4ANMA

Complex of ck2 with a cdc7 inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
328
Chain Sequence
SSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE II SUBUNIT ALPHA
publication title Discovery of Xl413, a Potent and Selective Cdc7 Inhibitor.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 113
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4anmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4anmA02
4C3RA 2XNBA 1M17A 5M44A 2PVYA 4PNKA 3HRFA 2CMWA 3ZRLA 3ZMMA 2XBJA 4C3PA 4IB3A 3R73A 4DT8A 3BHUA 5H3QA 4CRSA 3E7OA 4RIOA 3ZUVA 3VS4A 5LMKC 4EH2A 3SG9A 4MVFA 4CFUA 3AQVA 2A1AB 3QRKA 3QD4A 4AU8A 2WQEA 2YEXA 4OW8A 5HTBA 1KE8A 5K9IA 1J3HA 4H3QA 4K9YA 4YJRA 4GG7A 3UVPA 2UZEA 4FEXA 4KAOA 2CKPA 4J98A 2G1TA 3BHYA 5FDPA 2PMLX 2X7FA 3A8WA 2C0TA 4ZTQA 1UKIA 5JFWA 2XH5A 5BUIA 2JBOA 2XNOA 3OXIA 3LQ3A 4E5BA 3NCZA 4L45A 4PPCA 4YHFA 5HNGA 4EK6A 2YJSA 4ERWA 4O91A 1QL6A 4GJ2A 4CFWA 2X8IA 4HZRA 5ANDA 3UQCA 2YFXA 3VQUA 2JKKA 5L4QA 3DKFA 2PZYA 5HESA 4CZUA 3ORNA 2YWPA 3I0OA 5DWRA 3IW7A 3TCPA 3MA3A 4E73A 2IVVA 5CVHA 4IIRA 4KABA 3U87A 4C58A 5L2TA 2XK9A 4Y95A 2X6EA 4MXYA 2BAKA 1JNKA 2B54A 3AD5A 4X6QC 2GCDA 4AX8A 2NPQA 2J0MB 1TQPA 4RJ4A 1NVSA 4G1WA 2EXMA 4ZLOA 1AD5A 2ITPA 5CAQA 4IM2A 4D1ZA 4QYEA 4CCUA 1OL5A 4QP3A 1OKWA 3E8DA 4XV9A 4LOPA 1O6LA 5BVDA 3DFAA 4DAWA 5AV4A 1E9HA 4CGAA 3C0HA 4DEBA 2BVAA 4QP9A 3R21A 4PDOA 5AUXA 2C6DA 4MAOA 4BDCA 5EYMA 2BTRA 4RJ5A 1FVVA 5EQPA 5IG1A 4L46A 3ZOSA 2VAGA 3PLAE 4L9IA 3TG1A 2GU8A 2O65A 2ZV9A 4XHKB 2PVNA 3D9VA 1QPDA 2ERZE 3DY7A 3GC7A 4IANA 2CKOA 3C51A 3VUIA 2WB8A 4H58A 5CS6A 4R78A 3VF9A 2GS6A 3ZXTA 1PKGA 4HNFA 4O83A 5C01A 4MTAA 1PXMA 2OZOA 3FAAA 4DFXE 2H96A 2WMQA 2OWBA 4I0SA 4ZTRA 3LZBA 4GFOA 1H26A 4HOKA 2CGUA 3I4BA 3BPRA 5K0KA 4YNOA 1FGIA 2UW4A 4XG2A 2EXCX 2IN6A 5A3XA 3SXFA 4CG9A 3MVLA 2HELA 4R77A 2JDSA 1XWSA 4K6ZA 1MRVA 4PY1A 3WZJA 3DXQA 3C5UA 3NYOA 5DBXA 4WRSA 3Q96A 3HKOA 3FZOA 2WQBA 3ZM4A 2GS7A 2C6TA 5ETAA 3RCDA 2Y4IC 2X2LA 2PVHA 4QP7A 5FGKA 2XCHA 3RK9A 1MQ4A 5DG5A 3R7VA 4I4EA 4ALVA 4FKJA 3PJ1A 2XM8A 4RA4A 3DQXA 1WBWA 5DT4A 3FMHA 1P2AA 5EKOA 2FO0A 2PZRA 3QQFA 5ANGA 3TIYA 3UODA 4A9TA 4D1SA 3FHIA 3GUBA 4PL4A 4U44A 4QYFA 4BI1A 3UNKA 3RNIA 4NH1A 3JR1A 4KIQA 4BDFA 4DT9A 2C6OA 2ITNA 2PMIA 4HGEA 4QMOA 3MPAA 3W8LA 4EC8A 2RFDA 4IWDA 5C9CA 3AD6A 4G16A 3V5WA 3U9CA 5JH6A 4F6SA 5FRIA 3QD3A 3BBTB 2J51A 3II5A 2X4ZA 5CQUA 3RM6A 2B9HA 3JVSA 4GCJA 2VGPA 4ITHA 5AAGA 4J96A 3MH1A 4FZAB 3GNIB 4X3FA 3TZ9A 2X2MA 3OF0A 4U3YA 5DNRA 4XG8A 1I44A 1NVQA 2LGCA 3G15A 4F7NA 1W7HA 5JK3A 2BROA 3PE1A 3ZRMA 1SVGA 4M66A 3OVVA 4UWBA 4FBXA 1ZZ2A 4BCQA 4D5HA 3DBCA 4BWXA 3FMJA 2VRXA 4BZNA 2YM7A 4RSSA 1JSUA 5IQDA 4O7RA 5AR7A 5DOSA 4OAVB 5CF4A 1CKPA 4QMPA 5KHWA 3GU5A 4YBJA 4ACGA 4FKGA 2YA9A 3ODZX 2CLXA 5LVMA 4LUDA 5D12A 3L8SA 3E8CA 3BCEA 1W98A 4ZY5A 3HAMA 3FUPA 4RIYA 4PP7A 4DEIA 5IMEA 3EYGA 3V6SA 1PKDA 5FLFA 2W9FB 4XH6A 2VO7A 5HBEA 5HICA 3P7BA 4L52A 5I9UA 4AZVA 1IA9A 2JGZA 2RFEA 1R78A 3H9FA 4RG0A 5LARA 4CMOA 3PXYA 4O96A 4IAFA 1PXNA 3K3JA 1OKZA 4GUEA 1ERKA 4Y85A 3FQHA 1OIQA 2ZVAA 4WNPA 5L8KA 3HX4A 3P4KA 1JKSA 2WQMA 1NVRA 4RC4A 5E8ZA 3BYSA 3R83A 3Q4UA 5HE2A 2PE1A 2CKQA 4MNEA 4XG4A 5DR9A 1OKYA 3UYTA 4B0GA 2HZIA 4M13A 2RIOA 3D83A 1YXVA 4O0RA 3FI8A 1BLXA 3O2MA 3V6RA 4G6OA 2WEVA 2W4JA 3W2CA 4L67A 3IO7A 4WSQA 3RNYA 2W1DA 3VBWA 4BCFA 3UDBA 2XK8A 2WTCA 3PJ2A 3T9TA 3KVXA 4HCVA 5HTIA 5IPJA 2GQSA 4MD7E 3QCSA 5F4NA 3G51A 3BQRA 4O2PA 4FV4A 2QQ7A 2VTNA 4IAYA 2EUFB 5M51A 4FL3A 3EL7A 4AN3A 1K2PA 3HP2A 3S0OA 2OXDA 2HYYA 4BICA 4ITJA 3HMNA 4XG9A 3AC4A 3FMKA 3ORTA 3NEWA 4P90A 2GHLA 4RIWB 4L00A 2RG6A 4EH6A 4M8TA 4RVKA 4ANQA 1Q8TA 3PPJA 4C33A 4EWQA 3ZEPA 4QMYA 3ZLWA 2QOLA 4X0MA 1GOLA 2F57A 2XK4A 5DEYA 1IA8A 3ZXZA 4IEBA 4FL2A 3PSBA 5DMZA 4WBOA 5HVJA 3A8XA 4RWJA 1OITA 3LCSA 5EM8A 3SKCA 1OMWA 3LCKA 2YIYA 3A7GA 5E8UA 3MWUA 5CZIA 5E1SA 4NJ3A 2O2UA 3S95A 2WMWA 5J9YA 5LVPA 3KU2A 3G6GA 3U51A 4K18A 4NL0A 3CS9A 4BDEA 4XG7A 4ZJIA 4USFA 4CLIA 4DH5A 5KMKA 3HA6A 3FHRA 1MQBA 3JPVA 4FGRA 3FYJX 4GYGA 1LUFA 3E8NA 3NPCA 4FT5A 4LL0A 4D55A 1UA2A 3DBQA 4GW8A 4UYNA 5EW8A 2Z60A 2VUWA 3FC2A 3PWDA 3O7LB 1ZMUA 4ZTHA 4OBQA 2VX0A 3EKNA 3ATTA 3D2IA 4FKOA 5H9BA 3TJDA 3V5TA 3DOGA 2PL0A 3UMXA 2X6DA 4X3FB 4E6DA 3UOJA 1REJA 5HLPA 5DA3A 3EN6A 4QQTA 2WZJA 2JIVA 4LRKA 4F7SA 2R2PA 5CAOA 1YDRE 4QMMA 3EQBA 3EWHA 2QURA 2O0UA 3V01A 4I0RA 4UWYA 3C4XA 3OUNB 3GC9A 4S30A 2F9GA 4M15A 4C57A 3F5XA 4RJ8A 5C8MA 5GINE 3OWPA 4YZMA 3WIKA 5K5XA 1OL2A 2GHMA 4TYHA 4YUQA 3P0MA 2UW8A 1JKTA 2CN5A 3C50A 4D2VA 2OBJA 4IAAA 1Q61A 2XCKA 4NT4A 3CTQA 5DT3A 5HTCA 2W17A 2ACXA 4BHNA 5EI6A 3FMNA 3QTWA 1BI7A 3MI9A 2G2FA 4RIYB 3KY2A 3LHJA 3FXXA 4F99A 4C2VA 2ETKA 1XBBA 4RX7A 4AT3A 3H9OA 5HORA 4FV1A 5HZNA 5DLSA 1DAYA 2VNYA 3R9HA 5DHJA 5D1JA 1YI4A 3FZRA 5FM3A 2R3QA 3QUDA 4OTRA 4HVIA 3H30A 3KXNA 2E9VA 2FSMX 5EQEA 3HVCA 2QO7A 3GU4A 2CDZA 3TIZA 2XZSA 3QRTA 2B9IA 5CZHA 3PE2A 4FTCA 3OCBA 5BVNA 2ZB0A 4TT7A 5CT0A 4DTAA 3TZ8A 3ZFMA 4ANOA 4DTKA 2OIBA 4GKHA 3R22A 3ZDUA 3QUPA 4FMQA 4XBUA 5HLNA 4MNEB 1IASA 4UXQA 4BI0A 4DGGA 2EWAA 