3BYSA 1OM1A 5I5ZA 4S30A 4Y85A 5C9CA 4A4LA 2CKOA 1R78A 1GZOA 2XNEA 4BBMA 3PZHA 4O1OA 3W2CA 2KTYA 4BF2A 2VTNA 4CFWA 4CT1A 1WBSA 3ATTA 3DJ6A 1LEZA 3K5VA 3LXLA 4YUQA 4ONAA 4H1MA 3W2RA 4KUJA 4BI0A 4XP3A 3VWAA 1QMZA 2GU8A 2UVXA 3DLZA 3DQXA 4L7FA 4MBJA 5CVHA 2C6IA 3RCDA 5BVOA 5I0BA 5AP4A 4UMQA 1REKA 3LQ8A 3Q5ZA 4KRCA 3R9NA 3A7FA 4XRJA 4DC2A 4DYMA 4GT4A 5FRIA 5BVFA 4PPAA 5AAGA 3AD6A 4NKSA 4EOJA 1WVWA 1ZZLA 3FV8A 3MTFA 4LMNA 2XNMA 1XBCA 4AGWA 4USEA 3F69A 2F49A 2QLUA 4H3QA 4GYIA 5C27A 4XP0A 1LEWA 2CMWA 2FUMA 3GNIB 2WOUA 5AMNA 3COIA 3ENHA 1H28A 3LVPA 4QMNA 3DBDA 2X8DA 1REJA 4N57A 4W4XA 3O17A 2XJ0A 1NA7A 3D9VA 5ACBC 2VTOA 4YO4A 2W1EA 3IKAA 1UKHA 2G2FA 3NYXA 4FTLA 2ETRA 3M42A 4RZWA 4ZZMA 5GZAA 4J71A 4JL9A 5EM7A 2XKDA 4ZTHA 5C01A 4IB3A 4M14A 4QMPA 3BHYA 3I6UA 4DG3E 3PVUA 4FE2A 3D4QA 2ERKA 3H0YA 4G1WA 4RVLA 3DJ5A 4KABA 2BRGA 2W4JA 4FYNA 3SXRA 4XCUA 4PTCA 4E8AA 4EWQA 5JSMA 3VBTA 2FO0A 3FJQE 3UO4A 1OPKA 4QTCA 2C47A 1IA9A 3TM0A 1Y8YA 5CLPA 4BCIA 4AF3A 5A6OA 1JAMA 1ZAOA 1W83A 3MIAA 4PP7A 2W1GA 4CFVA 1OL2A 5HTIA 2C68A 3N4UA 1Y91A 5JFWA 4J99A 2QKWB 2GHLA 5CNOA 1XO2B 2CGWA 2VWIA 1BMKA 3AQVA 3F7ZA 3P78A 4GT5A 4YC3A 3OMVA 4OT5A 3HMOA 3KK9A 5EQYA 4FV2A 5D11A 4BL1A 5HLWA 2UUEA 4C33A 2C3KA 3K54A 2XBAA 3JUHA 2R3GA 2ZM4A 4HPTE 3FMJA 3GOKA 4K0YA 4TYGA 3NVMB 5IQCA 4CZYB 4RBLA 3TV6A 3QKLA 4BDEA 3F7WA 3QKMA 2WMBA 5E8UA 2WTKC 2C0TA 3W2PA
chains in the Genus database with same CATH superfamily
3IECA 2AC5A 2UZEA 2PVLA 5FEDA 4FNZA 3S2PA 3HMMA 4ANBA 4AZSA 3W0QA 3I5ZA 1TVOA 1XMMA 4FV8A 3P23A 2VTMA 5D7AA 2ESMA 5AR7A 5KMLA 2PL0A 3BLQA 4FT7A 2YABA 5HG7A 4F9CA 4O4BB 3R7OA 4F7LA 5ACKA 2DQ7X 3RTPA 4IVCA 3Q3BA 3QZFA 5GNKA 5JN2A 5E8WA 1XH9A 4BCKA 5IA1A 4LV5A 2KULA 3RNIA 3VF9A 4MUQA 3CP9A 3R1QA 4QMMA 4RIWB 3T9TA 4MXXA 5EW3A 4P4CA 4V01A 4ZEGA 3ETAA 4D4VA 3D7TB 5T68A 3S3IA 4XS2A 5CEQA 4G34A 4LMUA 3DNDA 4ZSAA 