3FSFA

P38 kinase crystal structure in complex with 3-(2,6-dichloro-phenyl)-7-[4-(2-diethylamino-ethoxy)-phenylamino]-1-methyl-3,4-dihydro-1h-pyrimido[4,5-d]pyrimidin-2-one
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
340
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
total genus 108
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fsfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fsfA01
3KXNA 3TKIA 5KMLA 1Y91A 2IZUA 4X0MA 2IWIA 1P5EA 5GJFA 1P14A 2V22A 3DGKA 2VD5A 4JRVA 2C6TA 4DH3A 4Q9ZA 3KFAA 3KVWA 2R3OA 4FKTA 3ROYA 2R3RA 5G6VA 4FSZA 2WTCA 3DJ5A 3GNIB 2CDZA 2VV9A 3GOPA 4DITA 3N4VA 3DDQA 3LXKA 1BUHA 1OVEA 5ACKA 3EYGA 5EKOA 5HICA 1SZMA 4D0WA 3UGCA 1IEPA 3BIZA 4KBKA 2HZ4A 3F3TA 2OIQA 4PPCA 1SVGA 3C4ZA 3MFRA 4F6WA 1XR1A 1ZZ2A 4XHKB 5HCYA 3SOCA 4YPDA 4ZMFA 2JBOA 4Y8DA 2ITXA 2OGVA 5E8WA 5TT7A 3U9NA 2ITUA 2C4GA 3P0MA 2GNGA 4EOPA 3RCJA 4U8ZA 2QOOA 1XHAA 2WTJA 3FMNA 3ORLA 4JG8A 3UP2A 3E3BX 2VO7A 4BB4A 2YACA 4R6VA 5A54A 5HD4A 2BDFA 4ZMEA 3AC4A 5K0XA 3UVRA 5DNRA 1G8SA 3EIDA 1H1SA 5HIBA 3VS4A 3LFQA 1P4FA 2J5FA 1RJBA 1SMHA 2VWBA 4OBQA 5M06A 2R3JA 3QCQA 2PUNA 3FY2A 4WG4A 1SVEA 4NFMA 5JH6A 5C03A 4NU1A 3IKAA 2CJMA 2YN8A 3I60A 2WTIA 4ZZOA 2GTNA 1F3MC 2UW9A 3E3PA 5A14A 2PY3A 4GW8A 4DINA 2F4JA 3PVWA 3MTFA 5KCVA 3LMHA 5HGIA 4ALVA 3LLAA 2XIRA 2O64A 2QC6A 5AEPA 4NCTC 1HCKA 4QYGA 1IA8A 2QO7A 5EM7A 2H9VA 4K9YA 3KULB 4FYNA 3CR0A 3CP9A 4YJOA 2W9ZB 5HKMA 2JEDA 4FL2A 4E73A 4BCIA 4GFMA 1BLXA 3D4QA 5L8KA 4JXFA 5IQEA 5EDQA 5EYCA 3RPYA 2OJJA 2OXXA 3MIAA 4D4SA 3AT3A 4KRDA 3AD6A 2BRMA 3VW8A 1U5RA 4E26A 1PMNA 4F0IA 3PG1A 4GEOA 3SRVB 2CLXA 3DJ6A 3V8WA 4ZSGA 2NRUA 5M56A 3JVSA 3EMGA 2C5NA 2GHLA 3BCEA 1J7LA 2I40A 5CVHA 5IQAA 2W06A 2XZSA 5FP6A 4EWHA 4UWCA 4DGOA 3GCUA 2R9SA 3V8TA 3EWHA 3LXPA 3PJ1A 1M14A 2VZ6A 4NWMA 2OICA 4RFYA 4ZP5A 5C8MA 3W32A 5JGAA 2QG5A 4QYFA 4BKZA 2Z7RA 5KMKA 5J8IA 5LMKA 2C68A 2EWAA 4U45A 2VO6A 4FSQA 3PA5A 4NZWB 4ZAUA 3QRUA 3A4PA 4PL3A 5C4LA 3VW6A 2X9EA 3A8XA 3NNXA 5IMEA 2E9PA 4PDPA 3UMXA 3VN9A 2PPQA 4Z7HA 2QO2A 5AR2A 3M1SA 3NS9A 5LCJA 4M12A 2JKOA 5J79A 2J2IB 3EOCA 4NFNA 1YXXA 1ZYCA 4PNKA 3Q6WA 2GHGA 4TWNA 3FSFA 3RJCA 3O50A 4J52A 3NW5A 3VF9A 3MH0A 3E63A 4FODA 4AT4A 3BHUA 3Q60A 3EZRA 4ZY5A 3VS6A 4RIWA 5JGDA 1JWHA 2XH5A 3T3VA 2H6DA 3ZRKA 4CZYB 4D58A 4DFUA 4QT1A 2QNJA 3KU2A 2R3QA 3EQBA 4XV2A 3QTXA 1M52A 3WBLA 1JKLA 2PTKA 4IEBA 4Z9LA 4XG4A 3LZBA 4E5AX 2R3FA 2XVDA 3TJCA 5K9IA 3FL4A 3KC3A 4UXLA 2C5OA 5DBXA 5EQEA 1YI6A 3KF7A 4HYHA 2AUHA 5AIKA 3VULA 3RK9A 1OKYA 5JN2A 2ITVA 3C5IA 1NY3A 3R7VA 3PJ3A 3D2IA 5DFPA 5AX9A 1PF8A 5EI6A 4RX8A 5BVNA 5IU2A 4YPSA 3WE4A 5AUWA 1IRKA 4YJVA 1OKZA 3VQUA 2GHMA 2XEYA 3CY2A 3QQKA 5DMZA 2VTJA 3FLSA 4E4NA 4RX7A 5LVPA 4I6FA 3CQEA 4UZHA 3KK8A 4XRLA 4A06A 5AP7A 3LFFA 4YNEA 5DLSA 3FKOA 3FZTA 4AA5A 1VEBA 3ULIA 5IQDA 1H27A 5EW3A 4DEBA 4FEUA 2XNOA 4WRSA 3IECA 3TNIA 4ITJA 4WBOA 5KMIA 5M07A 4QPAA 3TV7A 5E1EA 3W10A 1ZY4A 4FKSA 4IFCA 4AE6A 4QMZA 4ZSEA 4CMTA 3BBWA 4GIHA 4O6LA 5LQFA 4FV5A 4LRMA 1PXPA 2XJ0A 2ZM1A 1PYXA 2C6IA 4F7SA 4ZJVA 2W1HA 4ANOA 2XA4A 5C27A 4EC8A 5FEQA 2W1EA 5FLFA 2PUIA 4FNWA 2A27A 4E4MA 1G3NA 1W98A 3ZDUA 4EOOA 3ZO4A 1HCLA 4RX5A 3KXGA 5LMBA 3BGQA 3IW6A 3QTSA 4IAYA 3A7GA 2RFDA 3DKFA 3NUSA 3PZEA 2B1PA 4Y72A 4J8MA 3QXOA 3DNDA 4W9XA 4YHFA 4L42A 3ZMMA 4YTFA 5AR3A 4V05A 2VWVA 4U42A 2VTMA 1UU7A 3AQVA 4Z7GA 2GNJA 5F95A 5AMNA 4JDJA 5E90A 3RZFA 3SOAA 4O7RA 2HIWA 4FKQA 5HEZA 1YHWA 2YCRA 2PULA 3EQPA 2WIHA 3IDPA 3LCTA 3KRRA 3GI3A 5HOAA 1MRVA 1XQZA 2XS0A 3QQHA 4AZVA 5K0KA 5J87A 2UZNA 3O96A 5IQCA 4J95A 2OFUA 2NRYA 2W0JA 4PMSA 2RKUA 3V51A 3B8QA 4TNBA 4YLKA 5LVLA 2QLQA 3VF8A 1YHSA 2J50A 4RX9A 3MJ2A 4HYSA 3RK5A 3G6HA 2WGJA 2WO6A 3QGWA 3D5XA 4KS7A 4V0GB 4WT6A 2CSNA 5CT0A 4DG2E 2ZOQA 3C5UA 3DAJA 4WIHA 1ZOEA 4QMWA 2YLEA 2CNQA 4EOJA 3ZXTA 5HNBA 5CXZA 4AOJA 2XK7A 4NM3A 4YC6A 3QRTA 4AXAA 4D55A 4RQKA 2BRHA 3CGOA 3PP0A 4EQCA 4J53A 5DRBA 3NDMA 5A6NA 4YNOA 5CSPA 3OUNB 3ZCLA 4QMSA 2PVNA 4FK3A 4U80A 5JFVA 3UIUA 4NTSA 1UVRA 2YCSA 1OL6A 4U6RA 1OPKA 3REPA 3PRFA 3HV4A 3PSDA 3I5NA 4RA5A 1PJKA 3H3CA 4BN1A 1H01A 1H8FA 4JQ8A 3WZEA 3P7AA 4NIFB 4BGGA 2WFYA 4RIOA 1YQJA 3HKOA 5KE0A 4FTQA 3V8SA 4D28A 4R77A 1A48A 2GQGA 4FV0A 4MWHA 4FV1A 4ERWA 3VS7A 3EQDA 4IJ9A 2ETRA 4U44A 4X3FA 4AOTA 4XBUA 4HCUA 2HK5A 4BBEA 3HGKA 3PJCA 4W4VA 5AP5A 3N51A 2WMTA 4YU2A 3PPKA 1JAMA 5F1ZA 3PIYA 4PP7A 3U6HA 2J7TA 4X2FA 3W8LA 5I3OA 4CZUA 3COHA 4YC3A 3WF5A 4O7VA 5E8XA 3KF4A 3DFCB 3UTOA 2QR7A 3ZHPC 5FUTA 2FH9A 3IDCA 5F4NA 5KX8A 2E9UA 3QKMA 4IWOA 4GFGA 3FYJX 2X1NA 4FKWA 3BLQA 3GCQA 4CG8A 1OIQA 3BELA 4QO9A 1Q41A 4FTKA 3N4UA 2G2IA 3MW1A 3WF8A 4DH7A 2JD5A 3OWLA 3PVBA 2HWPA 2C5VA 4RQVA 3TUCA 3W2OA 4EC9A 4M69A 3L1SA 1OKWA 1DM2A 5IKWA 3DXNA 3U4UA 3TTIA 3SKCA 2BRGA 3TCPA 4E6DA 1ZXEA 4FX3A 5FDXA 3TKHA 5JKGA 5DEYA 5IH4A 4P4CA 5BNJA 1PXMA 1V0OA 2QO9A 1YHVA 4ZJIA 3W2SA 3ZLWA 4CRLA 3Q53A 4K0YA 4X2JA 2OI4X 3LQ5A 4ALWA 4DEAA 5AUTA 3TV4A 1GIHA 5BYZA 3KMUA 3Q52A 3ZRLA 4ZTMA 2XIYA 3II5A 3B8RA 3VVHA 4RC4A 4B8LA 2XJ2A 4EHGA 3Q9ZA 4EH9A 3N9XA 5DR9A 2VNWA 3E87A 3EH9A 1UNLA 