4AXAA

Structure of pka-pkb chimera complexed with (1s)-2-amino-1-(4- chlorophenyl)-1-(4-(1h-pyrazol-4-yl)phenyl)ethan-1-ol
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title At13148 is a Novel, Oral Multi-Agc Kinase Inhibitor with Potent Pharmacodynamic and Antitumor Activity.
pubmed doi rcsb
source organism Bos taurus
total genus 112
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4axaA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axaA02
3ZRKA 2IN6A 3EMGA 3DB8A 4EH6A 2QG5A 4PMPA 1PRYA 4U8ZA 4XLVA 5C8KA 4V0GA 3C4FA 5DMZA 1B39A 1ZYCA 5IQHA 1H28A 4JDJA 3NCGA 2ZYBA 4RFMA 3DK3A 4D55A 5L2TA 1QL6A 2PWLA 2WB8A 4QTBA 4AN2A 4L3LA 4GG5A 2R3QA 4UMPA 3DKGA 5G1XA 2P3GX 3MFUA 4NKAA 4YJRA 2IPXA 3UZRA 2XKFA 4UYAA 3UPXA 1YW2A 1QPDA 2X8IA 4AE9A 2NO3A 2XIXA 5EM8A 3PXKA 3ZDIA 3TJCA 4G3GA 4L7SA 4K6ZA 2XB7A 4U42A 5HO8A 1GZNA 4CCUA 1ZMVA 5CEKA 4K1BA 3W18A 5KX8A 3HA8A 4QMMA 4U80A 1BX6A 3ZO1A 4NH1A 3S95A 3OROA 5M09A 2VTQA 4EKKA 4JAIA 2O5KA 3Q4ZA 3R28A 2W9FB 5KMLA 5AWMA 2WZJA 3VUKA 4AZFA 5DG5A 4EEVA 4L52A 4NFMA 4FSWA 4DCAA 2O0UA 4FSUA 4YC6A 4TYJA 4DTAA 4M15A 4H1JA 4AWIA 3FC2A 5AP7A 3W2OA 4DTKA 3IDBA 3QTQA 3K2LA 3ZZWA 1FPUA 5CVFA 3EQCA 1FGKA 3LE6A 4PTCA 2KTYA 4BYIA 1R0PA 5F95A 3ORNA 4YHFA 5BMMA 3QTSA 3LLAA 2QKWB 2CJMA 3A8WA 3GCPA 4C3PA 3OW4A 3MWUA 2YFXA 1OL2A 3EN7A 2C30A 4F0FA 3PWDA 3POOA 4R3PA 3D7TA 5DGZA 4O0TA 5IUGA 1OGUA 3BYOA 5BVWA 4EWHA 4BDCA 4QMZA 5CEQA 4I92A 3MESA 2W1CA 1IR3A 2XNOA 5FEQA 5EKNA 3RWPA 3DLSA 4BCNA 5JK3A 1DAYA 3PRIA 3PDTA 2RIOA 4RZWA 2PSQA 2W06A 4FZDB 2IJMA 4BDFA 5JFWA 5D10A 4AT5A 4D9UA 5K3YA 3SDJA 4APCA 2Q0BA 4ITHA 3QCXA 5F9EA 1UU7A 1WMKA 5L4QA 2CPKE 5AR2A 5LCKA 2O63A 3FUPA 4RQKA 4D2VA 4BY9E 3NYNA 3HKOA 4JBOA 4XOYA 3SV0A 2CLQA 2VX1A 2F2UA 2YM3A 4O6LA 3DS6A 2YWVA 4QQCA 4GSBA 5BVFA 4HPTE 1Q8ZA 4Y72A 3BGPA 4MCVA 2ZV9A 4C02A 1WBWA 3Q4CA 4P7EA 3Q5IA 4QRCA 5AP5A 5ETAA 3SLSA 1WBOA 4DFZE 2C3IB 2IVTA 2YJSA 3Q9ZA 4F0IA 5L8LA 4ASEA 4M0ZA 4APPA 2YAKA 4QYFA 4OTGA 3O0GA 3C4WA 5AM6A 5AIRA 2G2HA 4DG0E 3Q04A 4QPSA 4EOQA 1NVSA 4YC3A 3QD0A 4RBLA 3PY3A 3RTPA 2XJ2A 3RAKA 3G5DA 4ANLA 3R7GA 4P4CA 5JN2A 5TOZA 2WMWA 4U81A 3WE4A 3AXWA 3V5JA 3HV5A 3TACA 3TIZA 1KE6A 4FSMA 2HWPA 3RNYA 3HMNA 4XG6A 4EOPA 5JFVA 3PIZA 1JKKA 2W05A 4YTFA 3VHEA 2IZSA 4EQMA 3LM0A 4F63A 4Z7HA 3AMYA 4FT5A 1TQPA 4IM2A 1UU8A 4QNAA 5A14A 3UO5A 2G2IA 3PY1A 1OKYA 3SOAA 3D5XA 2HCKA 3UMWA 3D9VA 1UA2A 4U45A 3BBTB 5DLSA 4U40A 3UOKA 4GFOA 2BTSA 2QQ7A 3NAXA 4QOXA 4G3FA 4NZWB 2XM9A 4FT0A 5JQ8A 3RPOA 3NNWA 3O8PA 2QHNA 2XM8A 4KIQA 2F57A 4WUNA 2BRHA 1Y8YA 3PVUA 4DGNA 3H0ZA 4BWKA 4OAUC 5IA4A 3F5PA 5CEMA 4RQVA 4GJ3A 3QL8A 1YI4A 4NK9A 4Z3VA 3DK6A 4RGJA 2PL0A 4F6WA 2B9HA 2ZM3A 5EQPA 3R8VA 3PVWA 1KE5A 4MWHA 2YZAA 1PXNA 4BRXA 5IISA 3SGCA 4M97A 3VUMA 2WMBA 2P2IA 3RINA 3RZBA 1MRVA 4FTCA 4AN3A 1Z5MA 2BFXA 2GFSA 4EK5A 1TVOA 4EQCA 1RW8A 2QHMA 3BWFA 1HCLA 3VUIA 3R02A 4A4XA 3ATTA 4FEXA 5BYLA 3JXWA 4GCJA 4O22A 2H9VA 3LIJA 2X39A 4QP8A 4RX8A 4AGWA 1ZXEA 4P5ZA 3DT1A 1KUTA 4R3CA 4PWNA 5KBRA 2O65A 3BGZA 3CY3A 4BTJA 2H34A 5EFQA 4GIIA 1OZ1A 2JIVA 2WQMA 3EFLA 2ITYA 2VUWA 3RK9A 3UYTA 5EI2A 4KUJA 2EXMA 3MB6A 4PL5A 1YKRA 5AUXA 4HVIA 4NM0A 4ZY5A 1FQ1B 4CYIA 4KBKA 5A4QA 2IVSA 2JFMA 1OL1A 4L68A 4AZSA 3P7BA 4BCPA 5FD2A 3I79A 2GQGA 4JG7A 4FYOA 3RBWA 3C4CA 3LFEA 3Q2JA 2HZ0A 2XIKA 4XUFA 4IADA 5IA0A 4BCMA 3KRWA 4K11A 2QVSE 4XH6A 4IX6A 4NSTA 5FGKA 3DB6A 4CFFA 1WCCA 1Q5KA 3OT3A 3P78A 5JQ5A 4KB8A 2R3JA 3AT3A 2ITQA 4ZSJA 3MTLA 3QUPA 4MQ1A 5FP5A 2Y4PA 3PVBA 3KFAA 3D7ZA 4NM5A 3WYXA 4E26A 4DCEA 4JQ8A 4KS8A 2UW9A 3DBDA 2X8EA 4QMPA 3TL8A 4Q9ZA 2G9XA 3OY1A 3CP9A 3HV6A 5EW9A 1A48A 4O84A 2GTNA 1SVEA 2XK8A 3DTCA 3ZLWA 5I4NA 3SVVA 3D5UA 3MIYA 4DA5A 2C0IA 4IMYA 4PMSA 3U87A 4RMZA 4L45A 4IACA 4UMUA 5K0XA 4PL3A 3SA0A 5LCJA 3DAJA 4NCTC 3ORPA 3PJCA 2BIYA 3IDCA 2VV9A 4ZLOA 3DJ7A 3HV7A 1XBCA 4C37A 5JZNA 1CSNA 3IOKA 4D1ZA 2VTTA 3ZOSA 1SZMA 2I0YA 3NUUA 3VVHA 3LFDA 2VNWA 2OLCA 1WVYA 3EFWA 4AF3A 2XVDA 3SQQA 4YLJA 4D4RA 2FGIA 3ZLSA 2UVXA 3G51A 1GAGA 4AT3A 2GNIA 3ALNA 1DI8A 1LUFA 1CKJA 3DNDA 5GJGA 3RGFA 4C0TA 3UPZA 4NJDA 1NA7A 4EK4A 2YLFA 4MVFA 3CQWA 4U44A 3NYXA 4XCUA 5HNGA 3EWHA 4B4LA 3U55A 4QP6A 2UZEA 4KA3A 5D41A 4HNIA 3QAME 5BUJA 5M51A 2AC5A 5JFSA 4ZXTA 3R21A 2WXVA 4FGBA 4O0UA 2WKMA 4GS6A 2ZM1A 5AAGA 4RWIA 1CKPA 4RZVA 3O50A 4O7WA 2Z60A 4QMVA 2GCDA 3TKIA 4KRDA 2HOGA 3R1NA 5J95A 4RX5A 2H96A 5DRBA 4O7LA 3RPRA 4CNHA 4CKJA 3DBEA 3LXKA 3FZRA 3BPRA 3NX8A 3V5TA 3Q6UA 5HD7A 3WYYA 5CAQA 4RA4A 2R7IA 4YZCA 2OJ9A 3OCTA 3ZLXA 3TIYA 2J90A 3UIUA 5TE0A 1Q4LA 4IWPA 2PU8A 4F9AA 4YZBA 4CZUA 4GFGA 2VTPA 1PMEA 3PWYA 3MVLA 4IX4A 4YMJA 4USEA 3QCSA 3BYMA 4NL0A 1JVPP 3RI1A 3NNXA 3OOGA 5DR9A 3LHJA 3I5ZA 4A07A 2DWBA 2R7BA 4RVKA 2W4KA 5IEYA 5KHWA 4GU9A 3NUPA 3R22A 5GJDA 4M84A 3I4BA 3QTIA 2ITVA 3ROYA 1JWHA 1H4LA 2J6MA 2VGOA 3E8CA 3TXOA 4AA4A 2XNBA 5AP2A 4BBFA 4EZ7A 4ZLYA 1BYGA 1H8FA 2CCIA 4ZAUA 3MSSA 4HOKA 4EI4A 2WPAA 4ZTHA 3BELA 4CV9A 3POZA 4BWPA 4TYHB 2NPQA 3VQHA 5KCVA 5H8GA 2W5HA 3TNHA 1OIRA 4W8DA 5EW3A 4D2PA 4E20A 1FOTA 1Q41A 3DXPA 1NW1A 3NVKI 2PE1A 