4QRCA 4X2JA 2PUNA 3EJ1A 4F64A 3Q2MA 4OBPA 4OTWA 5DR6A 5BYYA 4XOZA 4L8MA 5ETFA 1NA7A 3QC4A 4V0GA 5CSPA 3NX8A 3OROA 4MYGA 4CD0A 4U5JA 2WGJA 4E4XA 2YDIA 3A61A 3ALNA 5HU9A 3EZVA 4O82A 3MPMA 4H39A 4F9YA 4XUFA 3Q04A 4BB4A 3FZTA 4OBOA 4E5AX 3TDVA 2I7QA 4TWPA 4DEGA 5EYCA 5AX3A 3RI1A 3UP7A 4ANLA 1TQMA 4UZDA 3LXLA 4B4LA 4MXXA 5I4NA 4I5MA 5HVKA 3NIEA 5C03A 3VF8A 5KMNA 5DFPA 4HPUE 4J1RA 3ERKA 1PXLA 4A9SA 3MB7A 1W83A 2GMXA 3QRJA 5LWNA 2QO9A 4IZ5A 5JEBA 3R6XA 4JI9A 2G2HA 3MVJA 1PXKA 1LEZA 4YJTA 2XIRA 1XH9A 5KE0A 3FV8A 3UNJA 4XG3A 1MRYA 4CT2A 4FSMA 3NVMB 4P2KA 4FV2A 2PPQA 1M7QA 1YDTE 4G9CA 4NEUA 5IA4A 4DA5A 3OXZA 2AYPA 4FNYA 4M0ZA 4C59A 4FICA 3QD0A 3RAHA 3HEGA 1J7IA 4AFJA 2JDTA 3EFWA 2GNFA 5FBNC 4FVRA 5CASA 3UNZA 4EHZA 5J87A 3I7BA 4ASZA 1J91A 1YXXA 4RRVA 3D4QA 4OTIA 4FA2A 4GL9A 3LCDA 2HY0A 3D14A 5HO6A 2FYSA 3KK8A 4HGLA 5HD7A 1APME 2VX1A 4FKVA 2NRUA 4FZ6A 3F82A 3AMBA 3WYXA 4D0WA 5L6OA 4BRXA 1VEBA 3NDMA 3QXOA 5JZNA 2EU9A 5EOBA 5F9EA 2JLDA 4MD9E 4KSPA 2OO8X 2VO6A 3OWLA 2HXLA 3HRBA 3DTCA 2W96B 4FZFB 4QTDA 3PVBA 1OL6A 5CNNA 5C27A 3S2PA 4FZ7A 4AW1A 4RPVA 3VBQA 4MD8E 4RFMA 3KXHA 4FSZA 2UZOA 1WVWA 2PYWA 3RAWA 4O0VA 5FEDA 5JFXA 4HYSA 4XRJA 4B9DA 2JBPA 2XJ2A 4ZJVA 4USDA 5ETIA 4R5SA 1H28A 4TYHB 5M55A 3UQGA 3FY2A 4BC6A 3R71A 4ONAA 3TDWA 3PP1A 2X7GA 3A7HA 3O8UA 1KOBA 2QU5A 3OXTA 4Y73A 4RJ3A 4QNYA 5BUJA 4I6BA 2JC6A 4Y8DA 4YHTA 2YABA 4LG4A 3EN7A 4UMPA 2XK3A 4R3PA 4J99A 4LGGA 4XG6A 3KK9A 3ZCLA 4JXFA 1DM2A 2BIKB 4MXZA 4DHFA 3HMIA 4YC8A 3NNWA 3TUDA 4E1ZA 4M7IA 2BFXA 2R3MA 3B8QA 4IB5A 2QLUA 5LVLA 2RG5A 3WOWA 3LFCA 2YHVA 4IVCA 1QMZA 1UNHA 1CMKE 1UV5A 3GU7A 3MH2A 3R2BA 2WTKB 2VN9A 4S34A 4YPDA 4RC3A 4KRDA 3VWAA 4BI2A 3WARA 4AWIA 1YI3A 2I40A 4RMZA 2ONLA 2QG7A 5A6NA 4HVHA 5M4IA 5AV3A 5HG8A 2GFCA 3BGQA 2R3LA 2YJRA 1PY5A 3OUKA 3F69A 2YZLA 3CY2A 1HOWA 3R01A 2IZUA 4FKIA 3V5PA 3VUKA 3MTFA 3OC1A 4I1ZA 5IUHA 4KUJA 4JOAA 2YCFA 1WBNA 4J97A 5CSXA 5M07A 4J71A 5AIRA 5L8LA 3A7FA 2HW6A 2V7OA 4ANSA 4I3ZA 4O38A 4EOKA 3HV4A 3MIYA 4C36A 1FINA 2B53A 4FR4A 4LGDA 2VX3A 3R30A 3LXNA 4JQEA 4ID7A 3NAXA 3W2QA 5IQGA 4YZNA 1OI9A 2CJMA 4EONA 4N70A 3KMMA 2HCKA 2UV2A 3U4WA 5IDNA 1L8TA 2PE0A 3NUYA 5CVFA 3W8QA 2OU7A 3OOMA 4I92A 4KIPA 4L42A 1CM8A 3COMA 1PXJA 4A06A 3UIMA 3GVUA 4EKLA 1H27A 3GI3A 4BN1A 4JBPA 2C5NA 3RBWA 2BZJA 2FH9A 2GTMA 5IMXA 2ZMCA 3TUCA 5M57A 1ZMVA 3DLZA 3P7AA 3L8PA 5AUWA 4QMLA 3TTIA 4OTGA 1YRPA 2R64A 4JBVA 4NIFA 2OF4A 1ZXEA 5CI7A 3SD0A 5E9EA 3ALOA 2BDWA 5KZ0A 3DNDA 3C5IA 4FV8A 1YWVA 2QKWB 4IJ9A 1YOLA 4QPMA 5LMBA 5T68A 3NYNA 4F9WA 4D9TA 4D4VA 1YQJA 2O64A 4NUSA 3O71A 3PXRA 3OMVA 3M2WA 4IX4A 3TV7A 2Y6MA 2VTLA 2BR1A 1SZMA 2VTRA 5FBOA 5J95A 3R9DA 5IQHA 2QG5A 3HYHA 4WRGA 3VRZA 4W4YA 4BDKA 3U54A 5IA0A 3G9NA 4O1OA 2R3JA 1W84A 4AZTA 3QCQA 5B2KA 1QPJA 1ZY4A 3EN9A 4IBMA 3SDJA 5HBJA 3WF5A 4FT7A 3U9NA 4DFNA 3TTJA 4L3PA 3BEAA 4PPBA 2J0LA 1Q8UA 2P33A 1H1WA 2W1IA 4F1MA 4DITA 4R1VA 1LEWA 4D2PA 5I9ZA 2BZHB 4WHZA 3K5UA 3LMGA 3MY5A 4QP1A 2DYLA 4X2KA 5IUGA 4RC2A 3VUMA 4KBAA 3UG2A 4NU1A 3JVRA 2Z7RA 4N4SA 5KZIA 1B38A 3CEKA 3D5UA 3KRLA 3W2SA 3BRBA 1KE6A 4U40A 3SVVA 1M52A 2KTYA 2O63A 4LGHA 4F9BA 1H1PA 1B39A 4XS2A 5AUZA 1MUOA 1PYEA 4QPSA 4W9XA 2FGIA 3GBZA 3DAJA 2OFUA 3HECA 5DRDA 4DC2A 4FG7A 4BYIA 2XEZA 5LMAA 4EK4A 4BDJA 3G2FA 1M7NA 1EH4A 2C6LA 2CGWA 2WELA 4FKSA 4DCEA 5K4JA 2IW8A 3R8VA 3ORMA 4OLIA 3ZSHA 5H8GA 4GYIA 5L6PA 4FNWA 3QCYA 4B99A 3EQHA 3SHEA 4GU6A 4PX6A 2GDOA 1P14A 2PMNX 2RSVA 4NTTA 3E3BX 4CFNA 3BKBA 4ZY6A 4QMUA 4U6RA 1OVEA 3F2AA 2B0QA 3RAKA 5AMNA 3VW6A 1Z5MA 3V5QA 3A99A 2RFNA 3D5XA 2ESMA 1YVJA 3UZRA 1STCE 4AFEA 4O81A 3DAEA 4MH7A 2IG7A 5IEVA 5BMSA 3PVGA 4XV3A 3ZRKA 3GCVA 3E63A 3DNEA 3GU6A 1UWHA 4ASEA 2W4OA 2V0DA 2XNNA 1P4FA 4DE4A 3H10A 3I5NA 2W06A 4FNZA 3E93A 3AT2A 3R1YA 2C5OA 2DQ7X 3OY1A 5AM7A 2GNJA 2WTDA 3QQUA 4A4OA 3MB6A 3NUNA 3FL5A 4YTCA 4FVQA 3QC9A 4U41A 5HG5A 5M06A 3ITZA 2V55A 2OIDA 4EUUA 2JIUA 3NUSA 3F5UA 4X3FC 4C3FA 4PMPA 5L2IA 4QMSA 3KMWA 3SA0A 3NR9A 4JJRA 4E93A 4NW6A 5E90A 4DFUA 4DYMA 3CBLA 3PXZA 2OJGA 4QTCA 1Z57A 2XUUA 5CTPA 1G3NA 5E4HA 3TKHA 5TE0A 3FMLA 4A9YA 2C3JA 2QR8A 2JDOA 3CKWA 4NIFB 4G3CA 4FYOA 5CWZA 2VWIA 3NUXA 3WBLA 2GQRA 4NFNA 5GIOE 4HZSA 2RL5A 4Q2AA 1E1VA 2QD9A 4OUCA 3SV0A 4HGSA 4G6LA 3D2KA 2A4LA 1E1XA 4PUZA 5BPYA 4QOXA 1M14A 3IS5A 4MWHA 5F20A 4GIHA 4XNEA 3Q2JA 4EYJA 4I6FA 4O0TA 4Y72A 3F3WA 4C35A 2W5AA 2IVTA 4EHGA 5A4TA 3C0IA 4TNDA 1A06A 3OCSA 3DB8A 3FDNA 2C1BA 1Q62A 2VTAA 4N57A 4GT3A 4RVTA 4ZZOA 4BTJA 4C4FA 1KE5A 2PULA 1KV2A 4M84A 5HLWA 4QTEA 3TT0A 5KUPA 2AUHA 4FKLA 4JBOA 3TNHA 1WBOA 3QZFA 4M12A 4ACMA 2ZM1A 3ZYAA 3P1AA 4GS6A 4QYGA 5HG7A 4ZP5A 3FLYA 3N9XA 3RPYA 3ZSIA 3E62A 1U59A 2IPXA 5LQFA 1LP4A 2WMSA 3DK7A 5HOAA 3LVPA 4CV8A 4II5A 3I6UA 3UC4A 3CD8A 5GZ9A 2IVUA 3AT3A 4AGCA 4CLJA 2IVSA 5KMIA 4QQJA 3ACJA 3RHKA 3VJNA 2W9ZB 3FPQA 4EOQA 4I20A 4YGAA 3BYMA 4K33A 5FD2A 1JAMA 4BIBA 4CZYB 3LJ0A 5IQIA 4QMWA 3VBTA 4N6YA 2XNMA 5KBRA 3OT8A 5CVGA 5CLPA 4BDBA 3TNPC 2AC3A 3W10A 5CNOA 3LJ2A 5FTGA 3MGYA 4C61A 5I3RA 4UMUA 5CF5A 4E6AA 2NRYA 4U43A 1BUHA 4NYEA 2OICA 5HCZA 4A9UA 2PZIA 