2G2FA 3COIA 1GZNA 2F49A 3QHRA 3UIXA 1Q8YA 3UPXA 2ERZE 1JLUE 2PK9A 4F6UA 4UYAA 3PVUA 2O0UA 4JBPA 5CSHA 4YSMA 4DFXE 2C0IA 2YM3A 3RGFA 4YZ9A 2VTLA 4BBFA 4HOKA 2ZMDA 2YM7A 4MF1A 5B0XA 5H2UA 3UVQA 2Z60A 4DF3A 1YWNA 4DEEA 3CBLA 3O23A 1PXNA 4F9AA 4K1BA 5HO6A 3NYXA 4FG8A 4BDDA 1ZARA 4BWPA 4C4HA 4U97A 3OEZA 3BX5A 4GU6A 3G33A 2NNWB 3UO5A 2VTSA 3O51A 2XMYA 3LE6A 4FKGA 4AZEA 5ANEA 2C6KA 3JVRA 1OI9A 3H4JA 3PLSA 2QCSA 4NH1A 3EKKA 4XG6A 1NT2A 2QODA 3TWJA 5DG5A 3QX2A 4BYJA 2VN9A 2BRBA 2IG7A 3RINA 4M14A 2CKPA 3KREA 5GNKA 3RNYA 2WEIA 4IVAA 3VUTA 3POZA 1ZMVA 4MQ1A 4FI1A 2BZJA 4ZLOA 4MD8E 2O63A 3MVLA 3NEWA 1XH4A 3RALA 2PU8A 2H96A 3OOGA 1ZZLA 3H9OA 2A0CX 4BZDA 4TYJA 4RJ6A 1F0QA 1PXOA 4EK3A 4EWQA 5M08A 2BIKB 2JFMA 4EHEA 3R71A 4DYMA 1FBNA 5HVYA 1ZOHA 3FL5A 5E8VA 4GS6A 3EQCA 3PE2A 4RIXA 4EOIA 5HCZA 3SG9A 4JG7A 4HGTA 1JSTA 5FRIA 4LOPA 3MVHA 4MVFA 3VS0A 3ZBFA 3FUPA 4FR4A 4TYIA 2ERKA 4ZIMA 3BLHA 4ASDA 3T8OA 5IEYA 3R7EA 1U54B 1E1XA 5M44A 5EM8A 5HLWA 2IW6A 3D0EA 5EOLA 2JKMA 2QOIA 3GGFA 4YURA 2F9GA 3K54A 4YJNA 4ANNA 3BE2A 3QHWA 2R3PA 5M09A 3SW7A 4NW6A 3G15A 2GS2A 4MX9A 4E4LA 2X4FA 3ZM9A 4II5A 3H0YA 1YWRA 3F69A 1ZRZA 5HE1A 4PTEA 2PL0A 1BMKA 4I22A 4BCMA 5JK3A 2G2HA 2XRWA 2YAAA 2AC5A 3D7ZA 4I6BA 4YHTA 3EN6A 4C0TA 4EL9A 5JQ8A 2BZKB 4AN9A 4C4JA 4FSNA 4DH8A 3FLNC 3CEKA 4BHZA 5AR5A 3RTPA 5A4EA 4MXYA 2I0VA 5HLNA 3AC1A 3AGMA 5KKRB 2JC6A 2UW0A 4YGAA 3AMYA 4GT3A 2WMVA 2JIVA 4V04A 2CGVA 3DK7A 4FNZA 2BDJA 4NJ3A 1Q8UA 4D2TA 4O38A 5E8YA 4GVAA 3COMA 4RJ3A 3ANRA 4AA0A 3RNIA 4QP4A 1YI4A 4FT3A 4GT5A 4I5CA 4WUAA 1R78A 3FV8A 2P4IA 3S95A 2HAKA 3DB6A 3R73A 4ZLYA 4EEVA 4MK0A 4RIYB 4MBIA 5J7HA 2YCQA 5HVKA 2XIZA 3MPTA 5IA5A 3LW0A 3LMGA 3G6GA 3W2PA 3IO7A 3ZLSA 2OXDA 3OT3A 4I41A 3O2MA 4JL9A 4YJRA 1BYGA 2SRCA 3QQUA 4FL1A 1MP8A 4AX8A 1ZYLA 3PRIA 4TYEA 3ZUVA 5I4NA 3U6IA 5EHLA 3I4BA 3MFSA 3RAIA 4C4GA 2BVAA 4TKSA 2IW9A 4HVGA 5C8NA 5CAPA 2O2UA 4G17A 5I5ZA 3NLBA 3DS6A 3PSCA 3QLGA 3PWYA 4ZJJA 3TG1A 5JQ5A 3FMJA 3FQHA 2QOQA 3KGAA 3F5XA 3Q5ZA 4PWNA 3MESA 2YLFA 5AP6A 1CM8A 3GC0A 3MPAA 4CXAA 5D11A 4BBMA 4OAVB 5JFWA 3HRFA 4EK8A 3BBTB 4I24A 2XF0A 4R78A 2CGUA 5A9UA 3BU6A 3GCSA 3P7CA 1R3CA 3HA6A 4FZ6A 2OSCA 3FMMA 4GG7A 5AP2A 5FBOA 3ZLYA 4E93A 2WOUA 4AFEA 3W1FA 4LMUA 3S3IA 1DI8A 3G2FA 4L7FA 2E9OA 4LGGA 3QRIA 5DWRA 3SQQA 2ETMA 4IX5A 4WNKA 4JS8A 2PUPA 2IVSA 2ZDTA 3A7JA 3PXZA 3WZDA 1OL1A 1VYZA 2EXEA 5ICPA 1KE5A 4JR3A 4O0WA 4RWKA 4F70A 4GL9A 4BHNA 3FC1X 4AT5A 4W4XA 1VZOA 1YDRE 5J95A 4AZFA 3ZZWA 2B54A 5CLPA 2PVHA 4IWPA 3R30A 3AC8A 3T3UA 3B2TA 3F2NA 2DQ7X 2QI8A 1WFCA 2XBAA 3DPKA 3WF7A 2BALA 1YXSA 4G9CA 4CYIA 3C9WA 3EFLA 4WD5A 5J1WA 5AV1A 2ITZA 3O8UA 5CX9A 3BHHA 2G15A 2WEVA 2HENA 4HJOA 4IE9A 4AAAA 3GENA 4MYGA 3HZTA 4BCHA 4RJ4A 5IPJA 5CVFA 4MBLA 5KUPA 3ZSHA 4YBKA 4BCNA 3CQWA 2C6OA 4GJ3A 2Y4PA 4C7TA 2YAKA 4NSTA 3ZFMA 4BDJA 3GCPA 2XKEA 4R1YA 3PTGA 4YMJA 4GV1A 4FKIA 5L4QA 3FAAA 2WKMA 5L6PA 4M3QA 5HE3A 4BDBA 2YDKA 3A62A 2OZOA 4XX9A 4JT3A 4BKYA 3VBQA 2WELA 3E88A 4XH6A 3KCFA 4HNFA 4WA9A 4AOIA 4EYMA 3PPJA 4UALA 3UC4A 2DYLA 2GSFA 3O8TA 3IW4A 4HCTA 4J71A 4L45A 4GK4A 4MNFA 3SXFA 1DI9A 1Q24A 3MTLA 4FTOA 3QFVA 5IEVA 2BDWA 1OKVA 3SW4A 4KSPA 4N6YA 1BL6A 4L44A 2CCIA 4H3BA 2QU5A 5HESA 4RZVA 4BFMA 1E1VA 1W83A 4FVRA 2VWXA 4RLLA 4BIDA 3R8MA 5J5TA 2BIYA 3O7LB 4ENYA 4KKGA 4OTIA 5BVFA 4LG4A 3OWKA 2BR1A 4F09A 4MXAA 3DY7A 3Q9WA 3TDVA 2YHVA 5CZHA 5CF6A 4G1WA 3BHVA 5D41A 5DGZA 3ZUUA 4EQMA 5DN3A 4H39A 2W5BA 2PZPA 1GIJA 4CFMA 4FV3A 3LCKA 5D10A 4A4XA 4DT8A 2R2PA 4G2FA 2RF9A 4FKOA 3AC3A 3OF0A 4G34A 3A7IA 1B38A 2HW7A 3NWWA 3R7UA 4ZSAA 1OUYA 3E93A 5LMKC 3VAPA 4S31A 1XBAA 2BFXA 4RT7A 2VTNA 3E64A 5AR7A 2YDIA 4BCJA 3NSZA 2YIYA 5BVDA 1QPDA 3R6XA 4BY9E 2B0QA 4HGLA 3GU7A 3QWJA 3HMNA 5EW8A 5BVKA 4RIWB 3R8LA 3TT0A 2J4ZA 5ACBC 1H1QA 1KE9A 4BR3A 2OBJA 4RRVA 4HVSA 3EYHA 4CFNA 5LXMA 1YOLA 4CCUA 5FXSA 3PVGA 3HMIA 3ZC5A 5CEPA 3PLAE 3HAVA 3FWQA 3DA6A 4M15A 4Y83A 2I0YA 3ZEWA 4CT2A 2UZEA 4E7WA 4BC6A 4AZSA 4EQUA 5M53A 2BUJA 4I6QA 4WBBB 5BVEA 5TE0A 3U6JA 4CEGA 5FP5A 1Y6BA 2C1AA 2UZUE 4JBOA 3H0ZA 1LR4A 4KUJA 4FMQA 4NUSA 4X21A 3RI1A 4D4RA 3OCTA 3A8WA 4UY9A 4O7LA 2V7AA 2P2HA 4H1MA 4EORA 5ANKA 3UVPA 3PJ8A 3R22A 4R7HA 3EZVA 3QXPA 3UOKA 2PUUA 2X6DA 3EB0A 4BTKA 4HW7A 5J1VA 1SNXA 2Z7LA 4RWLA 4DAWA 5BMMA 2C6DA 5HD7A 4ZY4A 4XV9A 4IM2A 4Q2AA 3P23A 4IBMA 1WBOA 5CAUA 2YDJA 3GP0A 4R3CA 3CGFA 2X4ZA 2FVDA 4F4PA 2UZLA 2WAJA 3DQXA 5L2WA 4FF8A 1WZYA 3EFWA 3EQIA 5CF4A 2WQEA 2UUEA 4XP3A 5EG3A 3QTRA 1Q8ZA 3OCSA 2OLCA 2HW6A 5DE2A 4EYJA 2O8YA 4ANSA 2Y4IC 3QRKA 1KE8A 3NGAA 2CN5A 5JZNA 4UX9A 4K2RA 1QPEA 4JOAA 4PTGA 4A4LA 2V55A 1XO2B 3BKBA 5FTOA 2QOCA 4L01A 3RWQA 2X7GA 1PW2A 5FD2A 5TOZA 4DCAA 2W4OA 3G90X 4D2SA 2X6EA 3KXHA 2BZHB 5CF8A 2XKFA 3GVUA 4RJ8A 5AIRA 2EXCX 4PMTA 3DKOA 3NUAA 3WF9A 4BTFA 1YDTE 4GJ2A 3L9LA 3ZFXA 5GHVA 3TACA 1NVSA 4LI5A 4PDSA 2PZYA 3UE4A 4CG9A 3C0HA 2VTQA 2VTTA 3LFCA 2BTSA 3QYZA 4IW0A 5BUEA 3ZOSA 2WTKC 3BE9A 3FLYA 1GZOA 3AOXA 4RWJA 4JBQA 1YXVA 2GTMA 3DTCA 2VWWA 1UA2A 4IX6A 4RC2A 3T9IA 4ERKA 4IHPA 3RPVA 5KMNA 1QPCA 3FMLA 4HVIA 4ZEGA 2YEXA 1UV5A 4GK3A 