3LMIA 4TYHA 4X3FB 5GIPE 4QMWA 2OICA 3MFSA 4C4EA 4IAZA 2PMNX 1UNGA 4CFVA 1XO2B 4JDKA 5AA9A 1OL5A 3UC3A 3ZBFA 4JG6A 5DBXA 4ZIMA 2BZHB 4ITIA 1JQHA 3Q4UA 5C8MA 3R7VA 4BI0A 3AGLA 4KINA 4X3FA 3VBXA 3HV4A 3WBLA 3FZSA 1YWNA 4YO6A 4QTEA 3WZJA 1B6CB 4E4XA 4XNEA 2F49A 4CTBA 4EZ3A 3DKOA 1YXXA 2ZJWA 4WSQA 4C35A 3O7LB 1XWSA 3EHAA 3IDPA 4GT4A 4OTRA 1Q97A 4YPSA 5H8BA 3R9DA 3SXRA 3ZUUA 4EHEA 4EK8A 4QQJA 5M08A 2XMYA 4JDHA 4B8MA 1W0XC 3DK7A 5CEOA 3C13A 2YJRA 3ORTA 5KMOA 4RX7A 3Q60A 2XBAA 4UXLA 3OS3A 2XRWA 4ZEGA 3V5PA 4FGRA 5KHXA 2WTIA 5FDPA 5HLNA 3MN3A 1H1WA 1YOMA 4IB0A 1J7UA 2ITXA 5EYCA 3EYGA 2UZNA 3QWKA 2AUHA 2Y0AA 1JSTA 4QPAA 5M55A 1QPJA 2RL5A 4WKQA 2B1PA 4YHTA 1XHAA 4G17A 3E63A 4ASDA 4CTCA 5EM5A 4CMUA 1KOBA 4E1ZA 3BLQA 4EOKA 2A19B 2Z7LA 4BF2A 4DEDA 4M0YA 3A7HA 3OD6X 4F99A 3GCSA 3FMKA 4B6LA 2EB3A 2I0HA 3FHRA 4GIHA 5AM7A 4ALVA 1O6LA 4O1OA 2BFYA 4IC8A 4C3RA 3CTQA 3F5GA 4IVAA 1JBPE 5ANEA 4ENYA 3NVMB 1YWRA 2DUVA 1RE8A 4KSQA 3PJ2A 3L1SA 2XNGA 5H9BA 5A54A 3NWWA 3Q52A 4B0GA 1KOAA 3CCNA 3L8SA 5BUEA 1M52A 3OEZA 4O7SA 2WTWA 1BL6A 3QWJA 4I0RA 3P7CA 3CD8A 2GSFA 1IEPA 5E4HA 4ZJIA 2WEVA 2VWWA 4XP0A 4ERKA 3ZUVA 4UV0A 1UU9A 4BDDA 2P2HA 1RJBA 4IEBA 4O0XA 4ACHA 2W4JA 1HOWA 3OWLA 1FGIA 1H1QA 2R5TA 4G3CA 3EFJA 4WSYA 3AOXA 2UZTA 4AOIA 2QOCA 4GYGA 3G0FA 2C5VA 2OIDA 3EN4A 4G5JA 4BDBA 4CFWA 1FBNA 3O51A 3PLSA 3EKKA 4MAOA 4OLIA 3E7OA 4D0XA 5C01A 3HMMA 4I24A 4GH2A 4YJUA 2G2FA 2XJ0A 4ZTMA 5J1WA 1CDKA 3A7JA 2J7TA 3ENMA 5GIOE 2CCHA 5DRDA 5H2UA 4DGOA 3MY5A 4ZMFA 3UTOA 4O0RA 5HCXA 4LGHA 2CKPA 4M8TA 3AC5A 4NEUA 4F7JA 3M11A 2ZOQA 3NDMA 2IZRA 3C4ZA 4O7RA 4CV8A 4UZDA 1JOWB 4ACMA 3GOKA 3FV8A 3H10A 5DEYA 4Y5QA 3OY3A 4FT7A 2E9UA 4AU8A 1M7QA 4PTGA 2GDOA 4HCTA 1ZOHA 3JYAA 3NEWA 3L9MA 2VWUA 2CKQA 2XK9A 4L3JA 4UWYA 4HCVA 4X3JA 4ZLZA 3EQIA 4BBMA 2CLXA 4TWOA 3UODA 4IVCA 2F9GA 4IVDA 3UQFA 2VWIA 1ZMUA 3P4KA 4YNOA 3AD4A 4GUEA 2QURA 4XG2A 1YHSA 5IQDA 3UYSA 1SMHA 5IUHA 3MV5A 5B0XA 5CSVA 4BKYA 4C7TA 3LFSA 2I1MA 4H58A 3FI8A 4G6NA 3GFEA 4C36A 3GUBA 5FRIA 4EOLA 2RFSA 2VO0A 2WELA 3TKUA 4RJ4A 4EZ5A 3BIZA 5K5NA 5CZIA 2RFNA 2NNWB 4AXAA 5D9HA 1FVVA 5IA5A 4OTIA 3VNTA 2OJFE 4Y83A 5CF8A 3MY1A 4P90A 4WG5A 5HOAA 3R9HA 4IHPA 3HUBA 1WAKA 4DH8A 3HRCA 5A3XA 3BHTA 2OBJA 5EHYA 4EL9A 3IK3A 4F09A 4J98A 3JVRA 3CTHA 4IQ6A 4JBQA 5E8WA 4EK6A 1VEBA 4RJ7A 2C6TA 5BVDA 2FSTX 3FI3A 5EYDA 1URWA 2OF4A 3WF9A 3AG9A 3IG7A 3IPHA 1K3AA 3QTZA 4AW2A 3QYZA 1JLUE 4EH9A 5HVKA 3ITZA 2X6DA 3OFMA 4NCTA 3W16A 4FV8A 4LV8A 4CYJA 4DBXA 4B99A 4O6EA 3KXHA 5DI1A 3CC6A 2P4IA 3UVPA 4W9WA 5DN3A 1IAHA 3R73A 5E8YA 3OEFX 3FLQA 4H3QA 4EONA 5ETCA 4NYEA 3W2RA 3Q6WA 3P5KA 4TYEA 3IW5A 4MXAA 4FIEA 4N4SA 4UBAA 5HG8A 2UVZA 3HRBA 2LGCA 3K5VA 4D1XA 3D83A 4FF8A 1M17A 3JVSA 3VRYA 2YM4A 4L44A 1YRPA 3V5LA 1XBAA 2ZB0A 3E5AA 4J96A 4W4YA 2PZ5A 2PUIA 2G1TA 5EH0A 2PUPA 3OUNB 2BPMA 5IU2A 3TZ9A 4O0WA 2W7XA 2HXQA 2BCJA 3FXWA 3MDYA 3BV3A 4EH8A 2ITOA 3FBVA 5CI6A 1BKXA 4FTUA 3GU7A 4ZP5A 5FWKK 5K0KA 4DG3E 4ZS4A 3EL8A 1H01A 4IAYA 2WMAA 3LXPA 4RVTA 2BTRA 4XLIA 2XP2A 3Q9YA 3VWAA 4DEBA 2OJGA 5EK7A 4J7BA 3V8TA 2ITWA 5CAVA 2W96B 2WD1A 2YLEA 4EBVA 5HTIA 5L8KA 1Y6BA 3UP2A 1L8TA 3F2RA 4LOOA 4FTMA 2UW3A 2XYNA 4FKPA 3UBDA 4D5HA 1LP4A 1YXSA 2QKRA 1WBPA 4IX5A 4E3CA 4OUCA 2UZUE 4U3YA 4EC9A 2C6OA 3VBVA 3VC4A 1BLXA 1W7HA 3PP1A 2PMOX 4XEYA 3NUNA 4MBIA 4MXCA 3CJGA 4C3FA 4UB7A 3QFVA 3R30A 2ZAZA 4I3ZA 4JLCA 2X7FA 3R00A 1AD5A 3C9WA 3CQUA 2C69A 2OZAA 5B7VA 4DEIA 5I5ZA 4M66A 4PUZA 3DZOA 3QRUA 4NJ3A 4IM3A 3UO4A 3LFNA 2X2MA 2XYUA 5HX6A 2BZKB 4L42A 1YQJA 4BI2A 1GJOA 1Q8TA 3UO6A 5HNBA 2BAQA 2X81A 3WZKA 3FI2A 1Q8YA 3CIKA 3PPZA 2V22A 4FTKA 4I4EA 4NM3A 4YJQA 4FKQA 4ALUA 3SOCA 2WOUA 3GC8A 3BHYA 3JY0A 4GYIA 5J9LA 3D2IA 2BALA 2Z02A 3EH9A 1VYZA 3V6RA 3UC4A 3PRFA 3QF9A 4MQ2A 1E9HA 3VHKA 3WILA 4D4SA 4ERWA 4ORKA 4QYGA 3HLLA 2UZLA 4ZY4A 4OTDA 2XJ1A 3PPKA 3BYUA 2J4ZA 3HMPA 3DFAA 5ANKA 4F0GA 3NW5A 3ZMMA 3DA6A 2O2UA 2QC6A 5HE2A 2FB8A 3B8QA 2BILB 3GQIA 2QOOA 4WBOA 4ZSEA 3U9CA 4F6SA 3T3UA 2ERKA 4RIXB 1CM8A 5KMNA 4LUEA 3ENHA 4P5QA 5FM3A 1OMWA 4U3ZA 2JLDA 5L8JA 5T68A 3MVMA 5E1EA 3VJNA 3VS6A 3GCUA 4EOMA 4TNDA 3FDNA 4JOAA 5J87A 3ZSHA 1VYWA 3DY7A 3CR0A 3AC1A 3UQCA 1OL7A 3QX2A 3ELJA 3LCDA 4V01A 1WVXA 2A0CX 2P0CA 4LL5A 4QP7A 4ACDA 4DGMA 5KMJA 2VNYA 4I6QA 3COKA 1PXKA 2PZIA 4PDOA 1ZOGA 5IDNA 4DEHA 3FMMA 4AS0A 4EOJA 2HZ4A 2OIQA 2C6KA 4FODA 4F1TA 3H3CA 2QOLA 5JKGA 3W8QA 4B9DA 1B38A 4JIKA 5CANA 3IO7A 2XF0A 5ACKA 5L6OA 3R8UA 5JFXA 3D0EA 4W8EA 2X8DA 3RPVA 3KXXA 4YC8A 4YJVA 3ZFXA 3HMOA 1S9IA 4PMMA 2BUJA 5D7VA 4CKRA 4EOOA 2OKRA 1A06A 3LOKA 5K4JA 5L2WA 3ZZEA 3GU5A 5F94A 1WBVA 4N6YA 5ACBC 2WEIA 4IJ9A 4XYFA 4F7NA 4GMYA 3SRVB 2GNLA 3NIEA 2YM7A 3F5XA 2VO7A 1OUKA 3ZTXA 4RIYB 3ZC5A 4ACCA 4HYUA 3QBNA 1T46A 3OXTA 4O7VA 3TZ8A 1F0QA 1G5SA 4J8NA 3SRVA 2YITA 1APME 5HIBA 4KKEA 4IFGA 2XIRA 4KS7A 2JC6A 4KIKB 4DYMA 5AEPA 2Q83A 4M3QA 3DOGA 2J9MA 2R3GA 4EC8A 2ACXA 4WHZA 3S1HA 1NXKA 5HGIA 4TYIA 4O0VA 5JH6A 5M56A 3PLAE 2X6EA 2GNJA 1E1VA 5CVHA 4AZTA 3QUEA 4KIKA 1JSVA 4X3FC 1UKIA 5HKMA 5HTCA 3FY2A 3AGMA 1V0OA 3IW7A 3P08A 4FA2A 4CQGA 5IA1A 5EI6A 