4AXAA

Structure of pka-pkb chimera complexed with (1s)-2-amino-1-(4- chlorophenyl)-1-(4-(1h-pyrazol-4-yl)phenyl)ethan-1-ol
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title At13148 is a Novel, Oral Multi-Agc Kinase Inhibitor with Potent Pharmacodynamic and Antitumor Activity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4axaA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axaA02
3EYGA 4QMWA 3MYGA 4ACGA 2BKZA 4KBAA 4MNEA 2XYUA 3ELJA 5TT7A 3BU6A 5CX9A 4CMUA 4BYJA 2R5TA 5AUXA 2WEIA 2CSNA 5CENA 5H8BA 3CJFA 2CGUA 4RC4A 3TV4A 1PW2A 2VO3A 1M7NA 4FT0A 5ACKA 5L4QA 3QTSA 3OROA 5BVDA 3PVUA 3O51A 1M2QA 3VVHA 5IPJA 4KIQA 3BHYA 4ITJA 4Y46A 4FKLA 2X8DA 5CEIA 4EOLA 4GW8A 4ANQA 2QOCA 5DEWA 3OXTA 4FKTA 3C4XA 3FV8A 2RG5A 4YJQA 5AV1A 4DBXA 3JYAA 3EQBA 4P90A 1A9UA 4L44A 3BE2A 3ZH8A 5DIAA 2W4JA 3F9NA 4S34A 5IQGA 3FQHA 2BR1A 1CMKE 4M14A 4BBMA 2FGIA 1FMKA 3O8PA 3TEIA 3ZU7A 1CKJA 2I0HA 4DFYA 2EUFB 4AE6A 3DQXA 4WUNA 3PIZA 4ZOGA 2PULA 2A4LA 2YDJA 3F3WA 4TWNA 4UMRA 2JLDA 3Q9WA 5DNRA 3TJCA 3B2TA 4DN5A 5EKNA 3ORXA 4Y85A 4C59A 1RE8A 3TIYA 4R3PA 1K2PA 4XV9A 1KE9A 2VO0A 5IQBA 3FI3A 3OWJA 3ZFYA 3H10A 3U4WA 2IPXA 3DK7A 4XG2A 5C03A 2BCJA 4L8MA 2WTKC 1OIRA 3DV3A 1W83A 4A9YA 4NSTA 3TL8A 5J9LA 1I44A 2J0LA 4YNOA 4QP3A 5AM7A 3QLFA 2QOHA 3O2MA 3RKBA 4DEBA 3TN8A 3E3PA 3DJ5A 4BCOA 3OS3A 5GZ9A 4F4PA 5A4EA 3N4UA 4KB8A 3OD6X 3MY5A 3COIA 4CFNA 3JS2A 4TN6A 4F70A 3SA0A 4ASEA 1U4DA 5CQWA 2HK5A 2G2HA 3ZFXA 4JXFA 5FTQA 2Z02A 4E6AA 3OWLA 4K2RA 4WT6A 2ITUA 2J2IB 3L8PA 4G6OA 3MIYA 4M84A 2HW7A 5BYYA 2GNFA 2NRUA 4I4FA 4USDA 2YZLA 3PYYA 2R7BA 5C4LA 4JS8A 5TR6A 1P14A 2CKOA 3FYKX 2H96A 1OL6A 3PJCA 4XP0A 1ZY4A 4BZDA 4JBQA 4E5BA 2BZIB 3R7VA 3ZUUA 2BROA 1MQ4A 2R7IA 3BYOA 3DKGA 3I81A 3QCQA 4M13A 3GQIA 5FXQA 3TTIA 3TZ9A 4ZLZA 1V0PA 4RIXB 1YWNA 4YJOA 3ORMA 4HYHA 3S95A 2IVUA 3P78A 4QP6A 1CKIA 4OTDA 5KHXA 3QTQA 3MVHA 4L53A 3NNVA 4U42A 4BHNA 1V1KA 2PMNX 3C51A 3P08A 4XG8A 4AW5A 4RX7A 4CQEA 3L8XA 4BI1A 5HNIX 2J0MB 1XO2B 3B8RA 4PP7A 4XG4A 3EIDA 2J7TA 5D9HA 4XP3A 3ZO2A 2B9IA 3N51A 5AWMA 4CKIA 2NNWB 3HUCA 2W1GA 4NM5A 2WMAA 3QC9A 3VIDA 3PXRA 2IW8A 4FV9A 3FDNA 5A4CA 1GOLA 5J8IA 4EK8A 2J5FA 4K6ZA 5D7AA 3ZRLA 3QHRA 1IA8A 1JSVA 3EH9A 3H9FA 5EYDA 5GJDA 4RJ4A 2HZIA 5HLWA 5HLNA 4MCVA 3WILA 2AUHA 4QMLA 1LPUA 4O81A 3NYOA 4EZ5A 3VAPA 4YLJA 2CNVA 5CZHA 2WMTA 2WMVA 4GFMA 4QQCA 1Q8WA 2VV9A 5KO1A 2WQBA 2OJ9A 2ZOQA 5DOSA 4AZEA 2H9VA 4A07A 3I4BA 1YWVA 2QR8A 2EXEA 1U46A 3HEGA 4W8EA 3WOWA 2PZRA 3DA6A 3H0ZA 5ANGA 4ZY4A 5GIOE 4D0XA 5M09A 1ZAOA 3HV7A 1OM1A 5LVNA 3FJQE 2WQEA 5HKMA 3UTOA 3PLSA 4C4IA 2C5NA 4FV1A 4UX9A 3L9NA 5C9CA 3I7BA 2ZM4A 4C4GA 4CXAA 5CNOA 2W99B 4RIXA 5L8KA 3GI3A 4OTHA 2WAJA 2OW3A 3PP0A 5EM5A 3W2QA 3LFFA 1ZMVA 4KBCA 3WF5A 1H07A 3FI4A 4GV1A 4AZFA 3CEKA 4F63A 3QKLA 4O7VA 2O3PA 1PMVA 2X1NA 3OXZA 4U3YA 2PVRA 4UZDA 4W9XA 4BBFA 4FTCA 4EJNA 4AP7A 3F6XA 3VBWA 3U6HA 4BIEA 3MBLA 2FYSA 1WBSA 4TNDA 2ITZA 4E6QA 3UYSA 3MIAA 5EW8A 4AN2A 3K5UA 3PLAE 3NIEA 4X2KA 5KBRA 3DKFA 5BMMA 2XKCA 4FIJA 2XZSA 3QTRA 4GVAA 1KUTA 2GQRA 4FKIA 3PDTA 3BLRA 3JPVA 2UZEA 4JIKA 2Y4PA 5HI2A 2HY81 3VUIA 3LFBA 2R3NA 2R3KA 3AD6A 5BVEA 2Y0AA 3DBQA 4F65A 5I4NA 3HKOA 4EOMA 2KULA 5I9UA 3OT3A 3ZLYA 2YABA 1ZWSA 3DZOA 4O7NA 1R0EA 4PQNA 2YM4A 5H9BA 4BCPA 4QP7A 5JQ8A 2ZMDA 4DFUA 2I6LA 3EFKA 3GVUA 2OJGA 4E4NA 2VTNA 4L3JA 5LMAA 3CQUA 2JFLA 1QPJA 5GHVA 3RM7A 5J1WA 4FNXA 4ZLOA 3QZHA 4FEUA 1OIYA 2ERZE 5A9UA 2IVVA 1IAHA 1W7HA 2GMXA 4GFOA 3N4TA 2UW0A 5HORA 2Q0NA 2YITA 3A7FA 4BDCA 1H1QA 4ZJJA 5GZ8A 4F6UA 3QD3A 4I1ZA 4I4EA 3ZMMA 3CTQA 4XG7A 4EOKA 3U9CA 3PXYA 5FTOA 4DH3A 5DVRA 4ZMEA 4HVDA 2VX3A 3QTZA 1DI9A 4QMTA 3ZCLA 1GZ8A 2BTRA 3MDYA 3Q4CA 1H00A 1OGUA 3HZTA 2OXYA 4F9WA 1QCFA 3VQHA 5KZ0A 2HW6A 3GU5A 4DYMA 3KQ7A 3TDVA 2BALA 2OU7A 4FV6A 4FKRA 4IIRA 2Y6OA 5AP6A 4RLKA 4EK4A 2ZM3A 2UZWE 3MJ1A 3MTFA 4BDAA 2O64A 2OI4X 3ENMA 2XA4A 3R6XA 4MVFA 4K0YA 3LXLA 2W1CA 3Q9YA 4DF3A 4FTUA 2VTHA 4K8AA 5LCKA 3VUKA 3ZBFA 4Z16A 2C5VA 2KTYA 3FMDA 2Z7RA 4UALA 4LRMA 3RHKA 4IHPA 4CLIA 4H36A 3FPQA 5GJFA 1Y57A 4FX3A 4YU2A 5CF4A 5M4IA 5FUTA 3R7GA 2Z8CA 4IBMA 5D7VA 4G31A 4AUAA 4B6LA 2OK1A 4PNIA 2UW8A 4N6YA 3AD4A 4C37A 3QQUA 4GMYA 4O0SA 3K5VA 5A46A 3NUXA 2VTAA 2HENA 4OW8A 3EQPA 2YLFA 4DGOA 1FGKA 4M69B 2XRWA 3NYNA 4D2SA 1YKRA 4LG4A 1H8FA 2W5AA 5CI7A 4ZP5A 4E4MA 3R00A 3R0TA 3QZIA 5FDPA 4M3QA 3KXZA 4QP1A 1U54B 2PPQA 3PA4A 3WF6A 4JL9A 5CAQA 3DS6A 2JITA 3H4JA 3R71A 2GNJA 2GNIA 2ZMCA 5CNNA 3O71A 5B2MA 2Z2WA 3BYSA 2NO3A 3LKMA 3W2PA 4TL0A 3EFJA 1OB3A 3PVWA 4V01A 5HCYA 3POZA 4CNHA 2PE0A 4KKEA 1XH4A 5HNGA 4GEOA 3FPMA 3EMGA 3DK6A 3A60A 3V01A 5D1JA 3UZTA 5EFQA 2F7ZE 4NU1A 1BMKA 4YBKA 1Q8UA 4C7TA 3E64A 4FL2A 4X6RA 5D41A 3V8WA 3PXKA 2W1HA 3RP9A 3E62A 1IG1A 4FIGA 5IA3A 4IFCA 5ANIA 3T3VA 2PTKA 5I3OA 3ZXZA 2WTJA 3HYHA 4CYJA 2W7XA 4FEVA 3NZ0A 4V0GA 4HVHA 5E1EA 5E7RA 5ANKA 4LMUA 2QI8A 5CAVA 3QUPA 4ANNA 5BQ0A 4FODA 2F7XE 5HBEA 3R7IA 1Q99A 3PXQA 5AUYA 2YISA 2JDOA 4G3GA 3CC6A 3D5WA 3RPSA 2IJMA 3CGFA 3C5UA 4JG8A 4XBRA 4AZTA 4J1RA 4BB4A 5KUPA 2QONA 4EK3A 3RHXA 5TE0A 3R2BA 3SW7A 