4CKJA 3UOJA 1OUKA 3R7IA 2EB2A 5H3QA 3VUIA 5G1XA 4QP7A 4X6QC 5FG8A 1UWJA 4EZ7A 4DBXA 1JQHA 5ANIA 4AW5A 4OR5A 3ORZA 5C9CA 4YJSA 2BZIB 4H36A 1PXJA 4D5HA 4EKKA 2XYNA 4FV9A 3SDJA 4EH3A 3SHEA 4M67A 3A7FA 3R2YA 5J9YA 3W8QA 4W9WA 5ITAA 3KMWA 3QA0A 3DBCA 3HECA 4JQ7A 2EB3A 3CTQA 1O9UA 4IZAA 2Z7QA 5CF5A 3FI8A 4GSBA 4JRNA 5JT2A 4NW5A 1B6CB 5H9BA 3VRYA 3OHTA 2J5EA 3GEQA 4E5BA 2JIIA 4O0XA 2QONA 3ALNA 3VBWA 4USDA 4FSTA 1ZMUA 5IA2A 3F66A 3QTIA 4O0TA 5CEOA 5HG5A 3S1HA 1KSWA 4X3FB 4HVDA 4JX7A 4D2RA 2V0DA 3C4CA 3P5KA 2W99B 3QCSA 3I6WA 1YXTA 5CYIA 3SC1A 3UC3A 3VWAA 2WB8A 4P5ZA 2JDRA 4E5WA 2HCKA 4X3FC 4E6QA 3ATSA 1WBNA 4F0GA 4USFA 3OS3A 1OECA 2XIKA 4QNAA 4XV1A 3ZUTA 5HNIX 4J1RA 5ANJA 3QZGA 5H8EA 4AE9A 4MXZA 5EKNA 1NVRA 2RFSA 2R4BA 2ZV8A 4UN0C 1MQ4A 5IZFA 2YA9A 4GUBA 5HG7A 3W18A 4M0ZA 3Q4CA 4S30A 3Q4UA 4LYNA 3HDMA 4MWIA 3Q5IA 4IZ5A 4M69B 4FV6A 3EQGA 4DLJA 4KNBA 4H1JA 3ODYX 3PZHA 3PDTA 3AD4A 4IX3A 4FTRA 3NCGA 5KMJA 4N4SA 3UODA 3AXWA 5HE2A 4EH7A 2C0OA 5L2QA 4IACA 3IOPA 4IWQA 4WUNA 1OBDA 4FTJA 3QKKA 4KIPA 5BX0A 3DTWA 4I5HA 5CWZA 3VHKA 4HPTE 5IMXA 1QCFA 3ALOA 1CKIA 3P86A 4C02A 2F57A 4FUXA 1BI8A 4FTMA 1SYKA 4O21A 2ITWA 4YC8A 3ZM4A 3FZRA 4JDHA 3RM7A 2FYSA 4BGQA 5KBRA 3LM5A 1TVOA 1PKGA 2BILB 1J7IA 1MUOA 3DOGA 2YM5A 4TT7A 3BYMA 3IS5A 4FSYA 5EH0A 4BCOA 1UNHA 3QLFA 4XG8A 2I1MA 2V7OA 3FZOA 4ZTLA 3DV3A 4JIAA 1WAKA 2B7AA 4AZWA 2XRUA 1V0PA 5T6KA 3TTJA 3U55A 3L9NA 4R5YA 5GIPE 1UNGA 3FBVA 4TN6A 3ZYAA 2W1IA 1AD5A 4EOLA 3BI6A 4C2WA 5A6OA 1V0BA 2VTAA 3NUXA 5BUJA 4NL0A 3ENMA 4IAFA 3G0FA 3UO4A 3KRLA 3WF6A 1IG1A 3VO3A 2I0EA 2OJIA 3BYUA 2O5KA 5BPYA 1ZYJA 2HY81 3VUKA 2GPHA 3NUNA 3UG2A 2CLQA 2QHMA 1H08A 4AACA 1KV1A 3P08A 2PVFA 3KRXA 2FSTX 5CAVA 3EKNA 3DLSA 3VUGA 4YTHA 4BDEA 4J98A 4WNPA 4PY1A 4QMQA 2HXLA 3FLZA 4BDHA 5K4JA 3OC1A 4BI0A 3K5VA 4L3JA 4V01A 2XYUA 2V5QA 3FI3A 1JKSA 3HUBA 3Q9XA 4HZRA 1CKPA 3S4QA 2PMLX 4TY1A 3R9OA 4CGAA 4DGMA 3OXIA 4Q9SA 3KEXA 5E8TA 4NKSA 2E9NA 3WE8A 4RIXB 5CSVA 5IUHA 4FIFA 2CHLA 4BDFA 5HQ0A 3F5PA 4I0RA 2G1TA 3F3VA 5HNGA 4L6QA 4EH4A 5CEMA 5EQYA 4PQNA 3SLSA 4E20A 4BCFA 2FSMX 3NAXA 2R3IA 3LFDA 4GFOA 3TNHA 2KULA 4ZTRA 5CEIA 5ANGA 4CV9A 1J3HA 5IDNA 3VS1A 1J1CA 2VGOA 3OMVA 2QKRA 3TKUA 4MHAA 3GU6A 2BPMA 3OOMA 3AT2A 4OT5A 3HV6A 3TZ9A 4CTBA 3R00A 1Q97A 1J1BA 2QOBA 1XH8A 5JRSA 2FB8A 4OLIA 4HGSA 1WBVA 4MXCA 2Z2WA 3RPSA 2XK9A 3KMMA 2VUWA 3CSVA 3ROCA 3RBWA 3GFEA 4O27B 2X2MA 3R04A 3PXKA 4LGDA 2CN8A 2VU3A 4F9WA 1LUFA 3DCVA 4K33A 4HYIA 4O0YA 4QQCA 3LMIA 1J7UA 1ZLTA 4QOXA 2J51A 1BKXA 1REJA 4I20A 4U79A 1FQ1B 4YJPA 4F9YA 5A4TA 4YZNA 4IWDA 2OW3A 3R9HA 4AW1A 4BKJA 3EN7A 5KNJA 4XUFA 4JQEA 2XNPA 4E8AA 5CU2A 1APME 4U3YA 5AUYA 5LCKA 3ITZA 5FDPA 4FKJA 2P55A 4PMPA 2YWVA 4MXXA 2HYYA 2BROA 5E8ZA 2C6EA 3BYSA 1PMEA 4KRCA 2UZBA 1KOBA 2PMIA 1K9AA 4FGRA 1NXKA 3PIZA 4CT1A 2ITPA 2AC3A 2OF4A 3PSBA 4D0XA 5AX3A 4FZDB 2YERA 2BTRA 4N70A 1YI3A 3WZJA 4F7NA 3BWJA 4YP8A 5M4CA 2J90A 3TZMA 4QRCA 4DFLA 4PL4A 4KBCA 2Y0AA 2BAKA 2IVVA 4GYIA 4HGEA 3KXZA 4KWPA 4L3PA 3R8VA 2R0IA 5L2IA 1H07A 1IAHA 3V5QA 5CAOA 5H8GA 5HTIA 2WMSA 3KXMA 4NTTA 4AGDA 4ZXTA 3TI1A 4HVHA 3UO6A 4IDTA 3CIKA 3KCKA 3QBNA 4XV3A 1Y57A 4RVKA 4ZY6A 3O71A 3PUPA 1S9JA 5EYMA 1Q62A 5AAGA 5FTGA 3IQ7A 4FVQA 3QU0A 4TYHA 3ZH8A 3JY0A 3ZFYA 3TIYA 3ORPA 3F7ZA 5HTBA 4JVGA 3R8UA 3HP2A 1YVJA 2E9VA 2WQOA 3OD6X 3VJNA 4O81A 2XK8A 3M11A 5AV0A 5KBQA 3SXSA 4ZSLA 3NNUA 4EBVA 5J9ZA 3GC9A 4FL3A 3BYVA 3Q6UA 2OFVA 4ITIA 3GB2A 2OF2A 4AGWA 3UPZA 2GMXA 4C8BA 4YO4A 5IA0A 4O84A 4FOCA 4QQTA 3OG7A 2PVKA 2VX3A 2IZSA 3DLZA 3K3JA 3ORXA 5CZIA 3OW4A 3QUPA 2OXYA 3WOWA 4ANMA 1DAYA 2WZJA 4FNYA 1O6KA 4ZOGA 1ZWSA 2X39A 3NX8A 2ITQA 3PPZA 3W2CA 4KIKA 4E3CA 3HA8A 5IUIA 2PVMA 4L53A 3VHEA 3W16A 3RKBA 3CC6A 4TPTA 4R3RA 3F2RA 2P2IA 4GT4A 4O7ZA 2RIOA 4LQMA 4PL5A 3WIKA 3CJGA 4FC0A 2QU6A 2YZLA 4FNXA 4QMPA 4EUUA 1YOJA 3AG9A 2R5TA 2RGPA 2HELA 4C4EA 4IC8A 2ZYBA 4IAZA 2C69A 3LJ2A 4JG6A 4UYNA 3V5PA 3NPCA 1Q8TA 2UW5A 4M13A 5GJGA 5GZ9A 3NVMB 4FTCA 2JDVA 3E7VA 4G3CA 1GZKA 4QQJA 4C35A 3BLRA 3FY0A 1OITA 4L68A 4HYUA 2VNYA 4G6OA 2RSVA 4FYOA 4AQCA 4FT0A 3JXWA 2UV2A 3WYXA 4X2NA 5IISA 4R3PA 2ZB1A 2R7BA 4QTEA 2QG7A 1XKKA 4FT7A 1VR2A 3PIXA 5CU6A 1YXUA 5HG8A 3L8SA 4AW0A 3I5ZA 5TF9A 1FMKA 3UP7A 4DFZE 4LL5A 4AU8A 3UZPA 2X2LA 5L8LA 4Z16A 3THBA 4TZRA 4FV7A 1H26A 4Z3VA 3ETAA 3EQRA 3D5WA 3ERKA 3GT8A 4IX4A 2Y6MA 4OTFA 1H1RA 5FTQA 3RMFA 3C51A 4O22A 3QQLA 4CTCA 5DI1A 3UNZA 1RDQE 2W05A 3K5UA 1G8AA 4O7WA 1WBWA 2FSOX 1JVPP 4JIKA 4KS8A 3OROA 3U8WA 2ZAZA 2PE0A 4L8MA 5C01A 5HZNA 1OGUA 2C1BA 2OG8A 4FEVA 2HXQA 2XNBA 3MH2A 5KZ0A 4DCEA 1PXLA 2GFCA 2OWBA 2X2KA 3UIMA 2Y7JA 3OXZA 4PF4A 4CV8A 2I7QA 5F94A 4M7IA 3ZZEA 2YWPA 5HIEA 4L46A 3FHRA 3D94A 4EZ5A 3U54A 3LIJA 4TW9A 4YZCA 4EH5A 2R64A 3HEGA 1XJDA 5IEXA 2OJGA 2Z02A 2Y9QA 4FEQA 3UJGA 1GJOA 4C4FA 3POOA 1Z57A 4FIIA 4FGBA 4JJRA 3GUBA 4NM5A 5CQUA 3MIYA 4JAJA 4U3ZA 2CNUA 3EN4A 2F7ZE 5BVWA 4DGGA 3CXWA 2ZM3A 5GIOE 3DNEA 4L52A 3MY1A 4N57A 2ZVAA 4DA5A 3SX9A 2J0KA 5C8KA 2HY0A 4R8QA 1NVQA 3ZC6A 5AV4A 2QVSE 4NKAA 3D7TA 3AC5A 2VRXA 4F1OA 2B9JA 4FICA 3V5JA 2ITNA 2X0GA 2XNEA 