4DCAA 2X9EA 4E26A 1JWHA 5IA5A 4ZMFA 3O0GA 3QTZA 3VNTA 2F7EE 4BY9E 4OR5A 4U0IA 1J7UA 4XLIA 4Q5EA 5BYLA 2VTSA 1KWPA 1L3RE 4UY9A 5AFVA 4W4VA 3VO3A 4WUNA 4OTQA 2UZWE 4GRBA 2W5BA 3PIYA 4EJ7A 2E9PA 4JRVA 3DK6A 1VYWA 3LFSA 4EZ7A 2JKQA 4DH1A 2NP8A 3OW3A 4M3QA 2NO3A 2WMVA 4J7BA 2UZBA 3CJFA 4QPAA 4S33A 3LXPA 3BE2A 5AP6A 4B8LA 5CAPA 4TY1A 2QC6A 3ODYX 3TNQB 4FV9A 5AUTA 4ZAUA 3UTOA 5FEEA 4BKYA 4F0GA 1BL7A 4DN5A 4ASDA 4K1BA 4EBWA 2BFYA 1H1SA 3NYVA 3U8WA 5IU2A 3EN4A 4JG8A 3AXWA 4YU2A 3KXGA 5K3YA 3GOPA 3F3TA 3UO6A 4QO9A 3ZH8A 5CU2A 1ZAOA 4IJPA 5G6VA 4YTIA 1SMHA 4EH8A 4FIGA 3NZ0A 3D15A 4Q9SA 1DI8A 3QTUA 2C4GA 2ZV7A 4RX9A 3E8EA 4G6NA 4F08A 2V7AA 1H0VA 2J7TA 4ENYA 4NCTC 4F1OA 1YWNA 4BCPA 5EH0A 2ITQA 3A7IA 3NRMA 5E8XA 4F0IA 3DT1A 4ZS4A 3QF9A 5GZAA 4DGLC 5J1WA 3FXZA 4HGTA 1OIYA 3DXNA 3MFSA 3TV6A 1WMKA 2QOQA 5AX9A 3IGGA 3ZZWA 2EB2A 4A07A 2WEIA 3LQ5A 4HYUA 4IX6A 1G8AA 1ZYLA 2CSNA 4MBLA 5CSHA 3VHKA 2QI8A 3VS7A 3R1QA 1AQ1A 2BHEA 2C6IA 3G6HA 3RPVA 1AGWA 4B8MA 4BIEA 3FL4A 4IM0A 4BGGA 3NWWA 4DFZE 5JGDA 3P08A 1Y57A 1PMVA 5AV1A 4BDDA 4HVSA 3R8LA 1XBCA 4MX9A 3EQIA 1WVXA 3C0GA 3V8SA 4WBBB 4AT4A 2JKMA 4BFMA 3NS9A 2A19B 1R1WA 4AA4A 5JKGA 4AGDA 3ET7A 2DWBA 2WTKC 4JDJA 4FL1A 4WUAA 2Y8OA 5AV2A 2CKEA 5KKRB 3G5DA 3MFTA 5AP4A 4MKCA 3Q4ZA 2OZAA 4QMTA 4YLKA 5I9YA 3CY3A 2WD1A 3RJCA 3UZPA 3LM5A 4MQ1A 5A4CA 1GJOA 5L2WA 3CGOA 4BDIA 4EH3A 5AR5A 2WMRA 4M67A 2GNGA 2WO6A 3FMEA 3VBYA 4G3DA 4IWQA 3VULA 3P7CA 5AM6A 1OGUA 4NFMA 1Q5KA 4F4PA 2QHNA 3CLYA 1CDKA 4AA5A 4AOTA 5HCXA 3IPHA 2V22A 4APPA 4E20A 2XIZA 2XJ0A 1JSTA 3KMUA 3ORLA 2QOFA 3PVWA 1X8BA 4I6HA 5EYKA 3THBA 4AOIA 4IC8A 4IE9A 5AA9A 3RWPA 5JFVA 1FPUA 4BBMA 4YO4A 3FZSA 3IQ7A 5D41A 3QQKA 3CD3A 2YN8A 4TWCA 3BYOA 4FTOA 4NJDA 3RINA 2Q0NA 2QR7A 1YXTA 4I41A 2J4ZA 4FTUA 4IDTA 4UZHA 4AGUA 3QWJA 3NNUA 5HO8A 4ERKA 4RGJA 3RCJA 3CSVA 3C4CA 2PVKA 4UMRA 2W1CA 3LFEA 3E92A 4E3CA 2OG8A 3V8WA 1FQ1B 4P5QA 3PG3A 4QP6A 3V51A 3B2WA 5M08A 5D11A 4UV0A 4EI4A 5ETCA 4C7TA 3BBWA 3PLSA 4C2WA 2R3NA 5KX8A 3ORZA 1H1QA 3QYWA 4I5HA 5FTQA 3IOKA 4CQEA 5HQ0A 1UWJA 4LV8A 3T3VA 5LCJA 4AZFA 5CEIA 5L2SA 4K0YA 3F61A 4JRNA 3KRRA 3KVWA 4ZSEA 3KREA 2XA4A 2DUVA 3BYVA 3R7IA 1GZKA 2X4FA 3MJ2A 4EC9A 5AIKA 5L8JA 4XV1A 1QPEA 2CCHA 4FIHA 4PTGA 4FSQA 2X81A 3P79A 5CU4A 4S2ZA 4ZTNA 3HV5A 4DBNA 2NNWB 4IAIA 3GC8A 4TTHB 3FKOA 3EYHA 3HP5A 2HZ0A 3Q3BA 4PL3A 5DIAA 4CFMA 4DGMA 3RMFA 3SXRA 4PF4A 3FQSA 1Q8ZA 1LPUA 1BMKA 1WVYA 4X2FA 4XCUA 1U5RA 3LKMA 1ZOHA 4JX7A 3R7YA 5BYZA 3RM7A 2UZTA 4YMJA 2J0KA 4E8AA 5BNJA 2IZTA 5AJQA 3FPMA 4CNHA 4O7TA 4EBVA 3IDBA 1HCLA 3MVMA 2HK5A 2XIKA 3UMWA 4NCTA 2YWVA 5IQCA 3V5LA 4DF3A 2O8YA 2CNQA 5LXMA 4FV6A 3O17A 5DN3A 3BV3A 3MA6A 3BU6A 4BYJA 2OH4A 3FLNC 4NWMA 4CFXA 3LAUA 2UZDA 2HWOA 4QYYA 4QMXA 4DGNA 5EM5A 5GIPE 2FVDA 2E9NA 5F95A 4I94A 4E7WA 1DAWA 3L8XA 5J7HA 3QGYA 3I79A 2QOCA 2HENA 3Q5ZA 1Q3DA 2OJ9A 3LM0A 4CZTA 3ZLXA 3P86A 3Q9XA 2UVYA 2ERKA 2P2IA 3L9MA 3UGCA 4EK8A 1XH4A 1IRKA 2VTPA 3OHTA 3WF8A 2BRHA 3R2YA 4JDKA 3GGFA 2R9SA 3N4UA 2ONLC 2ITYA 3HA8A 4MNFA 2OZAB 4NKSA 2J5EA 3NW7A 1SYKA 3PY1A 5AR3A 1PMEA 2Y0AA 4L7SA 4FTMA 4FEWA 3ORKA 3D5WA 5T6KA 4QTAA 5DH3A 3KRJA 3DFCB 5HE0A 4DH8A 4QTBA 3ZO3A 4IHPA 3ZUUA 3NUPA 3VUHA 2R0IA 2BHHA 2GNHA 2KULA 3BU3A 2J9MA 4RWIA 4NM5A 2C6EA 4RA5A 1YHSA 2IZSA 5CF6A 4KWPA 3E3PA 2XIXA 1GZ8A 3Q4CA 5GNKA 3PA3A 4U3ZA 1YOMA 2YIRA 3C4FA 5ACKA 2FSTX 4IC7A 3EFLA 1WBPA 1VYZA 3F3VA 1J7LA 4RVMA 1XH6A 4D9UA 3U6HA 2QHMA 4GEOA 4YLLA 3MW1A 3PDTA 2HAKA 3HMOA 4XV2A 1PRYA 3G0FA 1H8FA 4FIFA 3QU0A 2RF9A 4AS0A 1FVRA 1J1BA 3CC6A 5LWMA 2QO2A 4G9RA 3DJ5A 4ANMA 5HIEA 5H2UA 2H8HA 3E5AA 5DYJA 4FTJA 4D58A 4FIEA 4ACCA 1ZYJA 3ZTXA 4MF0A 5HGIA 3VN9A 4CKIA 2GPHA 4M0YA 2XNEA 3ULIA 2FA2A 3EQDA 4ZOGA 4KIKA 3DBDA 2WMAA 4QP4A 5E1EA 4H05A 3UVRA 2ITOA 1P4OA 3WYYA 4S31A 1GIIA 4KKHA 3F7WA 4MBIA 4Z55A 4GFMA 4LM5A 4NW5A 4IWOA 3SW7A 3QTQA 4C0TA 5JFSA 4LMNA 4D5KA 1RQQA 4FF8A 4L3JA 4LRJA 4FTLA 5I5ZA 2X39A 4FIIA 4X2NA 4LRMA 4MK0A 4Z16A 3MJ1A 2GSFA 1XH7A 2OSCA 3C1XA 3OP5A 2X8EA 5CEMA 2PVFA 3K2LA 2J0JA 3CKXA 3QZIA 2VZ6A 4IDVA 4CT1A 4ZSLA 4AG8A 3PG1A 4D2RA 5A4QA 3OG7A 5GJGA 1CSNA 5HVYA 3L1SA 1MRUA 3MY0A 3O23A 3O50A 2UVZA 3R8PA 3BELA 1OECA 3EQPA 3TZMA 5LJJA 4W8EA 5AR4A 3QTXA 1JQHA 3UIUA 4BR3A 4UWCA 2A27A 1F3MC 2OI4X 4EOOA 3GEQA 4AZSA 4G5PA 2BALA 4EHVA 5J9ZA 3IONA 4QP8A 3Q5IA 4U8ZA 3Q52A 1F0QA 2VO3A 4PDSA 2C1AA 2XNPA 3BLQA 4IADA 2BAJA 1Y6BA 3AC3A 4L68A 4YHJA 4EOPA 3F88A 3OY3A 4XEYA 2G9XA 4CV9A 5DEWA 2UW9A 2WFYA 3DBEA 3EQCA 3TJCA 2C30A 4IB1A 2WOTA 3CPCA 3EQFA 3OBGA 3MFUA 4BDHA 5D7AA 5IQEA 1JKKA 2PY3A 3D7TA 1CTPE 3UZTA 1XQZA 4K11A 4IX5A 2JDRA 2ZB1A 4LOOA 3LMHA 4RZVA 1ZWSA 4BCKA 2R3IA 3MH3A 3DJ7A 5AP0A 2WPAA 4IXPA 3GENA 3DZQA 1QCFA 5K5NA 4FYNA 4ZTMA 4W9WA 4B6LA 2REIA 3NW6A 5FQDC 4FTIA 4RVLA 4EORA 4ZEGA 1KE7A 1R0PA 1R39A 4KBKA 5B7VA 3QWKA 3RPSA 5G1XA 3GOKA 2R7IA 3PWYA 4JT3A 5AP2A 5JRQA 5HNBA 4QQCA 4R7BA 2GQGA 4BBEA 3E88A 5I9VA 3TL8A 5BMMA 3GCSA 1BX6A 4I5CA 4IFCA 2C5VA 3BZ3A 3DZOA 4G34A 4LYNA 4MXAA 3VS2A 2QKRA 4AA0A 2GNIA 5E8YA 4YP8A 4BGHA 5AWMA 3PJ8A 1GY3A 2FSOX 3FKNA 1UKHA 4V0GB 