2WTKB 1SVGA 3QCSA 5HTIA 3LE6A 4A4XA 3KKVA 3LLTA 3R8PA 3V5JA 4MTAA 3M2WA 4RRVA 4IVCA 4JAJA 1U54A 3OEZA 3D0EA 3KU2A 4UV0A 4BN1A 4EKLA 5L2IA 4CLJA 4I5MA 4J97A 2PY3A 2CLXA 3F2AA 3UNKA 4NJ3A 4QRCA 4IADA 3WF8A 2BAJA 1BYGA 2WTDA 2QR7A 2ZV9A 3CP9A 3PRFA 3HDNA 4PL4A 5AP4A 4F1TA 4ZY6A 4DEEA 3GXLA 2XK9A 4EK5A 5GINE 1YXUA 2ITXA 3R1NA 4RC2A 4G6NA 3NUUA 5CU4A 4M97A 2WQNA 3CLYA 2UVYA 3HMNA 1PF8A 4BBEA 4FICA 4XG6A 3FZ1A 3MV5A 4IB5A 5HO8A 5GJGA 3FMEA 2BTSA 4P5ZA 1P4FA 4FOBA 4GS6A 5L2SA 2OGVA 1GJOA 4HW7A 4FVPA 3TIZA 3U4UA 2FSTX 2I0VA 4HNFA 2SRCA 4U41A 4ANSA 3F3VA 3DB8A 1OPJA 2UW9A 4FKOA 1ZRZA 4APCA 5IQIA 4FTLA 3CD8A 3ZLWA 4QNAA 2X8EA 2VTLA 3AGMA 3UYTA 5EI2A 4BI0A 4O22A 5AEPA 3F3TA 4QMUA 3OBJA 4EC8A 2QHMA 4CG8A 5CU3A 1HCKA 1W8CA 2HZ0A 4MD8E 4BDGA 4P5QA 2YDIA 3ZOSA 4CFMA 2XYNA 4G3DA 3EWHA 3C13A 1XR1A 4RIWA 5CI6A 2OIBA 5A14A 3NNUA 4IX5A 3EYHA 4Z7GA 4RFZA 3OUKA 3RZBA 3GP0A 5E8TA 4ACMA 2WU6A 4JQ7A 1PXPA 3NPCA 5EI8A 1Q24A 3G0EA 5J7HA 4D0WA 3FKOA 4IE9A 4EH5A 3MN3A 4WNOA 5IMXA 4CT2A 4IWPA 5CXHA 3CPBA 3A4PA 2V7AA 4EORA 3A4OX 3ZTXA 3E5AA 3F3ZA 2VN9A 2J50A 3LJ2A 2BMCA 3UZPA 4FTIA 2JIUA 4BC6A 5M51A 4FTMA 3NYVA 2C3JA 2CGXA 4K9YA 2X6DA 5K5XA 1QPCA 3DNEA 4AOTA 3Q3BA 4DLIA 5J9YA 5KMOA 4JDHA 4F9YA 2YZAA 1CTPE 3EN5A 4BCIA 4UN0C 3NMUF 3QZFA 3DT1A 4H3BA 3VW6A 4C62A 3FMHA 4L3PA 2RSVA 1HOWA 2LAVA 2W1DA 2J9MA 3FI2A 1FINA 1GIJA 4FBXA 4WKQA 5ANEA 4TWCA 5HHWA 4MNFA 1UU9A 1P4OA 2Y8OA 3KY2A 4S30A 1OL2A 1ZYSA 1DS5A 3L9PA 4MF1A 3C0HA 1H25A 4NCTC 5CU6A 5EYCA 2R4BA 4LOPA 4RX9A 4ZSGA 4M12A 4FSZA 4E73A 3LPBA 4UY9A 2WZJA 3NW6A 1GY3A 4F08A 3BGZA 2O8YA 3BPRA 3BGPA 3R9OA 4HZSA 2WMWA 1PXNA 2XB7A 2C3LA 3PP1A 4IM2A 2HCKA 3LXNA 3RBWA 2VAGA 1ZYLA 2VWZA 1MQBA 1XH7A 4DTAA 5BUJA 3D9VA 4J7BA 5AR7A 1O6LA 5ETCA 3WZKA 4D28A 2DWBA 2IZRA 5KKRB 3LCDA 4LV8A 2BZHB 4EH3A 3PJ1A 2BAKA 4AGWA 4Q5HA 3C4CA 5K4IA 2OBJA 2XK8A 4WRSA 3CQEA 3RZFA 4BGHA 3MFUA 5FG8A 5AUZA 4FSYA 4FSRA 2QLUA 5L2TA 2C30A 1ND4A 5HBJA 3QGWA 5LARA 1JVPP 5JFSA 2CKPA 4ONAA 3TG1A 4C35A 5LMKC 4KSPA 1Q5KA 2EXMA 3DU8A 3VBYA 2B9HA 4U43A 2R3FA 4IJPA 1URWA 5HOAA 5EM7A 4E6CA 5CEPA 2OLCA 2VO7A 2VTPA 1BI7A 5AP3A 3EQDA 3BQCA 2WMUA 4WNPA 3P86A 1YOMA 1WBTA 3PXZA 3TZMA 2O2UA 4MD7E 3HP5A 3OCBA 5B2KA 4MBIA 5J9ZA 4O7LA 2ACXA 4ORKA 4IAZA 3ZDIA 4KUJA 5KNJA 5EYKA 4FNZA 4YJVA 3G5DA 4TYEA 4EOJA 2P2HA 2XNMA 3UE4A 3F5GA 1LP4A 3KK8A 4XS2A 2GHMA 4CKRA 4O7ZA 1H26A 5IZFA 5IA2A 1OBGA 5CU0A 3I0QA 3KXGA 4MQ2A 3ZO4A 3V5PA 4YJSA 5I3RA 3G33A 5CT7A 4BKYA 3KEXA 4JRNA 3TT0A 3E3BX 2OZOA 4QMSA 3IGOA 4KAOA 4NZWB 5L6PA 2A0CX 3DKCA 3NR9A 1NA7A 5IH5A 4ZIMA 3ZHPC 3QA0A 4OBOA 4XLVA 3R7EA 4UXLA 4NKSA 4O27B 3CS9A 3ITZA 3VHEA 4H3QA 4QQTA 5KMNA 3FMKA 4KIOA 3NNXA 3EFWA 3MH3A 3DAEA 5HCZA 4LOQA 4E6DA 4W9WA 3C7QA 4FSQA 3VF9A 4MX9A 2FA2A 3W55A 4TT7A 1SM2A 4DGMA 2W4OA 3IS5A 5BYZA 1T46A 5K4JA 3GU7A 3SLSA 4O0UA 4O0TA 1OMWA 4G3CA 1YXVA 3FMMA 3NUSA 5B0XA 3S1HA 5HG5A 5T68A 5IQHA 4LV5A 1GNGA 2Z60A 4FG9A 3ZZWA 4AQCA 4DTKA 3DY7A 4F9AA 5C8NA 5BNJA 3UP7A 4B8MA 4EOOA 3MSSA 4MD9E 1QPEA 5HTCA 4PPBA 1ZOGA 2X2LA 2B1PA 4A9TA 2GQSA 4IZYA 4M0YA 2C0IA 4OR5A 4FTJA 3TV6A 3TKHA 1OKYA 2CDZA 4J99A 3F82A 3GU8A 3PIXA 4JG6A 1JOWB 4D9UA 3EQFA 3LM0A 5EOBA 5HZNA 4K11A 4LUEA 3D7TB 3DLZA 1BI8A 3AC2A 3HUBA 3JY0A 3EN7A 5FWKK 3M1SA 3NUPA 2P33A 2XJ1A 3QZGA 4D58A 1Z9XA 5I9WA 4FI1A 3FXZA 3BHTA 3NW7A 3TNHA 3LJ1A 4EKKA 5JT2A 2AC3A 4IWOA 1VR2A 4N0SA 2WOUA 4DA5A 3QFVA 2PHKA 2OICA 4BDDA 3RPRA 4DH7A 5IG1A 3MPAA 2GTNA 4IAIA 3ODZX 5FP5A 3UVPA 2AYPA 5HEZA 4JIAA 3COMA 2FSLX 3FLWA 3E8EA 4MXOA 4I5HA 5HU3A 4HYSA 3ZLSA 2CKEA 4FKUA 3TZ7A 1F3MC 3I1AA 1FMOE 2PVHA 4AA0A 2W05A 4PPAA 4PNKA 4HCUA 2XRUA 2YAAA 1XH5A 4R1VA 4EH8A 5L2QA 3B2WA 3UIBA 3KRXA 4KABA 4QMVA 2X81A 3SV0A 2HXLA 1JSUA 3VW8A 5B7VA 3QRKA 4QP8A 4WG3A 1R1WA 1BLXA 4RJ8A 5JFVA 3WYXA 2YA9A 2YWVA 3S00A 5AR4A 1ZMUA 5E90A 4I6HA 4HGTA 3WIGA 5HO7A 4FE2A 3QWJA 3W18A 4KIPA 2E9NA 2PE1A 4RIOA 1BUHA 1REKA 5IA1A 1JKTA 3DCVA 4GL9A 3E93A 3LFCA 4OLIA 2VTOA 4FL1A 4QNYA 3FQSA 2UVXA 4X2FA 2X6EA 2ONLC 5E91A 3VUMA 4ZZNA 2VNYA 4GIIA 4JG7A 5AUTA 4YHJA 2R0UA 4D1ZA 2UW3A 3IOPA 3D7TA 4BGGA 3QRTA 4YC8A 2HAKA 2QOLA 5AA8A 3P9JA 1KE7A 3PVGA 3RMFA 2ETKA 5AP7A 4BWPA 3HX4A 1YI4A 3QTWA 1RW8A 3ZM4A 2C1AA 2JGZA 3EHAA 1TKIA 3VUHA 2VX0A 4L00A 3LAUA 4WO5A 4FIHA 4BCNA 1S9IA 3F88A 3LW0A 4R3CA 3D7ZA 4Q2AA 2C5OA 3BV2A 5M56A 4Q5EA 4YHFA 2BPMA 5AIRA 2X2KA 3FC1X 3MH1A 3R8MA 3U55A 1JAMA 3KL8A 4QTBA 4U3ZA 3PWDA 4EH9A 4OGRA 4L43A 3Q04A 3RCJA 1WBPA 2P55A 4JX3A 2IZTA 4JJRA 4CD0A 2C47A 4W8DA 4R7IA 1FVRA 5C8KA 4QTAA 2PMOX 3D14A 4OTQA 3R9NA 3PPKA 4L7SA 5CASA 4ALWA 3PTGA 4BCQA 3PVBA 4EHGA 5HE2A 2PVFA 4IB1A 3BRBA 1YHSA 2VZ6A 3R8LA 1STCE 4V04A 4DH5A 2RL5A 3EQCA 3OP5A 2J6MA 4HZRA 2JEDA 2RG6A 2OF4A 2PVMA 3BU3A 3GCQA 3WE8A 1PYXA 3QKMA 2JKMA 3AT3A 4H3PA 5IQFA 3ORIA 3EQIA 4QQJA 3W10A 1B38A 4PTEA 3VRYA 3A7HA 3IO7A 2IZUA 3HGKA 3RK5A 2IVSA 3ZSHA 3DNDA 1T45A 1WFCA 1CDKA 3UO6A 3LMGA 3N9XA 3ZC6A 4TYHA 3LJ0A 4Q9ZA 3LXKA 4PP9A 2VRXA 4AX8A 4FA2A 3V6RA 2W5HA 4NJDA 2ITPA 5E9EA 4D5HA 4D9TA 5AAGA 3ALNA 3D5XA 4BZNA 3AC1A 3GC7A 3TNPC 2V0DA 5FP6A 