4TXCA 4UXQA 3LCDA 1M2QA 1Q8WA 3LCOA 4W8DA 1ZOGA 3MN3A 3W2QA 3DBDA 4C59A 3QC4A 3Q32A 3AT4A 3RM6A 1T45A 2JGZA 4ITHA 3CJFA 4I92A 1OIUA 2B55A 3IOKA 2PVJA 5HU9A 4AN2A 2XB7A 2PVLA 4FZ7A 4AGUA 2W1FA 3FLWA 2PWLA 5HU3A 4FTLA 5I3RA 1GY3A 3MPMA 4IVBA 1OL2A 5EOBA 4BICA 3DDPA 1Q61A 3KL8A 3ORTA 1ZMWA 5DH3A 4F1TA 2C3IB 3PXQA 4QMMA 2YIRA 3GBZA 4ASZA 3R01A 3QD3A 3HMPA 4QYYA 4FIGA 2IO6A 4JDIA 4EUTA 4GG5A 2WMAA 3HAMA 1DAWA 5ETFA 2YABA 2VTHA 2BMCA 3MVJA 2G9XA 3IDBA 2B9HA 2H34A 4MEDA 1O6YA 2BAJA 4C34A 4U40A 3WI6A 2OIDA 2YM6A 3DAEA 4BWXA 4UMRA 4RWIA 5DVRA 3ZBXA 2NPQA 5C4KA 4OBOA 4KABA 5EHYA 2XBJA 3OCGA 4I23A 2QQ7A 3HVCA 5FEEA 4KKEA 4M97A 1J91A 5L2SA 4DE4A 2CGXA 4BCGA 2GNHA 3R1NA 4H3PA 4Y95A 3D5UA 4J7BA 5AUZA 3M2WA 4Q5EA 4AUAA 3H10A 3UBDA 2VWZA 3LFSA 3TIZA 4FTNA 3RZBA 3BEGA 3F6XA 4QYEA 5CASA 5C1QB 3ZEPA 3LKMA 5IA1A 2XM8A 3DZQA 4KD1A 3FE3A 3UQGA 4DTKA 1U4DA 5FM3A 3I7BA 4PTCA 2VWUA 2BHEA 5CANA 3R7OA 2R0UA 4FSMA 5AP1A 3UMWA 2R3GA 1XH6A 2XNGA 1UU3A 4LRKA 3LVPA 5KZIA 2RFEA 5CVGA 4IMYA 3BZ3A 5CI6A 5FBNC 3IONA 1R0EA 4DEGA 3L8PA 3C0GA 5IQGA 3IGGA 3MVMA 4U81A 5FEDA 3UZTA 3QRJA 4UWYA 2OO8X 3UQCA 4Y5QA 4ZTSA 5IQHA 1R0PA 3IW8A 4FIJA 4MNEA 3LAUA 4O1OA 2UZDA 4IC7A 3QALE 4R5SA 1FVTA 4L00A 4D4YA 1Q99A 3FQEA 4XNEA 1M2PA 3P78A 4LMNA 5FWKK 4C36A 3GU5A 3FZSA 5LMAA 4DG0E 1JPAA 3NR9A 1M17A 3CY3A 5LVNA 3O17A 3DZOA 5EQPA 5DR2A 5KO1A 3OZ6A 3MH3A 4I5PA 4O7YA 3GC8A 5BMSA 2BRNA 3VNTA 3R9DA 4A4OA 4CCBA 1H28A 4QYHA 1GZ8A 5BYYA 2WD1A 3QAME 2WTWA 3ZSIA 4AGCA 2YIQA 4B4LA 3FZ1A 3ACKA 4UMPA 2WU7A 4AN3A 4KIQA 4QMLA 2BHHA 4QP8A 4PRJA 4W4WA 5DA3A 2IZTA 4K6ZA 3U87A 3EL7A 3UYSA 2Z8CA 4XP0A 2QHNA 3BQCA 1OM1A 3OFMA 4IADA 4UMTA 1W82A 4S33A 3MA3A 2WIPA 3CTHA 4A9YA 5LVMA 2DS1A 3OUKA 4L67A 2ACXA 2VTPA 3LQ8A 2GNLA 4IVCA 4YLJA 5M4FA 4CMOA 4I6HA 4OTRA 3VS2A 2XEZA 4M84A 3PFQA 2PMNX 4X3JA 4TTHB 1ZY5A 4XMOA 1H1WA 2QOKA 4K77A 4G3DA 4OTPA 4P5QA 3C7QA 4O1PA 5LJJA 4LV8A 1YW2A 3AMAA 4IZYA 4U0IA 5DOSA 4ASXA 3DT1A 1BX6A 2ITTA 4Q5HA 4X6RA 3ULZA 2F7XE 5DRDA 4A9UA 4XBRA 4BTJA 4USEA 5KHXA 2Q0NA 4RVMA 1U59A 3CD3A 3QX4A 4G3EA 5ANDA 4AF3A 4BZNA 3FMDA 2P0CA 1RW8A 4QP9A 1PXKA 2DUVA 3QGYA 3TZ8A 1WBSA 3FHIA 3KVXA 4CKRA 3HV7A 5CENA 3OCBA 1JBPE 2QOLA 1H0WA 4EH6A 1IASA 3LFAA 4YJTA 4MD9E 4I5MA 3F61A 3DK6A 3AMBA 5J5SA 4O0UA 4J97A 2GNFA 3PA3A 4FVPA 4IQ6A 2BKZA 3FEGA 3VUMA 3A61A 3ZS5A 5A4LA 5M57A 1REKA 3PY0A 3V01A 4ACGA 4ZTNA 2G01A 4BDKA 3G5DA 3NYNA 5M55A 5JZJA 4TWOA 3KRWA 3MGYA 2YFXA 1W84A 4ZK5A 5TR6A 3HMOA 3F5UA 5LWMA 5E9EA 1JKTA 2C3KA 2R3LA 4FKUA 2CGWA 3VBYA 4PUZA 3AC2A 4Y73A 4WOVA 3I1AA 4NJDA 4H58A 2WMUA 1YKRA 3I79A 4X2KA 1XH7A 3NAYA 3OBJA 4C3FA 3I7CA 2X9FA 4BGHA 3NZ0A 2JFLA 4BDIA 4UEUA 5AV3A 3NYOA 5CNOA 5IDPA 5K5XA 3ZO2A 4I1ZA 4UV0A 5HI2A 5T3QA 2C5YA 5AUVA 3PJ2A 4AZTA 2VWYA 4C61A 4F7LA 1OMWA 2HZ0A 4Y85A 3BRBA 1YOMA 3NNVA 1SVHA 5BUIA 2FUMA 3EJ1A 5CU3A 5A46A 2PZ5A 3FZPA 5CAQA 3OXTA 1WCCA 4RGJA 2ITYA 2VAGA 4WG5A 5AR4A 4IAKA 3C13A 2J0JA 3M42A 4FV2A 4EH2A 4ZZNA 3A60A 3O0GA 2H8HA 5EDPA 3ZU7A 3E62A 2JLDA 3ZTXA 3N4TA 4O7NA 5FGKA 3MH1A 4OTQA 5CU4A 2P33A 5EI2A 3A2CA 1QMZA 3E8DA 1MRUA 3VQHA 1BI7A 4FKRA 5LWNA 2R3KA 2Y4IB 4PDOA 4F1MA 1NW1A 1STCE 3JYAA 3MBLA 4IB3A 4YHJA 4CFUA 5EI8A 5EYKA 4BTMA 3KK9A 5KMMA 5ETIA 5JFSA 4S32A 4QMOA 1GOLA 4O0RA 2FA2A 4O2PA 4QTDA 5JRQA 5IH5A 5AWMA 3QCYA 3DQWA 3KN5A 1Q3WA 5E92A 4K8AA 2ETKA 4XG9A 4S2ZA 1Y8GA 1IA9A 3ANQA 4NT4A 2UZVA 2OJ9A 2ITOA 1T46A 2JITA 3ZSGA 4A9TA 4ALUA 3GU4A 3SD0A 3R9RA 3CQUA 4RLKA 4GIIA 5DEWA 5AA9A 1KOAA 5CNNA 4YTCA 4XEYA 4Z55A 2F2CB 2WTKB 2VWIA 2REIA 1M7QA 3AGLA 2O3PA 3ORNA 1E9HA 2OZAA 2V62A 4OUCA 4W4YA 4EK6A 5DHJA 3UYTA 3A4OX 3IW7A 2EUFB 4L9IA 4CMUA 4KSQA 2OH4A 2PZRA 1XBCA 4FZFB 4EH8A 4EK5A 1QL6A 1LEZA 3CE3A 3VUDA 3TM0A 5HX6A 4ANBA 4D2VA 4FIEA 4U7ZA 3LFNA 3NYVA 5LOHA 3EL8A 4FZAB 5I9YA 1FGIA 2I6LA 2JAVA 3JPVA 3BGZA 5D12A 3NMUF 4BRXA 2ZM4A 3E5AA 4AWIA 2GS7A 3U51A 4U41A 3BV3A 1PY5A 5I9VA 5AV2A 2HWOA 2CNVA 4I3ZA 2YZAA 2O65A 3AD5A 3R1QA 3IG7A 4L7SA 1KWPA 1CDKA 2B4SB 3PG3A 4GMYA 4BDGA 2Q83A 2JBPA 4FEWA 4A7CA 1XH9A 4XP2A 4CLJA 3MB7A 3L9PA 4UZDA 5B2KA 1ERKA 1A06A 3R0TA 4M68A 4QPSA 4YO6A 4K18A 5AUXA 3RP9A 3ZDIA 3Q4TA 5LARA 1FVVA 4HPUE 4RPVA 5DR6A 2Z7SA 1H00A 5CQWA 3TXOA 1WVYA 4JI9A 3W55A 4ACDA 1UU8A 2VTIA 1AQ1A 2UW7A 4IB5A 5M4UA 2WHBA 3RCDA 5IQFA 5GZ8A 4QMUA 4CLIA 5A4CA 3RPOA 5HO7A 3UQFA 5BYLA 4FG9A 3QUEA 4QMYA 4FKVA 3EN5A 2OH0E 1OPJA 4QP1A 3VBVA 2XUUA 3MI9A 3FI2A 4OTGA 4KB8A 3WZKA 4AP7A 1W0XC 2UZOA 4EOKA 3VRZA 4I4FA 3RPRA 3UIBA 1M2RA 4AT3A 4P7EA 1PMVA 5CEKA 4RVTA 4C3RA 3V5TA 3SA0A 5D1JA 4DEIA 4I0TA 2A4LA 4LRJA 2X8IA 3OW3A 5AAFA 3VBTA 5I9XA 5L8JA 4XCUA 4BI2A 4DFYA 1P4OA 1X8BA 4AFJA 4FV4A 2UW3A 2C6LA 3Q9YA 1OB3A 2C3JA 4QMTA 5E8UA 2ZJWA 3P9JA 5A3XA 4BF2A 3FLQA 4PP9A 3HLLA 3SVVA 4O83A 3BHTA 2QOFA 1ZYDA 3KRJA 4DBNA 4C37A 5HE0A 5F9EA 3TV6A 3B2WA 2UW8A 3NIZA 3RWPA 3QYWA 5CT7A 3IPHA 3VUHA 4FV8A 3RAWA 3EN9A 3RHKA 4TL0A 1L8TA 3QTQA 5L6OA 4HZSA 3OWJA 4RJ5A 2WNTA 2CPKE 4C58A 4QTCA 3JS2A 3K3IA 2JDOA 5DT0A 4D1ZA 4XOYA 4TYHB 3TUBA 4IZ7A 2WTVA 3KKVA 1TQIA 3KB7A 3H9RA 4IM3A 5HORA 4D1XA 2I0HA 