3PJ8A 5HG9A 4HGLA 2C5OA 3EFKA 5T6KA 4D28A 3AC8A 4D9TA 1M2RA 2HW6A 4PL4A 3OC1A 3QXPA 2R3FA 3R83A 4MKCA 5E8SA 4YUQA 3KEXA 3ZYAA 4E5BA 3BHVA 5JMSA 4CFMA 2B4SB 3FMEA 4UMTA 3OTUA 5ICPA 3BCEA 2B0QA 3VUTA 4JR3A 2A27A 2QODA 2VGPA 5C8NA 5FLFA 1Y91A 3TWJA 1BL7A 2QO9A 3FEGA 4BDHA 4DAWA 3S0OA 4EYJA 4DH5A 2YIQA 5BVKA 3OCSA 3T9TA 4QMXA 4EQUA 2F2CB 5J5TA 2FUMA 3A7GA 4FTJA 2QD9A 1FMKA 2OSCA 3P1AA 4EH3A 4C8BA 3E8EA 3DDQA 5IH5A 4FKLA 3L9PA 4J97A 2YERA 4DC2A 1PF8A 3ORMA 3UVRA 1H07A 3O96A 4FL3A 3FZTA 3LQ3A 4JBVA 3QTUA 1H1PA 5GZAA 4DEGA 2FA2A 2W1GA 5EQEA 4F4PA 2WNTA 3F2AA 3F3TA 3PXRA 4U97A 4Y85A 1I09A 3I6WA 1REKA 1SNUA 3NYVA 3ZDUA 5HG5A 4DFLA 4EH4A 4ASXA 5EYMA 3ULZA 5AP4A 4PDYA 2VAGA 4I0SA 4JX3A 1R39A 2QONA 3QZGA 2R4BA 1OPKA 2VTLA 3F69A 1XBBA 4O83A 3D2KA 1PYEA 2GPHA 4WNPA 5IMXA 4O86A 4G16A 3V5WA 3BKBA 3IONA 2BAJA 2XNEA 2YAAA 5DIAA 3ZM4A 4C4IA 4CLIA 2BKZA 5H3QA 4FSQA 2J5FA 5CWZA 2HZNA 3QQUA 3PA5A 1P5EA 4MYGA 2BRGA 4HCUA 3V8SA 2Y8OA 3GC9A 4UYNA 3OCBA 4JRVA 3R7IA 3UE4A 3QKMA 4FX3A 4F65A 2BDWA 3KF4A 4LOQA 5GZ8A 2GTMA 1ZYDA 3ODYX 4DH1A 2IVUA 2PZYA 1OVEA 3O8TA 4EH2A 4OTWA 3AC2A 4XG4A 5AR7A 3UG2A 3WE8A 3R7UA 3ETAA 1U5QA 4ANQA 2JKOA 4MXOA 5EDQA 3AC3A 2IZUA 1R78A 1H25A 4IBMA 2Z8CA 4NW5A 4TN6A 3BBWA 1ZZ2A 4UZHA 2F7XE 4BFMA 5GJFA 4X2FA 4BDAA 2B53A 1BUHA 2QOFA 5CT7A 2BVAA 2HIWA 4ACGA 5AFVA 3THBA 3D4QA 3OP5A 2I0VA 2ZDUA 2V5QA 3LJ2A 4FBXA 4DLJA 3O2MA 2PE0A 2UW0A 3WZEA 4BCGA 4BDEA 2C6EA 4Y73A 2R3OA 2YDIA 4RJ5A 4JRNA 3E93A 4G34A 4BYJA 1YHWA 3ZC6A 5M53A 4I5PA 2OIBA 1XJDA 2WMUA 3LZBA 5CNOA 3UDBA 5FXQA 2CSNA 3EQDA 2VX3A 4IB3A 5AMNA 4FZ7A 3TNQB 3KREA 5M4IA 5LJJA 3ZO2A 4RX9A 3BX5A 4GJ2A 4I5CA 3MH0A 3SW4A 5CAOA 3OW3A 1JNKA 4M7IA 5HTBA 4OGRA 2GQRA 4O96A 4ONAA 4FSRA 2HAKA 3COHA 3BWJA 4XRLA 3PE1A 2DQ7X 3GU4A 3NW6A 3GCQA 3HEGA 1P4FA 1PY5A 4IX3A 5BVNA 5KMIA 5DHJA 5HVJA 1SNXA 3U6JA 5AR8A 2PVJA 4O27B 2HENA 3MPMA 3SXSA 1TQIA 4JX7A 3IECA 4H3BA 2B9JA 5AV4A 1JKLA 4NW6A 5BVOA 3BLRA 2W1EA 5M06A 4FTRA 2FYSA 3KULB 4NTTA 1Q3WA 1UV5A 4O2ZA 4XBUA 3UGCA 4BGHA 4CEGA 4UN0C 5A4TA 3NMUF 2XZSA 5EYKA 4BCQA 5E8TA 3ZEPA 4HVDA 4FV3A 4YTHA 4JXFA 3VF8A 4LMNA 5LARA 5LVPA 4AP7A 3KULA 5CF5A 4PX6A 1Z9XA 1P2AA 4NWMA 4TNBA 2F4JA 4FTIA 1PMNA 2PMIA 5DPVA 5AA8A 4DN5A 4CT1A 2C3KA 3RM6A 4R78A 1STCE 5CQWA 1CKIA 4IWDA 3HYHA 2GNGA 3HZTA 2RFEA 3HX4A 4ANMA 2YCSA 4DGLC 3TM0A 4E8AA 2JBPA 1U54B 3CGOA 5HE1A 3T8OA 3OT8A 4YO4A 3KK9A 3IGGA 2OO8X 4HZSA 4X2JA 3IW6A 5IH4A 4BWXA 3GP0A 3CBLA 3T9IA 4MNFA 1KE9A 4X6RA 5AAEA 4ANSA 2BDJA 2C5YA 4QP1A 4BR3A 5HVYA 2WU6A 5CU0A 3ORXA 1U54A 3PG3A 2OFUA 3VS7A 3HV3A 4QP3A 4ZTLA 5FTOA 5FEDA 4CZYB 3C50A 4K2RA 2QOBA 1KV2A 5CF6A 2IWIA 4I22A 3QCQA 3QD4A 5CXHA 5IZFA 1ZYLA 4IXPA 2JKMA 2C6MA 5HBJA 3FMJA 4F1MA 2H8HA 3ZFMA 5EQYA 2OU7A 2X9FA 3MJ1A 2JDRA 4JBPA 1OL6A 2R64A 2XK6A 1UNLA 2H6DA 2P55A 3RNIA 1O9UA 4GFMA 3VQUA 5E91A 4PRJA 5FXRA 2YDKA 4LRJA 4E93A 4PPCA 2YM6A 2R0IA 4XS2A 2EXEA 3RVGA 2PVKA 4AACA 4FKJA 4DT8A 2PVNA 4IAFA 4QP2A 4D58A 3OBJA 1YXUA 4G3DA 4TT7A 1UWHA 4NUSA 1RDQE 2ETMA 3KRLA 4S30A 3EIDA 2W99B 3LXNA 3N51A 4I6BA 3WF6A 4ASZA 4QYYA 2HYYA 5K5XA 5CNNA 3W32A 3VS2A 4L00A 3K3JA 2Y9QA 4CT2A 2C5XA 5IQGA 4C34A 3VBQA 4FKRA 3GU6A 3WIGA 5LVLA 3EQGA 3K5UA 4FTQA 3EKNA 3PXZA 4AA0A 4O82A 4ZSGA 1PKDA 3MYGA 3TUCA 4D4VA 5M4CA 3DBCA 4R1YA 3VRZA 3WI6A 5ANDA 4RC4A 1J7LA 4YJSA 4FE2A 1Q24A 3U51A 4IH8A 4PQNA 4OBPA 1H0WA 3BV2A 3E92A 1H1RA 4FZ6A 1YHVA 5AR5A 5HE0A 3RKBA 3U9NA 3WF8A 5C03A 4E5AX 4G9CA 4CSVA 3QRJA 2BHEA 3QD2B 4A9SA 4EOIA 4LGGA 4C61A 2ZB1A 2R0UA 3G0EA 4XG3A 3F3VA 3DAKA 4QMSA 5JRSA 3E64A 2EU9A 3EN5A 3QQKA 2OXXA 2Y4IC 3ZSGA 5IQBA 4IVBA 3P23A 4UXQA 3BYSA 4C57A 1OKZA 5HICA 3FLNC 3M1SA 3PVGA 4FKSA 4DG2E 3GEQA 1ZOEA 4ZZOA 2JGZA 4FEUA 5EM7A 4TZRA 4B8LA 1L3RE 5DT0A 4FNWA 2E9VA 1W84A 3JUHA 1PXJA 4XX9A 5EOLA 3LMGA 3QZHA 3NUXA 4IAAA 4W4WA 2YDJA 2W5AA 3BGQA 4TPTA 5I9VA 4FUYA 4AUAA 4WG4A 5JGAA 4L43A 3UJGA 4OAVB 3LJ0A 5IPJA 3BU3A 5M57A 4TWCA 2PYWA 4ZMEA 3TEIA 2PZPA 4YURA 4A4OA 4Q9SA 2OWBA 2WTJA 2XUUA 3MY0A 1VR2A 4OT6A 3ZXTA 3VULA 2YZLA 1XKKA 2ITPA 2JDOA 5E8ZA 1GNGA 1Q61A 4RA5A 3FMDA 5TR6A 1PHKA 3TCPA 1PXPA 2B9FA 4QD6A 3IOPA 4MXYA 1QPEA 2B52A 3G6GA 3PIXA 2BZJA 2YM8A 1XH6A 3CPBA 4JS8A 4EUTA 2X7OA 4FEVA 3BHUA 3KN6A 2CNVA 4YNEA 3VBTA 4QTDA 3TI1A 3U4UA 4O7YA 2YCRA 1IRKA 2X1NA 4YLLA 4H05A 2OGVA 4I20A 4QNYA 3TJDA 3O71A 5EHOA 3U6HA 3MI9A 4FKWA 2VWBA 4LL0A 2GHLA 4L8MA 5TT7A 4IIRA 2XS0A 3FQHA 3QGYA 3VS0A 3Q32A 2W1HA 2VU3A 3BU6A 4LUDA 3AMAA 4AG8A 3R8MA 2XK7A 4O21A 2OXDA 2VTAA 3ZFYA 5AUZA 3DPKA 3QTRA 3BYVA 3HP5A 4X2KA 3R01A 3Q53A 2QO7A 3PYYA 4XRJA 3DBQA 3FZOA 5EDRA 2UV2A 3QLGA 4GKIA 3MA3A 2XNMA 2WGJA 2XRUA 3IQ7A 4A9RA 4FZFB 2OK1A 5A4EA 3CEKA 3COIA 4C2VA 3C0IA 5CAPA 5HZNA 1YOLA 5CEPA 4L01A 1PKGA 3C0GA 4DEEA 5JGDA 3TUBA 4FSTA 2EVAA 4WOVA 3TDVA 4S31A 3TZMA 3I60A 5HCZA 3B2TA 4NM7A 1CTPE 1VJYA 4F08A 4FKIA 2C68A 2ITTA 4X6QC 4ZZMA 4M67A 4ZJVA 2BKKA 4II5A 4JQ7A 5AUUA 5BX0A 4FNXA 2NRYA 2XKEA 4AGUA 3GVUA 4BDKA 3QALE 3BEAA 4D2RA 4PP9A 4BTMA 5FBNC 3LPBA 1IASA 3LQ5A 4RVLA 3A60A 5DYJA 3R9OA 3E3BX 4GG7A 2I0EA 4O2PA 1LEZA 3KY2A 4XOZA 