1UWJA 3KF4A 4AOIA 4PMPA 4WIHA 4KIKA 4DHIB 4BRXA 2ZFYA 5AV0A 4YC6A 2IZSA 2RFEA 2SRCA 4L3PA 4QPSA 4TWNA 3R83A 4DA5A 3BYUA 4BJJA 3EWHA 3NGAA 3A60A 2ONLC 5EOLA 2P2HA 4A07A 3OTVA 2RFDA 1XMLA 3FZSA 3IOKA 3CJGA 2B7AA 3W55A 4F1MA 3UOJA 4BDKA 3GCVA 3CQWA 1SYKA 4O0WA 1B38A 2ITVA 4AXCA 1PXOA 4QP8A 3EQGA 4LRKA 4W4WA 2YDKA 3EN4A 4FEVA 2C0IA 3BELA 2W17A 4K2RA 3VF8A 2WMRA 4F0IA 4EZ5A 4CZTA 3AC8A 2V62A 3E87A 4QP4A 3F88A 2YZLA 2WMXA 5A4QA 2R3KA 4GG5A 3MFTA 4B9DA 5CF8A 4DG2E 1FVVA 1NT2A 3WBLA 2BDJA 1H01A 5FXQA 5HNIX 4FR4A 5AP1A 5M53A 2X6EA 4IZAA 3V01A 3E88A 4H3BA 4ARKA 2NRUA 4H1JA 3ZO4A 1OKZA 1WMKA 2W9FB 4FVPA 3H3CA 4ZTMA 4ZOGA 4JIAA 3H30A 5CAQA 5KUPA 1OL1A 2WELA 3OXZA 1K9AA 3VO3A 2F9GA 4AE9A 4CT2A 4E1ZA 4E93A 1URWA 5L2SA 5FGKA 5EOBA 3ZO3A 2OH0E 1PF8A 3PSDA 3WIGA 2OK1A 3FWQA 2GNLA 2UW6A 4RC4A 4WO5A 4BI2A 4HCVA 4DF3A 3ZSHA 2PVRA 3MY1A 4MAOA 3T9IA 3S0OA 4IADA 3COMA 4FT0A 2X9EA 3D15A 3POOA 3SLSA 3TYKA 2HY0A 1STCE 3Q2MA 3VRYA 3A7HA 2VGPA 5AUTA 1IA8A 3D7ZA 4OGRA 2GHGA 3KVWA 4HGLA 4QQTA 5M07A 4N6YA 4G6OA 1XWSA 4NIFB 1Q8YA 3P08A 4A9YA 3IDPA 3TNHA 4EBVA 2PUNA 4APPA 1UNGA 3RWPA 1YDTE 2J9MA 3P5KA 4NH1A 4Y8DA 5HEZA 3E8NA 1BL7A 2CLQA 4JDHA 2WU6A 3DB8A 2UW4A 4YJUA 3QALE 4E20A 1OGUA 2VWXA 3V6SA 1Q8ZA 2ZM1A 4ZTNA 3G90X 4GFMA 3OROA 4QMTA 2I0VA 2WMSA 2J4ZA 4FBXA 4WG3A 3V8WA 4RIYA 3UZRA 5CAUA 2J5FA 4GG7A 5HBHA 3VUMA 3FQHA 3QQLA 3HUCA 3Q9XA 2C5XA 4G2FA 4IDVA 2YHVA 4IH8A 4RLLA 1Q99A 4DFNA 3CQEA 3VW6A 4XLVA 4HYUA 5CF4A 3L9PA 1YDRE 3FI8A 4AZVA 3Q2JA 3KXHA 2O63A 3AKJA 1OZ1A 3KRXA 5DH3A 3CIKA 1YHVA 3SRVB 4YZDA 4BCGA 2Y4IC 4LOOA 4QO9A 4C57A 2GFCA 5AR5A 3PJ8A 1LUFA 4TNBA 2F7XE 4K9YA 4O0TA 4S2ZA 4DT8A 1W2DA 3GT8A 2JKOA 1YOLA 1OUKA 1U54A 3V5LA 3TKHA 2FVDA 2VTIA 5A46A 4C58A 4ZIMA 3R2YA 4XV2A 4YJOA 4OUCA 3O8UA 4AGCA 2WEIA 4DN5A 4G5JA 4M67A 2WD1A 4JVGA 4ANLA 2VO7A 2C30A 3T8OA 4XG8A 5ICPA 3KREA 2BAKA 4ASEA 3V6RA 