4O0VA 2C5XA 4EOMA 2HZNA 4JR7A 4L43A 4YJUA 3RAKA 2W1DA 3BYOA 3MS9A 3EFJA 1W8CA 4FSWA 2IVUA 4WNMA 5AADA 5IG1A 3Q96A 3PXRA 2QKWB 5A4QA 3W33A 5H8BA 3QL8A 2XP2A 3Q2MA 3LLTA 4AA4A 4CKIA 2VO0A 5HLPA 4KIOA 3HV3A 4ID7A 4RVLA 4WSYA 4YTIA 1MQBA 4C38A 3V5LA 2JKQA 3E8NA 4OTHA 3CKWA 3RVGA 4RZWA 4HCVA 2ZV7A 4JX3A 5IH6A 1YWVA 5CSXA 4YR8A 5B2MA 2UZWE 4EBWA 2WXVA 2F2UA 2JIUA 4OBPA 4XG3A 1FGKA 3MJ1A 4KIKB 2AYPA 4LV5A 3DFAA 5CXHA 3ZLXA 3SG8A 4DT9A 4TNDA 3F3ZA 4BDCA 1Z9XA 4LUDA 2ZDUA 4CFVA 1XWSA 3R02A 4OW8A 2ZB0A 1P2AA 4NCTA 3QD2B 4IAAA 4D2WA 5IF1A 3QQJA 4EJ7A 4WSQA 4ONAA 3PY1A 3OEFX 2IZRA 5HBJA 3EQFA 5AP3A 4EJNA 1WMKA 2R3NA 3DJ7A 3DBEA 4QNYA 5CI7A 5CS6A 1Q4LA 4BDAA 4UMUA 4IVDA 1CTPE 4QMNA 2XKDA 3LQ3A 3GCVA 1H24A 1K2PA 3P4KA 1RQQA 2WOTA 4FT5A 4IJPA 3KULA 4GRBA 3PA4A 3BPRA 3QQGA 3PY3A 3FXXA 4CSVA 5EHOA 4I93A 4PNIA 3FC2A 3MA6A 4DFNA 5IUGA 3LPBA 1KUTA 2JDSA 2PVYA 2UW6A 3FJQE 3I6UA 5ETAA 3WARA 2EVAA 5IQIA 3U4WA 2C30A 4ENXA 2X7OA 4CD0A 3CCNA 5CTPA 1Q3DA 2ESMA 3F3UA 3SRVA 3UNJA 3R8ZA 5GZAA 2WQBA 4FEXA 2RL5A 5D7VA 4DGLC 4IM0A 4F08A 3QCXA 3NIEA 3CLYA 2PMOX 1UWHA 1URCA 3DBQA 4FTAA 4E4XA 1M7NA 4I0SA 3MY0A 1VYWA 2C47A 3UOLA 3K2LA 3HUCA 3ZRMA 5I0BA 3TNQB 3QTZA 4DEDA 4PPBA 4C3PA 4D5KA 4KA3A 3LFEA 4C33A 3DB8A 4IB1A 4J8NA 3BEAA 4QTBA 4R7IA 4UBAA 2GFSA 4EKLA 2Y8OA 2A1AB 4NM0A 2YM8A 2W5HA 5CY3A 4P90A 2WMQA 3R83A 3VS5A 3ZO1A 3G0EA 5EK7A 4AW2A 4FG7A 4O6EA 4CFXA 2ZMCA 1TKIA 5CU0A 3PE1A 3I81A 4JNWA 4PV0A 2X7FA 5EM5A 2A2AA 4EHVA 2B52A 5BQ0A 4GK2A 5EDRA 4BI1A 4D1SA 5JSMA 3Q2JA 5ETCA 4NM7A 4J99A 4N0SA 4MXOA 4I21A 3L8VA 2FGIA 5HCXA 1FINA 4OTWA 3W2RA 3MSSA 3D7TB 2CMWA 3PP1A 5B2LA 5AM6A 1NA7A 4B6LA 2OIBA 3Q04A 1MRYA 3ZO3A 1OL7A 3H30A 4EHZA 4XS2A 5FQDC 2R3HA 3FXZA 4IANA 3L9MA 3TUDA 4YLLA 5E91A 1GNGA 3LJ1A 4XLVA 2X8DA 2W96B 3VS3A 5K4IA 5E4HA 2WMXA 4DC2A 4A07A 5GINE 3EQHA 1OL5A 3I0OA 1LPUA 3A7HA 4F65A 5M4IA 3FPQA 3HDNA 4G16A 4ANQA 3VBXA 3G9NA 3PXYA 5DT4A 3F82A 1FVRA 4FK6A 4YJQA 4APPA 1CSNA 1UKHA 4O0SA 4XLIA 4DEHA 5L2TA 4ZS4A 4LL0A 3HYHA 4L3LA 2WMWA 3R28A 2YJSA 4FBXA 3HL7A 4N6ZA 4PPAA 3TJDA 4H05A 5HHWA 4O86A 4MBJA 3R2BA 3BU3A 1K3AA 3DU8A 2IW8A 3TEIA 4EONA 4TWCA 2YITA 1BL7A 3ET7A 2VTOA 2RFNA 3JUHA 5IQBA 4A9RA 4DHFA 2VX0A 3LXLA 3MFTA 4GH2A 4LGHA 2R3MA 3E92A 5E1SA 4A9SA 1PXIA 5JFXA 4ZS0A 2XIXA 4QP6A 2B9FA 3ORIA 5FXQA 4ZLZA 4C57A 5F20A 3V5WA 3BV2A 4B7TA 3OWPA 5J7BA 4RC3A 2VGPA 1JKKA 3G9LX 2PVRA 4MAOA 1WVWA 3KQ7A 4KINA 3UG1A 4BCPA 4FSRA 3NCZA 3DBFA 2XCKA 5I9UA 2WQNA 1KE7A 3F2AA 4G6NA 3RHXA 5HTCA 5B7VA 1ZAOA 3Q3BA 3IGOA 5IA3A 1QPJA 5I9ZA 3QA8A 3KA0A 2PHKA 3QC9A 4MKCA 3H9FA 4U43A 2OU7A 4EI4A 2FO0A 3QD0A 3E8CA 4RMZA 2IN6A 2FSLX 2PE1A 3ORMA 1IR3A 4M8TA 4WNOA 3UDBA 4BZOA 4EZ3A 2IPXA 2IVTA 3LM0A 3NW7A 2JKKA 4C62A 4D4VA 3OVVA 5DPVA 3ACJA 4O91A 1U46A 1AGWA 4E6CA 2XK4A 5FM2A 1R1WA 4D9UA 4WO5A 4BVUA 3EHAA 4ASEA 4R1VA 4IB0A 1PRYA 3ELJA 4MNEB 3QTUA 1EH4A 1OZ1A 2B9IA 2C6MA 3C50A 3KN6A 4I94A 3RAHA 4ACHA 3FDNA 3VJOA 3JY9A 4B99A 2JAMA 2YIWA 2E2BA 3L8XA 5AM7A 2IJMA 1GAGA 1KV2A 1PKDA 4MD7E 4XJ0A 5EM6A 5T68A 5JEBA 2XNMA 5AFVA 2HZIA 3LFBA 3WILA 1O6LA 5JMSA 4G9RA 3GC7A 4ZTHA 4E1ZA 4V0GA 3R9NA 2J0LA 3TZ7A 4GVJA 3V6RA 4CZTA 1TQPA 3GXLA 3PYYA 4QP2A 3HMMA 4RSSA 1G5SA 5K5NA 4UB7A 4B9DA 4C4IA 3TNWA 2CCHA 2ONLC 1B39A 4G5PA 4G5JA 3NRMA 3OT8A 4I4EA 4IXPA 2YIXA 3R1SA 2W17A 3QZIA 1R39A 4RA4A 4GCJA 3GOKA 2W4KA 3RK7A 1U5QA 5TO8A 2OJFE 3F7WA 4ARKA 2Y6OA 4KKHA 3R7GA 1LEWA 3DKCA 4QTAA 5CSWA 3GQIA 2UZTA 3QKLA 2EU9A 3NNWA 4BL1A 2W5AA 5JGBA 3C4WA 3ORKA 4NIFA 2B53A 3S2PA 4BYIA 3SGCA 4MCVA 4IDVA 4P2KA 3DXPA 3QTWA 4DLIA 3HP5A 3ID6C 2GNIA 3R7YA 3PXFA 3V04A 1WBTA 4QD6A 3LOKA 3LCSA 1JSVA 3D5VA 1JNKA 3LHJA 5AP4A 5HBHA 4G6LA 1TQMA 4JAIA 4PMMA 4F63A 2X8EA 4O82A 3C4EA 2YJRA 2DWBA 3BHYA 2GS6A 3LJ0A 4F0FA 3S0OA 3D2KA 2W9FB 3VC4A 1A9UA 5TKDA 4FT9A 1XBBA 2J0IA 4X2GA 4ZTQA 4YUQA 2X81A 2W7XA 4JBVA 3R63A 4AS0A 3JR1A 3D14A 3O8PA 3NUYA 3S00A 3DAKA 4BCQA 2WMBA 1H1PA 3P79A 4FUYA 3D9VA 4D2PA 4EOQA 3QUDA 1OIYA 4YZDA 2WPAA 4DTBA 2CKQA 4FOBA 5KKRC 1GIIA 4TWPA 3OBGA 1I09A 3UOHA 4GUEA 5DIAA 2CKEA 2UVYA 4WRGA 4GU9A 4TYGA 4ZZMA 3TNPC 2R7IA 2GU8A 3MFUA 5HVJA 1ATPE 3FSKA 1PMUA 5I9WA 1WBPA 5D7AA 3FKLA 3SV0A 4QP3A 4OTDA 4IIRA 3D83A 4UWBA 3HRBA 4DG3E 2JDTA 1SM2A 2P3GX 3SXRA 3CD8A 3COKA 2J9MA 3GQLA 4MTAA 4FTIA 4RG0A 5ANOA 3ZONA 3NW6A 3V6SA 4CQGA 3O7LD 4XG2A 4BCKA 4R7BA 2ZV9A 4BIBA 3ATTA 3OTUA 2PZIA 2QLUA 1Y6AA 4FKPA 5KMOA 3E8EA 4JDKA 4OGRA 4DTAA 3CTJA 4K11A 2XM9A 3C0IA 4U9AA 4B8MA 4GKHA 4DH1A 3A99A 2PSQA 4BIEA 4RJ7A 3WIGA 1I44A 1Z5MA 2W1ZA 4WHZA 5AR8A 4J96A 4LM5A 2XKCA 4KBAA 4IFGA 3MV5A 4QMVA 4D9TA 3FI4A 3FMHA 2WMRA 2RG5A 3MB6A 4TRLA 2BAQA 4CYJA 4LOQA 4PX6A 3SAYA 4O7SA 4G3FA 2NO3A 4DFBA 4M0YA 2BFYA 3DKGA 3F9NA 1YDSE 1JOWB 3F88A 4LUEA 3C1XA 1YRPA 3LXNA 2C0TA 1H0VA 2J6MA 4QMXA 3KY2A 2OKRA 2QR8A 1FPUA 2HOGA 1LP4A 4H3QA 4O96A 5J9LA 5HX8A 3CKXA 3P1AA 2RG6A 2WQMA 4XYFA 2PE2A 4DGNA 4G31A 4RBLA 4MF0A 4YZMA 3OY1A 4WG3A 2ONLA 3FKNA 1DS5A 3CPCA 4XOZA 4FTTA 3C4FA 2LAVA 3GFWA 3UNKA 1PYEA 1UU9A 2XJ1A 2VO3A 3DK3A 4F9BA 3G51A 3UZRA 3BWFA 5C26A 3MDYA 3MWUA 