2QOHA 2REIA 1WVWA 4K0YA 4RRVA 4DINA 3CJFA 3RHXA 5IDPA 3FLYA 4A9YA 4AFEA 4D4YA 2R3IA 4ID7A 4FOBA 4BGGA 5ANIA 1V0PA 3MBLA 4HYIA 5AV2A 2JIIA 3FE3A 3QLFA 4QQ5A 4G5PA 1ERKA 3DQXA 2XNPA 3EZVA 2WTCA 3E87A 4HPUE 5M07A 3PIYA 4FC0A 4I4FA 2NP8A 4TKSA 4W4VA 1VZOA 5A4LA 4HYSA 5L2QA 2Y6OA 3UZTA 4UEUA 1PYXA 4X2GA 2UVYA 5CU4A 3OG7A 5AUYA 3LFFA 4R5SA 4F7LA 5IEXA 2YISA 4FIHA 3U4WA 4BVUA 2VTRA 2VTJA 3D5VA 4KNBA 4QMOA 3F66A 4HVSA 3VS1A 4HGEA 1P4OA 2VTHA 3P79A 1Y6AA 4Y46A 4X2NA 3KU2A 5CF4A 4R7HA 1DM2A 3D15A 1XR1A 2PVHA 2VTOA 3O17A 3QRIA 3ORIA 4YZDA 2VWVA 4L67A 5FG8A 3W2CA 2ITZA 3KN5A 3F9NA 4PPBA 2WMXA 3V3VA 4WT6A 5GNKA 2C5NA 2W1IA 4ZTNA 4ZY6A 4CD0A 1PMUA 2CN5A 3BE2A 1Q62A 2WOTA 4RPVA 4TYGA 4N57A 2B55A 4U43A 1RQQA 1OECA 2BHHA 4MX9A 2GHMA 2PULA 4YJNA 2OZOA 1WBSA 5I9XA 4O1PA 1YDSE 4BC6A 4M14A 1PJKA 4JL9A 5C1QB 4QYHA 2ERZE 3COMA 5LQFA 2DYLA 5DE2A 4FTOA 5HHWA 5DNRA 4TRLA 3PE2A 4FSYA 4QMTA 4FTLA 4IAKA 5ANJA 4ZTQA 2IW9A 1Q8WA 1GOLA 4IWQA 1URCA 1XH9A 4GW8A 4EYMA 3JY9A 3TNWA 1SVGA 3LQ8A 1JAMA 1OI9A 2KULA 3ACKA 3OBGA 4FICA 5FQDC 5KZIA 3GT8A 4YSJA 4Q5HA 5GZ9A 5ANOA 3KL8A 3HMIA 4LFIA 4C4FA 4HW7A 5LMKC 5IG1A 5D1JA 5EKOA 3KVWA 3QRTA 4QO9A 4MBJA 4FG9A 4FKGA 2OXYA 3WIKA 4O7TA 3EQRA 3RK5A 4ZSLA 2ZV2A 1A9UA 3PXFA 4KSPA 3SD0A 3KC3A 4C38A 4BCJA 2JAVA 1SM2A 2R3NA 2CN8A 4ZTSA 2B9IA 2J0MB 2X4ZA 5DOSA 3VS3A 5M44A 5A9UA 5J9ZA 4HZRA 3EQFA 4DFXE 4ENXA 4Z7GA 3QA8A 1Y57A 5ETIA 2Y6MA 4WNMA 5BYYA 4MK0A 5HO7A 2FH9A 4G2FA 4YP8A 3BEGA 3PP0A 4C4GA 4BGQA 5KBQA 2WQOA 3FLWA 4KD1A 3RCJA 2Z7RA 3S3IA 5C9CA 2O8YA 3QTWA 5HESA 3NRMA 2YIXA 3QXOA 4XBRA 5K4IA 3OXIA 3WZDA 3KVXA 4BICA 4IE9A 2JD5A 3FLZA 2EWAA 1FMOE 4QP9A 4YJPA 1YDRE 3CY2A 3ODZX 2YCQA 4AW1A 5IEVA 5FM2A 4B7TA 2F7ZE 3F5UA 4N6ZA 2OH0E 4R7IA 4MBLA 3G6HA 4KRCA 1Q99A 3PG1A 3VBYA 3RJCA 3FZPA 4YSMA 2QLUA 4OBQA 4OTPA 4Y95A 4F64A 4IANA 4FI1A 3MVHA 3U6IA 2R3KA 2IZTA 4RWLA 4FUXA 2WIHA 2QI8A 5AIKA 1AGWA 4QMUA 3ERKA 3FKLA 1XH5A 2FSMX 3E88A 3S4QA 3ZBXA 3W2PA 3R1YA 2CDZA 4XJ0A 2A1AB 5EW8A 5IQCA 4FVQA 4E6QA 2Y4IB 3GNIB 2UZWE 3PZEA 3RM7A 4TWPA 1PXIA 3GQLA 1J3HA 2R3RA 2CNQA 2PK9A 2WQNA 5L2SA 4KAOA 3MPTA 4FVRA 2UZVA 4E6AA 4USDA 4YTCA 4JT3A 1H1SA 2PVFA 5IQAA 3RP9A 1LPUA 2PVRA 4YHJA 4ZOGA 3Q5ZA 3OVVA 4H3PA 5HQ0A 4L3PA 3KXMA 2PPQA 2B54A 4WUAA 5KNJA 5D7AA 4OTFA 2BRNA 2JKQA 3DXQA 3A99A 3KXNA 4GL9A 4ZZNA 5BMSA 5HU3A 5LVNA 3AD5A 3QQJA 3LMHA 5HE3A 3KKVA 5CSWA 3EZRA 2BDFA 2XKCA 5FUTA 1MUOA 3ORKA 5TO8A 4D2SA 3JPVA 4X0MA 2RKUA 3ROCA 3RK7A 1ZAOA 3B2WA 3LFBA 3W1FA 4LV5A 5BVEA 1OIQA 2UW4A 4IDTA 4N70A 3DXNA 1MQBA 3EQPA 3RMFA 3PXYA 2I7QA 3OWJA 5M4UA 2VD5A 5F4NA 3RPSA 3IKAA 4RIXA 4V04A 5DWRA 2ZMCA 2G15A 3PY0A 3OWPA 2IO6A 2CGVA 4FV1A 2XK4A 4ZTRA 3OOMA 3G33A 4IFCA 4WA9A 1JSUA 5AP1A 3TTIA 4D1SA 3NUAA 1ZYSA 4I6FA 4BDJA 3TKHA 3K54A 3ANQA 2RFDA 3KCFA 4E4LA 3KRXA 4G6LA 4R6VA 2GS7A 4TW9A 3R6XA 4R8QA 5KZ0A 2HELA 3C4XA 4E6CA 5AR4A 5FEEA 3VO3A 4E73A 1PW2A 2OFVA 3A2CA 2PMLX 4FEWA 3C1XA 5CU2A 1F5QA 2ESMA 3ZSIA 3R7EA 2J2IB 5CX9A 3KMUA 3V04A 3TN8A 1UKHA 4GRBA 1PXOA 4YPDA 3ZUTA 4F9BA 5A4CA 4IDVA 2UZBA 3FPQA 3KQ7A 1DAWA 1P14A 4LGDA 3UIXA 3QQHA 3NPCA 4IWOA 4Y5HA 3FL5A 5CI7A 4LOPA 3V01A 3F3WA 4NFNA 4IC7A 3P0MA 4X7QA 3H9OA 1XQZA 4ZS0A 2X2KA 3FSKA 2R3HA 4UALA 4WD5A 4I94A 5DR2A 2HW7A 3UOJA 3R2BA 3VJOA 1BI7A 2YWPA 2O64A 4D5KA 2JITA 3VS5A 1E1XA 4RLKA 1M2QA 2WFYA 3P7AA 4WG3A 5CQUA 1MRYA 4HYHA 4E4NA 3QA0A 3CTJA 3I6UA 4R5YA 3OF0A 3QKKA 4M13A 4RIYA 3WZUA 4BTFA 2GHGA 4DT9A 3DNEA 1KE7A 3MIAA 5L3AA 1IAJA 4QYEA 3C0HA 3GXLA 1PXLA 4K33A 4H36A 4O91A 2VO6A 4YZNA 1GZKA 3RPYA 3QHRA 2DS1A 2XIZA 3KB7A 2PHKA 4G31A 4S2ZA 2OJIA 2F7EE 4BIBA 3ZXZA 3F88A 3V5QA 3SG9A 4WNKA 2C0OA 3CKXA 4OW8A 5E8UA 4YU2A 2PY3A 5CLPA 3C51A 3E3PA 1U5RA 4ANBA 1R3CA 3O7LD 3D7TB 3LFAA 4FK6A 2PUUA 4AFJA 4FV6A 2C3JA 5AJQA 4LM5A 3DGKA 4CXAA 5LVOA 1OKVA 4E6DA 3MTFA 5BQ0A 4D0WA 5E1SA 3SW7A 4FTNA 1J7IA 3N4VA 4RWKA 3PA4A 5I3OA 3DBFA 3ZONA 4U9AA 3F3UA 3DAEA 4YTIA 4AN9A 4AT4A 3QRKA 5HEZA 4RC2A 4Z55A 4CG8A 3FY0A 3TUDA 2GU8A 4DF3A 3MB7A 2GNHA 2I40A 4LG4A 3UOLA 4F1OA 2W5BA 4DHFA 3S00A 5IA2A 3LJ1A 3GOPA 2X9EA 5F20A 1R1WA 4WO5A 3RAHA 1WFCA 1GY3A 5JRQA 2ZM4A 4YBKA 4FIIA 4UWCA 4C4JA 4HVHA 1ATPE 3BRBA 5LOHA 3NS9A 2FSLX 2WIPA 4CZTA 4EOSA 3KGAA 3LAUA 3I7CA 1FVRA 2WMQA 1V1KA 5HIEA 5A6NA 4QTCA 5CTPA 5E7RA 3QTXA 3TG1A 4R77A 4YR8A 4BDIA 1JKTA 2NRUA 2YCFA 1WZYA 3R71A 4IAIA 3WF5A 4AOTA 4LMUA 2WMSA 2Y7JA 3A61A 3LFQA 3W10A 3ZU7A 4FV9A 4ALWA 4CMOA 1KE8A 3PXQA 4YZ9A 4FV4A 3W2SA 2HK5A 2R2PA 2UW6A 2QR7A 4BI1A 4BCFA 3QC4A 3V6SA 3LFCA 3QGWA 4NT4A 1BI8A 3V8WA 5DT4A 4FG7A 2C1AA 2HY0A 3FWQA 3A4OX 3UNKA 4M12A 4FG8A 1G8AA 1XH4A 3JS2A 4JVGA 2CHLA 4RJ8A 2OH4A 2ZV7A 4R3RA 3H4JA 3TV6A 4O7ZA 4FL1A 3TV7A 4OR5A 4YBJA 3VBWA 5A46A 1I44A 3S2PA 1Q8UA 2PVYA 4O0YA 4CRSA 3A7IA 3R9RA 3G2FA 3ZHPC 4ZK5A 4BTKA 2CKOA 4HGTA 2QR8A 4YGAA 4QTAA 2VO3A 4FV5A 2VN9A 4JJRA 3E62A 1QPCA 1U4DA 3EYHA 3I0OA 2J5EA 4I0TA 2QLQA 3NLBA 3LM5A 1YOJA 5AX3A 1LEWA 1ND4A 5IQFA 3DDPA 4J99A 1OPJA 3HDMA 2J0KA 3CD3A 4BKJA 4EHZA 2BRMA 5LMKA 3TTJA 3C7QA 5E8XA 3SC1A 3CGFA 1OIUA 3ZRMA 4FTAA 1ZY5A 1X8BA 2VX0A 3GCVA 