3MDYA 3PJ1A 4BWKA 3FZTA 4RQKA 3F61A 3ZLXA 1OPJA 2C4GA 4G16A 3S4QA 4CFFA 4E4XA 3PWDA 1SNUA 1QPDA 5L6WL 4AGUA 4C7TA 2BIKB 4D5HA 5KMNA 3HMIA 3RALA 4ALVA 4F6SA 3WF8A 4FMQA 3TV4A 4NT4A 5CZIA 2ITUA 5AR4A 3QQKA 3JXWA 2JKQA 4PMMA 4R78A 3E8CA 2VD5A 4FEQA 4C3RA 2HZ4A 3FPMA 5CAVA 3R01A 4KB8A 2VTTA 4H3PA 2PE2A 4JQ7A 3R9DA 1WZYA 2OGVA 4BIBA 4BKJA 4BFMA 2GNFA 4V0GB 3EH9A 1U5QA 4TPTA 3PFQA 4UBAA 4AA5A 4FKGA 3LFNA 4YO6A 5AUVA 1YRPA 5EQPA 4FK3A 5E8TA 4GIHA 3VS0A 3DBEA 3VUKA 5M4FA 4BCQA 2B1PA 5LWMA 3AC4A 3DK7A 3QLGA 4K33A 4NEUA 3RZBA 3Q04A 4PV0A 3VJOA 1YXXA 4G3GA 3CR0A 5LCJA 1OITA 2X0QA 4YNEA 2OF2A 3F3VA 4MF1A 2IN6A 2F4JA 4IAZA 4EC9A 3RHXA 3SAYA 5HVJA 3BHHA 2JDSA 4NFMA 2HK5A 2R3HA 4YPSA 4CFNA 5HBJA 3EQBA 2UW3A 3UZTA 4L6QA 3G6GA 1M2QA 4FTRA 5B2LA 4E73A 4I94A 3R7YA 4QYHA 1SZMA 5JT2A 3WOWA 5E9EA 1P2AA 4XNEA 2QR8A 5ANDA 3Q4TA 2QVSE 4P5ZA 4DITA 3C5IA 5HE3A 4A4OA 5CQWA 4C2VA 5FTQA 1R39A 3F66A 4TT7A 4V04A 3BPRA 3L1SA 1XJDA 4GJ2A 3UZPA 4UMPA 1TFFA 2XARA 4AT4A 3NCZA 3R7EA 5E8YA 2EB3A 4B99A 2BHHA 3A4OX 3KULA 4UMTA 1P14A 1SMHA 4L45A 3RK7A 2JEDA 4FKPA 5HCZA 3F2NA 3RJCA 3NUYA 4LOPA 2CKQA 5DIAA 3PPZA 5T3QA 3E64A 4LV7A 1R0PA 4JDIA 4FSYA 5CU2A 5HNGA 1I44A 2BPMA 4FTUA 4YHFA 3RKBA 1W2FA 3UG1A 2F57A 2BKZA 3Q6UA 2ZV7A 1ZZ2A 1W8CA 4D2SA 3DY7A 3HAMA 4NM3A 4I6HA 4IB1A 4YTCA 3EN6A 2WMUA 3ZUUA 3OW3A 1DI8A 5CEKA 3VC4A 3EOCA 3ORKA 3PWYA 4X21A 3JYAA 4HGSA 4LG4A 4B8LA 3UP7A 3S1HA 4IAYA 2IPXA 5J5SA 4OR5A 3HV5A 2A27A 1DI9A 2WIHA 1BKXA 4XV9A 4KBAA 3SQQA 3OT3A 5JGAA 4FGRA 1JKTA 4RJ7A 4FICA 4IM3A 3R71A 3PE1A 2CHLA 4KIOA 3REPA 4YSJA 2VWUA 2OO8X 4AT5A 4MBLA 3RMFA 2ZOQA 4D55A 1EH4A 4ZS0A 3LM0A 4MNEB 4QDVA 5IMEA 2VZ6A 4NYEA 3SA0A 5L8KA 3CE3A 2X2KA 3AGMA 4D2PA 4R77A 4G3EA 3BEAA 3KN6A 3RPSA 2YIYA 2YLFA 4JRNA 4BBFA 4O86A 2BRMA 1UA2A 4C59A 5M4CA 5LARA 4ASDA 3PJ3A 4O27B 5H2UA 1NVRA 2OJGA 2W99B 5C8KA 5IQDA 2YFXA 4RJ8A 4QP6A 