3VW8A 4C4GA 4C4HA 4RFZA 2UZUE 3F3UA 3FSFA 4Q5HA 4R3CA 5CX9A 4BBFA 2IWIA 2R3GA 3CCNA 3G0EA 3VUTA 1A48A 1FBNA 1RDQE 3QRIA 4FE2A 3RTPA 4IH8A 2X8DA 5HCYA 5M4CA 1SNUA 3G90X 4PMMA 4DG0E 4ZZMA 3CGFA 3SG8A 3WZUA 4GG5A 5DPVA 2EVAA 3BHTA 4I22A 3LMIA 2J5FA 5ANKA 1G8SA 4GUBA 3WZKA 3A2CA 3SX9A 4CSVA 3D5VA 3QX2A 4HYHA 4DLJA 2ETRA 5EW3A 4JLCA 3V5JA 1V0PA 2PMOX 3OOGA 4GH2A 3Q9YA 2W1FA 2GNLA 3M42A 3MESA 4KIKB 4U81A 4GVJA 3VBVA 3PZEA 1XJDA 3TV4A 5AP1A 3PVUA 3QX4A 1U46A 5IEYA 2UW5A 2ZJWA 5IH5A 4AXAA 2VTHA 3CP9A 4YZCA 4C4JA 3KRWA 2P3GX 4BWKA 3OW4A 5KMLA 3QRUA 5BVEA 4KD1A 4WG5A 3W16A 1T45A 2ZDTA 3FI3A 3MBLA 1YOJA 3NUUA 4JIKA 5HIDA 3WF6A 1OUKA 3CTJA 3OBJA 3ZZEA 3D0EA 4PWNA 3OCTA 3L9LA 4UB7A 3OEZA 3AT4A 1OPKA 2XKDA 4KKGA 3ZBFA 3CQWA 1ZYSA 4FOCA 4TWOA 2XJ1A 2B9FA 3R63A 1P5EA 4ALUA 2WNTA 4I4FA 4JAIA 5ANEA 5EHYA 1IR3A 2R0UA 2YM5A 3TNIA 5JN2A 4BCJA 5IA1A 2YDKA 4MXCA 3O8TA 4ZSJA 3QBNA 3SOCA 1UVRA 3R02A 2UZLA 4FUYA 4BHZA 4D28A 2R7BA 3TACA 4ASXA 4Y5HA 4EOJA 3SGCA 5EM7A 1KUTA 1BL6A 4RJ6A 4BCIA 3Q60A 5KKRC 4XLVA 3O51A 3V04A 3RK5A 4KNBA 2HZNA 3F3ZA 4NZWB 4CCBA 4O7SA 3C4WA 4WO5A 2P0CA 4QT1A 3BI6A 3VVHA 3GFWA 3MS9A 3HV7A 4BCOA 5T3QA 3TUBA 4ZTSA 2J0IA 4LOQA 3HMPA 2Q0BA 2PU8A 3IDPA 3ZO2A 1URWA 2ZM3A 4LV5A 4ACDA 4E6QA 3TZ7A 2VTOA 1KOAA 2PVRA 3D7TB 4W8DA 3MIAA 3TWJA 2C68A 4FSTA 3NNXA 1G5SA 1VZOA 2WU6A 4A7CA 4RBLA 4FT0A 1IEPA 3LFNA 3L9NA 5EDQA 3BIZA 2PZPA 1SNXA 4L44A 2Z7SA 2WQOA 4H3PA 4WOVA 4KINA 3ZLSA 3KCFA 4AE9A 2P55A 5A4LA 1FGKA 3GQIA 4LFIA 5J79A 4ZLYA 2YITA 4M69A 3ZUTA 4TWNA 1F5QA 3ZHPC 1Q8YA 4JG6A 1Y6AA 5CT7A 3FLWA 5F1ZA 3ULZA 3AC2A 4PNIA 5FDXA 4I23A 2VU3A 2QCSA 5JSMA 3EN5A 3VS3A 4ZS0A 1PMUA 3A60A 5ANIA 3ZBXA 2QOKA 5KMJA 3TM0A 3LFQA 3GU8A 3KL8A 4RQKA 3VS1A 4BCNA 1YHVA 4JR3A 4YJUA 4ZIMA 4OT6A 2W1HA 3BX5A 4CKRA 5IA3A 1GZNA 3W32A 3MN3A 1XR1A 2CLQA 5CEQA 5KNJA 5CAVA 2BRGA 4TNBA 3QZGA 5J1VA 3WILA 4WSYA 1O9UA 3DA6A 3P9JA 2ITVA 4ZSGA 2H6DA 4YJQA 4JBQA 4JR7A 4Z7HA 4XRLA 3T8OA 3VC4A 2B7AA 5AP5A 5CALA 4O7ZA 4RJ7A 4O1PA 4OT5A 3KF4A 4D2SA 2OK1A 4BKZA 3EIDA 4F6UA 4IB0A 3DGKA 1H07A 2UW7A 4FG9A 2WXVA 3DS6A 3FKLA 4AW2A 3VS5A 5A4EA 5HD4A 4FV3A 3DKCA 4PMSA 4JS8A 4FSUA 3G33A 4C8BA 5HG9A 1JSVA 3T9IA 4AZWA 2BPMA 3ZLYA 3OEFX 1PXPA 2ZYBA 5CSVA 5EM6A 3ZO1A 4YJVA 4DH3A 5HI2A 5CSWA 3FE3A 2VWVA 2C69A 4BIDA 5J7BA 2PE2A 2JD5A 3UYSA 3PA4A 3QLGA 4HPTE 4CYJA 3KN6A 2HZ4A 2EB3A 2W05A 4XP3A 3AOXA 2VV9A 4EH4A 1U5QA 3DJ6A 2ZDUA 3QA0A 3F5GA 5JQ8A 1OZ1A 2YIWA 3JS2A 4K77A 1WZYA 3FMMA 4FTQA 4O84A 1RE8A 4F7JA 2RKUA 3UIBA 2IZRA 5H8EA 2YCRA 1WBVA 3RK7A 1BKXA 5EI2A 2J90A 2VTTA 3KGAA 1WCCA 3K3IA 1ZZLA 1GAGA 1PJKA 3QYZA 4TL0A 4WIHA 3RWQA 4HCUA 2C5XA 2F2CB 1CKJA 3AMYA 3UOHA 3ZO4A 5CU6A 4BTFA 3N4VA 2WTJA 4IACA 3FJQE 2C5YA 3GCUA 1M2PA 2R4BA 1JKLA 3FSKA 3I0QA 4PTEA 3ANQA 2B55A 3QLFA 2BIYA 1H00A 4QD6A 4UALA 5FXQA 3Q9ZA 2W5HA 1PMNA 4Z7GA 5ACBC 1WFCA 3VJOA 3A7JA 5ANOA 1S9JA 4D4RA 2BRBA 1IAHA 5FWKK 3E7VA 4UMTA 3HGKA 2OXXA 4A4LA 3QQGA 2VWZA 4AW5A 5HU3A 2RFSA 3C13A 4EKKA 4YC3A 3TN8A 3LQ8A 3DLSA 5CY3A 5M56A 4ITIA 3LLTA 4C34A 2CGXA 2QODA 5D9HA 2BMCA 4EEVA 4O7WA 3BHHA 4ALWA 3IOPA 1ZLTA 4QMZA 3PRIA 2XB7A 2PUIA 3UPZA 5HHWA 2XVDA 2GHGA 2XIYA 4JL9A 1ZOGA 4NM7A 2X1NA 3MY1A 4FK3A 4FV5A 4KS8A 4P7EA 1Q8WA 1YHWA 2WU7A 3WZDA 4AE6A 5AR2A 2QONA 2OGVA 2YM4A 4YZDA 5JZJA 3KA0A 3ROYA 4YZBA 4ARKA 1OM1A 4PV0A 4CEGA 3HNGA 2XBAA 1H08A 3L8VA 4IM3A 1OBDA 3IW4A 3AG9A 4CMTA 3ATSA 3I6WA 4M69B 2IW6A 5IEXA 3PSCA 4HW7A 3FLSA 1SM2A 4FKQA 3LLAA 1ZY5A 4CMUA 1U54A 4Q9ZA 2J2IB 3GT8A 2W99B 3OTUA 2H9VA 5HNIX 2IW9A 1WBTA 3ZFYA 3EFKA 3GFEA 1JOWB 4I5PA 1IAJA 3MPTA 4R7IA 4UYAA 3QTIA 5CYIA 5AR8A 2XRUA 4EQMA 3ZFXA 4AN9A 2JKOA 1H0WA 4D4SA 2Z2WA 4PTCA 3Q9WA 3R7UA 5IDPA 3JUHA 3FZ1A 4EOMA 1YXUA 3PA5A 3CIKA 3RVGA 2BRMA 1FOTA 3W2OA 1M2RA 2YERA 5EHOA 5GJFA 4LQMA 3U6JA 4R3RA 3D7ZA 3AD4A 3RALA 2F4JA 2LAVA 1UU3A 3CE3A 4YPSA 2QNJA 4DBXA 5EHLA 3P78A 2R5TA 2P2HA 4X6RA 1REKA 2X0GA 5ICPA 4RIWA 1BI8A 1FMOE 3QQJA 2EXEA 4F6WA 2R3OA 4Z3VA 5AUUA 4FSNA 3IK3A 4IZYA 2BZIB 2WHBA 4I93A 2WOUA 2YLFA 3QALE 3ZM9A 2XP2A 2XKEA 5FP6A 3UPXA 4AAAA 2YACA 4U97A 4O7VA 2CCIA 5TKDA 3FEGA 3MYGA 3R7GA 5CU0A 3IW8A 1TVOA 5LCKA 3QFVA 3R9RA 3NSZA 1I09A 4EJNA 4IQ6A 4IZ7A 4F65A 4IX3A 3PUPA 4FUXA 5K0XA 1UNLA 1BYGA 3LOKA 2E9OA 4JQ7A 2XK7A 5C1QB 3KXZA 4RX8A 2G01A 4H1JA 3R0TA 1YKRA 2BILB 3DXPA 2BDFA 2PTKA 3CQEA 1V0BA 3EFJA 4EYMA 3WE8A 5A14A 3BQCA 3MFRA 4EK5A 1GIHA 3KC3A 3RPRA 3NGAA 1MP8A 2UUEA 4IW0A 4U9AA 2JEDA 1XO2B 3CJGA 4FOBA 4WKQA 4LUEA 3GQLA 5E8TA 4AF3A 5DRBA 1ZARA 2QVSE 3EMGA 5IKWA 3F6XA 4A4XA 3REPA 1JPAA 2BKZA 4X3JA 3R8UA 2OJJA 3QXPA 4AOJA 3KQ7A 4GSBA 2OLCA 4R5YA 3DBFA 5J5SA 1K3AA 2C3LA 3IKAA 5HE3A 4CQGA 4PRJA 3SLSA 5LMKA 1YW2A 4EQUA 4KS7A 4RIXA 5CXZA 2G15A 4L43A 3UQFA 3MTLA 5D10A 4FTNA 3O7LD 5EDPA 4G5JA 4XYFA 3DDPA 3QKLA 3NUAA 3LPBA 4ANNA 1W82A 4YSMA 3W1FA 4EH9A 5M09A 1Q99A 4BL1A 2DS1A 2XK6A 2YDJA 4WT6A 3UG1A 3HZTA 4PPAA 3DB6A 4I0TA 4F1TA 4U80A 5B2MA 3CTHA 3P5KA 4DFBA 4E4MA 4GK3A 4FKTA 5CI6A 1Y8YA 3R8MA 3D94A 4UN0C 3UBDA 4F70A 1YXSA 3A4PA 4ZTLA 3OWKA 3W18A 2C0IA 3LJ1A 4O0WA 5A46A 5JMSA 4GKIA 