3JUHA 3AXWA 4I21A 3VULA 3OMVA 2XBJA 3Q53A 4EQCA 4RQKA 3G9NA 4AG8A 1A48A 2ITWA 4BDKA 5I5ZA 4OAVB 1PKGA 3UBDA 2JDTA 2B9JA 3D2IA 5DA3A 2IW9A 4H1JA 4HOKA 3E8NA 5BPYA 3I6UA 4LRJA 1M2PA 3A7IA 4GT4A 5HVYA 3TNWA 3PSCA 3RM6A 4E4LA 3O0GA 5JKGA 1KWPA 5HIEA 1PMUA 2YCQA 3ETAA 3OZ6A 4FTKA 3UO5A 3HV5A 2UW5A 3HL7A 3QTUA 3CXWA 3F7ZA 3HA6A 5DPVA 1OKVA 4FOCA 3IW8A 5FEEA 3DXQA 1E1XA 4AT3A 3UNJA 4GU9A 3I7CA 2ITTA 2O63A 4EH2A 3E7OA 4GU6A 2BDJA 4B0GA 1KV2A 4PF4A 1YW2A 4Y73A 1XH8A 2VWUA 4QP4A 4ACHA 5J7BA 3QX2A 3EL7A 3OCGA 3TDWA 5DWRA 3RAHA 2W9FB 3NUNA 5EK7A 4DT9A 5CF6A 3TTJA 3T3UA 5JFXA 3DJ7A 3VJNA 3SAYA 5FBOA 4JOAA 1UWJA 3DKOA 4WBBB 2X8IA 4GYIA 4DLJA 3QRJA 5IMEA 4HGLA 4F6SA 2VNWA 3EB0A 4U81A 3F7WA 4EOIA 3FLYA 4AE9A 2RFDA 2G15A 4B99A 3PJ3A 2BRBA 4WNKA 4BYIA 3FLSA 4L42A 4QYFA 2C6EA 5TOZA 3KN5A 2X9EA 1YOJA 1BL7A 5IQEA 4C0TA 2EWAA 3AD5A 4PPCA 4AXAA 2ZM1A 5ACBC 2WPAA 3UIXA 4JBVA 5KBQA 3SHEA 4L6QA 5AUUA 4RWJA 3PPJA 2HWOA 1R3CA 2QCSA 3BEGA 4ZJIA 1Q3WA 3PRIA 4JX7A 3FYJX 5L2WA 4NCTA 2HYYA 3SVVA 2WNTA 3FEGA 3R30A 2X39A 4F1OA 1OVEA 2BAQA 5CF5A 4EH4A 4AACA 1CKPA 5EW9A 3Q96A 3OW3A 4QPSA 4TYGA 3RPOA 3W32A 3SDJA 4C36A 3KF4A 4BRXA 5BUEA 4GK3A 3U54A 2IN6A 2C6IA 2C3KA 2XNNA 5CQUA 3GB2A 4ZS0A 4C4EA 4AA5A 5FRIA 2YIRA 3AC4A 4XH6A 2XIZA 1SVHA 1XH9A 3HRCA 5E8SA 4GUBA 3RAIA 2X0GA 5H8EA 3OVVA 4N6ZA 4C4FA 4DCEA 4FV2A 5EDPA 3SD0A 4I24A 2BHHA 3OY3A 2I1MA 4JQ8A 2YIQA 3O8TA 2JDSA 4X0MA 1UVRA 5LQFA 5EQEA 4C3PA 2WO6A 4XX9A 1YXXA 4U79A 5EM6A 4JLCA 3DAJA 2EB3A 3FKLA 2YDKA 3IOKA 4FT9A 4AW2A 4KNBA 2GQGA 4F9BA 5HQ0A 5LCJA 5LMKA 3W16A 4BDIA 5EKOA 3CCNA 2YN8A 1WBNA 2DUVA 1SNXA 3JVRA 3TXOA 2XNPA 2YCSA 4PTGA 3Q4ZA 3OG7A 3R73A 3ULIA 4ACCA 5K5NA 5T3QA 4E26A 3ORTA 3PA3A 4GG5A 5DHJA 4BY9E 4AFEA 3BLQA 5IA4A 4ZY5A 5A4QA 3U6JA 2BFYA 2RFSA 2Z7QA 1VZOA 5HVKA 1OZ1A 2J0JA 3IONA 3BU5A 2WD1A 5DN3A 5HD7A 4TWPA 2R3RA 2X7OA 4BTKA 3DTCA 3ZSIA 4JR7A 2A2AA 2A19B 4L3LA 2JAMA 1OITA 1WVXA 3EN4A 4LUDA 4TZRA 1SVEA 5FXRA 3QRIA 1UWHA 4Y83A 3VS5A 2VWXA 4AAAA 3G51A 3NAYA 2YM6A 4U80A 5DI1A 4F7JA 4HNIA 1OBDA 5KZIA 2UZDA 1UKHA 4H1MA 3SRVB 3CKWA 2XMYA 3O8UA 3CTHA 1MRUA 4XCUA 4PX6A 3IECA 3BIZA 3VRZA 4WIHA 3NGAA 4GT5A 3FL5A 4F9CA 1Q8TA 4L46A 3FMJA 4U5JA 3C0IA 4EH6A 1UV5A 1IAJA 2XP2A 2PUIA 5AR3A 4CZYB 2PUNA 2W9ZB 3HMMA 1X8BA 3Q52A 4GK2A 4I20A 4DEHA 4FTNA 2Y9QA 1SZMA 4D2RA 1SYKA 5CZIA 3UIMA 3ZXTA 4S33A 1G3NA 4KSQA 3R7UA 2O0UA 5D11A 3WE4A 4C57A 4G9CA 4FGRA 4NW6A 1FOTA 3FQEA 5JZNA 4C3FA 3TJDA 4NYEA 3NDMA 1XBCA 4V0GB 4YTCA 5KMIA 2E9OA 2DS1A 4ZAUA 4YUQA 4OBPA 4GRBA 2E9UA 2QODA 3BBTB 1R39A 4P4CA 4EK6A 2GFCA 2ITOA 1Q4LA 2QOFA 1FGIA 2YIYA 4YPSA 1CSNA 3G15A 3R9RA 1IRKA 4KIKB 4UXQA 4PUZA 4G17A 2GTMA 3ANQA 2V7OA 3COHA 2CCIA 3P23A 5CSPA 2YEXA 4XG9A 5G1XA 2ITYA 5DYJA 2QOQA 4OTRA 4H58A 4ALUA 2GSFA 4CFUA 4NUSA 4UEUA 2W1EA 5M55A 2UVZA 5BVWA 2OSCA 4MF0A 4UBAA 3W2RA 5LWMA 3SRVA 4R78A 3AT2A 4YHTA 3QYZA 2XNGA 2QQ7A 4IQ6A 4EH7A 1MUOA 3BBWA 2X7GA 2XM8A 4O0XA 3GFEA 2GNGA 3GEQA 4JDJA 4RZVA 4AN9A 3L1SA 4IAAA 4XYFA 3UQGA 3MS9A 3QQHA 3QCYA 4EUTA 4FV3A 4O91A 5KMKA 2VUWA 2XUUA 2ERKA 1AGWA 2PVLA 3MW1A 1K9AA 4QMQA 2JKOA 2R3MA 3CD3A 4USFA 4EWQA 5CVGA 3O7LD 3P7CA 4X3FC 5E1SA 3A8WA 3GCUA 3R21A 1PMNA 3EOCA 3MESA 3KRJA 4FKJA 4I22A 3C1XA 5A4LA 5CEOA 2O65A 4M7IA 3AC3A 4KRCA 2XNEA 4FTRA 4TY1A 2C68A 3EZRA 5HE0A 4O0YA 5GNKA 4YJPA 3ZO3A 3C5IA 3THBA 3T9TA 4ZTMA 5L6OA 5AUWA 4FK6A 1S9JA 4K18A 3F5XA 3OBGA 4XG3A 4S31A 5JRQA 5IQCA 4LL5A 4CRSA 4ENXA 2QKRA 4TPTA 3QGYA 4YGAA 5LXMA 2B0QA 3DDQA 5AP5A 5M44A 3EZVA 2XH5A 3Q4TA 4O0VA 2ONLA 4CYIA 4KIKA 4GT3A 2UW4A 4WBOA 5J95A 4RIWB 3U8WA 3RWQA 3EQGA 4PY1A 4DE4A 1TQMA 3MB7A 5HG9A 2R64A 4D2PA 4YPDA 4QP2A 3QTXA 3WBLA 3VQUA 3QL8A 2A1AB 5JGBA 1YXSA 4MYGA 4CEGA 3IDCA 1Y8YA 2OJFE 3DBEA 4U44A 1NVSA 2GNLA 3DBDA 4FG8A 2OG8A 3H9RA 4J8NA 1IEPA 4C38A 4UYNA 4GK4A 4WG4A 2WELA 3P4KA 5C27A 2WB8A 4JNWA 3QHWA 2JIIA 3L8SA 2UZNA 4FGBA 4H39A 4NFMA 5KMMA 2CMWA 2WTCA 4EBVA 2XCHA 2B4SB 3SX9A 4DTBA 4QTCA 1PXMA 1SNUA 3FL4A 4DGNA 3O7LB 3P0MA 2YACA 1YVJA 4BDJA 3MJ2A 4PL3A 4II5A 4BCJA 4ZJVA 4M0ZA 4IDTA 2JBPA 2XK6A 3P5KA 4D4YA 4R6VA 3NVKI 4RA4A 3VS4A 4IC7A 2VWYA 3QTIA 4NK9A 5CEQA 3HAMA 3BKBA 4RVTA 1TQPA 4EHEA 3UP2A 3GQLA 4WRGA 5T6KA 3KVXA 4OT5A 4YTFA 3F2NA 2QO2A 5DRDA 5CVFA 3V5TA 5K0KA 4G34A 4EQMA 2W0JA 1IR3A 3MFTA 3IDPA 3OTUA 4RG0A 3GC9A 3IW6A 4JDIA 4J53A 4RLLA 3REPA 4FYNA 4M67A 4JR3A 5AADA 5AR8A 4MQ1A 3BWFA 2ZDUA 3WZJA 2RFEA 3HV4A 2CKQA 2WMBA 3DFAA 2ZB0A 3W1FA 5A4TA 4NTTA 2UV2A 2JIVA 2J90A 4U6RA 4U7ZA 2OO8X 3UOLA 4EWHA 2BHEA 2IW6A 4PMPA 3A2CA 3DGKA 5DMZA 1NY3A 4O1PA 1NW1A 3LLAA 5CSWA 1WAKA 4CTCA 4ANLA 1XH6A 2PVYA 4O1OA 3NNWA 4IWQA 3KRRA 4NFNA 4R7BA 4ZXTA 4O7TA 3FSFA 3LFSA 4FTOA 3WZDA 4XNEA 3Q32A 5HX6A 3H9OA 2R0IA 1YDRE 1O9UA 4EHZA 3E63A 3MVMA 4X3JA 4L01A 3TZ8A 4NTSA 1GZNA 4QO9A 3R8ZA 3TUDA 4O2PA 4RFYA 4L45A 4CFFA 4F0FA 4LRKA 1YHVA 4BKZA 3FZRA 3SG9A 2JAVA 3D83A 5DGZA 4MXCA 3RI1A 3BEAA 4P2KA 3GGFA 4ZZOA 4FL3A 4DH1A 3HMIA 4IJ9A 1OECA 3D2KA 4L7FA 4QPMA 4Y5HA 4LMNA 5M06A 1J91A 2OWBA 5AP2A 3HAVA 4CSVA 4KA3A 2PL0A 1PJKA 3QD0A 3RJCA 4HVGA 4YBJA 