3QZGA 4MKCA 3ZBFA 2FSOX 3ZYAA 2QD9A 5DLSA 2J0KA 2UV2A 3R8VA 5KMOA 5FQDC 3GP0A 3GI3A 4D2RA 2OXDA 2ETMA 4M13A 2PVHA 5AR2A 5TT7A 4F63A 2CCIA 1PYXA 3DS6A 3ZZWA 1W98A 1M14A 4F64A 3H9RA 4FKRA 4IB5A 4AA0A 4DFUA 2XNNA 4PL5A 5AP3A 3C4EA 4GV1A 4YR8A 4GRBA 5IA2A 2XB7A 1WAKA 1HCLA 3AD4A 3GB2A 4NUSA 1OL6A 2RG5A 4V05A 3BV3A 4QTDA 2BDFA 2Z7QA 1CMKE 2X8IA 3ENMA 4I20A 4GK2A 4WUNA 1G8JA 4BKZA 5GHVA 2ZDTA 3A61A 2OJJA 5GJGA 4PDOA 3KN5A 5DFPA 4QNAA 1Y8GA 5AUUA 3CXWA 4S34A 2XJ2A 5CYIA 5D9HA 5EYKA 3RNYA 4X6QC 5EDQA 5IPJA 4TWCA 2E9OA 4IWDA 1PMNA 2GS2A 3EFKA 4F99A 4OT6A 5AV3A 1YI6A 4O4DA 1V0BA 5AP5A 4NCTA 3EMGA 5HD4A 3GC8A 2OZOA 1W82A 2EB2A 3PPKA 5IA5A 3ZEPA 1PY5A 4AQKA 4O0RA 4ENYA 1GZKA 4TN6A 2C6EA 5EW8A 4XHKB 4ZZOA 3CPCA 3R73A 3D0EA 4HGEA 3DTWA 4NW5A 4RWLA 3RWQA 4WKQA 3NMUF 3LHJA 2FGIA 3IW6A 4FNWA 4W9XA 4BYIA 3OWKA 5GJFA 5HLPA 4O0UA 4DH5A 3AGLA 2Y8OA 5FBOA 2C6DA 4GYGA 3FHIA 3F9NA 4QMXA 3UVRA 3BU5A 4XG7A 4U80A 4J8MA 3DT1A 5K0KA 4EYJA 4FOCA 4AU8A 5I9UA 2JDVA 3NAXA 3UGCA 1BL6A 4F0GA 3UMWA 4F0FA 2Y4PA 5DWRA 5H8BA 5DEYA 4RVKA 4R1YA 5DGZA 2Z2WA 4M15A 3RP9A 4P90A 5JQ5A 2WKMA 4QYFA 2E9NA 2A19B 5E92A 4D2WA 4HW7A 3LMIA 3UC4A 1YHSA 1O6YA 2JKMA 4ZTQA 4EOKA 5JZJA 5EK7A 1H08A 2I1MA 4D5KA 3FE3A 3ZRKA 4DFLA 4FIGA 3A4PA 3KXZA 4KKEA 5LMKC 2R3FA 4X3FA 3RI1A 3ZS5A 4R3PA 3FC2A 5FXSA 3KIOC 1KE7A 2VX0A 4FV4A 2J51A 3HDNA 3LCSA 3LFBA 1YXTA 4M7IA 3NVKI 3FKLA 3V5WA 3UNJA 3QQHA 2XK9A 3PLSA 2OJ9A 2DUVA 2FB8A 3C4XA 4FEXA 3I6WA 2FA2A 2CKEA 1J1BA 3UYTA 5IDPA 3TNWA 4EH5A 3GU8A 3UOKA 2O8YA 1M7QA 3DJ7A 4DEAA 3LM5A 4HYSA 1Q61A 4PTEA 3BWFA 4FOBA 3ID6C 2BRBA 4GK3A 5HNBA 2R4BA 1Z9XA 4UXQA 5A4LA 3EFWA 4QP3A 5HE2A 4CYIA 1FINA 2Y9QA 3UPXA 2BR1A 3RK9A 4RIXB 3BV2A 4BKYA 3AMAA 5A54A 5KBQA 5D12A 3G2FA 4FIIA 4FEUA 4LM5A 4NM7A 4MXAA 5DR6A 4A9UA 5EHOA 2PHKA 3WIKA 1G8SA 5LVNA 3W8LA 2CNQA 3HNGA 4Q5EA 2XNPA 3SW4A 4MQ2A 4XMOA 2DWBA 2W5BA 