4MH7A 3FQSA 4NEUA 2OZAB 1ND4A 5CEQA 3CS9A 2W1CA 3Q4ZA 1L3RE 3QZFA 5GJDA 1ZYSA 3ENHA 3ODZX 2QD9A 4IH8A 4IAIA 4NK9A 5AP0A 5L3AA 3HV5A 5BVOA 4RFZA 2PYWA 5EFQA 5HIDA 1U54A 3FMKA 4F6SA 2ZV2A 5D9HA 4OAUC 4CFWA 5FXRA 4LFIA 4LOOA 4BWKA 4O7TA 4HNIA 5AUUA 4C2VA 3KXXA 5HBEA 3QF9A 3MYGA 3QZHA 4FE2A 4NYEA 2W4JA 4Y5HA 3V3VA 1FOTA 4S34A 3F5GA 3GU8A 4EOSA 2GQSA 2WU6A 5LVOA 2LGCA 3QWKA 4WKQA 3ZXZA 4XRJA 2CKOA 2YCFA 3FPMA 4W8EA 5K3YA 4DH5A 2QURA 4CFFA 1KE6A 4F7JA 4G3GA 1CKJA 1FMOE 2BCJA 3FMEA 3QD4A 3VIDA 4O2ZA 4YBJA 5AAEA 4KAOA 3NUUA 4FA2A 2UW4A 4ACCA 2VTRA 2VX1A 4QQ5A 1Y8YA 4ZSJA 4MQ2A 5AA8A 1IAJA 3U9CA 4ANLA 3I0QA 4RFMA 4F9CA 2OK1A 4OT6A 1S9IA 3R8PA 4DN5A 4EK4A 1H25A 2XCHA 4YSJA 3R1YA 3PWDA 4CRSA 1F5QA 2GDOA 3WZUA 5DYJA 2WTDA 3CPBA 2XK6A 5EW9A 4CNHA 5M51A 3QQFA 4GKIA 5L6WL 3FYKX 3T9TA 2GCDA 5AJQA 3F3WA 1PHKA 1RE8A 2W1GA 3HNGA 3E7OA 4F64A 5CALA 3R21A 2Q0BA 2EXMA 2KTYA 4RIYA 1URWA 2NP8A 2UVZA 3OP5A 4JLCA 5HG9A 4APCA 3P7BA 3BGPA 1JSUA 4FKLA 4QPMA 4UMQA 4Y46A 4F99A 2BKKA 1OPLA 2XK3A 3EFKA 4M66A 4YZBA 3BQRA 1OIRA 4FIHA 3NUPA 5EYDA 1SNUA 1CMKE 3C4XA 4FTUA 4B0GA 2J0MB 3DXQA 1W7HA 3TN8A 4CVAA 3TL8A 2C3LA 2A19B 3D15A 2F7EE 4AG8A 4PDYA 5E7RA 4GYGA 1UKIA 3HRCA 3MY5A 1HOWA 1WVXA 4CQEA 1V1KA 1Q5KA 2QOHA 2YM4A 3HX4A 3IW5A 1VJYA 3BU5A 3OTVA 1OBGA 5IA4A 2UVXA 4ACMA 5KHWA 4ORKA 5HO8A 4FSUA 4E6AA 3TDWA 2XNNA 1H4LA 4X7QA 5E8SA 3FXWA 3NVKI 1XH5A 4U5JA 2GQRA 5DT3A 3WYYA 2YISA 4XG7A 3IK3A 3OY3A
chains in the Genus database with same CATH superfamily
3KXNA 3TKIA 5KMLA 1Y91A 2IZUA 4X0MA 2IWIA 1P5EA 5GJFA 1P14A 2V22A 3DGKA 2VD5A 4JRVA 2C6TA 4DH3A 4Q9ZA 3KFAA 3KVWA 2R3OA 4FKTA 3ROYA 2R3RA 5G6VA 4FSZA 2WTCA 3DJ5A 3GNIB 2CDZA 2VV9A 3GOPA 4DITA 3N4VA 3DDQA 1TFFA 3LXKA 1BUHA 1OVEA 5ACKA 3EYGA 5EKOA 5HICA 1SZMA 4D0WA 3UGCA 1IEPA 3BIZA 4KBKA 2HZ4A 3F3TA 2OIQA 4PPCA 1ST0A 1SVGA 3C4ZA 3MFRA 4F6WA 1XR1A 1ZZ2A 4XHKB 5HCYA 3SOCA 4YPDA 4ZMFA 2JBOA 4Y8DA 2ITXA 2OGVA 5E8WA 5TT7A 3U9NA 2ITUA 2C4GA 3P0MA 2GNGA 4EOPA 3RCJA 4U8ZA 2QOOA 1XHAA 2WTJA 3FMNA 3ORLA 4JG8A 3UP2A 3E3BX 2VO7A 4BB4A 2YACA 4R6VA 5A54A 5HD4A 2BDFA 4ZMEA 3AC4A 5K0XA 3UVRA 5DNRA 1G8SA 3EIDA 1H1SA 5HIBA 3VS4A 3LFQA 1P4FA 2J5FA 1RJBA 1SMHA 2VWBA 4OBQA 5M06A 2R3JA 3QCQA 2PUNA 1TZDA 3FY2A 4WG4A 1SVEA 4NFMA 5JH6A 5C03A 4NU1A 3IKAA 2CJMA 2YN8A 3I60A 2WTIA 4ZZOA 2GTNA 1F3MC 2UW9A 3E3PA 5A14A 2PY3A 4GW8A 4DINA 2F4JA 3PVWA 3MTFA 5KCVA 2XARA 5HGIA 3LMHA 4ALVA 3LLAA 2XIRA 2O64A 2QC6A 5AEPA 4NCTC 1HCKA 4QYGA 1IA8A 2QO7A 5EM7A 2H9VA 4K9YA 3KULB 4FYNA 3CR0A 3AKJA 3CP9A 4YJOA 2W9ZB 5HKMA 2JEDA 4FL2A 4E73A 4BCIA 4GFMA 1BLXA 3D4QA 5L8KA 4JXFA 5IQEA 5EDQA 5EYCA 3RPYA 2OJJA 2OXXA 3MIAA 4D4SA 1W2DA 3AT3A 4KRDA 3AD6A 2BRMA 3VW8A 1U5RA 4E26A 1PMNA 4F0IA 3PG1A 4GEOA 3SRVB 2CLXA 3DJ6A 3V8WA 4ZSGA 2NRUA 5M56A 4JMQA 3JVSA 3EMGA 2C5NA 2GHLA 3BCEA 1J7LA 2I40A 2XAMA 5CVHA 5IQAA 2W06A 2XZSA 5FP6A 4EWHA 4UWCA 4DGOA 1XMLA 3GCUA 2R9SA 3V8TA 3EWHA 3LXPA 3PJ1A 1M14A 2VZ6A 4NWMA 2OICA 4RFYA 4ZP5A 5C8MA 3W32A 5JGAA 2QG5A 4QYFA 4BKZA 2Z7RA 5KMKA 5J8IA 5LMKA 2C68A 2EWAA 4U45A 2VO6A 4FSQA 3PA5A 4NZWB 4ZAUA 3QRUA 3A4PA 4PL3A 5C4LA 3VW6A 2X9EA 3A8XA 3NNXA 5IMEA 2E9PA 4PDPA 3UMXA 3VN9A 2PPQA 4Z7HA 2QO2A 5AR2A 3M1SA 3NS9A 5LCJA 4M12A 2JKOA 5J79A 2J2IB 3EOCA 4NFNA 1YXXA 1ZYCA 4PNKA 3Q6WA 2GHGA 4TWNA 4I6LA 3FSFA 3RJCA 3O50A 4J52A 3NW5A 3VF9A 3MH0A 3E63A 4FODA 4AT4A 3BHUA 3Q60A 3EZRA 4ZY5A 3VS6A 4RIWA 5JGDA 1JWHA 2XH5A 3T3VA 2H6DA 3ZRKA 4CZYB 4D58A 4DFUA 4QT1A 2QNJA 3KU2A 2R3QA 3EQBA 4XV2A 3QTXA 1M52A 3WBLA 1JKLA 2PTKA 4IEBA 4Z9LA 4XG4A 3LZBA 4E5AX 2R3FA 2XVDA 3TJCA 5K9IA 3FL4A 3KC3A 4UXLA 2C5OA 5DBXA 5EQEA 1YI6A 3KF7A 4HYHA 2AUHA 5AIKA 3VULA 3RK9A 1OKYA 5JN2A 2ITVA 3C5IA 1NY3A 3R7VA 3PJ3A 3D2IA 5DFPA 5AX9A 1PF8A 5EI6A 4RX8A 5BVNA 5IU2A 4YPSA 3WE4A 5AUWA 1IRKA 4YJVA 1OKZA 3VQUA 4AQKA 2GHMA 2XEYA 3CY2A 3QQKA 5DMZA 2VTJA 3FLSA 4E4NA 4RX7A 5LVPA 4I6FA 3CQEA 4UZHA 3KK8A 4XRLA 4A06A 5AP7A 3LFFA 4YNEA 5DLSA 3FKOA 3FZTA 4AA5A 1VEBA 3ULIA 5IQDA 1H27A 5EW3A 4DEBA 4FEUA 2XNOA 4WRSA 3IECA 3TNIA 4ITJA 4WBOA 5KMIA 5M07A 4QPAA 3TV7A 5E1EA 3W10A 1ZY4A 4FKSA 4IFCA 4AE6A 4QMZA 4ZSEA 4CMTA 3BBWA 4GIHA 4O6LA 5LQFA 4FV5A 4LRMA 1PXPA 2XJ0A 2ZM1A 1PYXA 2C6IA 4F7SA 4ZJVA 2W1HA 4ANOA 2XA4A 5C27A 4EC8A 5FEQA 2W1EA 5FLFA 2PUIA 4FNWA 2A27A 4E4MA 1G3NA 1W98A 3ZDUA 4EOOA 3ZO4A 1HCLA 4RX5A 3KXGA 5LMBA 3BGQA 3IW6A 3QTSA 4IAYA 3A7GA 2RFDA 3DKFA 3NUSA 3PZEA 2B1PA 4Y72A 4J8MA 3QXOA 3DNDA 4W9XA 4YHFA 4L42A 3ZMMA 4YTFA 5AR3A 4V05A 2VWVA 4U42A 2VTMA 1UU7A 3AQVA 4Z7GA 2GNJA 5F95A 5AMNA 4JDJA 5E90A 3RZFA 3SOAA 4O7RA 2HIWA 4FKQA 5HEZA 3AKLA 1YHWA 2YCRA 2PULA 3EQPA 2WIHA 3IDPA 3LCTA 3KRRA 3GI3A 5HOAA 1MRVA 1XQZA 2XS0A 3QQHA 4AZVA 5K0KA 5J87A 2UZNA 3O96A 5IQCA 4J95A 4BJJA 2OFUA 2NRYA 2W0JA 4PMSA 2RKUA 3V51A 3B8QA 4TNBA 4YLKA 5LVLA 2QLQA 3VF8A 1YHSA 2J50A 4RX9A 3MJ2A 4HYSA 3RK5A 3G6HA 2WGJA 2WO6A 3QGWA 3D5XA 4KS7A 4V0GB 4WT6A 2CSNA 5CT0A 4DG2E 2ZOQA 3C5UA 3DAJA 4WIHA 1ZOEA 4QMWA 3PUFC 2YLEA 2CNQA 4EOJA 3ZXTA 5HNBA 5CXZA 4AOJA 2XK7A 4NM3A 4YC6A 3QRTA 4AXAA 4D55A 4RQKA 2BRHA 3CGOA 3PP0A 4EQCA 