4OAUC 3FAAA 3L8VA 4N57A 2BVAA 5ETAA 4C58A 1PRYA 4ASXA 3S2PA 4NT4A 3WIKA 5IISA 4QYEA 4A06A 3AC8A 3GNIB 3FHIA 4CFVA 4BTMA 2CN5A 5J1VA 3NS9A 3R02A 3K2LA 3EL8A 2VWWA 3ET7A 2X2MA 4RX8A 2ESMA 1XHAA 1GIHA 1Y6BA 3GU6A 4IZ7A 1FBNA 1L3RE 4NIFA 4C4JA 4E3CA 3LFNA 2GHGA 3COKA 4DG2E 4FSTA 2HOGA 1ZOHA 2BRGA 2NRYA 2R3OA 4IACA 4EQUA 4FV7A 1Q8ZA 2YHVA 3ULZA 4ZEGA 2BRHA 2XEYA 4NWMA 4BWXA 2CNQA 1JQHA 3Q60A 5JK3A 4CTBA 1OIUA 3QD2B 4Z7HA 4LFIA 3UMWA 3NAXA 5DBXA 4DEGA 5HBHA 3ZUTA 2IG7A 3ODYX 3QUDA 4BTFA 1YXTA 2FO0A 3VF8A 1R78A 4X7QA 3RINA 4CGAA 5EOLA 3BGQA 3HVCA 2R9SA 4WSQA 3PUPA 3E92A 3C50A 3L9MA 4EI4A 4I93A 1MP8A 4OBQA 4O83A 1B39A 5FGKA 3SOAA 5CSVA 4RVKA 1UNGA 1OKWA 4GG7A 2Q83A 5M07A 3FLQA 2X7FA 3MB6A 5CEKA 4ENYA 1G8SA 2PMLX 3C4FA 2W06A 4EEVA 5JZJA 3NRMA 3VUDA 3BV3A 5EI6A 1JLUE 2VTRA 4RWKA 3Q9ZA 2PZYA 2YAKA 5E8UA 3V5LA 3WF9A 2CN8A 1XWSA 2WGJA 4YTHA 5JMSA 5ETFA 1OUYA 4YZDA 5TF9A 2XKEA 3FZSA 4UZHA 4GSBA 3S4QA 5HO6A 4R5SA 1QMZA 4PDPA 1DAWA 3HMOA 3ZEPA 4XRJA 4F7NA 3QA8A 1H08A 2WIHA 3RPYA 2UZLA 2PYWA 2H8HA 1YDTE 4FVQA 3W2SA 4B4LA 2X4ZA 4J52A 4IVBA 4RJ7A 3NVMB 3PXFA 4CRLA 3KA0A 1M17A 5JGDA 2J5EA 3K3IA 2YIXA 2C6TA 4I6FA 2OKRA 5FEDA 1PKDA 3FBVA 4P7EA 5I9YA 2BILB 4WOVA 4V05A 5BVFA 2VD5A 3W2CA 3Q5IA 1J1CA 2VO6A 3AMAA 3R83A 3CBLA 4BL1A 1VYWA 4YO4A 3MA3A 3KXNA 3AOXA 2F2CB 2V22A 5HG7A 2ZDTA 4A4LA 3EN6A 4U45A 4AU8A 4FVRA 5HVJA 4OTFA 1WZYA 4ID7A 3EQRA 4XJ0A 1I09A 4FSNA 5HX8A 2G1TA 3AT4A 4RFMA 4JBPA 3VS6A 3TKUA 3S0OA 1K3AA 3CY2A 4LYNA 3RTPA 2VGPA 4XP2A 2ZJWA 3UVRA 5C26A 5I0BA 2HZ4A 4RPVA 2PSQA 4CCUA 4DEDA 2CHLA 1ZOEA 4FV0A 5AP0A 2V5QA 4BIBA 1FVTA 3LFEA 4JT3A 2EU9A 4TXCA 1GIIA 1H0WA 2JFMA 3A7JA 3VN9A 2ZV7A 4O0RA 4BWKA 4FV4A 5AM6A 1DAYA 3FZPA 3KRLA 5I9ZA 3KN6A 3TUBA 2P2IA 3L9LA 3MH2A 3ZLXA 4E5WA 2V55A 3LOKA 2V62A 4IC8A 4ZTLA 3QKKA 4A9UA 4ZK5A 2FUMA 4KS8A 3H3CA 1M52A 4AN3A 5M08A 2WTIA 4RX5A 4I94A 3KREA 2XKFA 5ICPA 1GZOA 4G2FA 4PMSA 5A6OA 1IASA 5IDPA 2OH0E 5M57A 4HCTA 3MVJA 1KOAA 2G01A 3A61A 3R7OA 5LVPA 2BZJA 3LMHA 2QO7A 5GIPE 4BDFA 4KWPA 4ZMFA 1J3HA 4IH8A 2XS0A 4AZSA 1Z5MA 4IB3A 3BELA 3VS3A 4C2VA 3EN9A 2GDOA 4MXAA 3K3JA 3TI1A 5C8MA 3KCFA 3UPXA 4CZUA 3F5PA 3M11A 5AP1A 3PY1A 3V5QA 2OFVA 5IEXA 1YI3A 3A7GA 2P4IA 4RZWA 4CVAA 4FIFA 3OWPA 4D2VA 2BRNA 4LGDA 5A3XA 1H28A 4G3EA 4FT3A 3LHJA 3OFMA 3NIZA 3E8CA 2QU6A 4QMNA 1NXKA 4APPA 4DFXE 5EDQA 4N4SA 3ZC5A 4F64A 2C4GA 3I0OA 5EW3A 1PYEA 5AV3A 3RPVA 4PWNA 3GOPA 3DXPA 4D55A 5HLPA 3ORLA 4FZFB 2H34A 4WD5A 3OEFX 1Q97A 2ZVAA 3G9LX 3CPCA 2GS6A 3B8QA 3EKNA 3KMUA 5EHOA 3TNQB 3LXPA 2B53A 3HLLA 4JRVA 1WMKA 2FH9A 3EKKA 4KD1A 4TYHB 5KE0A 3OWKA 5DT3A 3AGLA 5M4CA 3WF7A 2IVTA 4FSWA 4RBLA 4YZ9A 3TACA 1XJDA 2XF0A 3LVPA 3UJGA 3NW5A 4BCHA 1JPAA 4IW0A 4F0GA 3SXRA 4OTIA 2LGCA 1OUKA 4X3FA 4TNBA 4ANOA 5AJQA 5LOHA 2PK9A 4L9IA 5HESA 3KF7A 2PZIA 3VWAA 3AG9A 1EH4A 4MWIA 3ZUVA 2ZV8A 4KINA 3OTVA 5H2UA 3BHHA 4D2WA 4JI9A 1Q3DA 4RWLA 5I9VA 2VTJA 2C1BA 3OUNB 3CTJA 3FY0A 2VWVA 2B54A 3GC0A 2C69A 5HCXA 4UWCA 4GVJA 3KCKA 4YJTA 3WI6A 3OCSA 3E88A 4FKPA 3JR1A 4FT5A 3Q6WA 4I6BA 1OL1A 5BVNA 2QHNA 3QAME 3V3VA 4O6LA 3IG7A 3VS0A 3OY1A 1OPKA 4AOJA 2C6OA 2C6KA 1Q61A 4GYGA 1YDSE 4QMMA 4OTGA 2GFSA 5AUVA 1F0QA 4YO6A 2GU8A 4YJNA 2I0YA 4FZAB 1ZY5A 4YLLA 5F94A 1GAGA 3UQFA 3ERKA 3I79A 4PMMA 1JKSA 1YI6A 3IW7A 2PUPA 3P7BA 1H4LA 1V0BA 5KHWA 4B7TA 3TM0A 4RVMA 4HVIA 4I41A 2BIKB 5AA9A 4EOPA 5CALA 4EONA 3R1YA 3ZZEA 2WMRA 4DGLC 2RKUA 3MGYA 3TV7A 4R1YA 3CSVA 1JNKA 1UA2A 5EH0A 4K33A 2I0EA 3FZOA 3P7AA 3SG8A 3R9DA 4CG9A 5IA0A 3MA6A 3C0GA 5JEBA 4UWYA 5BVKA 5C4KA 1PXKA 1ZZLA 4QOXA 4ZSAA 3WZEA 2FSOX 1ATPE 3DDPA 1M14A 4FKGA 4AS0A 4IAYA 2YM3A 2RGPA 4FMQA 2OH4A 4JBOA 3ZBXA 4TYIA 1F5QA 4QMXA 2OF2A 3QD4A 4TRLA 1REJA 3BCEA 3R1SA 1GZKA 3W8QA 4NM3A 1MRVA 3CJGA 1O6KA 1VYZA 4W4YA 1WVYA 1Z57A 3A62A 1VJYA 4AF3A 2R3GA 3VC4A 4C61A 2YM8A 3HDMA 2VTSA 4HPTE 2CNUA 4MEDA 3OT8A 4Q9SA 2QOOA 2JBOA 2ITVA 4IB0A 3W33A 3MFSA 5AV4A 2YJSA 3R1QA 4O84A 5HG8A 5CLPA 4BZOA 4IX4A 2XIRA 1H1WA 4DG3E 3BQRA 4FEQA 3LFAA 3Q6UA 4FR4A 4JVGA 5G6VA 4MXXA 5CU2A 3KXMA 5JFWA 1CM8A 3BLHA 1W82A 4GJ2A 3VJOA 3DXNA 3DB6A 1OKZA 5F1ZA 4MK0A 4AGDA 3ZS5A 2QG7A 1FQ1B 4U40A 4FT7A 3EJ1A 3F69A 3NCZA 5ETIA 3UC3A 5LMBA 4O21A 3IK3A 5EHYA 3IW5A 4R77A 3DAKA 4NM7A 1KSWA 5AV2A 5JGAA 5LVOA 4DCAA 4AZWA 1UNHA 4YP8A 4BKJA 3DTWA 3UOJA 3EQHA 4J95A 4FTQA 2WQMA 2XIKA 5FDXA 5CTPA 4LGHA 3VUGA 4FIIA 4XBUA 3E87A 2HXQA 2JKQA 3F3UA 4I92A 4NH1A 1YQJA 5DLSA 4QQ5A 4AW1A 1PXLA 2C6LA 1H1RA 4RIYB 3AMYA 2J0KA 2W96B 3GCSA 2B55A 4A9SA 5A54A 2GHLA 5J79A 5EQPA 4U0IA 3MPTA 3QU0A 4BDBA 4G1WA 3R04A 4DINA 2JC6A 4FSUA 4X2JA 4IAKA 2VGOA 5DT0A 3DBFA 4QP9A 4ZS4A 5DEYA 3SOCA 3DJ6A 4IEBA 4ZSLA 4AW0A 4MXYA 3HECA 3VO3A 2J0IA 3Q2JA 4YMJA 4GKIA 2AC5A 4C4HA 2DQ7X 4EYMA 1BL6A 2QO9A 4YNEA 4DFZE 4DC2A 3NWWA 5L3AA 5FM2A 5A6NA 1WBVA 2UUEA 2CLQA 3PSBA 2XBAA 4FF8A 4L67A 2FSMX 1Y6AA 1FVVA 2YM7A 4FG7A 2XK4A 4R5YA 1E1VA 3QQJA 1JKKA 3QQGA 4C02A 4DFNA 4O7YA 5DFPA 3GC8A 1W98A 3MPMA 5C01A 1A06A 4ALVA 5BUIA 2RF9A 4HJOA 3HMPA 4X2GA 2E9VA 2PWLA 3LQ5A 3MH0A 1JKLA 2VTTA 4FIEA 3UC4A 5AFVA 3BZ3A 5IUIA 2R3LA 