4MXOA 3PJCA 3FMDA 3ROCA 3O96A 2XYNA 3R28A 4YJNA 5DVRA 4ZK5A 1UU7A 3SAYA 2QLQA 4ZLZA 3KKVA 2VNWA 2B52A 2W1EA 2YAAA 3F7ZA 5FXSA 4AP7A 4X7QA 1B6CB 4MEDA 1U54B 2JAVA 5K4IA 5M53A 2PSQA 3PIXA 4FKRA 4YTFA 1M2QA 1U4DA 1UU8A 4AQCA 2R3RA 4D2WA 3JY9A 1DI9A 3RP9A 5CANA 5C4LA 4U79A 1OPLA 4R1YA 3DCVA 5IQBA 4HJOA 3RKBA 4WG4A 2HWPA 3KF7A 4FC0A 5BVWA 5J9LA 1Q24A 3VS6A 2WTVA 4USEA 4EOIA 4E4NA 2Y9QA 4FV7A 2HY81 4QQ5A 4WNMA 2I0EA 1SVHA 4KSQA 1KV1A 2I0HA 5A9UA 4GU9A 4BZDA 4O27B 2XNGA 4FX3A 2BUJA 1ATPE 4HNIA 2ITZA 1Y91A 2IO6A 3H0ZA 4CTCA 2ITWA 5HX8A 4DTBA 2YCSA 2X9FA 3NYXA 5IISA 5JQ5A 4MHAA 3ZS5A 4O6LA 4BDAA 2R3HA 2YM6A 4H1MA 4ACHA 5HIBA 2YISA 2Y6OA 1UNGA 2XRWA 4G2FA 4TYJA 3R8ZA 5IQAA 4GFGA 3N51A 4U7ZA 2PVJA 4F9CA 2J6MA 4XBRA 4ZZNA 3EZRA 4J95A 4X21A 5FEQA 5KMOA 2OJIA 2JDVA 3C9WA 3BYUA 3QTRA 4JAJA 4CVAA 5L6WL 2Z7QA 4QMQA 3I1AA 4OTFA 4FKUA 4FG8A 2WKMA 3HDNA 2BCJA 3M11A 5BVOA 2CNUA 4JX3A 5HX6A 3F2NA 4JQ8A 4JG7A 1H24A 4GT4A 1ND4A 3Q4TA 4YSJA 2I6LA 4J8NA 2HXQA 3EH9A 3DKOA 2CGVA 3PIZA 4O22A 2CN8A 3FY0A 2HIWA 2J50A 4AGWA 3JXWA 4EZ5A 2O5KA 4FT3A 4YTHA 5I0BA 3OS3A 2UZNA 3BWJA 4IVBA 3BE9A 1OL1A 4ZY4A 3SOAA 5HO7A 4FEQA 3LIJA 3MV5A 5AAEA 3EB0A 4FTKA 4NM0A 4WA9A 3NMUF 4PMTA 4EZ3A 4FTAA 1ZYCA 3GC0A 1H1RA 3LFAA 5E8VA 3RZBA 2H34A 3KEXA 4BVUA 4BTMA 3ORXA 3PXKA 1FMKA 3KCKA 2JFLA 2WAJA 3KRXA 4RZWA 3NVKI 2YCQA 1HCKA 1W0XC 3DDQA 3VIDA 3ELJA 3QA8A 2QOIA 3PZHA 4D1XA 4FK6A 4WD5A 2XKCA 2OIQA 4CXAA 4RIXB 2BAQA 3C4ZA 3UC3A 2PVMA 4ZXTA 2R3FA 3UO4A 3UOLA 3F2RA 3LFDA 3GCPA 3HMMA 4RLKA 5JRSA 2BKKA 3RGFA 4ENXA 3BGZA 4TN6A 4Y46A 4TW9A 4DGOA 5IH6A 2HOGA 3BLRA 4M14A 5JT2A 4EOLA 4EUTA 2VWUA 2WMTA 2OJFE 2VD5A 3C7QA 3VBXA 3AMAA 5DR2A 2VWWA 2WIPA 2WMXA 4DEAA 4DH7A 3O8PA 5GJDA 1OIUA 4GK2A 1OKVA 4QMVA 3AC5A 1PYXA 4BTKA 3ANRA 1Q3WA 3CQUA 5A6OA 2I0YA 5M4FA 2WQNA 4XX9A 4JIAA 4EH5A 2ZMDA 2ZV8A 3DQWA 3EHAA 3OZ6A 5HBHA 5J8IA 3VAPA 4AACA 5CEKA 4IFGA 1OL7A 5I9WA 2ZM4A 2C3IB 1R0EA 3AGLA 5FM2A 3ACKA 4KKEA 3OCGA 4O7LA 1OBGA 3ZDIA 5DT0A 1PF8A 5IZFA 3MH0A 3BV2A 3HUBA 3T3UA 1TKIA 4OGRA 3RZFA 4BZOA 2XF0A 3UJGA 4UMQA 3ENMA 4YLJA 4IAZA 5EOLA 4U42A 2VWYA 2JFMA 2WMUA 3EQGA 3TKIA 1VR2A 3PY3A 2FB8A 4CFFA 5AADA 5IH4A 4N6ZA 4G3EA 3ZC5A 2JIIA 2XM9A 5LVNA 2QU6A 2C0OA 2E9UA 5TT7A 3R04A 4ANBA 3QUEA 4B7TA 1ZMWA 4DLIA 3WF7A 2W7XA 4AT5A 2WMBA 3CPBA 1YI6A 5L2QA 3OFMA 3G9LX 5IF1A 1PHKA 2W1GA 3POOA 3EL8A 4NTSA 4O2ZA 5IQFA 3A4OX 2B1PA 1PW2A 4OAUC 2P4IA 2GFSA 5GZ8A 1NT2A 1YDSE 2I0VA 2RGPA 2JITA 1OB3A 2WIHA 3DAKA 3FYKX 4HYIA 4KRCA 4BF2A 4O0UA 5J5TA 3U55A 4DFLA 5EQYA 3POZA 2PVLA 2UW6A 3MSSA 3N4TA 3TNWA 1W8CA 4G3GA 4UX9A 4RFYA 3QTSA 4J53A 3PPZA 1H25A 5KMMA 4I24A 4FNXA 3IECA 3LCOA 4JDHA 4L7FA 1WBSA 3PFQA 4RT7A 3R9OA 1RW8A 3UE4A 4HVDA 4X2GA 4O86A 1OIRA 3PY0A 5HEZA 3ZSGA 4DG3E 3GCQA 3QHWA 4D2TA 3KULA 4BKJA 1V1KA 4DFYA 4W4XA 4BGQA 2UW3A 2XMYA 4UEUA 3FI2A 3NIZA 1Q97A 4XP2A 3CR0A 5FTOA 2BDJA 3E64A 3NW5A 4NM3A 4MWIA 5E91A 3SQQA 2IJMA 4DINA 2OKRA 4XMOA 4FVPA 3MDYA 2W0JA 4I21A 2VTJA 4E5WA 4F9AA 4LMUA 2XKFA 4PL5A 3PP0A 1GNGA 5HKMA 2Y4IB 1Q4LA 3QQLA 3TI1A 4RWKA 2ETMA 5B0XA 3I81A 4F7LA 3ORPA 3WF9A 3R1NA 5EI8A 1O6YA 2XEYA 2Z7LA 5CF8A 2UZVA 2PHKA 2Z02A 2PUUA 1VJYA 3KXMA 2OXYA 5B2LA 5I9XA 2X7OA 4YO6A 2F49A 4OTPA 1LR4A 2QOBA 3PXQA 2C3KA 3NAYA 4V04A 2W1ZA 4G17A 4CRLA 2ZOQA 2BTSA 3HRCA 4PP9A 1PXIA 3PJ3A 4QP2A 3LFBA 4TYIA 5CQWA 2UVXA 4M97A 2CNVA 3KFAA 3KB7A 1ZOEA 3FC1X 3TEIA 5IA2A 1O6KA 4S32A 2F2UA 3PXFA 3FXWA 4KA3A 4C62A 4ORKA 2YAKA 4C37A 1GIJA 4L53A 3C4EA 4P4CA 3QGWA 3M1SA 3ZEWA 4U45A 3BWFA 4LI5A 3FWQA 4E6CA 4LL5A 3Q6WA 5AUYA 1OPJA 3BLHA 4H3BA 5CXHA 3F9NA 4FIJA 3HLLA 1CKIA 1IG1A 3W55A 5JGAA 3GXLA 4YR8A 4RLLA 1XH8A 1XKKA 3UP2A 5EW9A 4NK9A 5A54A 4FT9A 3JYAA 3QCXA 4H36A 4L01A 5C26A 3OTVA 4L6QA 3H3CA 1JLUE 2GTNA 3F66A 4FKPA 3OWJA 2G2IA 4Y83A 1NXKA 2CHLA 4BCGA 3V3VA 5TR6A 4CTBA 3CXWA 1XH5A 1V0OA 3AC1A 5AV0A 5BVFA 1J1CA 3AC8A 3HV3A 3QKKA 5FG8A 4TYGA 5AUVA 3A62A 3LE6A 2AC5A 2Y7JA 3HDMA 3Q6UA 5BUEA 4OTDA 4PQNA 4RX5A 3VHEA 5AA8A 4DEEA 3TXOA 3JY0A 4CYIA 4XJ0A 2C47A 4WNOA 4YJSA 5E7RA 2C6MA 1Q41A 1S9IA 3R7OA 1NW1A 4YZ9A 2R3KA 3IW5A 4CG8A 5KBQA 3PRFA 4ZMEA 2XYUA 4MCVA 2VWXA 3QL8A 5LOHA 4ZJJA 4GVAA 4NKAA 2C6KA 5EYDA 4NSTA 3ZONA 1PXOA 3BGPA 4EL9A 1JBPE 3FZPA 3WZEA 3S00A 3BU5A 4O7NA 5AP3A 2ITXA 1K9AA 3MVHA 4O0YA 5CENA 4AN2A 4C38A 3DTWA 4WG3A 4R7HA 2WTIA 2PK9A 4K2RA 4F0FA 4J8MA 4UXLA 4EK3A 3NCGA 3V8TA 3LW0A 4O0XA 5M4UA 5FUTA 3S4QA 4AUAA 2V62A 3K5VA 3RPOA 4FEUA 3P23A 3GP0A 4FGBA 5TF9A 4FSRA 5D7VA 3R9NA 2BZKB 2W4KA 4I6QA 5FXRA 3HAVA 2VTMA 3SRVA 1T46A 2F7ZE 4MBJA 4O21A 5EKNA 5LVOA 1H01A 4MQ2A 2ZV2A 4AZEA 2YM3A 5JGBA 3BEGA 4K8AA 2VWBA 2WTWA 4J52A 3KULB 4TRLA 4YURA 2GS2A 4YJPA 1Y8GA 4YNEA 4WNKA 4F09A 1KSWA 5C8NA 2YM8A 3B8RA 5H8BA 4IVDA 4DEHA 3U6IA 3DPKA 4ZSAA 2Q83A 2F7XE 3DV3A 3WI6A 3ETAA 2O3PA 2OFVA 3UOKA 2VTIA 2VO0A 4M68A 4TYEA 1Z9XA 2B4SB 5DGZA 2V5QA 5BVKA 3VQHA 1WAKA 5BQ0A 4EH7A 3DU8A 4OTHA 4R6VA 3NLBA 3PPKA 3PYYA 4V01A 3TKUA 4Z9LA 5IUIA 3W2RA 1H4LA 4YBKA 4GIIA 2PUPA 3VS0A 5ANJA 3NNVA 4TZRA 1XHAA 3VRYA 3LFFA 3R1SA 5TO8A 4UBAA 3WE4A 1R3CA 3LXKA 