3MH0A 3QCXA 3ZLWA 5G1XA 5JRQA 5CALA 3V5QA 2OJFE 5E1SA 1U5RA 2PZRA 3JVRA 2C6KA 4FTJA 4DHFA 4JX3A 5CU0A 4CKJA 3D2KA 3TUBA 3UO6A 2XCHA 4CG9A 3KA0A 4F09A 1L3RE 4NK9A 5GIPE 2JIIA 4QPMA 4CG8A 4KBKA 1YOMA 2BIYA 1WBPA 4XRLA 3GCSA 4QMQA 1NVQA 3NEWA 4YSMA 2HAKA 4B8MA 4UB7A 4C38A 4UV0A 1JNKA 1M52A 4C2WA 4O1PA 4E6QA 3OZ6A 1T46A 2ITNA 3QRIA 3D5XA 4JQEA 4FL1A 2PUPA 4I6LA 4G5PA 2OW3A 3DTCA 4KWPA 5L8JA 3VW8A 5FP6A 4YJRA 2A98A 5EYDA 3R00A 2Y6OA 4YTIA 4LGHA 1CKJA 3Q53A 5FTOA 3C0HA 4FKQA 4FSTA 4CRSA 5JK3A 1YWRA 1KOBA 3ZSGA 2Q83A 5L4QA 2RFNA 3GU5A 2G2IA 2PMOX 2QOFA 5HQ0A 5LVMA 3MPTA 4AACA 4C4EA 5LMAA 5KE0A 3VBVA 4QP2A 3W2SA 1XR1A 4OBPA 1Q8WA 2ZVAA 3F5UA 4IQ6A 4BDJA 3DK3A 4II5A 5BVEA 3DDQA 4FK6A 3VHKA 3QGYA 4EH4A 3AT2A 3DBQA 2GNGA 3PXZA 5M4UA 5KZIA 3L9MA 3TV7A 1PHKA 4XEYA 2RFSA 2UZLA 5CSHA 4LGGA 4ZS4A 5BUEA 3ZFMA 2YLEA 5HTCA 4KKHA 4M0YA 3QCSA 3PP1A 2B9JA 2B55A 1HCKA 3V04A 4QMSA 4O7LA 4R3RA 2AQXA 3BZ3A 4MWHA 4TWPA 1OKWA 3EFLA 3UQGA 1UV5A 2YM3A 3PA5A 4ZLOA 2WQBA 5CY3A 3IW5A 3CGOA 4ZY6A 5EI8A 1KE6A 4KS7A 3QC4A 4IJPA 5ETIA 5HO6A 4QRCA 3PDTA 4HYHA 3PA4A 5BUJA 5IA4A 4IMYA 4MF0A 3C4FA 3VNTA 4C3FA 1CDKA 4F4PA 3U8WA 1H26A 5LJJA 5M09A 3DV3A 3TZ9A 2X39A 3O50A 3BQRA 3FAAA 3LFAA 4I5PA 3CQUA 4EK6A 4HPUE 2YIRA 4BCNA 1FVRA 2X0OA 5IA0A 5HO8A 3QRUA 5E8ZA 4JBQA 5K5NA 4EHGA 3ZOSA 5DOSA 3LFCA 5EI6A 3NIEA 2UVZA 4HNFA 3M1SA 2BMCA 3PRIA 1Q62A 4NTSA 3E8DA 3NYOA 5IUIA 3FI3A 2PPQA 3WZDA 5KCVA 3PY1A 4GKHA 1H1SA 3VUGA 5A6NA 3GCPA 1RJBA 2G15A 3P79A 4JNWA 5KNJA 3COKA 2VNWA 2YCRA 4UN0C 4C61A 4IAFA 3DZQA 3FMEA 4RLKA 4GIIA 2VN9A 3HVCA 5LVLA 3NLBA 4YLKA 4F9WA 4CCUA 4BTKA 3R0TA 1YW2A 3MESA 2ZV8A 2XEZA 1GZNA 3PVWA 4CTCA 3EQCA 3W2QA 2QQ7A 3CPBA 4O7ZA 3EQDA 5HVYA 3AD5A 3ZH8A 1KV2A 4DCEA 4QNYA 1W7HA 3FQSA 2OU7A 1H1WA 5AX9A 3V5TA 4IX6A 3PIYA 3R21A 4JDJA 3MPMA 3BHUA 4W8EA 5M08A 5FD2A 5FEQA 1MQ4A 2XAOA 4BC6A 3LMHA 3ZU7A 2BZIB 