3OCGA 4C58A 4FIGA 4DH7A 1YI6A 4TL0A 4E4MA 1NVRA 3OTVA 4LI5A 2ONLC 4Q2AA 2R3LA 2YEXA 5AAFA 3GFWA 4RVMA 3RCDA 3KF7A 4JI9A 1H27A 5LMAA 4A9UA 4IZAA 4BN1A 2VWYA 1CMKE 3LCKA 5CSXA 5E92A 5FP6A 5I9WA 3EJ1A 2WHBA 3D5WA 3GI3A 4EWQA 4H39A 5CSHA 2BAKA 2C0TA 2OJJA 3I81A 5EM6A 4CG9A 4PDSA 2RF9A 4XG8A 2PVLA 4OBOA 4FOCA 3L9NA 3HNGA 3DFCB 3WOWA 5FDXA 3NAYA 1H0VA 3AC4A 4BZNA 3SG8A 4I5MA 3QX4A 3WARA 5FBOA 1DS5A 3BQCA 3TT0A 2XA4A 4ITJA 3HL7A 1O6YA 5EDPA 2PTKA 4PNKA 5I3RA 5CEIA 3U8WA 2C6DA 3KXGA 1YI3A 4EBWA 2AYPA 4O38A 5LXMA 2LAVA 5CXZA 3PUPA 3MA6A 3HGKA 4I23A 3R7OA 1W82A 3BU5A 4RIWB 5F1ZA 3TV4A 4P2KA 3Q2MA 5GHVA 3GC0A 3NCZA 3NYOA 3PFQA 2YM5A 1M7NA 2UZOA 3DLZA 4L7FA 5BYZA 5BUIA 3CPCA 3CS9A 5M4FA 4F9YA 2V62A 2IW6A 4A9TA 4RIWA 3TNIA 5BPYA 3D14A 4DITA 3WF7A 3MGYA 3O23A 4IW0A 3ALOA 4MD7E 3N4TA 3M2WA 5CASA 3QQLA 3C4EA 4XV9A 2W9ZB 5CENA 3TNPC 3CKWA 5AV1A 3T3VA 1NY3A 1SVHA 3FJQE 3UVQA 4C33A 5HCYA 3C5UA 4CCBA 1W98A 3KRJA 2QG7A 3UQGA 4O0SA 4KIOA 1R0EA 4J8MA 3L8VA 1ZLTA 4AZVA 2YIWA 3EQHA 2PE2A 2XIYA 1GZOA 2RG5A 2VTIA 2YHVA 5HNIX 2PZRA 3I7BA 2W4OA 3BLHA 2JKKA 2YN8A 4MH7A 2GMXA 3NZ0A 2O3PA 3UNZA 3DQWA 3ZRLA 4C59A 4MXZA 3V51A 1H00A 2EUFB 5IKWA 3ZM9A 4EJ7A 2QNJA 3F61A 4W4XA 1BMKA 5J7HA 5FTGA 4MD8E 1TQMA 1AQ1A 3R8ZA 2V7AA 1ZMWA 3L9LA 2GNFA 2BIKB 2WTKB 3HAVA 5CYIA 5T3QA 5HORA 4J95A 3KCKA 2ETKA 3W8LA 2G01A 5E9EA 4FKVA 4TY1A 2UW5A 5CVGA 2CMWA 3UZPA 5HX8A 4BZDA 4EH7A 4ZJJA 3LVPA 4G9RA 5KMKA 4J52A 4PPAA 3NUYA 3HA6A 4YZMA 4X21A 3PTGA 4JDIA 3MPAA 4G6OA 5CZHA 3KXZA 4GVAA 5AUTA 3W2QA 2WTVA 3G9LX 5CALA 1OBGA 3GB2A 4I41A 4GT3A 4BDGA 2VRXA 3QCYA 2Z2WA 3FAAA 3PA3A 5DH3A 3PSBA 4U6RA 2R3MA 3LCSA 5HO6A 2C6LA 4UX9A 3AMBA 4DFUA 2CGWA 5AADA 5I9YA 3E8DA 4GEOA 2RG6A 5E90A 4TTHB 4D2TA 3IW8A 1H26A 1Q3DA 2YABA 4FTTA 3NNUA 3OMVA 5CAUA 4U0IA 4IJPA 3F82A 3HUCA 3ZEWA 2V7OA 4S32A 5CS6A 4D2WA 2WO6A 3HRFA 2HXLA 2SRCA 3EQBA 4KBAA 4I5HA 2W1DA 2XEZA 4WBBB 2W1ZA 2WMTA 2BR1A 5AP0A 3ID6C 3G90X 3A62A 3ANRA 1TKIA 3TDWA 3H0YA 1XH7A 5DR6A 2QOQA 2CKEA 2Q0NA 4A4LA 3F7WA 3R2YA 5C4LA 4EHVA 2FO0A 2JIUA 4OTQA 4OT5A 5AX9A 3QZIA 3VIDA 3QYWA 2VTNA 4O81A 3ZH8A 4BHZA 1OIYA 5C27A 4QQTA 5J9YA 4F9CA 1QMZA 1UNHA 4FV7A 4M69B 1G8SA 4AAAA 1OITA 3CE3A 3REPA 2J50A 3GU8A 4MF0A 4KKHA 5CU3A 2XCHA 4XG7A 4KIPA 4FV2A 1ZWSA 5HIDA 3W55A 4QMYA 3H30A 4M69A 1NVQA 1PXMA 2BMCA 1W83A 4OTHA 4LYNA 5AP3A 5KKRC 3IGOA 4R7BA 4FKTA 2GQSA 3EN9A 3EB0A 5DVRA 1K9AA 1KV1A 3MH1A 4K9YA 3DZQA 4FIJA 5L2IA 3RWQA 1OB3A 1UWJA 4AOJA 4FNZA 4AX8A 1SYKA 4MXXA 3QZFA 3LCTA 1M2PA 3EN6A 3F7ZA 3K3IA 3MFTA 1GIJA 4BB4A 4RIOA 3II5A 2ITNA 4DBNA 3ORLA 5EOBA 4BKZA 5JZJA 3FMNA 2XH5A 3KA0A 4I21A 2V55A 4MF1A 4HNFA 3P9JA 4JG8A 2WTDA 3VUGA 4RFYA 2EB2A 5FTQA 2WAJA 3QQFA 4GT5A 1KSWA 3DU8A 2CGUA 3DKCA 1YXTA 3GENA 3RHKA 4UMRA 3VW6A 1GIIA 3SX9A 3DJ5A 3VUHA 2QU5A 4L6QA 4R1VA 4BCIA 5HU9A 3UP7A 4QMQA 4TWNA 3FXZA 4V05A 5G6VA 5LMBA 4PV0A 2W0JA 1WBNA 1LR4A 1Z57A 2QCSA 5I0BA 3NNVA 1ZY4A 1K2PA 1OUYA 2ZVAA 3OHTA 2E2BA 2J51A 1NT2A 1Y8GA 3CLYA 1ZRZA 1ZYJA 2IW8A 4MEDA 2XEYA 2B7AA 4KWPA 4DFBA 4U41A 1QCFA 3Q9WA 4WNOA 5H8EA 1MQ4A 5HBHA 3R9NA 2WQBA 2OG8A 3FPMA 5HBEA 3SKCA 5D11A 1T45A 1V0BA 4KBCA 4EUUA 5TKDA 1OM1A 3DV3A 2AC3A 4MTAA 3DJ6A 2WMRA 5L6PA 4ARKA 3FZ1A 3N4UA 1YVJA 3Q3BA 3VW8A 2C3LA 5GINE 4CGAA 3FLSA 3NSZA 3SHEA 3L8PA 2JDSA 2OF2A 4KKGA 2UW8A 3AD6A 3C5IA 2JAMA 1MP8A 3R7YA 1YXVA 5A6OA 4FKUA 2QOIA 3A8XA 4RWJA 4AZWA 4DFNA 2W1FA 3AT2A 4IZYA 2FVDA 3ACJA 4DGGA 3IS5A 3R1SA 1FINA 1H08A 5EI8A 4AGDA 2QOKA 2ZDTA 3JR1A 3GBZA 2R3PA 3A7FA 4FSNA 4K8AA 5CSPA 2OI4X 4YLKA 3CXWA 4FSZA 2C47A 3MFRA 3R63A 5AR3A 5IQEA 4RG0A 4TXCA 1MRUA 4JQEA 4C2WA 2X0GA 3PSCA 2XK3A 3R1QA 1F3MC 2UZDA 3OWKA 4I6HA 3ZO3A 2HY81 4S33A 3M42A 5DT3A 3QQGA 2J0LA 4W9XA 4NU1A 4FT3A 4HJOA 4QT1A 2ONLA 2XKDA 4J53A 4RJ6A 4FYNA 5IH6A 3LXLA 3UIMA 1OBDA 5HD4A 1IA8A 4XV2A 3FYKX 3CQEA 3I1AA 3NR9A 2YIYA 4PF4A 5J5SA 4FVPA 2PUNA 4FL2A 3QU0A 4DEAA 2J0JA 1JKSA 3SXFA 3ZCLA 4AW5A 2GS6A 3VF9A 4PP7A 4N0SA 3FI4A 4FV0A 3Q9XA 4L9IA 5CY3A 4Z16A 2BZIB 2UW7A 3BE9A 4RFZA 2E9OA 4PTEA 5B2KA 3VAPA 4JR7A 3FYJX 4MHAA 4ANNA 3R04A 5EG3A 3MH3A 5I9UA 3ULIA 2YACA 4GK2A 3G9NA 3F3ZA 1JPAA 4U79A 2YIRA 3H9RA 3AT4A 4F9WA 5J8IA 5I9ZA 2E9PA 1YWVA 2UUEA 3OUKA 4F6UA 3CSVA 4AW0A 3DKFA 3NIZA 5ANGA 4DLIA 3O8UA 5TF9A 3FXXA 4JAJA 1WBTA 3QC9A 4CQEA 2VTSA 4XP3A 2A4LA 5DFPA 3E7VA 4QPMA 3LKMA 5L6WL 4A06A 3GGFA 2V0DA 3B8RA 1ZZLA 2WMVA 1GZ8A 4A7CA 5IUIA 1KWPA 4GUBA 5C26A 3TZ7A 3AQVA 3F6XA 4MNEB 3ZS5A 4CVAA 4PNIA 3ZLYA 4CFNA 3BQRA 4CRLA 4M68A 4O7NA 3PJ1A 5KUPA 1W8CA 4FMQA 4BBEA 4XG9A 4RSSA 2X2LA 3HAMA 1U59A 4E5WA 4MNEA 4EORA 2WQEA 3FMHA 4S34A 1XH8A 2RSVA 5J79A 3NUSA 1EH4A 4EKLA 4F70A 2VZ6A 4IZ5A 2FSOX 3LLTA 2C4GA 5K9IA 3PZHA 5FXSA 2ETRA 3MS9A 5BNJA 5AUVA 3Q96A 4IB1A 4FIFA 4GK4A 5DA3A 4BIEA 5HLPA 3MJ2A 3QUDA 4K18A 1YDTE 2A2AA 2X4FA 2Z7SA 4IM0A 4UWBA 3LCOA 3RAWA 5E8VA 4XHKB 1OPLA 4RC3A 4GK3A 4CFUA 4WRGA 3VN9A 4LRMA 5HI2A 4F7SA 3FL4A 2JBOA 4QP4A 3NW7A 4KABA 3Q4TA 4G3EA 5B2LA 4XP2A 3R8LA 3HVCA 4USFA 3FKNA 4AGCA 2HZIA 4HVGA 5IA3A 1U46A 2YA9A 5JGBA 3QKLA 2J0IA 4HGSA 4GVJA 4MD9E 2C6IA 4FK3A 