4P5ZA 5EK7A 4KIOA 4FSWA 4DG2E 3QKMA 4QNAA 3FLZA 1XBAA 4HCTA 5E8SA 3UVQA 3W33A 3IDCA 4BDGA 4D4YA 3PTGA 3F5PA 3HUCA 4FSYA 4FV0A 3ORIA 3OT3A 4BCMA 2YZAA 2OH0E 4PDYA 3H0YA 4QMNA 3H4JA 3L9PA 2I1MA 3EOCA 3AGMA 3QQHA 4W4WA 1RJBA 2ITUA 4JVGA 4KB8A 4RQVA 2UW0A 2YIXA 3B2TA 4TXCA 1TQIA 4APCA 4BCHA 4FEVA 3VUDA 3QHRA 5BX0A 5ITAA 3EKKA 5EFQA 3EQRA 1YWRA 3R7EA 3QAME 4V05A 1QPCA 1UU9A 2JAMA 3FI4A 2R3PA 4FTTA 5AEPA 2Y4PA 4G31A 3VUGA 1FVTA 5F94A 3LCTA 3IGOA 4C4IA 3E87A 4C02A 3W2PA 3BHVA 2A2AA 2ITTA 5GHVA 3Q53A 4O0SA 4GMYA 4IAKA 4CKJA 3COKA 4R8QA 4MF1A 3KN5A 5C8KA 3FLQA 5CEOA 3UO5A 5EDRA 1ZRZA 4IMYA 1NY3A 3ID6C 4GJ3A 3S1HA 5EG3A 5L3AA 4JNWA 5TOZA 5KCVA 5I3OA 2VGOA 4YC6A 3KXXA 1KE9A 2OW3A 4N0SA 2OF2A 3SXSA 4FZDB 3DK3A 5DI1A 5DE2A 2VTQA 4GV1A 4TPTA 1OUYA 2CPKE 5HE1A 3COHA 4YJOA 3U4UA 1ZYDA 3I5ZA 4D0XA 3RAIA 4L3LA 4HVGA 2E2BA 3R00A 4QYHA 2YIQA 4GT5A 1GZOA 3IG7A 3OD6X 4O6EA 2ZAZA 2FUMA 4XP0A 5C4KA 3K54A 3ENHA 3PSDA 4C4EA 3ZC6A 4A9RA 4DEDA 1DS5A 4PDPA 4IVAA 3WIGA 3Q32A 3ZU7A 3FQEA 3SW4A 2Z8CA 4IZAA 2QOOA 4EQCA 4GK4A 5KHXA 3I7CA 2A0CX 3IW6A 4TKSA 4EWHA 4FTRA 5E8WA 4F63A 2PWLA 5CEPA 2FSLX 4BWPA 1URCA 5AP7A 4JDIA 1JVPP 2X2KA 3GB2A 4E4LA 3UIXA 5E92A 4RWLA 4G3FA 2BRNA 2QOHA 2HW7A 3QD2B 5FP5A 4XOYA 3HV6A 3DKGA 4Y5QA 3S3IA 4CFVA 5CAUA 4O7YA 3SRVB 4IWPA 4FODA 3I60A 3H9RA 3HL7A 1A9UA 2PZ5A 4EOSA 3COIA 5KO1A 2YLEA 5AAFA 2SRCA 3RHXA 3QZHA 3FBVA 4EHEA 2B9JA 4FKWA 5CU3A 1SVEA 4FI1A 4AW0A 4KBCA 3SC1A 2XS0A
chains in the Genus database with same CATH superfamily
4C3RA 2XNBA 1M17A 5M44A 2PVYA 4PNKA 3HRFA 2CMWA 3ZRLA 3ZMMA 2XBJA 4C3PA 4IB3A 3R73A 4DT8A 3BHUA 5H3QA 4CRSA 3E7OA 4RIOA 3ZUVA 3VS4A 5LMKC 4EH2A 3SG9A 4MVFA 4DHIB 4CFUA 3AQVA 2A1AB 3QRKA 3QD4A 4AU8A 2WQEA 2YEXA 4OW8A 5HTBA 1KE8A 5K9IA 1J3HA 4H3QA 4K9YA 4YJRA 4GG7A 3UVPA 2UZEA 4FEXA 4KAOA 2CKPA 4J98A 2G1TA 4O4DA 3BHYA 5FDPA 2PMLX 2X7FA 3A8WA 2C0TA 4ZTQA 1UKIA 5JFWA 2XH5A 5BUIA 2JBOA 2XNOA 3OXIA 3LQ3A 4E5BA 3NCZA 4L45A 4PPCA 4YHFA 5HNGA 4EK6A 2YJSA 4ERWA 4O91A 1QL6A 4GJ2A 4CFWA 2X8IA 4HZRA 5ANDA 3UQCA 2YFXA 3VQUA 2JKKA 5L4QA 3DKFA 2PZYA 5HESA 4CZUA 3ORNA 2YWPA 3I0OA 5DWRA 3IW7A 3TCPA 3MA3A 4E73A 2IVVA 5CVHA 4IIRA 4KABA 3U87A 4C58A 5L2TA 2XK9A 4Y95A 2X6EA 4MXYA 2BAKA 1JNKA 2B54A 3AD5A 4X6QC 2GCDA 4AX8A 2NPQA 2J0MB 1TQPA 4RJ4A 1NVSA 4G1WA 2EXMA 4ZLOA 3ML1A 1AD5A 2ITPA 5CAQA 4IM2A 4D1ZA 4QYEA 4CCUA 1OL5A 4QP3A 1OKWA 3E8DA 4XV9A 4LOPA 1O6LA 5BVDA 3DFAA 4DAWA 5AV4A 1E9HA 4CGAA 3C0HA 4DEBA 2BVAA 4QP9A 3R21A 4PDOA 5AUXA 2C6DA 4MAOA 4BDCA 5EYMA 2BTRA 4RJ5A 1FVVA 5EQPA 5IG1A 4L46A 3ZOSA 2VAGA 3PLAE 4L9IA 3TG1A 2GU8A 2O65A 2ZV9A 4XHKB 2PVNA 3D9VA 1QPDA 2ERZE 3DY7A 3GC7A 4IANA 1XMMA 2CKOA 3C51A 3VUIA 2WB8A 4H58A 5CS6A 4R78A 3VF9A 2GS6A 3ZXTA 1PKGA 4HNFA 4O83A 5C01A 4MTAA 1PXMA 2OZOA 3FAAA 4DFXE 2H96A 2WMQA 2OWBA 4I0SA 4ZTRA 3LZBA 4GFOA 1H26A 4HOKA 2CGUA 3I4BA 3BPRA 5K0KA 4YNOA 1FGIA 2UW4A 4XG2A 2EXCX 2IN6A 5A3XA 3SXFA 4CG9A 3MVLA 2HELA 4R77A 2JDSA 1XWSA 4K6ZA 1MRVA 4PY1A 3WZJA 1ST0A 3DXQA 3C5UA 3NYOA 5DBXA 4WRSA 3Q96A 3HKOA 3FZOA 2WQBA 3ZM4A 2GS7A 2C6TA 5ETAA 3RCDA 2Y4IC 2X2LA 2PVHA 4QP7A 5FGKA 2XCHA 3RK9A 3NFGB 1MQ4A 5DG5A 3R7VA 4I4EA 4ALVA 4FKJA 3PJ1A 2XM8A 4RA4A 3DQXA 1WBWA 5DT4A 3FMHA 1P2AA 5EKOA 2FO0A 2PZRA 3QQFA 5ANGA 3TIYA 3UODA 4A9TA 4D1SA 3FHIA 3GUBA 4PL4A 4U44A 4QYFA 4BI1A 3UNKA 3RNIA 4NH1A 3JR1A 4KIQA 4BDFA 4DT9A 2C6OA 2ITNA 2PMIA 4HGEA 4QMOA 3MPAA 3W8LA 4EC8A 2RFDA 4IWDA 5C9CA 3AD6A 4G16A 3V5WA 2AEGA 3U9CA 5JH6A 4F6SA 5FRIA 3QD3A 3BBTB 2J51A 3II5A 2X4ZA 5CQUA 3RM6A 2B9HA 3JVSA 4GCJA 2VGPA 4ITHA 5AAGA 4J96A 3MH1A 4FZAB 3GNIB 4X3FA 3TZ9A 2X2MA 3OF0A 4U3YA 5DNRA 4XG8A 1I44A 1NVQA 2LGCA 3G15A 4F7NA 1W7HA 5JK3A 2BROA 3PE1A 3ZRMA 1SVGA 4M66A 3OVVA 4UWBA 4FBXA 1ZZ2A 4BCQA 4D5HA 3DBCA 4BWXA 3FMJA 2VRXA 4BZNA 2YM7A 4RSSA 1JSUA 5IQDA 4O7RA 5AR7A 5DOSA 4OAVB 5CF4A 1CKPA 4QMPA 5KHWA 3GU5A 4YBJA 4ACGA 4FKGA 2YA9A 3ODZX 2CLXA 5LVMA 4LUDA 5D12A 3L8SA 3E8CA 3BCEA 1W98A 4ZY5A 3HAMA 3FUPA 4RIYA 4PP7A 4DEIA 5IMEA 3EYGA 3V6SA 1PKDA 3P5JC 5FLFA 2W9FB 4XH6A 2VO7A 5HBEA 5HICA 3P7BA 4L52A 5I9UA 4AZVA 1IA9A 2JGZA 2RFEA 1R78A 3H9FA 4RG0A 5LARA 4CMOA 3PXYA 4O96A 4IAFA 1PXNA 3K3JA 1OKZA 4GUEA 1ERKA 4Y85A 3UDSA 3FQHA 1OIQA 2ZVAA 4WNPA 5L8KA 3HX4A 3P4KA 1JKSA 2WQMA 1NVRA 4RC4A 5E8ZA 3BYSA 3R83A 3Q4UA 5HE2A 2PE1A 2CKQA 4MNEA 4XG4A 5DR9A 1OKYA 3UYTA 4B0GA 2HZIA 4M13A 2RIOA 3D83A 1YXVA 4O0RA 3FI8A 1BLXA 3O2MA 3V6RA 4G6OA 2WEVA 2W4JA 3W2CA 4L67A 3IO7A 4WSQA 3RNYA 2W1DA 3VBWA 4BCFA 3UDBA 2XK8A 2WTCA 3PJ2A 3T9TA 3KVXA 4HCVA 5HTIA 5IPJA 2GQSA 4MD7E 3QCSA 5F4NA 3G51A 3BQRA 4O2PA 4FV4A 2QQ7A 2VTNA 4IAYA 2EUFB 5M51A 4FL3A 3EL7A 4AN3A 1K2PA 3HP2A 3S0OA 2OXDA 2HYYA 4BICA 4ITJA 3HMNA 4XG9A 3AC4A 3FMKA 3ORTA 3NEWA 4P90A 2GHLA 4RIWB 4L00A 2RG6A 4EH6A 4M8TA 4RVKA 4ANQA 1Q8TA 3PPJA 4C33A 4EWQA 3ZEPA 4QMYA 3ZLWA 2QOLA 4X0MA 1GOLA 2F57A 2XK4A 5DEYA 1IA8A 3ZXZA 4IEBA 4FL2A 3PSBA 5DMZA 4WBOA 5HVJA 3A8XA 4RWJA 1OITA 3LCSA 5EM8A 3SKCA 1OMWA 3LCKA 2YIYA 3A7GA 5E8UA 3MWUA 5CZIA 5E1SA 4NJ3A 2O2UA 3S95A 2WMWA 5J9YA 5LVPA 3KU2A 3G6GA 3U51A 4K18A 4NL0A 