3A99A 3MWUA 2R3LA 4QYYA 2LAVA 2YZAA 4IXPA 5HX8A 3PE2A 4TYEA 3OF0A 4RPVA 4QT1A 4L52A 1GZ8A 2ITTA 2VNYA 4DH7A 1XBAA 3G0FA 5CF5A 4DTKA 2O64A 3EHAA 4XG9A 1PXIA 1WBOA 1P5EA 4UXLA 1DS5A 1JQHA 1QPEA 2V7OA 3NZ0A 5AV2A 3UIXA 1PYEA 1OKYA 5BYLA 3ZRLA 4W4YA 1JBPE 4EH2A 3HKOA 4ZXTA 3KRWA 4QTEA 5ANIA 4Y46A 3UYSA 2O2UA 4LQMA 3O71A 4QQJA 5F1ZA 3LIJA 1ZYLA 5TE0A 3ZDIA 3QTRA 5K3YA 5EYCA 3R63A 4FTIA 3FPQA 1Q5KA 3CEKA 5KMKA 1Z57A 2VO3A 5D10A 3MGYA 3MYGA 5AR3A 3PXQA 3Q4ZA 2YM7A 3LMGA 4GK4A 4MWIA 5EQEA 4PDPA 1YXUA 2IW8A 3CY2A 3C7QA 4WSQA 3FL5A 1OMWA 4JXFA 4TZRA 3H9OA 4OBQA 5IUHA 2JBOA 2PMLX 3SGCA 3I4BA 4OAVB 4FZ7A 5A3XA 2J90A 3ZEWA 3Q9YA 2BFYA 1LP4A 4FKVA 1JPAA 4JT3A 4D4RA 2VAGA 4IAIA 2Q0BA 5GZ8A 4FIJA 1JOWB 4RX8A 1Q97A 1B39A 1BI8A 2PZIA 3V5JA 2HELA 3IGGA 5JFVA 5DI1A 4JJRA 4WT6A 4B7TA 3QF9A 2OI4X 4FNXA 4I21A 4PQNA 4D28A 3R2BA 1WBVA 3IQ7A 2VWZA 1NXKA 3UMXA 4IVDA 3A8WA 4EH3A 4O0YA 3E7VA 4AE6A 3ZC5A 3ORXA 4FKJA 4M3QA 5M55A 1UWHA 4PP9A 3ZSIA 3ROYA 2JD5A 2ZV2A 5BMSA 4BIDA 3BQCA 3RPYA 2UZOA 5LXMA 3C50A 2V7AA 2B9IA 2YERA 4BHZA 3NUPA 2WO6A 4L00A 2GNIA 4YURA 4FJVA 3R7GA 4PDSA 3RAIA 3GQLA 4FZFB 4DGMA 4IM2A 5E4HA 4GVJA 4ANMA 1YI3A 4BI1A 4DCAA 2XJ1A 3O8TA 4BGQA 3ZM9A 3K5UA 4FTMA 5B0XA 5EFQA 3P0MA 4RA4A 3A7IA 4O4FA 3MA6A 1SVHA 3DDPA 3UOHA 4JRVA 4OAUC 1U46A 3AG9A 5CI7A 4S31A 2GMXA 2C6TA 3QRKA 3RAWA 2OIDA 3NSZA 1J7IA 4J1RA 4DFXE 2YWVA 1UKIA 4QMLA 4NU1A 5DBXA 3P7BA 3DNEA 3HDMA 1TQPA 3MH1A 1GIIA 3TTIA 1CSNA 4F70A 5IISA 3ATSA 2F2CB 1XKKA 3UOLA 2XK7A 3AMBA 4MXOA 5CAOA 3VUHA 2JFMA 2IW6A 4G3DA 4AAYA 2HXLA 3MW1A 4IIRA 2XYNA 2HWPA 2P55A 1OKVA 3FYKX 4GU6A 4RJ6A 3VQHA 3OY1A 3TZ8A 5GJDA 4EONA 4EEVA 2YEXA 1OECA 1M7NA 4PMSA 4R3CA 3VS5A 5FDXA 1MUOA 4GVAA 4P5QA 4BDIA 5C1QB 2B0QA 3GU6A 2XS0A 2Z7SA 4H36A 3W33A 3ZXZA 4JOAA 4YZ9A 4A4XA 4CQGA 5TKDA 3TDWA 3QAME 4MX9A 3F82A 3MN3A 2OWBA 4JIKA 3DGKA 2RF9A 3QTZA 1WCCA 