3F2NA 4CMTA 4AQCA 4AA5A 5IMEA 4AZEA 3FHIA 5HLWA 5J7BA 2IVVA 2GS2A 3RAIA 3N9XA 4PMTA 4EH5A 1REJA 2XBJA 3KRRA 3E8NA 1UVRA 4LRKA 4DE4A 1O6KA 3FC1X 3UOHA 2W17A 3A4PA 2C1BA 4G1WA 5IQIA 5AV3A 3HDNA 5AP6A 5KO1A 4FNYA 4H1MA 5EHLA 4K77A 4FKOA 2CGXA 4I93A 4RT7A 2RGPA 4BHNA 4PDPA 4YJOA 4U7ZA 5JEBA 3H9FA 2HWOA 4Q5EA 4XV1A 4QMNA 4JIAA 2GFCA 2QU6A 4ZSAA 4U5JA 1J1BA 1IA9A 3MW1A 3D94A 3OZ6A 2P33A 4JNWA 4DH3A 4J1RA 4BL1A 5JSMA 3PSDA 4DTBA 3DTWA 3KMWA 4I1ZA 4AE6A 4CKIA 2OZAB 1UU3A 3FSFA 5CT0A 4BCKA 5LWNA 3UIBA 1J1CA 4IB5A 5C4KA 3R0TA 5IF1A 3BI6A 3VS4A 3HECA 2OW3A 4XV3A 4CFXA 4C4HA 1M14A 1DI9A 4RJ3A 3OXZA 3LW0A 4WIHA 4L46A 4ANOA 3FQEA 4EK3A 3KK8A 5DEWA 2BRBA 3SAYA 3ATSA 1ZARA 3I0QA 3MVJA 2WU7A 4PY1A 4LQMA 4NTSA 3ZO4A 1J91A 3FQSA 3ET7A 3L8XA 4YJTA 5LWMA 5KKRB 5LVMA 5AV0A 3KMMA 4GKHA 4UY9A 2ZV8A 3FKOA 3GC7A 3I5NA 3HP2A 3PPJA 4BIDA 3P86A 4NIFB 4Y8DA 4UMQA 4BZOA 3W33A 3UNJA 2JDVA 3EL7A 4QMLA 4BCOA 1G3NA 5D12A 1S9JA 4C62A 5CU6A 5ITAA 4MWIA 4EJNA 4XMOA 5J1VA 1OKWA 4FZAB 2PVMA 4Z9LA 3NGAA 2QO2A 4NIFA 5ETFA 5KMMA 2VWXA 3BHHA 2JDTA 2WTKC 3FMLA 1IG1A 1PMVA 3RZFA 2XCKA 3UG1A 1FVTA 3RALA 2ZMDA 4GU6A 3MH2A 2XNNA 3ORZA 2VWZA 4GV1A 3U54A 2Z7QA 4E7WA 5B2MA 2EXCX 3EOCA 4CLJA 2E9NA 3R8PA 4FT9A 3BZ3A 2R9SA 4FEQA 4J71A 2JEDA 4EHGA 1GIHA 3UMXA 3IW4A 5HG7A 3DCVA 4DFYA 4L53A 2CNUA 2IG7A 1H24A 5KE0A 2BROA 4V0GB 4NKSA 3G15A 4BCHA 5AUWA 3VUDA 3PJ3A 4IZ7A 4RLLA 2JFLA 1HCKA 2I6LA 4FR4A 2ITUA 2X7GA 3QHWA 4WRSA 3QD3A 5JT2A 2VTMA
chains in the Genus database with same CATH superfamily
3ZRKA 2IN6A 3EMGA 3DB8A 4EH6A 2QG5A 4PMPA 1PRYA 4U8ZA 4XLVA 5C8KA 4V0GA 3C4FA 5DMZA 1B39A 1ZYCA 5IQHA 1H28A 4JDJA 3NCGA 3VONA 2ZYBA 4RFMA 3DK3A 4D55A 5L2TA 1QL6A 4DDIA 2PWLA 2WB8A 4QTBA 4AN2A 4L3LA 4GG5A 2R3QA 4UMPA 3DKGA 5G1XA 2P3GX 3MFUA 4NKAA 4YJRA 2IPXA 3UZRA 2XKFA 4UYAA 3UPXA 1YW2A 1QPDA 2X8IA 4AE9A 2NO3A 2XIXA 5EM8A 3PXKA 3ZDIA 3TJCA 4G3GA 4L7SA 4K6ZA 2XB7A 4U42A 5HO8A 1GZNA 4CCUA 1ZMVA 5CEKA 4K1BA 3W18A 5KX8A 3HA8A 4QMMA 4U80A 1BX6A 3ZO1A 4NH1A 3S95A 3OROA 5M09A 2VTQA 4EKKA 4JAIA 3UDZA 2O5KA 3Q4ZA 3R28A 2W9FB 5KMLA 5AWMA 2WZJA 3VUKA 4AZFA 5DG5A 4EEVA 4L52A 4NFMA 4FSWA 4DCAA 2O0UA 4FSUA 4YC6A 4TYJA 4DTAA 4M15A 4H1JA 4AWIA 3FC2A 5AP7A 3W2OA 4DTKA 3IDBA 3QTQA 3K2LA 3ZZWA 1FPUA 5CVFA 3EQCA 1FGKA 3LE6A 4PTCA 2KTYA 4BYIA 1R0PA 5F95A 3ORNA 4YHFA 5BMMA 3QTSA 3LLAA 2QKWB 2CJMA 3A8WA 3GCPA 4C3PA 3OW4A 3MWUA 2YFXA 1OL2A 3EN7A 2C30A 4F0FA 3PWDA 3POOA 4R3PA 3D7TA 5DGZA 4O0TA 5IUGA 1OGUA 3BYOA 5BVWA 4EWHA 4BDCA 4QMZA 5CEQA 4I92A 3MESA 2W1CA 1IR3A 2XNOA 5FEQA 5EKNA 3RWPA 3DLSA 4BCNA 5JK3A 1DAYA 3PRIA 3PDTA 2RIOA 4RZWA 2PSQA 2W06A 4FZDB 2IJMA 4BDFA 5JFWA 5D10A 4AT5A 4D9UA 5K3YA 3SDJA 4APCA 2Q0BA 4ITHA 3QCXA 5F9EA 1UU7A 1WMKA 5L4QA 2CPKE 5AR2A 5LCKA 2O63A 3FUPA 4RQKA 4D2VA 4BY9E 3NYNA 3HKOA 4JBOA 4XOYA 3SV0A 2CLQA 2VX1A 2F2UA 2YM3A 4O6LA 3DS6A 2YWVA 4QQCA 4GSBA 5BV3A 5BVFA 4HPTE 1Q8ZA 4Y72A 3BGPA 4MCVA 2ZV9A 4C02A 1WBWA 3Q4CA 4P7EA 3Q5IA 4QRCA 5AP5A 5ETAA 3SLSA 1WBOA 4DFZE 2C3IB 2IVTA 2YJSA 3Q9ZA 4F0IA 5L8LA 4ASEA 4M0ZA 4APPA 2YAKA 4QYFA 4OTGA 3O0GA 3C4WA 5AM6A 5AIRA 2G2HA 4DG0E 3Q04A 4QPSA 4EOQA 1NVSA 4YC3A 3QD0A 4RBLA 3PY3A 3RTPA 2XJ2A 3RAKA 3G5DA 4ANLA 3R7GA 4P4CA 5JN2A 5TOZA 1ST4A 2WMWA 4U81A 3WE4A 3AXWA 3V5JA 3HV5A 3TACA 3TIZA 1KE6A 4FSMA 2HWPA 3RNYA 3HMNA 4XG6A 4EOPA 5JFVA 3PIZA 1JKKA 2W05A 4YTFA 3VHEA 2IZSA 4EQMA 3LM0A 4F63A 4Z7HA 3AMYA 4FT5A 1TQPA 4IM2A 1UU8A 4QNAA 5A14A 3UO5A 2G2IA 3PY1A 1OKYA 3SOAA 3D5XA 2HCKA 3UMWA 3D9VA 1UA2A 4U45A 3BBTB 5DLSA 4U40A 3UOKA 4GFOA 2BTSA 2QQ7A 3NAXA 4QOXA 4G3FA 4NZWB 2XM9A 4FT0A 5JQ8A 3RPOA 3NNWA 3O8PA 2QHNA 2XM8A 4KIQA 2F57A 4WUNA 2BRHA 1Y8YA 3PVUA 4DGNA 4DHJA 2X0PA 3H0ZA 4BWKA 4OAUC 5IA4A 3F5PA 5CEMA 4RQVA 4GJ3A 3QL8A 1YI4A 4NK9A 4Z3VA 3DK6A 4RGJA 2PL0A 4AQKA 4F6WA 2B9HA 2ZM3A 3UDTA 5EQPA 3R8VA 3PVWA 1KE5A 4MWHA 2YZAA 1PXNA 4BRXA 5IISA 3SGCA 4M97A 3VUMA 2WMBA 2P2IA 3RINA 3RZBA 1MRVA 4FTCA 4AN3A 1Z5MA 2BFXA 2GFSA 4EK5A 1TVOA 4EQCA 1RW8A 2QHMA 3BWFA 1HCLA 3VUIA 3R02A 4A4XA 3ATTA 4FEXA 5BYLA 3JXWA 4GCJA 4O22A 2H9VA 3LIJA 2X39A 4QP8A 4RX8A 4AGWA 1ZXEA 4P5ZA 3DT1A 1KUTA 4R3CA 4PWNA 5KBRA 4QDVA 2O65A 3BGZA 3CY3A 4BTJA 2H34A 5EFQA 4GIIA 1OZ1A 2JIVA 2WQMA 3EFLA 2ITYA 2VUWA 3RK9A 3UYTA 5EI2A 4KUJA 2EXMA 3MB6A 4PL5A 1YKRA 5AUXA 4HVIA 4NM0A 4ZY5A 1FQ1B 4CYIA 4KBKA 5A4QA 1VLRA 2IVSA 2JFMA 1OL1A 4L68A 4AZSA 3P7BA 4BCPA 5FD2A 3BL9A 3I79A 2GQGA 4JG7A 4FYOA 4DHIB 3RBWA 3C4CA 3LFEA 3Q2JA 2HZ0A 2XIKA 4XUFA 4IADA 5IA0A 4BCMA 3KRWA 4K11A 2QVSE 4XH6A 4IX6A 4NSTA 5FGKA 3DB6A 4CFFA 1WCCA 1Q5KA 3OT3A 3P78A 5JQ5A 4KB8A 2R3JA 3AT3A 2ITQA 4ZSJA 3MTLA 3QUPA 4MQ1A 5FP5A 2Y4PA 3PVBA 3KFAA 3D7ZA 4NM5A 3WYXA 4E26A 4DCEA 4JQ8A 4KS8A 2UW9A 3DBDA 2X8EA 4QMPA 3TL8A 4Q9ZA 2G9XA 3OY1A 3CP9A 3HV6A 5EW9A 1A48A 4O84A 2GTNA 1SVEA 2XK8A 3DTCA 3ZLWA 5I4NA 3SVVA 3D5UA 3MIYA 4DA5A 2C0IA 4IMYA 4PMSA 3U87A 4RMZA 4L45A 4IACA 4UMUA 5K0XA 4PL3A 3SA0A 3PFYA 5LCJA 3DAJA 4NCTC 3ORPA 3PJCA 2BIYA 3IDCA 2VV9A 4ZLOA 3DJ7A 3HV7A 1XBCA 4C37A 5JZNA 1CSNA 3IOKA 4D1ZA 2VTTA 3ZOSA 1SZMA 2I0YA 3NUUA 3VVHA 3LFDA 