3CS9A 4BDEA 4XG7A 4ZJIA 4USFA 4CLIA 4DH5A 5KMKA 3HA6A 3FHRA 1MQBA 3JPVA 4FGRA 3FYJX 4GYGA 1LUFA 3E8NA 3NPCA 4FT5A 4LL0A 4D55A 1UA2A 3DBQA 4GW8A 4UYNA 5EW8A 2Z60A 2VUWA 3FC2A 3PWDA 3O7LB 1ZMUA 4ZTHA 4OBQA 2VX0A 3EKNA 3ATTA 3D2IA 4FKOA 5H9BA 3TJDA 4O4EA 3DOGA 2PL0A 3UMXA 2X6DA 4X3FB 3V5TA 4E6DA 3UOJA 1REJA 5HLPA 5DA3A 3EN6A 4QQTA 2WZJA 2JIVA 4LRKA 4F7SA 2R2PA 5CAOA 1YDRE 4QMMA 3EQBA 3EWHA 2QURA 2O0UA 3V01A 4I0RA 4UWYA 3C4XA 3OUNB 3GC9A 4S30A 2F9GA 4M15A 4C57A 3F5XA 4RJ8A 5C8MA 5GINE 3OWPA 4YZMA 3WIKA 5K5XA 1OL2A 2GHMA 4TYHA 4YUQA 3P0MA 2UW8A 1JKTA 2CN5A 3C50A 4D2VA 2OBJA 4IAAA 1Q61A 2XCKA 4NT4A 3CTQA 5DT3A 5HTCA 2W17A 2ACXA 4BHNA 5EI6A 3FMNA 3QTWA 1BI7A 3MI9A 2G2FA 4RIYB 3KY2A 3LHJA 3FXXA 4F99A 3VONA 4C2VA 2ETKA 1XBBA 4RX7A 4AT3A 3H9OA 5HORA 4FV1A 5HZNA 5DLSA 1DAYA 2VNYA 3R9HA 5DHJA 5D1JA 1YI4A 3FZRA 5FM3A 2R3QA 3QUDA 4OTRA 4HVIA 3H30A 3KXNA 2E9VA 2FSMX 5EQEA 3HVCA 2QO7A 3GU4A 2CDZA 3TIZA 2XZSA 3QRTA 2B9IA 5CZHA 3PE2A 4DDIA 4FTCA 3OCBA 5BVNA 2ZB0A 4TT7A 5CT0A 4DTAA 3TZ8A 3ZFMA 4ANOA 4DTKA 2OIBA 3W0OA 4GKHA 3R22A 3ZDUA 3QUPA 4FMQA 4XBUA 5HLNA 4MNEB 1IASA 4UXQA 4BI0A 4DGGA 2EWAA 4QRCA 4X2JA 2PUNA 3EJ1A 4F64A 3Q2MA 4OBPA 4OTWA 4QDVA 5DR6A 5BYYA 4XOZA 4L8MA 5ETFA 1NA7A 3QC4A 4V0GA 5CSPA 3NX8A 3OROA 4MYGA 4CD0A 4U5JA 2WGJA 4E4XA 2YDIA 3A61A 3ALNA 5HU9A 3EZVA 4O82A 3MPMA 4H39A 4F9YA 4XUFA 3Q04A 4BB4A 3FZTA 4OBOA 4E5AX 3TDVA 2I7QA 4TWPA 4DEGA 5EYCA 5AX3A 3RI1A 3UP7A 4ANLA 1TQMA 4UZDA 3LXLA 4B4LA 4MXXA 5I4NA 4I5MA 5HVKA 3NIEA 5C03A 3VF8A 5KMNA 5DFPA 4HPUE 4J1RA 3ERKA 1PXLA 4A9SA 3MB7A 1W83A 2GMXA 3QRJA 5LWNA 2QO9A 4IZ5A 5JEBA 3R6XA 4JI9A 2G2HA 3MVJA 1PXKA 1LEZA 4YJTA 2XIRA 1XH9A 5KE0A 3FV8A 3UNJA 4XG3A 1MRYA 4CT2A 4FSMA 3NVMB 4P2KA 4FV2A 2PPQA 1M7QA 1YDTE 4G9CA 4NEUA 5IA4A 4DA5A 3OXZA 2AYPA 4FNYA 4M0ZA 4C59A 4FICA 2IEWA 3QD0A 3RAHA 3HEGA 1J7IA 4AFJA 2JDTA 3EFWA 2GNFA 5FBNC 4FVRA 5CASA 3UNZA 4EHZA 5J87A 3I7BA 4ASZA 1J91A 1YXXA 4RRVA 3D4QA 4OTIA 4FA2A 4GL9A 3LCDA 2HY0A 3D14A 5HO6A 2FYSA 3KK8A 4HGLA 5HD7A 1APME 2VX1A 4FKVA 2NRUA 4FZ6A 3O5AA 3F82A 3AMBA 3WYXA 4D0WA 5L6OA 4BRXA 1VEBA 3NDMA 3QXOA 5JZNA 2EU9A 5EOBA 5F9EA 2JLDA 4MD9E 4KSPA 2OO8X 2VO6A 3OWLA 2HXLA 3HRBA 3DTCA 2W96B 4FZFB 4QTDA 3PVBA 1OL6A 3AKKA 5CNNA 5C27A 3S2PA 4FZ7A 4AW1A 4RPVA 3VBQA 4MD8E 4RFMA 3KXHA 4FSZA 2UZOA 1WVWA 2PYWA 3RAWA 4O0VA 5FEDA 5JFXA 4HYSA 4XRJA 4B9DA 2JBPA 2XJ2A 4ZJVA 4USDA 5ETIA 4R5SA 1H28A 4TYHB 5M55A 3UQGA 3FY2A 4BC6A 3R71A 4ONAA 3TDWA 3PP1A 2X7GA 3A7HA 4O4CA 3O8UA 1KOBA 2QU5A 3OXTA 4Y73A 4RJ3A 4QNYA 5BUJA 4I6BA 2JC6A 4Y8DA 4YHTA 2YABA 4LG4A 3EN7A 4UMPA 2XK3A 4R3PA 4J99A 4LGGA 4XG6A 3KK9A 3ZCLA 4JXFA 1DM2A 2BIKB 4MXZA 4DHFA 3HMIA 4YC8A 3NNWA 3TUDA 4E1ZA 4M7IA 2BFXA 2R3MA 3B8QA 4IB5A 2QLUA 5LVLA 2RG5A 3WOWA 3LFCA 2YHVA 4IVCA 1QMZA 1UNHA 1CMKE 1UV5A 3GU7A 3MH2A 3R2BA 2WTKB 2VN9A 4S34A 4YPDA 4RC3A 4KRDA 3VWAA 4BI2A 3WARA 4AWIA 1YI3A 2I40A 4RMZA 2ONLA 2QG7A 5A6NA 4HVHA 5M4IA 5AV3A 5HG8A 2GFCA 3BGQA 4AXCA 2R3LA 2YJRA 1PY5A 3OUKA 3F69A 2YZLA 4DDGA 3CY2A 1HOWA 3R01A 2IZUA 4FKIA 3V5PA 3VUKA 3MTFA 3OC1A 4I1ZA 5IUHA 4KUJA 4JOAA 2YCFA 1WBNA 4J97A 4O4FA 5CSXA 4F78A 5M07A 4J71A 5AIRA 5L8LA 3A7FA 2HW6A 2V7OA 4ANSA 4I3ZA 4O38A 4EOKA 3HV4A 3MIYA 4C36A 1FINA 2B53A 4FR4A 4LGDA 2VX3A 3R30A 3LXNA 4JQEA 4ID7A 3NAXA 3W2QA 5IQGA 4YZNA 1OI9A 2CJMA 4EONA 4N70A 3KMMA 2HCKA 2UV2A 3U4WA 5IDNA 1L8TA 2PE0A 3NUYA 5CVFA 3W8QA 3AKLA 2OU7A 3OOMA 4I92A 4KIPA 4L42A 1CM8A 3COMA 1PXJA 4A06A 3UIMA 3GVUA 4EKLA 1H27A 3GI3A 4BN1A 4JBPA 4LV7A 2C5NA 3RBWA 2BZJA 2FH9A 2GTMA 5IMXA 2ZMCA 3TUCA 5M57A 1ZMVA 3DLZA 3P7AA 3L8PA 5AUWA 4QMLA 3TTIA 4OTGA 1YRPA 2R64A 4JBVA 4NIFA 2OF4A 1ZXEA 5CI7A 3SD0A 5E9EA 3ALOA 2BDWA 5KZ0A 3DNDA 3C5IA 4FV8A 1YWVA 2QKWB 4IJ9A 1YOLA 4QPMA 5LMBA 5T68A 3NYNA 4F9WA 4D9TA 4D4VA 1YQJA 2O64A 4NUSA 3O71A 3PXRA 3OMVA 3M2WA 4IX4A 3TV7A 2Y6MA 2VTLA 2BR1A 1SZMA 2VTRA 5FBOA 5J95A 3R9DA 5IQHA 2QG5A 3HYHA 4WRGA 3VRZA 4W4YA 4BDKA 3U54A 5IA0A 3G9NA 4O1OA 2R3JA 1W84A 4AZTA 3QCQA 5B2KA 1QPJA 1ZY4A 3EN9A 4IBMA 3SDJA 5HBJA 3WF5A 4FT7A 3U9NA 4DFNA 3TTJA 4L3PA 3BEAA 4PPBA 2J0LA 1Q8UA 2P33A 1H1WA 2W1IA 4F1MA 4DITA 4R1VA 1LEWA 4D2PA 5I9ZA 2BZHB 4WHZA 1W2CA 3K5UA 3LMGA 3MY5A 4QP1A 2DYLA 4X2KA 5IUGA 4RC2A 3VUMA 4KBAA 3UG2A 4NU1A 3JVRA 2Z7RA 4N4SA 5KZIA 1B38A 3CEKA 3D5UA 3KRLA 3W2SA 3BRBA 1KE6A 4U40A 3SVVA 1M52A 2KTYA 2O63A 4LGHA 4F9BA 4MUQA 1H1PA 1B39A 4XS2A 5AUZA 1MUOA 1PYEA 4QPSA 4W9XA 2FGIA 3GBZA 3DAJA 2OFUA 3HECA 5DRDA 4DC2A 4FG7A 4BYIA 2XEZA 5LMAA 4EK4A 4BDJA 3G2FA 1M7NA 1EH4A 2C6LA 2CGWA 2WELA 4FKSA 4DCEA 5K4JA 2IW8A 3R8VA 3ORMA 4OLIA 3W0QA 3ZSHA 5H8GA 4GYIA 5L6PA 4FNWA 3QCYA 4B99A 3EQHA 3SHEA 4GU6A 4PX6A 2GDOA 1P14A 2PMNX 2RSVA 4NTTA 3E3BX 4CFNA 3BKBA 4ZY6A 4QMUA 4U6RA 1OVEA 3F2AA 2B0QA 3RAKA 5AMNA 3VW6A 1Z5MA 3V5QA 3A99A 2RFNA 3D5XA 2ESMA 1YVJA 3UZRA 1STCE 4AFEA 4O81A 3DAEA 4MH7A 2IG7A 5IEVA 5BMSA 3PVGA 4XV3A 3ZRKA 3GCVA 3E63A 3DNEA 3GU6A 1UWHA 4ASEA 1G8JA 2W4OA 2V0DA 2XNNA 1P4FA 4DE4A 3H10A 3I5NA 2W06A 4FNZA 3E93A 3AT2A 3R1YA 2C5OA 2DQ7X 3OY1A 5AM7A 2GNJA 2WTDA 3QQUA 4A4OA 3MB6A 