3R01A 4QT1A 4ZTRA 2BKKA 5IKWA 2O5KA 3FUPA 3GFWA 4QMPA 5H8GA 4YR8A 5K9IA 4R8QA 4R3RA 4IM0A 3CQWA 5I9XA 3AMBA 3GCPA 2DYLA 3R7YA 4C2WA 2VWIA 2WXVA 5H3QA 4RJ5A 4DAWA 3G90X 4ZTSA 3I60A 3KXHA 4M66A 3T9IA 5HTBA 2PVJA 3ORNA 2YWPA 2OIDA 3LQ8A 4I0TA 5ANDA 4FC0A 2XNOA 3R2YA 3AQVA 4G5PA 3CR0A 1QPDA 5F95A 4J71A 3V6SA 2E9PA 3Q2MA 2BDFA 4RIYA 2OJIA 1PXIA 4O2ZA 3CKXA 2G2FA 3QALE 4NM0A 5F4NA 2Y6MA 3PWYA 4HCVA 5CS6A 5KKRC 5CXZA 3GT8A 2C0OA 2XKDA 2B7AA 2PMIA 3LZBA 5J5SA 2BUJA 1LEZA 3PJ2A 4FK3A 2GS2A 3ZDUA 4EOQA 1ZYCA 4AT5A 5FTGA 2Z7SA 4F1MA 3PG3A 2WKMA 4KBKA 3SXFA 3MY1A 3NUYA 2YJRA 3IKAA 2WMXA 2RFNA 2YCRA 1M2RA 4G6LA 2GS7A 4O0WA 3RALA 2XK7A 4E1ZA 1UNLA 2R3HA 3A99A 4IANA 4OT6A 3WYYA 2Y4IC 4HGEA 4Z55A 1YRPA 4QMYA 3V04A 1Q41A 2ZAZA 3K54A 4IX6A 4QYYA 4BGQA 2PZ5A 3QWKA 5JSMA 2QG5A 5BMSA 3ZM9A 3ALOA 3RNIA 3D94A 4EHVA 5IUGA 3C4WA 3UO4A 3D15A 4Y95A 2XJ2A 3P79A 5FQDC 4FNWA 4E8AA 2IWIA 4BCKA 4F99A 3PG1A 4XMOA 3A8XA 3BWJA 5F9EA 4ZZMA 3OW4A 4DEIA 4DITA 3DPKA 4GKHA 3LCSA 3TCPA 3VNTA 4FEXA 2PVKA 3RCDA 4D1XA 4IFGA 5DH3A 3TUCA 3N4VA 2NPQA 1ZZ2A 3SC1A 5AAFA 4EYJA 4UB7A 3U6IA 3U9NA 2B9FA 4CT1A 4I23A 3TWJA 4USEA 3PFQA 4B9DA 3RAKA 4W4WA 3KFAA 4O82A 3PPZA 4AOIA 5BX0A 3D4QA 3ZRKA 3NEWA 5IDNA 4YTIA 2W5BA 5AX9A 3FXWA 2XM9A 4W4VA 5FM3A 5IEVA 3H30A 4D5KA 1KOBA 5E92A 1IA9A 3SW4A 4JAIA 3UOHA 2HY0A 1PY5A 3R8UA 4DT8A 3JY9A 3VBQA 1KV1A 3ORZA 3I5ZA 4WNMA 4PDSA 1RJBA 4CQGA 4QTDA 3PE2A 2WMQA 3VUTA 4FV5A 2JDVA 3C4ZA 2XIYA 4EBWA 5KX8A 1QL6A 2UZBA 5D10A 4LM5A 4QYHA 5CEMA 3FLZA 2QOIA 4FUXA 3QBNA 3LCKA 4IZAA 4CCBA 2G2IA 1LUFA 3G6HA 3DBCA 4ZSJA 4OTPA 2F7EE 4LL0A 4TTHB 3KXXA 4BIDA 3OHTA 3MWUA 3ZO1A 5DG5A 3FKNA 2EVAA 4L68A 4LGGA 4BCGA 1APME 3UPZA 3RK7A 3D5VA 5ANJA 2W17A 5K3YA 4YURA 4O86A 1LEWA 2IO6A 1FPUA 1JWHA 2R3PA 2W4KA 3KULB 1BX6A 4FKSA 5CVHA 2W1FA 3GOKA 4PMTA 3RVGA 2W1ZA 5LWNA 2PVNA 4PRJA 4AWIA 2OFUA 5KCVA 5ANOA 1H1PA 2Z7LA 2EXCX 3QF9A 5HIBA 3R22A 1UU7A 2OXDA 4BF2A 4K77A 5IH4A 4YZCA 3VS7A 2CJMA 4MBJA 5JN2A 2EB2A 3VS1A 2CPKE 3QX4A 4XUFA 4O7SA 2XJ0A 4D4RA 5IQDA 1UU3A 3DK3A 4GCJA 3UIUA 3QLGA 3PJ8A 4RSSA 4MH7A 5DR2A 1YWRA 1UKIA 1URCA 5AV0A 1OL5A 3UQCA 4O96A 1PXOA 4M15A 2UW7A 3E8DA 2IZSA 3DZQA 2BFXA 5IQAA 5IUHA 4EOSA 3HP2A 3OCTA 4L52A 3NLBA 3UODA 3BYUA 4UMTA 5K0XA 3D5UA 4BCMA 4UMPA 4ACDA 4O6EA 2I40A 3W8LA 3C9WA 5CYIA 4A4OA 4CMTA 4BFMA 4DFLA 3UMXA 1YOLA 3V8SA 2ETMA 5EDRA 4D4SA 3GENA 1PHKA 1G8AA 3NUAA 4IM3A 1Q62A 2OZAB 4JDKA 3UNZA 2R2PA 4XV2A 4WUAA 3KVWA 4CZTA 4M69A 5AAEA 1U59A 3T8OA 3KB7A 3KMWA 2PUUA 3G0FA 4XRLA 2QVSE 4NEUA 4YZBA 5CAUA 4UMQA 3EFLA 5EYMA 3G2FA 5CY3A 3QQKA 4B8LA 4GFGA 4WG5A 4HYIA 3OXIA 4XOZA 3PY3A 2WIPA 4ANBA 1LR4A 1ZYDA 5L8JA 5FD2A 4CMOA 4BTJA 5D12A 2QU5A 2ZB1A 4FZ7A 1J1BA 3QQLA 1VEBA 4FKVA 3KULA 3ZEWA 4RGJA 5E4HA 3LFDA 4F0IA 4F6WA 2FB8A 4MAOA 3W2OA 4IMYA 4RWIA 4YC6A 2WHBA 4UYAA 2QC6A 4AA4A 3LIJA 2VTIA 4G5JA 4TKSA 2VTQA 4J96A 2RIOA 4I6QA 2X4FA 4H05A 4TWOA 5E8WA 3UG2A 3FLNC 2HZNA 3H0YA 3NSZA 4ITHA 5BVOA 4BICA 3VBTA 5CANA 4QPAA 2ITNA 4U9AA 3POOA 3MTLA 1ZARA 4AZVA 5CAPA 4G3FA 1XKKA 1B6CB 3PZEA 5IH6A 3UZRA 3NCGA 2W1IA 4HVSA 5EHLA 3UOKA 4NIFB 4FZ6A 4C33A 2G9XA 2R3IA 5M53A 1SMHA 2VX1A 3HNGA 3FC2A 3NX8A 3O50A 4QMOA 4EL9A 5L6WL 4YLKA 4TYJA 2OJJA 4MWHA 3IQ7A 4DBNA 3R9HA 4YZNA 1W0XC 2GPHA 2HELA 1ZYJA 2XVDA 1RDQE 3IDBA 4HGSA 4E20A 5B2LA 1PXJA 2OZAA 5J5TA 4IXPA 2YERA 5DE2A 2UZUE 4D4VA 3QYWA 5IEYA 2C6MA 5HD4A 3LCOA 2WTWA 4FUYA 3R28A 2QOBA 1AQ1A 4LQMA 4PDYA 4FV8A 5E8VA 4Y5QA 4E4XA 3CY3A 4F7LA 2UW6A 2Y7JA 3DFCB 4BDHA 4WSYA 1WCCA 3O96A 5L8LA 5E8YA 1U5QA 2GNHA 3PIYA 3QCXA 4BVUA 5LJJA 4ANMA 2OXXA 3ACJA 1ZLTA 2YM5A 4QYGA 5HICA 1J7LA 4EUUA 5FXSA 3VS2A 4FYOA 1OPLA 1YHWA 3ENHA 4KKGA 5CF8A 4NKAA 1ZMWA 3RK9A 2WFYA 4DEAA 3U87A 1XQZA 4DGGA 2F2UA 3UVQA 4FKQA 2PE2A 3FWQA 4CFWA 3QXPA 3CIKA 4I3ZA 3PSDA 3FHRA 4C3RA 1WVWA 4YJRA 2UZVA 4QD6A 4M68A 3ATSA 2UZOA 3RWPA 5ITAA 5TKDA 4EZ3A 3MVLA 3OF0A 2JDRA 3BX5A 4KRDA 1KE6A 4OUCA 2QNJA 4W4XA 3S3IA 2X9FA 5KMJA 2F9GA 4YZMA 1WBWA 3E7VA 5HGIA 1KE5A 1JBPE 4CKJA 5E8ZA 3QRUA 4D2TA 1MRYA 2XNBA 4CV8A 4GIHA 4PTCA 3DQWA 3GU4A 3HRBA 4QMZA 5DRBA 3FZTA 5LVLA 3ANRA 4YSJA 4U97A 4A9RA 5HIDA 5EG3A 3IW4A 2J51A 4K1BA 4XOYA 4BHZA 4I0SA 4XV1A 1AD5A 3KRWA 4QTEA 3KK9A 4CFXA 3JXWA 4ZLYA 1BKXA 3BE9A 2CCHA 2F49A 2WOTA 1JSTA 5HE1A 5IF1A 5JRSA 4D1SA 4FEWA 3FY2A 4FSMA 2C0TA 2H6DA 3IGGA 4ASZA 4ERWA 4O7WA 1Q8YA 2B52A 2C5YA 4EZ7A 4XHKB 3V51A 4GUEA 5AR2A 2PU8A 2A27A 4FTTA 3BYMA 1H0VA 4FTAA 4N70A 4IWDA 4MBLA 2CGWA 5AIKA 1L8TA 5E8XA 4M8TA 4IX3A 1DM2A 2YIWA 3OOMA 5CSXA 3U51A 2BZKB 2QKWB 2P3GX 1G5SA 1H1SA 2VWBA 4KKHA 4O38A 5F20A 3TKIA 4RJ6A 3R63A 2Y4IB 5HE3A 5AX3A 3JVSA 5CSHA 3HV3A 4S32A 3KGAA 4Y8DA 2OIQA 3FSKA 3LM5A 4KS7A 4UWBA 5FLFA 2QURA 4ZTQA 2XCKA 5HNBA 4AT4A 1OIQA 3ORKA 4J8MA 4IZ5A 2GCDA 2HIWA 3HA8A 5M4UA 2WEVA 3BHVA 4YJUA 1ZXEA 2JKKA 3UG1A 4RJ3A 3ATTA 1NVRA 2XIXA 4BI2A 3RAWA 1H27A 4U8ZA 4EJ7A 3IPHA 2HWPA 4MXZA 4A7CA 3CGOA 2BIYA 3MFRA 3NYXA 5CWZA 1U5RA 1OL7A 2VTMA 5CT0A 4Z9LA 3II5A 4AFJA 3PZHA 1PMEA 3SXSA 4FNYA 4X21A 4HYUA 1TQIA 1XBBA 2QOKA 4RMZA 4PL5A 3ROYA 3KMMA 3P1AA 4G9RA 