4J53A 5DRBA 3NDMA 5A6NA 4YNOA 5CSPA 3OUNB 3ZCLA 4QMSA 2PVNA 4FK3A 4U80A 5JFVA 3UIUA 4NTSA 1UVRA 2YCSA 1OL6A 4U6RA 1OPKA 3REPA 3PRFA 3HV4A 3PSDA 3I5NA 4RA5A 1PJKA 3H3CA 4BN1A 1H01A 1H8FA 4JQ8A 3WZEA 3P7AA 4NIFB 4BGGA 2WFYA 4RIOA 1YQJA 3HKOA 5KE0A 4FTQA 3V8SA 4D28A 4R77A 1A48A 2GQGA 4FV0A 4MWHA 4FV1A 4ERWA 3VS7A 3EQDA 4IJ9A 2ETRA 4U44A 4X3FA 4AOTA 4XBUA 4HCUA 2HK5A 4BBEA 3HGKA 3PJCA 4W4VA 5AP5A 1XMMA 3O5AA 3N51A 2WMTA 4YU2A 3PPKA 1JAMA 5F1ZA 3PIYA 4PP7A 3U6HA 2J7TA 4X2FA 3W8LA 5I3OA 4CZUA 3COHA 4YC3A 3WF5A 4O7VA 5E8XA 3KF4A 3DFCB 3UTOA 2QR7A 3ZHPC 5FUTA 2FH9A 3IDCA 5F4NA 5KX8A 2E9UA 3QKMA 4IWOA 4GFGA 3FYJX 2X1NA 4FKWA 3BLQA 3GCQA 4CG8A 1OIQA 3BELA 4QO9A 1Q41A 4FTKA 3N4UA 2G2IA 3MW1A 3WF8A 4DH7A 2JD5A 3OWLA 3PVBA 2HWPA 2C5VA 4RQVA 3TUCA 3W2OA 4EC9A 4M69A 3L1SA 1OKWA 1DM2A 5IKWA 3DXNA 3U4UA 3TTIA 3SKCA 2BRGA 3TCPA 4E6DA 1ZXEA 4FX3A 5FDXA 3TKHA 5JKGA 5DEYA 3TYKA 5IH4A 4P4CA 5BNJA 1PXMA 1V0OA 2QO9A 1YHVA 4ZJIA 3W2SA 3ZLWA 4CRLA 3Q53A 4K0YA 4X2JA 2OI4X 3LQ5A 4ALWA 4DEAA 5AUTA 3TV4A 1GIHA 5BYZA 3KMUA 3Q52A 2X0OA 3ZRLA 4ZTMA 2XIYA 3II5A 3B8RA 3VVHA 4RC4A 4B8LA 2XJ2A 4EHGA 3Q9ZA 4EH9A 3N9XA 5DR9A 2VNWA 3E87A 3EH9A 1UNLA 2G2FA 3COIA 1GZNA 2F49A 3QHRA 3UIXA 1Q8YA 3UPXA 2ERZE 1JLUE 2PK9A 4F6UA 4UYAA 3PVUA 2O0UA 4JBPA 5CSHA 4YSMA 4DFXE 2C0IA 4LV7A 2YM3A 3RGFA 4YZ9A 2VTLA 4BBFA 4HOKA 2ZMDA 3W0NA 2YM7A 4MF1A 5B0XA 5H2UA 3UVQA 2Z60A 4DF3A 1YWNA 4DEEA 3CBLA 3O23A 1PXNA 4F9AA 4K1BA 5HO6A 3NYXA 4FG8A 4BDDA 1ZARA 4BWPA 4C4HA 4U97A 3OEZA 3BX5A 4GU6A 3G33A 2NNWB 3UO5A 2VTSA 3O51A 2XMYA 3LE6A 4FKGA 4AZEA 5ANEA 2C6KA 3JVRA 1OI9A 3H4JA 3PLSA 2QCSA 4NH1A 3EKKA 4XG6A 1NT2A 2QODA 3TWJA 5DG5A 3QX2A 4BYJA 2VN9A 2BRBA 2IG7A 3RINA 4M14A 2CKPA 3KREA 5GNKA 3RNYA 2WEIA 4IVAA 3VUTA 3POZA 1ZMVA 4MQ1A 4FI1A 2BZJA 4ZLOA 4MD8E 2O63A 3MVLA 3NEWA 1XH4A 3RALA 2PU8A 2H96A 3OOGA 1ZZLA 3H9OA 2A0CX 4BZDA 4TYJA 4RJ6A 1F0QA 1PXOA 4EK3A 4EWQA 5M08A 2BIKB 2JFMA 4EHEA 3R71A 4DYMA 1FBNA 5HVYA 1ZOHA 3FL5A 5E8VA 4GS6A 3EQCA 3PE2A 4RIXA 4EOIA 5HCZA 3SG9A 4JG7A 4HGTA 1JSTA 5FRIA 4LOPA 3MVHA 4MVFA 3VS0A 3ZBFA 3FUPA 4FR4A 4TYIA 2ERKA 4ZIMA 3BLHA 4ASDA 3T8OA 5IEYA 3R7EA 1U54B 1E1XA 5M44A 5EM8A 5HLWA 2IW6A 3D0EA 5EOLA 2JKMA 2QOIA 3GGFA 4YURA 2F9GA 3K54A 4YJNA 4ANNA 3BE2A 3QHWA 2R3PA 5M09A 3SW7A 4NW6A 3G15A 2GS2A 4MX9A 4E4LA 2X4FA 3ZM9A 4II5A 3H0YA 1YWRA 3F69A 1ZRZA 5HE1A 4PTEA 2PL0A 1BMKA 4I22A 4BCMA 5JK3A 2G2HA 2XRWA 2YAAA 2AC5A 3D7ZA 4I6BA 4AXEA 4YHTA 3EN6A 4C0TA 4EL9A 5JQ8A 2BZKB 4AN9A 4C4JA 4FSNA 4DH8A 3FLNC 3CEKA 4BHZA 5AR5A 3RTPA 5A4EA 4MXYA 2I0VA 5HLNA 3AC1A 3AGMA 5KKRB 2JC6A 2UW0A 4YGAA 3AMYA 4GT3A 2WMVA 2JIVA 4V04A 2CGVA 3DK7A 4FNZA 2BDJA 4NJ3A 1Q8UA 4D2TA 4O38A 5E8YA 4GVAA 3COMA 4RJ3A 3ANRA 4AA0A 3RNIA 4QP4A 1YI4A 4FT3A 4GT5A 4I5CA 4WUAA 1R78A 3FV8A 2P4IA 3S95A 2HAKA 3DB6A 3R73A 4DHIB 4ZLYA 4EEVA 4MK0A 4RIYB 4MBIA 5J7HA 2YCQA 5HVKA 2XIZA 3MPTA 5IA5A 3LW0A 3LMGA 3G6GA 3W2PA 3IO7A 3ZLSA 2OXDA 3OT3A 4I41A 3O2MA 3W0OA 4JL9A 4YJRA 1BYGA 2SRCA 3QQUA 4FL1A 1MP8A 4AX8A 1ZYLA 3PRIA 4TYEA 3ZUVA 5I4NA 3U6IA 5EHLA 3I4BA 3MFSA 3RAIA 4C4GA 2BVAA 4TKSA 2IW9A 4HVGA 5C8NA 5CAPA 2O2UA 4G17A 5I5ZA 3NLBA 3DS6A 3PSCA 3QLGA 3PWYA 4ZJJA 3TG1A 5JQ5A 3FMJA 3FQHA 2QOQA 3KGAA 3F5XA 3Q5ZA 4PWNA 3MESA 2YLFA 5AP6A 1CM8A 3GC0A 3MPAA 4CXAA 5D11A 4BBMA 4OAVB 5JFWA 3HRFA 4EK8A 3BBTB 4I24A 2XF0A 4R78A 2CGUA 5A9UA 3BU6A 3GCSA 3P7CA 1R3CA 3HA6A 4FZ6A 2OSCA 3FMMA 4GG7A 5AP2A 5FBOA 3ZLYA 4E93A 2WOUA 4AFEA 3W1FA 4LMUA 3S3IA 1DI8A 3G2FA 4L7FA 2E9OA 4LGGA 3QRIA 5DWRA 3SQQA 2ETMA 4IX5A 4WNKA 4JS8A 2PUPA 4QDEA 2IVSA 2ZDTA 3A7JA 3PXZA 3WZDA 1OL1A 1VYZA 2EXEA 5ICPA 1KE5A 4JR3A 4O0WA 4RWKA 4F70A 4GL9A 4BHNA 3FC1X 4AT5A 4W4XA 1VZOA 1YDRE 5J95A 4DHJA 4AZFA 3ZZWA 2B54A 5CLPA 2PVHA 4IWPA 3R30A 3AC8A 3T3UA 2XAOA 3B2TA 3F2NA 2DQ7X 2QI8A 1WFCA 2XBAA 3DPKA 3WF7A 2BALA 1YXSA 4G9CA 4CYIA 3C9WA 3EFLA 4WD5A 5J1WA 5AV1A 2ITZA 3O8UA 5CX9A 3BHHA 2G15A 2WEVA 2HENA 4HJOA 4IE9A 4AAAA 3GENA 4MYGA 3HZTA 4BCHA 4RJ4A 5IPJA 5CVFA 4MBLA 5KUPA 3ZSHA 4YBKA 4BCNA 3CQWA 2C6OA 4GJ3A 2Y4PA 4C7TA 2YAKA 4NSTA 3ZFMA 4BDJA 3GCPA 2XKEA 4R1YA 3PTGA 4YMJA 4GV1A 4FKIA 5L4QA 3FAAA 2WKMA 5L6PA 4M3QA 5HE3A 4BDBA 2YDKA 3A62A 2OZOA 4XX9A 4JT3A 4BKYA 3VBQA 2WELA 3E88A 4XH6A 3KCFA 4HNFA 4WA9A 4AOIA 4EYMA 3PPJA 4UALA 3UC4A 2DYLA 2GSFA 3O8TA 3IW4A 4HCTA 4J71A 4L45A 4GK4A 4MNFA 3SXFA 1DI9A 1Q24A 3MTLA 4FTOA 3QFVA 5IEVA 2BDWA 1OKVA 3SW4A 4KSPA 4N6YA 1BL6A 4L44A 2CCIA 4H3BA 2QU5A 5HESA 4RZVA 4BFMA 1E1VA 1W83A 4FVRA 2VWXA 4RLLA 4BIDA 3R8MA 5J5TA 2BIYA 3O7LB 4ENYA 4KKGA 4OTIA 5BVFA 4LG4A 3OWKA 2BR1A 4F09A 4MXAA 4LDTA 3DY7A 3Q9WA 3TDVA 2YHVA 5CZHA 5CF6A 4G1WA 3BHVA 5D41A 5DGZA 3ZUUA 4EQMA 5DN3A 4H39A 2W5BA 2PZPA 1GIJA 4CFMA 4FV3A 3LCKA 5D10A 4A4XA 4DT8A 2R2PA 4G2FA 2RF9A 4FKOA 3AC3A 3OF0A 4G34A 3A7IA 1B38A 2HW7A 3NWWA 3R7UA 4ZSAA 1OUYA 3E93A 5LMKC 3VAPA 4S31A 1ST4A 1XBAA 2BFXA 4RT7A 2VTNA 3E64A 5AR7A 2YDIA 4BCJA 3NSZA 2YIYA 5BVDA 1QPDA 3R6XA 4BY9E 2B0QA 4HGLA 3GU7A 3QWJA 3HMNA 5EW8A 5BVKA 4RIWB 3R8LA 3TT0A 2J4ZA 4O4BB 5ACBC 1H1QA 1KE9A 4BR3A 2OBJA 4RRVA 4HVSA 