3NUNA 3FL5A 4YTCA 4FVQA 3QC9A 4U41A 5HG5A 5M06A 3ITZA 2V55A 2OIDA 4EUUA 2JIUA 3NUSA 3F5UA 4X3FC 4C3FA 4PMPA 5L2IA 4QMSA 3KMWA 3SA0A 3NR9A 4JJRA 4E93A 4NW6A 5E90A 4DFUA 4DYMA 3CBLA 3UDZA 3PXZA 2OJGA 4QTCA 1Z57A 2XUUA 5CTPA 1G3NA 5E4HA 3TKHA 5TE0A 3FMLA 4A9YA 2C3JA 2QR8A 2JDOA 3CKWA 4NIFB 4G3CA 4FYOA 5CWZA 2VWIA 3NUXA 3WBLA 2GQRA 4NFNA 5GIOE 4HZSA 2RL5A 4Q2AA 1E1VA 2QD9A 4OUCA 3SV0A 2X0OA 4HGSA 4G6LA 3D2KA 2A4LA 1E1XA 4PUZA 5BPYA 3TYKA 4QOXA 1M14A 3IS5A 4MWHA 5F20A 4GIHA 4XNEA 3Q2JA 4EYJA 4I6FA 4O0TA 4Y72A 3F3WA 4C35A 2W5AA 2IVTA 4EHGA 5A4TA 3C0IA 4TNDA 1A06A 3OCSA 3DB8A 3FDNA 2C1BA 1Q62A 2VTAA 4N57A 4GT3A 4RVTA 4ZZOA 4BTJA 4C4FA 1KE5A 2PULA 1KV2A 4M84A 5HLWA 4QTEA 3TT0A 5KUPA 2AUHA 4FKLA 4JBOA 3TNHA 1WBOA 3QZFA 4M12A 4ACMA 2ZM1A 3ZYAA 3P1AA 4GS6A 4QYGA 5HG7A 4ZP5A 3FLYA 3N9XA 3RPYA 1XMLA 3ZSIA 3E62A 1U59A 2IPXA 5LQFA 1LP4A 2WMSA 3DK7A 5HOAA 3LVPA 4CV8A 4II5A 3I6UA 3UC4A 3CD8A 5GZ9A 2IVUA 3AT3A 4AGCA 4CLJA 2IVSA 5KMIA 4QQJA 3ACJA 3RHKA 3VJNA 2W9ZB 3FPQA 4EOQA 4I20A 4YGAA 3BYMA 4K33A 5FD2A 1JAMA 4BIBA 4CZYB 3LJ0A 5IQIA 4QMWA 4DHJA 3VBTA 4N6YA 2XNMA 5KBRA 3OT8A 5CVGA 5CLPA 4BDBA 3TNPC 2AC3A 3W10A 5CNOA 3LJ2A 5FTGA 3MGYA 4C61A 5I3RA 4UMUA 5CF5A 4E6AA 2NRYA 4U43A 1BUHA 4NYEA 2OICA 5HCZA 4A9UA 2PZIA 4DCAA 2X9EA 4E26A 1JWHA 5IA5A 4ZMFA 3O0GA 3QTZA 3VNTA 2F7EE 4BY9E 4OR5A 4U0IA 1J7UA 4XLIA 4Q5EA 5BYLA 2VTSA 1KWPA 1L3RE 4UY9A 5AFVA 4W4VA 3VO3A 4WUNA 4OTQA 2UZWE 4GRBA 2W5BA 3PIYA 4EJ7A 2E9PA 4JRVA 3DK6A 1VYWA 3LFSA 4EZ7A 2JKQA 4DH1A 2NP8A 3OW3A 4M3QA 2NO3A 2WMVA 4J7BA 2UZBA 3CJFA 4QPAA 4S33A 3LXPA 3BE2A 5AP6A 4B8LA 5CAPA 4TY1A 2QC6A 3ODYX 3TNQB 4FV9A 5AUTA 4ZAUA 3UTOA 5FEEA 4BKYA 4F0GA 1BL7A 4DN5A 4ASDA 4K1BA 4EBWA 2BFYA 1H1SA 3NYVA 3U8WA 5IU2A 3EN4A 4JG8A 3AXWA 4YU2A 3KXGA 5K3YA 3GOPA 3F3TA 3UO6A 4QO9A 3ZH8A 5CU2A 1ZAOA 4IJPA 5G6VA 4YTIA 1SMHA 4EH8A 4FIGA 3NZ0A 3D15A 4Q9SA 1DI8A 3QTUA 2C4GA 2ZV7A 4RX9A 3E8EA 4G6NA 4F08A 2V7AA 1H0VA 2J7TA 4ENYA 4NCTC 4F1OA 1YWNA 4BCPA 5EH0A 2ITQA 3A7IA 3NRMA 5E8XA 4F0IA 3DT1A 4ZS4A 3QF9A 5GZAA 4DGLC 5J1WA 3FXZA 4HGTA 1OIYA 3DXNA 3MFSA 3TV6A 1WMKA 2QOQA 5AX9A 3IGGA 3ZZWA 2EB2A 4A07A 2WEIA 3LQ5A 4HYUA 4IX6A 1G8AA 1ZYLA 2CSNA 4MBLA 5CSHA 3VHKA 2QI8A 3VS7A 3R1QA 1AQ1A 2BHEA 2C6IA 3G6HA 3RPVA 1AGWA 4B8MA 4BIEA 3FL4A 4IM0A 4BGGA 3NWWA 4DFZE 5JGDA 3P08A 1Y57A 1PMVA 5AV1A 4BDDA 4HVSA 3R8LA 1XBCA 4MX9A 3EQIA 1WVXA 3C0GA 3V8SA 4WBBB 4AT4A 2JKMA 4BFMA 3NS9A 2A19B 1R1WA 4AA4A 5JKGA 4AGDA 3ET7A 2DWBA 2WTKC 4JDJA 4FL1A 4WUAA 2Y8OA 5AV2A 2CKEA 5KKRB 3G5DA 3MFTA 5AP4A 4MKCA 3Q4ZA 2OZAA 4QMTA 4YLKA 5I9YA 3CY3A 2WD1A 3RJCA 3UZPA 3LM5A 4MQ1A 5A4CA 1GJOA 5L2WA 3CGOA 4BDIA 4EH3A 5BV3A 5AR5A 2WMRA 4M67A 2GNGA 2WO6A 3FMEA 3VBYA 4G3DA 4IWQA 3VULA 3P7CA 5AM6A 1OGUA 4NFMA 1Q5KA 4F4PA 2QHNA 3CLYA 1CDKA 4AA5A 4AOTA 5HCXA 3IPHA 2V22A 4APPA 4E20A 2XIZA 2XJ0A 1JSTA 3KMUA 3ORLA 2QOFA 3PVWA 1X8BA 4I6HA 5EYKA 3THBA 4AOIA 4IC8A 4IE9A 5AA9A 3RWPA 5JFVA 1FPUA 4BBMA 4YO4A 3FZSA 3IQ7A 5D41A 1W2FA 3CD3A 3QQKA 2YN8A 4TWCA 3BYOA 4FTOA 4NJDA 3RINA 2Q0NA 2QR7A 1YXTA 4I41A 2J4ZA 4FTUA 4IDTA 4UZHA 4AGUA 3QWJA 3NNUA 5HO8A 4ERKA 4RGJA 3RCJA 3CSVA 3C4CA 2PVKA 4UMRA 2W1CA 3LFEA 3E92A 4E3CA 2OG8A 3V8WA 1FQ1B 4P5QA 3PG3A 4QP6A 3V51A 3B2WA 5M08A 5D11A 4UV0A 4EI4A 5ETCA 4C7TA 3BBWA 3PLSA 4C2WA 2R3NA 5KX8A 3ORZA 1H1QA 3QYWA 4I5HA 5FTQA 3IOKA 4CQEA 5HQ0A 1UWJA 4LV8A 3T3VA 5LCJA 4AZFA 5CEIA 5L2SA 4K0YA 3F61A 4JRNA 3KRRA 3KVWA 4ZSEA 3KREA 2XA4A 2DUVA 3BYVA 3R7IA 1GZKA 2X4FA 3MJ2A 4EC9A 5AIKA 5L8JA 4XV1A 1QPEA 2CCHA 4FIHA 4PTGA 4FSQA 2X81A 3P79A 5CU4A 4S2ZA 4ZTNA 3HV5A 4DBNA 2NNWB 4IAIA 3GC8A 4TTHB 3FKOA 3EYHA 3HP5A 2HZ0A 3Q3BA 4PL3A 5DIAA 4CFMA 4DGMA 3RMFA 3SXRA 4PF4A 3FQSA 1Q8ZA 1LPUA 1BMKA 1WVYA 4X2FA 4XCUA 2NYAA 1U5RA 3LKMA 1ZOHA 4JX7A 3R7YA 5BYZA 3RM7A 2UZTA 4YMJA 2J0KA 4E8AA 5BNJA 2IZTA 5AJQA 3FPMA 4CNHA 4O7TA 4EBVA 3IDBA 1HCLA 3MVMA 2HK5A 2XIKA 3UMWA 4NCTA 2YWVA 5IQCA 3V5LA 4DF3A 2O8YA 2CNQA 5LXMA 4FV6A 3O17A 5DN3A 4LDTA 3BV3A 3MA6A 3W0PA 3BU6A 4BYJA 2OH4A 3FLNC 4NWMA 4CFXA 3LAUA 2UZDA 2HWOA 4QYYA 4QMXA 4DGNA 5EM5A 5GIPE 2FVDA 2E9NA 5F95A 4I94A 4E7WA 1DAWA 3L8XA 5J7HA 3QGYA 3I79A 2QOCA 2HENA 3Q5ZA 1Q3DA 2OJ9A 3LM0A 4CZTA 1ST4A 3ZLXA 3P86A 3Q9XA 2UVYA 2ERKA 2P2IA 3L9MA 3UGCA 4EK8A 1XH4A 1IRKA 2VTPA 3OHTA 3WF8A 2BRHA 3R2YA 4JDKA 3GGFA 2R9SA 3N4UA 2ONLC 2ITYA 3HA8A 4MNFA 2OZAB 4NKSA 2J5EA 3NW7A 1SYKA 3PY1A 5AR3A 1PMEA 2Y0AA 4L7SA 4FTMA 4FEWA 3ORKA 3D5WA 5T6KA 4QTAA 5DH3A 3KRJA 3DFCB 5HE0A 4DH8A 4QTBA 3ZO3A 4IHPA 3ZUUA 3NUPA 3VUHA 2R0IA 2BHHA 2GNHA 2KULA 3BU3A 2J9MA 4RWIA 4NM5A 2C6EA 4RA5A 1YHSA 2IZSA 5CF6A 4KWPA 3E3PA 2XIXA 1GZ8A 3Q4CA 5GNKA 3PA3A 4U3ZA 1YOMA 2YIRA 3C4FA 5ACKA 2FSTX 4IC7A 3EFLA 1WBPA 1VYZA 3F3VA 1J7LA 4RVMA 1XH6A 4D9UA 3U6HA 2QHMA 4GEOA 4YLLA 3MW1A 3PDTA 2HAKA 3HMOA 4XV2A 1PRYA 3G0FA 1H8FA 4FIFA 3QU0A 2RF9A 4AS0A 1FVRA 1J1BA 3CC6A 5LWMA 2QO2A 4G9RA 3DJ5A 4ANMA 5HIEA 5H2UA 2H8HA 3E5AA 5DYJA 4FTJA 4D58A 4FIEA 4ACCA 1ZYJA 3ZTXA 4MF0A 5HGIA 3VN9A 4CKIA 2GPHA 4M0YA 2XNEA 3ULIA 2FA2A 3EQDA 4ZOGA 4KIKA 3DBDA 2WMAA 4QP4A 5E1EA 4H05A 3UVRA