4AGCA 3WZUA 3RGFA 3LQ3A 4I5CA 3C4EA 1XBAA 3SKCA 4DHFA 4ZTHA 2C3IB 2YLEA 1E9HA 3LFQA 4IVDA 3BHUA 4JQEA 5DR6A 3O17A 3FXXA 3R8VA 3QUEA 4ERKA 4UMUA 3DLSA 2ITQA 1KE8A 3MI9A 3V8TA 3O23A 4I5PA 4IVAA 3PE1A 3UDBA 5EQYA 4AGUA 4G16A 4BDEA 3VBVA 3MY0A 4IDVA 4O7RA 5GZAA 1ERKA 3PA5A 3I6WA 4E7WA 2BDWA 2NP8A 4J98A 4PDOA 1R0PA 3DOGA 5JH6A 3BI6A 4GH2A 2VU3A 4LOOA 4C34A 4DFBA 2I7QA 5BYLA 1Y91A 3UGCA 3QQFA 2BRMA 3OC1A 1WBOA 5IU2A 4NL0A 3HV6A 1W84A 3BYVA 4DG0E 1H01A 4YC3A 2YFXA 4PV0A 1M7QA 5KMLA 2E2BA 4EC9A 3AC5A 3VBXA 2ZYBA 1P2AA 2WU7A 3PY0A 5DR9A 3QXOA 4X3FB 4RQVA 2ETRA 1V0OA 1HCLA 5FEQA 3SQQA 2P0CA 4TW9A 4MNEB 3RNYA 4ASDA 1J7IA 2R3JA 5LVMA 3FMNA 3F61A 3G6GA 4XLIA 4RT7A 4HPUE 5M4FA 3GUBA 4E5AX 3FE3A 3LMIA 1Y8GA 4NW5A 3GCVA 5J87A 4RVLA 3ZRMA 1RQQA 2F4JA 4MKCA 4XV3A 4RA5A 3FMLA 2XK3A 3GBZA 4CV9A 4BCFA 4C8BA 3ZYAA 5DT4A 2ZV2A 3TNIA 3VHKA 4DH8A 4MHAA 3ZFMA 5AR5A 5AMNA 1H24A 2QLQA 2XEZA 4GJ3A 2CGVA 3CE3A 3WARA 3F5UA 1NVQA 5CAOA 2UZTA 4ZSEA 3M42A 4E93A 4LI5A 2C5XA 3ROCA 2F57A 3ACKA 4X2NA 3FI8A 2WTVA 1P5EA 4X6QC 4S2ZA 3F66A 3Q5ZA 4YSMA 2REIA 4ZTNA 4OTWA 1DI8A 3QC4A 2WQOA 2QD9A 4F7SA 2FVDA 3SGCA 2Q0BA 2WMSA 5FBNC 3ZONA 1O6YA 2J4ZA 4ARKA 3Q4UA 4IAFA 3LCTA 4WHZA 4Y72A 3HRFA 3V5WA 3OOGA 4R7HA 5IA5A 1UU8A 2YCFA 1J7UA 4BR3A 4RC3A 1TVOA 2JD5A 2PZPA 4FZDB 5TO8A 3F2RA 3ZSGA 3ID6C 5EM8A 4XEYA 4Z3VA 4F09A 3KC3A 3Q9XA 4ITIA 4FKWA 5C1QB 1NT2A 5JQ5A 4I0RA 2C6DA 2R3QA 3ORPA 4WA9A 1OI9A 3I5NA 5HU9A
chains in the Genus database with same CATH superfamily
3EYGA 4QMWA 3MYGA 4ACGA 2BKZA 4KBAA 4MNEA 2XYUA 3ELJA 5TT7A 3AKLA 3BU6A 5CX9A 4CMUA 4BYJA 2R5TA 5AUXA 2WEIA 2CSNA 5CENA 5H8BA 3CJFA 4O4BB 2CGUA 3ML1A 4RC4A 3TV4A 1PW2A 2VO3A 1M7NA 4FT0A 5ACKA 5L4QA 3QTSA 3OROA 5BVDA 3PVUA 3O51A 1M2QA 3VVHA 5IPJA 4KIQA 3BHYA 4ITJA 4Y46A 4FKLA 2X8DA 5CEIA 4EOLA 4GW8A 4ANQA 2QOCA 5DEWA 3OXTA 4FKTA 3C4XA 3FV8A 2RG5A 4YJQA 5AV1A 4DBXA 3JYAA 3EQBA 4P90A 1A9UA 4L44A 3BE2A 3ZH8A 5DIAA 2W4JA 3F9NA 4S34A 5IQGA 3FQHA 2BR1A 1CMKE 4M14A 4BBMA 2FGIA 1FMKA 3O8PA 3TEIA 3ZU7A 1CKJA 2I0HA 4DFYA 2EUFB 4AE6A 3DQXA 4WUNA 3PIZA 4O4CA 4ZOGA 2PULA 2A4LA 2YDJA 3F3WA 4TWNA 4UMRA 2JLDA 3Q9WA 5DNRA 3TJCA 3B2TA 4DN5A 5EKNA 3ORXA 4Y85A 4C59A 1RE8A 3TIYA 4R3PA 1K2PA 4XV9A 1KE9A 2VO0A 5IQBA 3FI3A 3OWJA 3ZFYA 3H10A 3U4WA 2IPXA 3DK7A 3UDTA 4XG2A 5C03A 2BCJA 4L8MA 2WTKC 1OIRA 3DV3A 1W83A 4A9YA 4NSTA 3TL8A 5J9LA 1I44A 2J0LA 4YNOA 4QP3A 5AM7A 3QLFA 2QOHA 3O2MA 3RKBA 4DEBA 3TN8A 1XMMA 3E3PA 3DJ5A 4BCOA 3OS3A 5GZ9A 4F4PA 5A4EA 3N4UA 4KB8A 3OD6X 3MY5A 3COIA 4CFNA 3JS2A 4TN6A 4F70A 3SA0A 4ASEA 1U4DA 5CQWA 2HK5A 2G2HA 3ZFXA 4JXFA 5FTQA 2Z02A 4E6AA 3OWLA 4K2RA 4WT6A 2ITUA 2J2IB 3L8PA 4G6OA 3MIYA 4M84A 2HW7A 5BYYA 2GNFA 2NRUA 4I4FA 4USDA 2YZLA 3PYYA 2R7BA 5C4LA 4JS8A 5TR6A 1P14A 2CKOA 3FYKX 2H96A 1OL6A 3PJCA 4XP0A 1ZY4A 4BZDA 4JBQA 4E5BA 2BZIB 3R7VA 3ZUUA 2BROA 1MQ4A 2R7IA 3BYOA 3DKGA 3I81A 3QCQA 4M13A 3GQIA 5FXQA 3TTIA 3TZ9A 4ZLZA 1V0PA 4RIXB 1YWNA 4YJOA 3ORMA 4HYHA 3S95A 2IVUA 3P78A 4QP6A 1CKIA 4OTDA 5KHXA 3QTQA 3MVHA 4L53A 3NNVA 4U42A 4BHNA 1V1KA 2PMNX 3C51A 3P08A 4XG8A 4AW5A 4RX7A 4CQEA 3L8XA 4BI1A 5HNIX 2J0MB 1XO2B 3B8RA 4PP7A 4XG4A 3EIDA 2J7TA 5D9HA 4XP3A 3ZO2A 2B9IA 3N51A 5AWMA 4CKIA 2NNWB 3HUCA 2W1GA 4NM5A 2WMAA 3QC9A 3VIDA 3PXRA 2IW8A 4FV9A 3FDNA 5A4CA 1GOLA 5J8IA 4EK8A 2J5FA 4K6ZA 5D7AA 3ZRLA 3QHRA 1IA8A 1JSVA 3EH9A 3H9FA 5EYDA 5GJDA 4RJ4A 2HZIA 5HLWA 5HLNA 4MCVA 3WILA 2AUHA 4QMLA 1LPUA 4O81A 3NYOA 4EZ5A 3VAPA 4YLJA 2CNVA 5CZHA 2WMTA 2WMVA 4GFMA 4QQCA 1Q8WA 2VV9A 5KO1A 2WQBA 2OJ9A 2ZOQA 5DOSA 4AZEA 2H9VA 4A07A 3VONA 4AAYA 3I4BA 1YWVA 2QR8A 2EXEA 1U46A 3HEGA 4W8EA 3P5JC 3WOWA 2PZRA 3DA6A 3H0ZA 5ANGA 4ZY4A 5GIOE 4D0XA 5M09A 1ZAOA 3HV7A 1OM1A 5LVNA 3FJQE 2WQEA 5HKMA 3UTOA 3PLSA 4C4IA 2C5NA 4FV1A 4UX9A 3L9NA 5C9CA 3I7BA 2ZM4A 4C4GA 4CXAA 5CNOA 2W99B 4RIXA 5L8KA 3GI3A 4OTHA 2WAJA 2OW3A 3PP0A 5EM5A 3W2QA 3LFFA 1ZMVA 4KBCA 3WF5A 1H07A 3FI4A 4GV1A 4AZFA 3CEKA 4F63A 3QKLA 4O7VA 2O3PA 1PMVA 2X1NA 3OXZA 4U3YA 2PVRA 4UZDA 4W9XA 2XARA 4BBFA 4FTCA 4EJNA 4AP7A 3F6XA 3VBWA 3U6HA 4BIEA 3MBLA 2FYSA 1WBSA 4TNDA 2ITZA 4E6QA 3UYSA 3MIAA 5EW8A 4AN2A 3K5UA 3PLAE 3NIEA 4X2KA 5KBRA 3DKFA 5BMMA 2XKCA 4FIJA 2XZSA 3QTRA 4GVAA 1KUTA 2GQRA 4FKIA 3PDTA 3W0PA 3BLRA 3JPVA 2UZEA 4JIKA 2Y4PA 5HI2A 2HY81 3VUIA 3LFBA 2R3NA 2R3KA 3AD6A 5BVEA 2Y0AA 3DBQA 4F65A 5I4NA 3HKOA 4EOMA 2KULA 5I9UA 3OT3A 3ZLYA 2YABA 3W0OA 1ZWSA 3DZOA 4O7NA 1R0EA 4PQNA 2YM4A 5H9BA 4BCPA 4QP7A 5JQ8A 2ZMDA 3KIOC 4DFUA 2AQXA 2I6LA 3EFKA 3GVUA 2OJGA 4E4NA 2VTNA 4L3JA 5LMAA 3CQUA 2JFLA 1QPJA 5GHVA 3RM7A 5J1WA 4FNXA 4ZLOA 3QZHA 4FEUA 1OIYA 2ERZE 5A9UA 2IVVA 1IAHA 1W7HA 2GMXA 4GFOA 3N4TA 2UW0A 5HORA 2Q0NA 2YITA 3A7FA 4BDCA 1H1QA 4ZJJA 5GZ8A 4F6UA 3QD3A 4I1ZA 4I4EA 3ZMMA 3CTQA 4XG7A 1W2CA 4EOKA 3U9CA 3PXYA 5FTOA 4DH3A 5DVRA 4ZMEA 4HVDA 2VX3A 3QTZA 1DI9A 4QMTA 3ZCLA 1GZ8A 2BTRA 3MDYA 3Q4CA 1H00A 1OGUA 5BV3A 3HZTA 2OXYA 4F9WA 1QCFA 3VQHA 5KZ0A 2HW6A 3GU5A 4DYMA 3KQ7A 3TDVA 2BALA 2OU7A 4FV6A 4FKRA 4IIRA 2Y6OA 5AP6A 4RLKA 4EK4A 2ZM3A 2UZWE 3MJ1A 3MTFA 4BDAA 2O64A 2OI4X 3ENMA 