2VNWA 2OLCA 1WVYA 3EFWA 4AF3A 2XVDA 3SQQA 4YLJA 4D4RA 2FGIA 3ZLSA 2UVXA 3G51A 1GAGA 4AT3A 2GNIA 3ALNA 1DI8A 1LUFA 1CKJA 3DNDA 2IEWA 5GJGA 3RGFA 4C0TA 4NJDA 1NA7A 4EK4A 3UPZA 2YLFA 4MVFA 3CQWA 4U44A 3NYXA 4XCUA 5HNGA 3EWHA 4B4LA 3U55A 4QP6A 2UZEA 4KA3A 5D41A 4HNIA 3QAME 5BUJA 5M51A 2AC5A 5JFSA 4ZXTA 3R21A 2WXVA 4FGBA 4O0UA 2WKMA 4GS6A 2ZM1A 5AAGA 4RWIA 1CKPA 4RZVA 3O50A 4O7WA 2Z60A 4QMVA 2GCDA 3TKIA 4KRDA 2HOGA 3R1NA 5J95A 4RX5A 2H96A 5DRBA 4O7LA 3RPRA 4CNHA 4CKJA 3DBEA 3LXKA 3FZRA 3BPRA 3NX8A 3V5TA 3Q6UA 5HD7A 2X0QA 3WYYA 5CAQA 4RA4A 2R7IA 4YZCA 2OJ9A 3OCTA 3ZLXA 3TIYA 2J90A 3UIUA 5TE0A 1Q4LA 4IWPA 2PU8A 4F9AA 4YZBA 4CZUA 4GFGA 2VTPA 1PMEA 3PWYA 3MVLA 4IX4A 4YMJA 4USEA 3QCSA 3BYMA 4NL0A 1JVPP 3RI1A 3NNXA 3OOGA 5DR9A 3LHJA 3I5ZA 4A07A 2DWBA 2R7BA 4RVKA 2W4KA 5IEYA 5KHWA 4GU9A 3NUPA 3R22A 5GJDA 4M84A 3I4BA 3QTIA 2ITVA 3ROYA 1JWHA 1H4LA 2J6MA 2VGOA 3E8CA 3TXOA 4AA4A 2XNBA 5AP2A 4BBFA 4EZ7A 4ZLYA 1BYGA 4MUQA 1H8FA 2CCIA 4ZAUA 3MSSA 4HOKA 4EI4A 2WPAA 4ZTHA 3BELA 4CV9A 3POZA 4BWPA 4TYHB 2NPQA 3VQHA 5KCVA 5H8GA 2W5HA 3TNHA 1OIRA 4W8DA 5EW3A 4D2PA 4E20A 1FOTA 1Q41A 3DXPA 1NW1A 3NVKI 2PE1A 3LMIA 4TYHA 4X3FB 5GIPE 4QMWA 2OICA 3MFSA 4C4EA 4IAZA 2PMNX 1OGYA 1UNGA 4CFVA 1XO2B 4JDKA 5AA9A 1OL5A 3UC3A 3ZBFA 4JG6A 5DBXA 4ZIMA 2BZHB 4ITIA 1JQHA 3Q4UA 5C8MA 3R7VA 4BI0A 3AGLA 4KINA 4X3FA 3VBXA 3HV4A 3WBLA 3FZSA 1YWNA 4YO6A 4QTEA 3WZJA 1B6CB 4E4XA 4XNEA 2F49A 4CTBA 4EZ3A 3DKOA 1YXXA 2ZJWA 4WSQA 4C35A 3O7LB 1XWSA 3EHAA 3IDPA 4GT4A 4OTRA 1Q97A 4YPSA 5H8BA 3R9DA 3SXRA 3ZUUA 4EHEA 4EK8A 4QQJA 4O4CA 5M08A 2XMYA 4JDHA 4B8MA 1W0XC 3DK7A 5CEOA 3C13A 2YJRA 3ORTA 5KMOA 4RX7A 3Q60A 2XBAA 4UXLA 3OS3A 2XRWA 4ZEGA 3V5PA 4FGRA 5KHXA 2WTIA 5FDPA 5HLNA 3MN3A 1H1WA 1YOMA 4IB0A 1J7UA 2ITXA 5EYCA 3EYGA 2UZNA 3QWKA 2AUHA 2Y0AA 1JSTA 4QPAA 5M55A 1QPJA 2RL5A 4WKQA 2B1PA 4YHTA 1XHAA 4G17A 3E63A 4ASDA 4CTCA 5EM5A 4CMUA 1KOBA 4E1ZA 3BLQA 4EOKA 2A19B 2Z7LA 4BF2A 4DEDA 4M0YA 3A7HA 3OD6X 4F99A 3GCSA 3FMKA 4B6LA 2EB3A 2I0HA 3FHRA 4GIHA 5AM7A 4ALVA 1O6LA 4O1OA 2BFYA 4IC8A 4C3RA 3CTQA 3F5GA 4IVAA 1JBPE 5ANEA 4ENYA 3NVMB 1YWRA 2DUVA 1RE8A 4KSQA 3PJ2A 3L1SA 2XNGA 5H9BA 5A54A 3NWWA 3Q52A 4B0GA 1KOAA 3CCNA 3L8SA 5BUEA 1M52A 3OEZA 4O7SA 2WTWA 1BL6A 3QWJA 4I0RA 3P7CA 3CD8A 2GSFA 1IEPA 5E4HA 4ZJIA 2WEVA 2VWWA 4XP0A 4ERKA 3ZUVA 4UV0A 1UU9A 4BDDA 2P2HA 1RJBA 4IEBA 1G8KA 4O0XA 4ACHA 2W4JA 1HOWA 3OWLA 1FGIA 1H1QA 2R5TA 4G3CA 3EFJA 4WSYA 3AOXA 2UZTA 4AOIA 2QOCA 4GYGA 3G0FA 2C5VA 2OIDA 3EN4A 4G5JA 4BDBA 4CFWA 1FBNA 3O51A 3PLSA 3EKKA 4MAOA 4OLIA 3E7OA 4D0XA 5C01A 3HMMA 4I24A 4GH2A 4YJUA 2G2FA 2XJ0A 4ZTMA 5J1WA 1CDKA 3A7JA 2J7TA 3ENMA 5GIOE 2CCHA 5DRDA 5H2UA 4DGOA 3MY5A 4ZMFA 3UTOA 4O0RA 5HCXA 4LGHA 2CKPA 4M8TA 3AC5A 4NEUA 4F7JA 3M11A 2ZOQA 3NDMA 2IZRA 3C4ZA 4O7RA 4CV8A 4UZDA 1JOWB 4ACMA 3GOKA 3FV8A 3H10A 5DEYA 4Y5QA 3OY3A 4FT7A 2E9UA 4AU8A 1M7QA 4PTGA 2GDOA 4HCTA 1ZOHA 3JYAA 3NEWA 3L9MA 2VWUA 2CKQA 2XK9A 4L3JA 4UWYA 4HCVA 4X3JA 4ZLZA 3EQIA 4BBMA 2CLXA 4TWOA 3UODA 4IVCA 2F9GA 4IVDA 3UQFA 2VWIA 1ZMUA 3P4KA 4YNOA 3AD4A 4GUEA 2QURA 4XG2A 1YHSA 5IQDA 3UYSA 1SMHA 5IUHA 3MV5A 5B0XA 5CSVA 4BKYA 4C7TA 3LFSA 2I1MA 4H58A 3FI8A 4G6NA 3GFEA 4C36A 3GUBA 5FRIA 4EOLA 2RFSA 2VO0A 2WELA 3TKUA 4RJ4A 4EZ5A 3BIZA 5K5NA 5CZIA 2RFNA 2NNWB 4AXAA 5D9HA 1FVVA 5IA5A 4OTIA 3VNTA 2OJFE 4Y83A 5CF8A 3MY1A 4P90A 4WG5A 5HOAA 3R9HA 4IHPA 3HUBA 1WAKA 4DH8A 3HRCA 5A3XA 3BHTA 2OBJA 5EHYA 4EL9A 3IK3A 4F09A 4J98A 3JVRA 3CTHA 4IQ6A 4JBQA 5E8WA 4EK6A 1VEBA 4RJ7A 2C6TA 5BVDA 2FSTX 3FI3A 5EYDA 1URWA 2OF4A 3WF9A 4LDTA 3AG9A 3IG7A 3IPHA 1K3AA 3QTZA 4AW2A 3QYZA 1JLUE 4EH9A 5HVKA 3ITZA 2X6DA 3OFMA 4NCTA 3W16A 4FV8A 4LV8A 4CYJA 4DBXA 4B99A 4O6EA 3KXHA 5DI1A 3CC6A 2P4IA 3UVPA 4W9WA 5DN3A 1IAHA 3R73A 5E8YA 3OEFX 3FLQA 4H3QA 4EONA 5ETCA 4NYEA 3W2RA 3Q6WA 3P5KA 4TYEA 3IW5A 4MXAA 4FIEA 4N4SA 4UBAA 5HG8A 2UVZA 3HRBA 2LGCA 3K5VA 4D1XA 3D83A 4FF8A 1M17A 3JVSA 3VRYA 2YM4A 4L44A 1YRPA 3V5LA 1XBAA 2ZB0A 3E5AA 4J96A 4W4YA 2PZ5A 2PUIA 2G1TA 5EH0A 2PUPA 3OUNB 2BPMA 5IU2A 3TZ9A 4O0WA 2W7XA 2HXQA 2BCJA 3FXWA 3MDYA 3BV3A 4EH8A 2ITOA 3FBVA 5CI6A 1BKXA 4FTUA 3GU7A 4ZP5A 5FWKK 5K0KA 4DG3E 4ZS4A 3EL8A 1H01A 4IAYA 2WMAA 3LXPA 4RVTA 2BTRA 4XLIA 2XP2A 3Q9YA 3VWAA 4DEBA 2OJGA 5EK7A 4J7BA 3V8TA 2ITWA 5CAVA 2W96B 2WD1A 2YLEA 4EBVA 5HTIA 5L8KA 1Y6BA 3UP2A 1L8TA 3F2RA 4LOOA 4FTMA 2UW3A 2XYNA 4FKPA 3UBDA 4D5HA 1LP4A 1YXSA 2QKRA 1WBPA 4IX5A 4E3CA 4OUCA 2UZUE 4U3YA 4EC9A 2C6OA 3VBVA 3VC4A 1BLXA 1W7HA 3PP1A 2PMOX 4XEYA 3NUNA 4MBIA 4MXCA 3CJGA 4C3FA 4UB7A 3QFVA 3R30A 2ZAZA 4I3ZA 4JLCA 2X7FA 3R00A 1AD5A 3C9WA 3CQUA 2C69A 2OZAA 5B7VA 4DEIA 5I5ZA 4M66A 4PUZA 3DZOA 3QRUA 4NJ3A 4IM3A 3UO4A 3LFNA 2X2MA 2XYUA 5HX6A 2BZKB 4L42A 1YQJA 4BI2A 1GJOA 1Q8TA 3UO6A 5HNBA 2BAQA 2X81A 3WZKA 3FI2A 1Q8YA 3CIKA 3PPZA 2V22A 4FTKA 4I4EA 4NM3A 4YJQA 4FKQA 4ALUA 3SOCA 2WOUA 3GC8A 3BHYA 3JY0A 4GYIA 5J9LA 3D2IA 2BALA 2Z02A 3EH9A 1VYZA 3V6RA 3UC4A 3PRFA 3QF9A 4MQ2A 1E9HA 3VHKA 3WILA 4D4SA 4ERWA 4ORKA 4QYGA 3HLLA 2UZLA 4ZY4A 4OTDA 2XJ1A 3PPKA 3BYUA 2J4ZA 3HMPA 3DFAA 5ANKA 4F0GA 3NW5A 3ZMMA 