4GFOA 2OIQA 1AD5A 3G9LX 1ERKA 5AP2A 4UY9A 4Z55A 2BDWA 3LFQA 4XLIA 4QTAA 4JG8A 1J7UA 2NRYA 5F95A 2XVDA 5HZNA 2CJMA 4Y95A 4C4HA 3LE6A 4JLCA 5DR9A 1H27A 4GH2A 2I7QA 5M56A 4J96A 4WNKA 3FDNA 2CNVA 4O22A 3OOMA 4ZSJA 4M69A 5E1EA 4RMZA 2O0UA 3U54A 4ZK5A 3NUNA 2WMWA 5KKRB 3NS9A 1TQMA 3PUPA 3F5GA 3QTIA 3UIBA 4WG5A 1ZYJA 4FZ6A 3W8QA 3HV3A 1O6LA 1ZMUA 4FL2A 3HECA 5CNNA 3ORZA 3GU7A 4WSYA 2X0GA 3OY3A 2UW5A 4H39A 4F9BA 5E8SA 4LFIA 4EOQA 1KUTA 3OCGA 2Q0NA 2XAMA 2CPKE 3OP5A 4TYHA 2WXVA 2BROA 4A9TA 4MBIA 4HVGA 3LQ3A 2PMNX 5I3OA 1CM8A 3DCVA 3BGZA 4JDKA 4DDIA 3OCTA 4PL3A 3GFWA 3R28A 1KE8A 4F6UA 1Q24A 1OIUA 3ITZA 3LCOA 3N51A 2XIZA 4O96A 4QQCA 5F20A 2JC6A 4FSZA 3O7LB 1LPUA 5L3AA 5FM2A 4PY1A 5AA8A 3D14A 1ZMWA 3GXLA 3K3JA 4HYIA 4X2JA 1ZYDA 4YJNA 3N4TA 4KIKB 4RGJA 4CLJA 4U97A 4DFZE 4XX9A 2O3PA 3KKVA 4XYFA 3ORNA 3BE2A 4O7TA 1ZMVA 4EH8A 4F6WA 4CMTA 5HE0A 5HU9A 4BJJB 4FA2A 4OTFA 4LV8A 4L01A 3P7AA 1YHWA 4C34A 3OBJA 5IH4A 5KX8A 4FV0A 5DHJA 3FLNC 5FP5A 4TYIA 4EOPA 5AJQA 4L42A 2RG6A 5M51A 5FDPA 5L2WA 2XIXA 2WU7A 3QKKA 4FT5A 5BVKA 2ZM3A 2XK8A 2VGOA 2XA4A 4X2FA 3R7IA 2J6MA 4TRLA 2XIRA 3UVPA 1V1KA 2IWIA 3F5XA 4EOSA 1SVGA 3EQIA 3RAHA 3KCKA 2XP2A 3QCYA 3L9NA 2R7IA 3DPKA 3EJ1A 2GNJA 4FKUA 4YZCA 5DEWA 4CEGA 3UE4A 2R0IA 4BGHA 5L2QA 4EH9A 2QHNA 4FKWA 4MD9E 3TKUA 3VS2A 2QG5A 5CSVA 4D1SA 4FL3A 4MEDA 4E4MA 3QUEA 1MRYA 2RSVA 4YGAA 3EFJA 5ANOA 3PSCA 1V0OA 4O7YA 3POZA 2OXYA 4Z7GA 3D2IA 2OXXA 3OHTA 2OG8A 3E3PA 4I5CA 4LYNA 4MHAA 4BDHA 5I4NA 2PZPA 3ACKA 4RX9A 3CJFA 5IKWA 3M2WA 4RSSA 3NAYA 3PG3A 1RE8A 1XH4A 5LQFA 3KK8A 4HVSA 4KIQA 3B2WA 4H05A 4FTAA 2J7TA 3DAKA 4DE4A 3GC7A 5DPVA 2IVVA 3L8XA 2XKEA 5AEPA 2BRHA 3ZCLA 4CTBA 4J52A 3HUBA 1FGIA 2XZSA 3QRJA 2YWPA 2GQSA 3QUPA 3FUPA 4O6LA 3IGOA 3PPJA 2C1BA 4WNPA 2WTJA 3A62A 4LUDA 1PXPA 2XF0A 4IWPA 3PG1A 4X2KA 3DFCB 3L8VA 4HGTA 4PNIA 3K3IA 4DLIA 3KMUA 2ZB1A 4FV7A 2B52A 3QGWA 