2XA4A 3R6XA 4MVFA 4K0YA 3LXLA 2W1CA 3Q9YA 4DF3A 4FTUA 2VTHA 4K8AA 5LCKA 3VUKA 3ZBFA 4Z16A 2C5VA 2KTYA 3FMDA 2Z7RA 4UALA 4LRMA 3RHKA 4IHPA 4CLIA 4H36A 3FPQA 5GJFA 1Y57A 4FX3A 4YU2A 5CF4A 5M4IA 5FUTA 1ST4A 3R7GA 2Z8CA 4IBMA 5D7VA 4G31A 4AUAA 4B6LA 2OK1A 4PNIA 2UW8A 4N6YA 3AD4A 4C37A 3QQUA 4GMYA 4O0SA 3K5VA 5A46A 3NUXA 2VTAA 2HENA 4OW8A 3EQPA 2YLFA 4DGOA 1FGKA 4M69B 2XRWA 3NYNA 4D2SA 1YKRA 4LG4A 1H8FA 2W5AA 5CI7A 4ZP5A 4E4MA 3R00A 3R0TA 3QZIA 5FDPA 4M3QA 3KXZA 4QP1A 1U54B 2PPQA 3PA4A 3WF6A 4JL9A 5CAQA 3DS6A 2JITA 3H4JA 3R71A 2GNJA 2GNIA 2ZMCA 5CNNA 3O71A 5B2MA 2Z2WA 3BYSA 2NO3A 3LKMA 3W2PA 4TL0A 3EFJA 1OB3A 3PVWA 4V01A 5HCYA 3NFGB 3POZA 4CNHA 2PE0A 4KKEA 1XH4A 5HNGA 4GEOA 3FPMA 3EMGA 3DK6A 3A60A 3V01A 5D1JA 3UZTA 5EFQA 2F7ZE 4FJVA 4NU1A 1BMKA 4YBKA 1Q8UA 4C7TA 3E64A 4FL2A 4X6RA 5D41A 3V8WA 3PXKA 2W1HA 3RP9A 3E62A 1IG1A 4FIGA 5IA3A 4IFCA 5ANIA 3T3VA 2PTKA 5I3OA 3ZXZA 2WTJA 3HYHA 4CYJA 2W7XA 4FEVA 3NZ0A 4V0GA 4HVHA 5E1EA 5E7RA 5ANKA 4LMUA 2QI8A 5CAVA 3QUPA 4ANNA 5BQ0A 4FODA 2F7XE 5HBEA 3R7IA 1Q99A 3PXQA 5AUYA 2YISA 2JDOA 4G3GA 3CC6A 3D5WA 3RPSA 1VLRA 2IJMA 3CGFA 3C5UA 4JG8A 4XBRA 4AZTA 4J1RA 4BB4A 5KUPA 2QONA 4EK3A 3RHXA 5TE0A 3R2BA 3SW7A 2WTKB 1SVGA 3QCSA 5HTIA 3LE6A 4A4XA 3KKVA 3LLTA 3R8PA 3V5JA 4MTAA 3M2WA 4RRVA 4IVCA 4JAJA 1U54A 3OEZA 3D0EA 3KU2A 4UV0A 4BN1A 4EKLA 5L2IA 4CLJA 4I5MA 4J97A 2PY3A 2CLXA 3F2AA 3UNKA 4NJ3A 4QRCA 4IADA 3WF8A 2BAJA 1BYGA 2WTDA 2QR7A 2ZV9A 3CP9A 3PRFA 3HDNA 4PL4A 5AP4A 4BJJA 4F1TA 4ZY6A 4DEEA 3GXLA 2XK9A 4EK5A 5GINE 1YXUA 2ITXA 3R1NA 4RC2A 4G6NA 3NUUA 5CU4A 4M97A 2WQNA 3CLYA 2UVYA 3HMNA 1PF8A 4BBEA 4FICA 4XG6A 3FZ1A 3MV5A 4IB5A 5HO8A 5GJGA 3FMEA 2BTSA 4P5ZA 1P4FA 4FOBA 4GS6A 5L2SA 2OGVA 1GJOA 4HW7A 4FVPA 3TIZA 3U4UA 2FSTX 2I0VA 4HNFA 2SRCA 4U41A 4ANSA 3F3VA 3DB8A 1OPJA 2UW9A 4FKOA 1ZRZA 4APCA 5IQIA 4FTLA 3CD8A 3ZLWA 4QNAA 2X8EA 2VTLA 3AGMA 3UYTA 5EI2A 4BI0A 4O22A 5AEPA 3F3TA 4QMUA 3OBJA 4EC8A 2QHMA 4CG8A 5CU3A 1HCKA 1W8CA 2HZ0A 4MD8E 4BDGA 4P5QA 2YDIA 3ZOSA 4CFMA 2XYNA 4G3DA 3EWHA 3C13A 1XR1A 4RIWA 5CI6A 2OIBA 5A14A 3NNUA 4IX5A 3EYHA 4Z7GA 4RFZA 3OUKA 3RZBA 3GP0A 5E8TA 4ACMA 2WU6A 4JQ7A 1PXPA 3NPCA 5EI8A 1Q24A 3G0EA 5J7HA 4D0WA 3FKOA 4IE9A 4EH5A 3MN3A 4WNOA 5IMXA 4CT2A 4IWPA 5CXHA 3CPBA 3A4PA 2V7AA 4EORA 3A4OX 3ZTXA 3E5AA 3F3ZA 2VN9A 2J50A 3LJ2A 2BMCA 3UZPA 4FTIA 2JIUA 4BC6A 3TMOA 5M51A 4FTMA 3NYVA 2C3JA 2CGXA 4K9YA 2X6DA 5K5XA 1QPCA 3DNEA 4AOTA 3Q3BA 4DLIA 5J9YA 5KMOA 4JDHA 4F9YA 2YZAA 1CTPE 3EN5A 4BCIA 4UN0C 3NMUF 3QZFA 3DT1A 4H3BA 3VW6A 4C62A 3FMHA 4L3PA 2RSVA 1HOWA 2LAVA 2W1DA 2J9MA 3FI2A 1FINA 1GIJA 4FBXA 4WKQA 5ANEA 4TWCA 5HHWA 4MNFA 3W0RA 1UU9A 1P4OA 2Y8OA 3KY2A 4S30A 1OL2A 1ZYSA 1DS5A 3L9PA 4MF1A 3C0HA 1H25A 4NCTC 5CU6A 5EYCA 2R4BA 4LOPA 4RX9A 4ZSGA 4M12A 4FSZA 4E73A 3LPBA 4UY9A 2WZJA 3NW6A 1GY3A 4F08A 3BGZA 2O8YA 3BPRA 3BGPA 3R9OA 4HZSA 3UDSA 2WMWA 1PXNA 2XB7A 2C3LA 3PP1A 4IM2A 2HCKA 3LXNA 3RBWA 2VAGA 1ZYLA 2VWZA 1MQBA 1XH7A 4DTAA 5BUJA 3D9VA 4J7BA 5AR7A 1O6LA 5ETCA 3WZKA 4D28A 2DWBA 2IZRA 5KKRB 3LCDA 4LV8A 2BZHB 4EH3A 3PJ1A 2BAKA 4AGWA 4Q5HA 3C4CA 5K4IA 2OBJA 2XK8A 4WRSA 3CQEA 3RZFA 4BGHA 3MFUA 5FG8A 5AUZA 4FSYA 4FSRA 2QLUA 5L2TA 2C30A 1ND4A 5HBJA 3QGWA 5LARA 1JVPP 5JFSA 2CKPA 4ONAA 3TG1A 4C35A 5LMKC 4KSPA 1Q5KA 2EXMA 3DU8A 3VBYA 2B9HA 4U43A 2R3FA 4IJPA 1URWA 5HOAA 5EM7A 4E6CA 5CEPA 2OLCA 2VO7A 2VTPA 1BI7A 5AP3A 3EQDA 3BQCA 2WMUA 4WNPA 3P86A 1YOMA 1WBTA 3PXZA 3TZMA 2O2UA 4MD7E 3HP5A 3OCBA 5B2KA 4MBIA 5J9ZA 4O7LA 2ACXA 4ORKA 4IAZA 3ZDIA 4KUJA 5KNJA 5EYKA 4FNZA 4YJVA 3G5DA 4TYEA 4EOJA 2P2HA 2XNMA 3UE4A 3F5GA 1LP4A 3KK8A 4XS2A 2GHMA 4CKRA 4O7ZA 1H26A 5IZFA 5IA2A 1OBGA 5CU0A 3I0QA 3KXGA 4MQ2A 3ZO4A 3V5PA 4YJSA 5I3RA 3G33A 5CT7A 4BKYA 4QDVA 3KEXA 4JRNA 3TT0A 3E3BX 2OZOA 4QMSA 3IGOA 4KAOA 4NZWB 5L6PA 2A0CX 3DKCA 3NR9A 1NA7A 5IH5A 4ZIMA 3ZHPC 3QA0A 4OBOA 4XLVA 3R7EA 4UXLA 4NKSA 4O27B 3CS9A 3ITZA 3VHEA 4H3QA 4QQTA 5KMNA 3FMKA 4KIOA 3NNXA 3EFWA 3MH3A 3DAEA 5HCZA 4LOQA 4E6DA 4W9WA 3C7QA 4FSQA 3VF9A 4MX9A 2FA2A 3W55A 4TT7A 1SM2A 4DGMA 2W4OA 3IS5A 5BYZA 1T46A 5K4JA 3GU7A 3SLSA 4O0UA 4O0TA 1OMWA 4G3CA 1YXVA 3FMMA 3NUSA 5B0XA 3S1HA 5HG5A 5T68A 5IQHA 4LV5A 1GNGA 2Z60A 4FG9A 3ZZWA 4AQCA 4DTKA 3DY7A 4F9AA 5C8NA 5BNJA 3UP7A 4B8MA 4EOOA 3MSSA 4MD9E 1QPEA 5HTCA 4PPBA 1ZOGA 2X2LA 2B1PA 4A9TA 2GQSA 4IZYA 4M0YA 2C0IA 4OR5A 4FTJA 3TV6A 3TKHA 3W0SA 1OKYA 2CDZA 4J99A 3F82A 3GU8A 3PIXA 4JG6A 1JOWB 4D9UA 3EQFA 3LM0A 5EOBA 5HZNA 4K11A 4LUEA 4MUQA 3D7TB 3DLZA 1BI8A 3AC2A 3HUBA 3JY0A 3EN7A 5FWKK 3M1SA 3NUPA 2P33A 2XJ1A 3QZGA 4D58A 1Z9XA 5I9WA 4FI1A 3FXZA 3BHTA 3NW7A 3TNHA 3LJ1A 4EKKA 5JT2A 2AC3A 4IWOA 1VR2A 4N0SA 2WOUA 4DA5A 3QFVA 2PHKA 2OICA 4BDDA 3RPRA 4DH7A 5IG1A 3MPAA 2GTNA 4IAIA 3ODZX 5FP5A 3UVPA 2AYPA 5HEZA 4JIAA 3COMA 2FSLX 3FLWA 3E8EA 4MXOA 4I5HA 5HU3A 4HYSA 3ZLSA 2CKEA 4FKUA 3TZ7A 1F3MC 3I1AA 1FMOE 2PVHA 4AA0A 2W05A 4PPAA 4PNKA 4HCUA 2XRUA 2YAAA 1XH5A 4R1VA 4EH8A 5L2QA 3B2WA 3UIBA 3KRXA 4KABA 4QMVA 2X81A 3SV0A 2HXLA 1JSUA 3VW8A 5B7VA 3QRKA 4QP8A 4WG3A 1R1WA 1BLXA 4RJ8A 5JFVA 3WYXA 2YA9A 2YWVA 