3EYHA 4CFNA 5LXMA 1YOLA 4CCUA 5FXSA 3PVGA 3HMIA 3ZC5A 5CEPA 3PLAE 3HAVA 3FWQA 3DA6A 4M15A 4Y83A 2I0YA 3ZEWA 4CT2A 2UZEA 4E7WA 4BC6A 4AZSA 4EQUA 5M53A 2BUJA 4I6QA 4WBBB 5BVEA 5TE0A 3U6JA 2ZFYA 4CEGA 5FP5A 1Y6BA 2C1AA 2UZUE 3TMOA 4JBOA 3H0ZA 1LR4A 4KUJA 4FMQA 4NUSA 4X21A 3RI1A 4D4RA 3OCTA 3A8WA 4UY9A 4O7LA 2V7AA 2P2HA 4H1MA 4EORA 5ANKA 3UVPA 3PJ8A 3R22A 4R7HA 3EZVA 3QXPA 3UOKA 2PUUA 2X6DA 3EB0A 4BTKA 4HW7A 5J1VA 1SNXA 2Z7LA 4RWLA 4DAWA 5BMMA 2C6DA 5HD7A 4ZY4A 4XV9A 4IM2A 4Q2AA 3P23A 4IBMA 1WBOA 5CAUA 2YDJA 3GP0A 4R3CA 3CGFA 2X4ZA 2FVDA 4F4PA 2UZLA 2WAJA 3DQXA 4O4EA 4FF8A 1WZYA 5L2WA 3EFWA 3EQIA 5CF4A 2WQEA 2UUEA 4XP3A 5EG3A 3QTRA 1Q8ZA 3OCSA 2OLCA 2HW6A 5DE2A 4EYJA 2O8YA 4ANSA 2Y4IC 3QRKA 1KE8A 3NGAA 2CN5A 5JZNA 4UX9A 4K2RA 1QPEA 4JOAA 4PTGA 4A4LA 2V55A 1XO2B 3BKBA 5FTOA 2QOCA 4L01A 3RWQA 2X7GA 1PW2A 5FD2A 5TOZA 4DCAA 2W4OA 3G90X 4D2SA 2X6EA 3KXHA 2BZHB 4O4CA 2XKFA 3GVUA 4RJ8A 5AIRA 2EXCX 5CF8A 4PMTA 3DKOA 3NUAA 3WF9A 4BTFA 1YDTE 4GJ2A 3L9LA 3ZFXA 5GHVA 3TACA 1NVSA 4LI5A 4PDSA 2PZYA 3UE4A 4O4FA 4CG9A 3C0HA 2VTQA 2VTTA 3LFCA 2BTSA 3QYZA 4IW0A 5BUEA 3ZOSA 4BJJB 2WTKC 3BE9A 3FLYA 1GZOA 3AOXA 4RWJA 4JBQA 1YXVA 2GTMA 3DTCA 2VWWA 1UA2A 4IX6A 4RC2A 3T9IA 4ERKA 1W2FA 4IHPA 3RPVA 5KMNA 1QPCA 3FMLA 4HVIA 4ZEGA 2YEXA 1UV5A 4GK3A 4CKJA 3UOJA 1OUKA 3R7IA 2EB2A 5H3QA 3VUIA 5G1XA 4QP7A 4X6QC 5FG8A 1UWJA 4EZ7A 4DBXA 1JQHA 5ANIA 4AW5A 4OR5A 3ORZA 5C9CA 4MUQA 4YJSA 2BZIB 4H36A 1PXJA 4D5HA 4EKKA 2XYNA 4FV9A 3SDJA 4EH3A 3SHEA 4M67A 3A7FA 3R2YA 5J9YA 3W8QA 4W9WA 5ITAA 3KMWA 3QA0A 3DBCA 3HECA 4JQ7A 2EB3A 3CTQA 1O9UA 4IZAA 2Z7QA 5CF5A 3FI8A 4GSBA 4JRNA 5JT2A 4NW5A 1B6CB 5H9BA 3VRYA 3OHTA 2J5EA 4QEBA 3GEQA 4E5BA 2JIIA 4O0XA 2QONA 3ALNA 3VBWA 4USDA 4FSTA 1ZMUA 5IA2A 3F66A 3QTIA 4O0TA 5CEOA 5HG5A 3S1HA 1KSWA 4X3FB 4HVDA 4JX7A 4D2RA 2V0DA 3C4CA 3P5KA 2W99B 3QCSA 3I6WA 1YXTA 5CYIA 3SC1A 3UC3A 3VWAA 2WB8A 4P5ZA 2JDRA 4E5WA 2HCKA 4X3FC 4E6QA 3ATSA 1WBNA 4F0GA 4USFA 3OS3A 4FJVA 1OECA 2XIKA 4QNAA 4XV1A 3ZUTA 5HNIX 4J1RA 5ANJA 3QZGA 5H8EA 4AE9A 4MXZA 5EKNA 1NVRA 2RFSA 2R4BA 2ZV8A 4UN0C 1MQ4A 5IZFA 2YA9A 4GUBA 5HG7A 3W18A 4M0ZA 3Q4CA 4S30A 3Q4UA 4LYNA 3HDMA 3W0MA 4MWIA 3Q5IA 4IZ5A 4M69B 4FV6A 3EQGA 4DLJA 4KNBA 4H1JA 5BV3A 3ODYX 3PZHA 3PDTA 3AD4A 4IX3A 4FTRA 3NCGA 5KMJA 4N4SA 3UODA 3AXWA 5HE2A 4EH7A 2C0OA 5L2QA 4IACA 3IOPA 4IWQA 4WUNA 1OBDA 4FTJA 3QKKA 4KIPA 5BX0A 3DTWA 4I5HA 5CWZA 3VHKA 4HPTE 5IMXA 1QCFA 3ALOA 1CKIA 3P86A 4C02A 2F57A 4FUXA 1BI8A 4FTMA 1SYKA 4O21A 2ITWA 4YC8A 3ZM4A 3FZRA 4JDHA 3RM7A 2FYSA 4BGQA 5KBRA 3LM5A 1TVOA 1PKGA 2BILB 1J7IA 1MUOA 2NYAA 3DOGA 2YM5A 4TT7A 3BYMA 3IS5A 4FSYA 5EH0A 4BCOA 1UNHA 3QLFA 4XG8A 2I1MA 2V7OA 3FZOA 4ZTLA 3DV3A 4JIAA 1WAKA 2B7AA 4AZWA 2XRUA 1V0PA 5T6KA 3TTJA 3U55A 3L9NA 4R5YA 5GIPE 1UNGA 3FBVA 4TN6A 3ZYAA 2W1IA 1AD5A 4EOLA 3BI6A 4C2WA 5A6OA 1V0BA 2VTAA 3NUXA 5BUJA 4NL0A 3ENMA 4IAFA 3G0FA 3UO4A 3KRLA 3WF6A 1IG1A 3VO3A 2I0EA 2OJIA 3BYUA 2O5KA 5BPYA 1ZYJA 2HY81 3VUKA 2GPHA 3NUNA 3UG2A 2CLQA 2QHMA 1H08A 4AACA 1KV1A 3P08A 2PVFA 3KRXA 2FSTX 5CAVA 3EKNA 3DLSA 3VUGA 4YTHA 4BDEA 4J98A 4WNPA 4PY1A 4QMQA 2HXLA 3FLZA 4BDHA 5K4JA 3OC1A 3NFGB 4BI0A 3K5VA 3W0RA 4L3JA 4V01A 2XYUA 2V5QA 3FI3A 1JKSA 3HUBA 3Q9XA 4HZRA 1CKPA 3S4QA 2PMLX 4TY1A 3R9OA 4CGAA 4DGMA 3OXIA 4Q9SA 3KEXA 5E8TA 4NKSA 2E9NA 3WE8A 4RIXB 5CSVA 5IUHA 4FIFA 2CHLA 4BDFA 5HQ0A 3F5PA 4I0RA 2G1TA 3F3VA 5HNGA 4L6QA 4EH4A 5CEMA 5EQYA 4PQNA 3SLSA 4E20A 4BCFA 2FSMX 3NAXA 2R3IA 3LFDA 4GFOA 3TNHA 2KULA 4ZTRA 5CEIA 5ANGA 4CV9A 1J3HA 5IDNA 3VS1A 1J1CA 2VGOA 3OMVA 2QKRA 3TKUA 4MHAA 3GU6A 2BPMA 3OOMA 3AT2A 4OT5A 3HV6A 3TZ9A 4CTBA 3R00A 1Q97A 1J1BA 2QOBA 1XH8A 5JRSA 2FB8A 4OLIA 4HGSA 1WBVA 4MXCA 2Z2WA 3RPSA 2XK9A 3KMMA 2VUWA 3CSVA 3ROCA 3RBWA 3GFEA 4O27B 2X2MA 3R04A 3PXKA 4LGDA 2CN8A 2VU3A 4F9WA 1LUFA 3DCVA 4K33A 4HYIA 4O0YA 4QQCA 3LMIA 1J7UA 1ZLTA 4QOXA 2J51A 1BKXA 1REJA 4I20A 4U79A 1FQ1B 4YJPA 4F9YA 5A4TA 4YZNA 4IWDA 2OW3A 3R9HA 4AW1A 4QDVA 4BKJA 3EN7A 5KNJA 4XUFA 4JQEA 2XNPA 4E8AA 5CU2A 1APME 4U3YA 5AUYA 5LCKA 3ITZA 5FDPA 4FKJA 2P55A 4PMPA 2YWVA 4MXXA 2HYYA 2BROA 5E8ZA 2C6EA 3BYSA 1PMEA 4KRCA 2UZBA 1KOBA 2PMIA 1K9AA 4FGRA 1NXKA 3PIZA 4CT1A 2ITPA 2AC3A 2OF4A 3PSBA 4D0XA 5AX3A 4FZDB 2YERA 2BTRA 4N70A 1YI3A 3WZJA 4F7NA 3BWJA 4YP8A 5M4CA 2J90A 3TZMA 4QRCA 4DFLA 4PL4A 4KBCA 2Y0AA 4AXFA 2BAKA 2IVVA 4GYIA 4HGEA 3KXZA 4KWPA 4L3PA 3R8VA 2R0IA 5L2IA 1H07A 1IAHA 3V5QA 5CAOA 5H8GA 5HTIA 2WMSA 3KXMA 4NTTA 4AGDA 4ZXTA 3TI1A 4HVHA 3UO6A 4IDTA 3CIKA 3KCKA 3QBNA 4XV3A 1Y57A 4RVKA 4ZY6A 3O71A 3PUPA 1S9JA 5EYMA 1Q62A 5AAGA 5FTGA 3IQ7A 4FVQA 3QU0A 4TYHA 3ZH8A 3JY0A 3ZFYA 3TIYA 3ORPA 3F7ZA 5HTBA 3UDTA 4JVGA 3R8UA 3HP2A 1YVJA 2E9VA 2WQOA 3OD6X 3VJNA 4O81A 2XK8A 3M11A 5AV0A 5KBQA 3SXSA 4ZSLA 3NNUA 4EBVA 5J9ZA 3GC9A 4FL3A 3BYVA 3Q6UA 2OFVA 4ITIA 3GB2A 2OF2A 4AGWA 3UPZA 2GMXA 4C8BA 4YO4A 5IA0A 4O84A 4FOCA 4QQTA 3OG7A 2PVKA 2VX3A 2IZSA 3DLZA 3K3JA 3ORXA 5CZIA 3OW4A 3QUPA 2OXYA 3WOWA 4ANMA 1DAYA 2WZJA 4FNYA 1O6KA 4ZOGA 1ZWSA 2X39A 3NX8A 2ITQA 3PPZA 3W2CA 4KIKA 4E3CA 3HA8A 5IUIA 2PVMA 4L53A 3VHEA