2QU6A 3SD0A 3UG2A 4O7RA 4R7BA 4Q9SA 2YJRA 5CS6A 3EN7A 3LLAA 3Q52A 3UTOA 3OXIA 2AEGA 5EM8A 2CNUA 3VN9A 4QMWA 4KBCA 4XJ0A 3GC9A 3KRJA 5IQIA 1KSWA 3QWKA 4Y5QA 3U55A 4YZNA 4FKIA 4FG7A 4O7SA 3K2LA 4RIYB 3GCQA 2GS6A 4R7IA 3SDJA 2X7OA 2NO3A 4L8MA 4AA4A 3I7BA 2BTSA 5CT0A 3LXPA 5JGDA 3AKLA 5J9YA 3BCEA 3I79A 4BCMA 4ZTRA 4DLJA 4LL5A 5KMIA 4QEBA 3PLAE 4AXEA 4J95A 5K4JA 2X7FA 3R04A 4DGLC 2VWWA 2YM4A 4BYJA 3TJCA 3P4KA 3QFVA 5AA9A 4ASZA 4C37A 2WMAA 4FYOA 5CT7A 2F7ZE 1PKDA 2UZUE 1YOJA 3EQHA 5ETFA 3DFAA 3QXPA 4KD1A 5AR8A 3TNQB 2JLDA 2XKFA 5CSWA 4DG0E 1AQ1A 3E62A 1U54B 5EI2A 3HMPA 3VUDA 4APCA 2VO6A 5A4CA 5JFSA 4WUAA 1BLXA 4HCTA 2PVMA 4KNBA 3DAJA 4MXZA 3NUXA 4FSNA 4LGDA 2XMYA 3MPAA 4QMYA 3KRLA 4DDGA 2XK4A 1IEPA 4BZOA 3RPVA 1JSTA 1CKPA 2P3GX 2W1DA 1IASA 3BGQA 3GEQA 3QX4A 4ALUA 1XH8A 3PZEA 4TNDA 2YM5A 4DFBA 3LXNA 2QODA 3AKKA 1RW8A 2ZJWA 4IM0A 4MK0A 2C5OA 2J0JA 4RJ5A 3JS2A 4U41A 2OF4A 3F6XA 4FSQA 4IX3A 5ETAA 2C6MA 4F9YA 4AP7A 4IANA 1ATPE 4AW2A 2X4FA 4I3ZA 5TF9A 5J1WA 4EBWA 3LJ0A 2H96A 2ZB0A 4JBVA 5CANA 1DAYA 2RGPA 2JITA 2YISA 3NNVA 4RWJA 1PJKA 5IMXA 4Q2AA 4ANSA 3VULA 1KWPA 5BNJA 4N0SA 2WNTA 4TXCA 1Y6AA 5HG9A 4AXDA 3W18A 3R8ZA 4EYMA 4F1TA 2QCSA 4FV5A 4ORKA 4L9IA 1S9IA 3ACJA 4IWQA 1XBBA 3MVHA 5BUIA 4U7ZA 3ZTXA 4X3JA 4FV9A 2W0JA 4GSBA 4BICA 2C6LA 2ACXA 3FLQA 4NWMA 2X6DA 4QYEA 2VU3A 2VTRA 3UNZA 3F3TA 2X1NA 3L8PA 5BPYA 4W9WA 3U87A 4YZMA 4RX5A 4HZSA 3ZC6A 4RT7A 4Y5HA 3M11A 4ITJA 3B8QA 2E2BA 3KF7A 5C4KA 2OZAA 3ZLYA 4BDCA 4BWPA 2PK9A 4IBMA 5HORA 4WBOA 3IW8A 4CVAA 3A7GA 5K4IA 4F65A 1Q8TA 1PXNA 2W06A 2EXCX 2YJSA 2R7BA 3D83A 5DMZA 3O51A 4G9RA 3VUTA 3HP2A 4AW1A 4ZJJA 4FVQA 4M68A 2ONLA 4G3CA 4FI1A 3ORTA 1Q8UA 4E6AA 3SOAA 3VQUA 1QPJA 4GFGA 4OW8A 3WE8A 5JKGA 4IWOA 4XOZA 4EHEA 2ITXA 4ERKA 4ZP5A 5A4TA 4UYNA 2W5HA 4ALWA 3UDBA 4N6ZA 1E1VA 3KULB 5IF1A 4D0WA 2FSMX 1H00A 3KGAA 3MS9A 3R8PA 1S9JA 4S32A 3SKCA