3S00A 5AR4A 1ZMUA 5E90A 4I6HA 4HGTA 3WIGA 5HO7A 4FE2A 3QWJA 3W18A 4KIPA 2E9NA 2PE1A 1W2FA 1BUHA 1REKA 4RIOA 5IA1A 1JKTA 3DCVA 4GL9A 3E93A 3LFCA 4OLIA 2VTOA 4FL1A 4QNYA 3FQSA 2UVXA 4X2FA 2X6EA 2ONLC 5E91A 3VUMA 4ZZNA 2VNYA 4GIIA 4JG7A 5AUTA 4YHJA 2R0UA 4D1ZA 2UW3A 3IOPA 3D7TA 4BGGA 3QRTA 4YC8A 2HAKA 2QOLA 5AA8A 3P9JA 1KE7A 3PVGA 3RMFA 2ETKA 5AP7A 4BWPA 3HX4A 1YI4A 3QTWA 1RW8A 3ZM4A 2C1AA 2JGZA 3EHAA 1TKIA 3VUHA 2VX0A 4L00A 3LAUA 4WO5A 4FIHA 4BCNA 1S9IA 3F88A 3LW0A 4R3CA 3D7ZA 4Q2AA 2C5OA 3BV2A 5M56A 4Q5EA 4YHFA 2BPMA 5AIRA 2X2KA 3FC1X 3MH1A 3R8MA 3U55A 1JAMA 3KL8A 4QTBA 4U3ZA 3PWDA 4EH9A 4OGRA 4L43A 3Q04A 3RCJA 1WBPA 2P55A 4JX3A 2IZTA 4JJRA 4CD0A 2C47A 4W8DA 4R7IA 1FVRA 5C8KA 2NYAA 4QTAA 2PMOX 3BL9A 3D14A 4OTQA 3R9NA 4JMQA 3PPKA 4L7SA 5CASA 4ALWA 3PTGA 4BCQA 3PVBA 4EHGA 5HE2A 2PVFA 4IB1A 3BRBA 1YHSA 2VZ6A 3R8LA 1STCE 4V04A 4DH5A 2RL5A 3EQCA 3OP5A 2J6MA 4HZRA 2JEDA 2RG6A 2OF4A 2PVMA 3BU3A 3GCQA 3WE8A 1PYXA 3QKMA 2JKMA 3AT3A 4H3PA 5IQFA 3ORIA 3EQIA 4QQJA 3W10A 1B38A 4PTEA 3VRYA 3A7HA 3IO7A 2IZUA 3HGKA 3RK5A 2IVSA 3ZSHA 3DNDA 1T45A 1WFCA 1CDKA 3UO6A 3LMGA 3N9XA 3ZC6A 4TYHA 3LJ0A 4Q9ZA 3LXKA 4PP9A 2VRXA 4AX8A 4FA2A 3V6RA 2W5HA 4NJDA 2ITPA 5E9EA 4D5HA 4D9TA 5AAGA 3ALNA 3D5XA 4BZNA 3AC1A 3GC7A 3TNPC 2V0DA 5FP6A 3JUHA 3AXWA 4I21A 3VULA 3OMVA 2XBJA 3Q53A 4EQCA 4RQKA 3G9NA 4AG8A 4DHZA 2XANA 1A48A 2ITWA 4BDKA 5I5ZA 4OAVB 1PKGA 3UBDA 2JDTA 2B9JA 3D2IA 5DA3A 2IW9A 4H1JA 4HOKA 3E8NA 5BPYA 3I6UA 4LRJA 1M2PA 3A7IA 4GT4A 5HVYA 3TNWA 3PSCA 3RM6A 4E4LA 3O0GA 5JKGA 1KWPA 5HIEA 1PMUA 2YCQA 3ETAA 3OZ6A 4FTKA 3UO5A 3HV5A 2UW5A 3HL7A 3QTUA 3CXWA 3F7ZA 3HA6A 5DPVA 1OKVA 4FOCA 3IW8A 5FEEA 3DXQA 1E1XA 4AT3A 3UNJA 4GU9A 3I7CA 2ITTA 2O63A 4EH2A 3E7OA 4GU6A 2BDJA 4B0GA 1KV2A 4PF4A 1YW2A 4Y73A 1XH8A 2VWUA 4QP4A 4ACHA 5J7BA 3QX2A 3EL7A 3OCGA 3TDWA 5DWRA 3RAHA 2W9FB 3NUNA 5EK7A 4DT9A 5CF6A 3TTJA 3T3UA 5JFXA 3DJ7A 3VJNA 3SAYA 5FBOA 4JOAA 1UWJA 3DKOA 4WBBB 2X8IA 4GYIA 4DLJA 3QRJA 5IMEA 4HGLA 4F6SA 2VNWA 3EB0A 4U81A 3F7WA 4EOIA 3FLYA 4AE9A 2RFDA 2G15A 4B99A 3PJ3A 2BRBA 4WNKA 4BYIA 3FLSA 4L42A 4QYFA 2C6EA 5TOZA 4LV7A 3KN5A 2X9EA 1YOJA 1BL7A 5IQEA 4C0TA 2EWAA 3AD5A 4PPCA 4AXAA 2ZM1A 5ACBC 2WPAA 3UIXA 4JBVA 5KBQA 3SHEA 4L6QA 5AUUA 4RWJA 3PPJA 2HWOA 1R3CA 2QCSA 3BEGA 4ZJIA 1Q3WA 3PRIA 4JX7A 3FYJX 5L2WA 4NCTA 2HYYA 3SVVA 2WNTA 3FEGA 3R30A 2X39A 4F1OA 1OVEA 2BAQA 5CF5A 4EH4A 4AACA 1CKPA 5EW9A 3Q96A 3OW3A 4QPSA 4TYGA 3RPOA 3W32A 3SDJA 4C36A 3KF4A 4BRXA 2X0QA 4GK3A 5BUEA 2IN6A 3U54A 2C6IA 2C3KA 2XNNA 5CQUA 3GB2A 4ZS0A 4C4EA 4AA5A 5FRIA 2YIRA 3AC4A 4XH6A 2XIZA 1SVHA 1XH9A 3HRCA 5E8SA 4GUBA 3RAIA 2X0GA 5H8EA 3OVVA 4N6ZA 4C4FA 4DCEA 4FV2A 5EDPA 3SD0A 4I24A 4I6LA 2BHHA 3OY3A 2AEGA 2I1MA 4JQ8A 2YIQA 2XAOA 3O8TA 2JDSA 4X0MA 1UVRA 5LQFA 5EQEA 4C3PA 2WO6A 4XX9A 1YXXA 4U79A 5EM6A 4JLCA 3DAJA 2EB3A 3FKLA 2YDKA 3IOKA 4FT9A 4AW2A 4KNBA 2GQGA 4F9BA 5HQ0A 5LCJA 5LMKA 3W16A 4BDIA 4DDIA 5EKOA 3CCNA 2YN8A 1WBNA 2DUVA 1SNXA 3JVRA 3TXOA 2XNPA 2YCSA 4PTGA 3Q4ZA 3OG7A 3R73A 3ULIA 4ACCA 5K5NA 5T3QA 4E26A 3ORTA 3PA3A 4GG5A 5DHJA 4BY9E 4AFEA 3BLQA 5IA4A 4ZY5A 5A4QA 3U6JA 2BFYA 2RFSA 2Z7QA 1VZOA 5HVKA 3PUFC 1OZ1A 2J0JA 3IONA 3BU5A 2WD1A 5DN3A 5HD7A 4TWPA 2R3RA 2X7OA 4BTKA 3DTCA 3ZSIA 4JR7A 2A2AA 3BLAA 2A19B 4L3LA 2JAMA 1OITA 1WVXA 3EN4A 4LUDA 4TZRA 1SVEA 5FXRA 3QRIA 1UWHA 4Y83A 3VS5A 2VWXA 4AAAA 3G51A 3NAYA 2YM6A 4U80A 5DI1A 4F7JA 4HNIA 1OBDA 5KZIA 2UZDA 1UKHA 4H1MA 3SRVB 3CKWA 2XMYA 3O8UA 3CTHA 1MRUA 4XCUA 4PX6A 3IECA 3BIZA 3VRZA 4WIHA 3NGAA 4GT5A 3FL5A 3NFFB 4F9CA 1Q8TA 4L46A 3FMJA 4U5JA 3C0IA 4EH6A 1UV5A 1IAJA 2XP2A 2PUIA 5AR3A 4CZYB 2PUNA 2W9ZB 3HMMA 1X8BA 3Q52A 4GK2A 4I20A 4DEHA 4FTNA 2Y9QA 1SZMA 4D2RA 1SYKA 5CZIA 3UIMA 3ZXTA 4S33A 1G3NA 4KSQA 3R7UA 2O0UA 5D11A 3WE4A 4C57A 4G9CA 4FGRA 4NW6A 1FOTA 3FQEA 5JZNA 4C3FA 3TJDA 4NYEA 3NDMA 1XBCA 4V0GB 4YTCA 5KMIA 2E9OA 2DS1A 4ZAUA 4YUQA 4OBPA 4GRBA 2E9UA 2QODA 3BBTB 1R39A 4P4CA 4EK6A 3W0NA 2GFCA 2ITOA 1Q4LA 2QOFA 1FGIA 2YIYA 4YPSA 1CSNA 3G15A 3R9RA 1IRKA 4KIKB 4UXQA 4PUZA 4G17A 2GTMA 3ANQA 2V7OA 3COHA 2CCIA 3P23A 5CSPA 2YEXA 4XG9A 5G1XA 2ITYA 5DYJA 2QOQA 4OTRA 4H58A 4ALUA 2GSFA 4CFUA 4NUSA 4UEUA 2W1EA 5M55A 2UVZA 5BVWA 2OSCA 4MF0A 4UBAA 3W2RA 5LWMA 3SRVA 4R78A 3AT2A 4YHTA 3QYZA 2XNGA 2QQ7A 4IQ6A 4EH7A 1MUOA 3BBWA 2X7GA 2XM8A 4O0XA 4BJJB 3GFEA 2GNGA 3GEQA 4JDJA 4RZVA 4AN9A 3L1SA 4IAAA 4XYFA 3UQGA 3MS9A 3QQHA 3QCYA 4EUTA 4FV3A 4O91A 5KMKA 2VUWA 2XUUA 2ERKA 1AGWA 2PVLA 3MW1A 1K9AA 4QMQA 2JKOA 2R3MA 3CD3A 4USFA 4EWQA 5CVGA 3O7LD 3P7CA 4X3FC 5E1SA 3A8WA 3GCUA 3R21A 1PMNA 3EOCA 3MESA 3KRJA 4FKJA 4I22A 3C1XA 5A4LA 5CEOA 2O65A 4M7IA 3AC3A 4KRCA 2XNEA 4FTRA 4AXEA 4TY1A 2C68A 3EZRA 5HE0A 4O0YA 5GNKA 4YJPA 3ZO3A 3C5IA 3THBA 3T9TA 4ZTMA 5L6OA 5AUWA 4FK6A 1S9JA 4K18A 3F5XA 3OBGA 4XG3A 4S31A 5JRQA 5IQCA 4LL5A 4CRSA 4ENXA 2QKRA 4TPTA 3QGYA 4YGAA 5LXMA 2B0QA 3DDQA 5AP5A 5M44A 3EZVA 2XH5A 3Q4TA 4O0VA 2ONLA 4CYIA 4KIKA 4GT3A 2UW4A 4WBOA 5J95A 4RIWB 3U8WA 3RWQA 3EQGA 4PY1A 4DE4A 1TQMA 3MB7A 5HG9A 2R64A 4D2PA 4YPDA 4QP2A 3QTXA 3WBLA 3VQUA 3QL8A 2A1AB