3DA6A 2O2UA 2QC6A 5HE2A 2FB8A 3B8QA 2BILB 3GQIA 2QOOA 4WBOA 4ZSEA 3U9CA 4F6SA 3T3UA 2ERKA 4RIXB 1CM8A 5KMNA 3NFFB 4LUEA 3ENHA 4P5QA 5FM3A 1OMWA 4U3ZA 2JLDA 5L8JA 5T68A 3MVMA 5E1EA 3VJNA 4AXDA 3VS6A 3GCUA 4EOMA 4TNDA 3FDNA 4JOAA 5J87A 3ZSHA 1VYWA 4BJJB 3DY7A 3CR0A 3AC1A 3UQCA 1OL7A 3QX2A 3ELJA 3LCDA 4V01A 3AKJA 1WVXA 2A0CX 2P0CA 4LL5A 4QP7A 4ACDA 4DGMA 5KMJA 2VNYA 4I6QA 3COKA 1PXKA 2PZIA 1W2FA 1ZOGA 4PDOA 5IDNA 4DEHA 3FMMA 4AS0A 4EOJA 4BJJA 2HZ4A 2OIQA 2C6KA 4FODA 4F1TA 3H3CA 2QOLA 5JKGA 3W8QA 4B9DA 1B38A 4JIKA 5CANA 3IO7A 2XF0A 5ACKA 5L6OA 3R8UA 5JFXA 3D0EA 4W8EA 2X8DA 3RPVA 3KXXA 4YC8A 4YJVA 3ZFXA 3HMOA 1S9IA 4PMMA 2BUJA 5D7VA 4CKRA 4EOOA 2OKRA 1A06A 3LOKA 5K4JA 5L2WA 3ZZEA 3GU5A 5F94A 1WBVA 4N6YA 5ACBC 2WEIA 4IJ9A 4XYFA 4F7NA 4GMYA 3SRVB 2GNLA 3NIEA 2YM7A 3F5XA 2VO7A 1OUKA 3ZTXA 4RIYB 3ZC5A 4ACCA 4HYUA 3QBNA 1T46A 3OXTA 4O7VA 3TZ8A 1F0QA 1G5SA 4J8NA 3SRVA 2YITA 1APME 5HIBA 4KKEA 4IFGA 2XIRA 4KS7A 2JC6A 4KIKB 4DYMA 5AEPA 2Q83A 4M3QA 3DOGA 2J9MA 2R3GA 4EC8A 2ACXA 4WHZA 3S1HA 1NXKA 5HGIA 4TYIA 4O0VA 5JH6A 5M56A 3PLAE 2X6EA 4O4FA 2GNJA 1E1VA 5CVHA 4AZTA 3QUEA 4KIKA 1JSVA 4X3FC 1UKIA 5HKMA 5HTCA 3FY2A 3AGMA 1V0OA 3IW7A 3P08A 4FA2A 4CQGA 5IA1A 5EI6A 3PJ8A 5HG9A 4HGLA 2C5OA 3EFKA 5T6KA 4D28A 3AC8A 4F78A 4D9TA 1M2RA 2HW6A 4PL4A 3OC1A 3QXPA 2R3FA 3R83A 4MKCA 5E8SA 4YUQA 3KEXA 3ZYAA 4E5BA 3BHVA 5JMSA 4CFMA 2B4SB 3FMEA 4UMTA 3OTUA 5ICPA 3BCEA 2B0QA 3VUTA 4JR3A 2A27A 3UDSA 2QODA 2VGPA 5C8NA 5FLFA 1Y91A 3TWJA 1BL7A 2QO9A 3FEGA 4BDHA 4DAWA 3S0OA 4EYJA 4DH5A 2YIQA 5BVKA 3OCSA 3T9TA 4QMXA 4EQUA 2F2CB 5J5TA 2FUMA 4O86A 2XAOA 3A7GA 4FTJA 2QD9A 1FMKA 2OSCA 3P1AA 4EH3A 4C8BA 3E8EA 3DDQA 5IH5A 4FKLA 3L9PA 4J97A 2YERA 4DC2A 1PF8A 3ORMA 3UVRA 1H07A 3O96A 4FL3A 3FZTA 3LQ3A 4JBVA 3QTUA 1H1PA 5GZAA 4DEGA 2FA2A 2W1GA 5EQEA 4F4PA 2WNTA 3F2AA 3F3TA 3PXRA 4U97A 4Y85A 1I09A 3I6WA 1REKA 1SNUA 3NYVA 3ZDUA 5HG5A 4DFLA 4EH4A 4ASXA 5EYMA 3ULZA 5AP4A 4PDYA 2VAGA 4I0SA 4JX3A 1R39A 2QONA 3QZGA 2R4BA 1OPKA 2VTLA 3F69A 1XBBA 4O83A 1W2CA 1PYEA 2GPHA 3D2KA 4WNPA 5IMXA 4G16A 3V5WA 3BKBA 3IONA 2BAJA 2XNEA 2YAAA 5DIAA 3ZM4A 4C4IA 4CLIA 2BKZA 5H3QA 4FSQA 4QEBA 2J5FA 5CWZA 2HZNA 3QQUA 3PA5A 1P5EA 4MYGA 2BRGA 4HCUA 3V8SA 2Y8OA 3GC9A 4UYNA 3OCBA 4JRVA 3R7IA 3UE4A 3QKMA 4FX3A 4F65A 2BDWA 3KF4A 4LOQA 5GZ8A 2GTMA 2NYAA 1ZYDA 3ODYX 4DH1A 2IVUA 2PZYA 1OVEA 3O8TA 4EH2A 4OTWA 3AC2A 4XG4A 5AR7A 3UG2A 3WE8A 3R7UA 3ETAA 4O4EA 1U5QA 4ANQA 2JKOA 4MXOA 5EDQA 3AC3A 2IZUA 1R78A 1H25A 4IBMA 2Z8CA 4NW5A 4TN6A 3BBWA 1ZZ2A 4UZHA 2F7XE 4BFMA 5GJFA 4X2FA 4BDAA 2B53A 1BUHA 2QOFA 5CT7A 2BVAA 2HIWA 4ACGA 5AFVA 3THBA 3D4QA 3OP5A 2I0VA 2ZDUA 2V5QA 3LJ2A 4FBXA 4DLJA 3O2MA 2PE0A 2UW0A 3WZEA 4BCGA 4BDEA 2C6EA 1TFFA 4Y73A 2R3OA 2YDIA 4RJ5A 4JRNA 3E93A 4G34A 4BYJA 1YHWA 3ZC6A 5M53A 4I5PA 2OIBA 1XJDA 2WMUA 3LZBA 5CNOA 3UDBA 5FXQA 2CSNA 3EQDA 2VX3A 4IB3A 5AMNA 4FZ7A 3TNQB 3KREA 5M4IA 5LJJA 3ZO2A 4RX9A 3BX5A 4GJ2A 4I5CA 3MH0A 3SW4A 5CAOA 3OW3A 1JNKA 4M7IA 5HTBA 4OGRA 2GQRA 4O96A 4ONAA 4FSRA 2HAKA 3COHA 3BWJA 4XRLA 3PE1A 2DQ7X 3GU4A 3NW6A 3GCQA 3HEGA 1P4FA 1PY5A 4IX3A 5BVNA 5KMIA 5DHJA 5HVJA 1SNXA 3U6JA 5AR8A 2PVJA 4O27B 2HENA 3MPMA 3SXSA 1TQIA 4JX7A 3IECA 4H3BA 2B9JA 5AV4A 1JKLA 4NW6A 5BVOA 3BLRA 2W1EA 3W0PA 5M06A 4FTRA 2FYSA 3KULB 4NTTA 1Q3WA 1UV5A 4O2ZA 4XBUA 3UGCA 4BGHA 4CEGA 4UN0C 5A4TA 3NMUF 2XZSA 5EYKA 4BCQA 5E8TA 3ZEPA 4HVDA 4FV3A 4YTHA 4JXFA 3VF8A 4LMNA 5LARA 5LVPA 4AP7A 3KULA 5CF5A 4PX6A 1Z9XA 1P2AA 4NWMA 4TNBA 2F4JA 4FTIA 1PMNA 2PMIA 5DPVA 5AA8A 4DN5A 4CT1A 2C3KA 3RM6A 4R78A 1STCE 5CQWA 1CKIA 4IWDA 3HYHA 2GNGA 3HZTA 2RFEA 3HX4A 4ANMA 2YCSA 4DGLC 3TM0A 4E8AA 2JBPA 1U54B 3CGOA 5HE1A 3T8OA 3OT8A 1TZDA 4YO4A 3KK9A 3IGGA 2OO8X 4HZSA 4X2JA 3IW6A 5IH4A 4BWXA 3GP0A 3CBLA 3T9IA 4MNFA 1KE9A 4X6RA 5AAEA 4ANSA 2BDJA 2C5YA 4QP1A 4BR3A 5HVYA 2WU6A 5CU0A 3ORXA 1U54A 3PG3A 2OFUA 3VS7A 3HV3A 4QP3A 4ZTLA 5FTOA 5FEDA 4CZYB 3C50A 4K2RA 2QOBA 1KV2A 5CF6A 2IWIA 4I22A 3QCQA 3QD4A 5CXHA 5IZFA 1ZYLA 4IXPA 2JKMA 2C6MA 5HBJA 3FMJA 4F1MA 2H8HA 3ZFMA 5EQYA 2OU7A 2X9FA 3MJ1A 2JDRA 4JBPA 1OL6A 2R64A 2XK6A 1UNLA 2H6DA 2P55A 3RNIA 1O9UA 4GFMA 3VQUA 5E91A 4PRJA 5FXRA 2YDKA 4LRJA 4E93A 4PPCA 2YM6A 2R0IA 4XS2A 2EXEA 3RVGA 2PVKA 4AACA 4FKJA 4DT8A 2PVNA 4IAFA 4QP2A 2AEGA 4D58A 3OBJA 1YXUA 4G3DA 4TT7A 1UWHA 4NUSA 1RDQE 2ETMA 3KRLA 4S30A 3EIDA 2W99B 3LXNA 3N51A 4I6BA 3WF6A 4ASZA 4QYYA 2HYYA 5K5XA 5CNNA 3W32A 3VS2A 4L00A 3K3JA 2Y9QA 4CT2A 2C5XA 5IQGA 4C34A 3VBQA 4FKRA 3GU6A 3WIGA 5LVLA 3EQGA 3K5UA 4FTQA 3EKNA 3PXZA 4AA0A 4O82A 4ZSGA 1PKDA 3MYGA 3TUCA 4D4VA 5M4CA 3DBCA 4R1YA 3VRZA 3WI6A 5ANDA 4RC4A 1J7LA 4YJSA 4FE2A 1Q24A 3U51A 4IH8A 4PQNA 4OBPA 1H0WA 3BV2A 3E92A 1H1RA 4FZ6A 1YHVA 5AR5A 5HE0A 3RKBA 3U9NA 3WF8A 5C03A 4E5AX 4G9CA 4CSVA 3QRJA 2BHEA 3QD2B 4A9SA 4EOIA 4LGGA 4C61A 2ZB1A 2R0UA 3G0EA 4XG3A 3F3VA 3DAKA 4QMSA 5JRSA 3E64A 2EU9A 3EN5A 3QQKA 2OXXA 2Y4IC 3ZSGA 5IQBA 4IVBA 3P23A 4UXQA 3BYSA 4C57A 1OKZA 5HICA 3FLNC 3M1SA 3PVGA 4FKSA 4DG2E 3GEQA 1ZOEA 4ZZOA 2JGZA 4FEUA 5EM7A 4TZRA 4B8LA 1L3RE 5DT0A 4FNWA 2E9VA 1W84A 3JUHA 1PXJA