4AXAA

Structure of pka-pkb chimera complexed with (1s)-2-amino-1-(4- chlorophenyl)-1-(4-(1h-pyrazol-4-yl)phenyl)ethan-1-ol
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title At13148 is a Novel, Oral Multi-Agc Kinase Inhibitor with Potent Pharmacodynamic and Antitumor Activity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
total genus 112
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4axaA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axaA02
5D9HA 3RHXA 3MVLA 4DTKA 4L3JA 3AC4A 3RGFA 3PXFA 2BILB 2QD9A 4IE9A 5TF9A 4IAZA 2JIUA 3PPZA 3L8XA 4F09A 3POZA 1P4FA 3AXWA 4RJ8A 4FZFB 5HE3A 5ITAA 1YOJA 1SYKA 4EEVA 5E4HA 3D7TB 4CFUA 4QP2A 3BEGA 5A14A 1PYEA 3VS7A 4MEDA 5IQBA 4PUZA 4MXXA 1PXKA 1H27A 2ZOQA 1NVSA 3KCFA 4L53A 4YLJA 4Z55A 3BU5A 4L3LA 3CCNA 4NT4A 1AQ1A 5DYJA 2VZ6A 4XS2A 5J1WA 4ZTMA 3HAMA 3LIJA 3NZ0A 3R8MA 2AC5A 2X39A 4MYGA 4I5MA 1YI4A 5KMIA 3OXTA 5L6WL 1U5RA 3Q4CA 3EFWA 5DWRA 3QTQA 4BCFA 4BDEA 1ZZ2A 4OTDA 4N0SA 2JGZA 3PJCA 3VO3A 2IZSA 3NUAA 3R7UA 4XP3A 2WTKB 3D14A 3IGOA 5FQDC 3EB0A 5LJJA 3GCPA 3F6XA 5DLSA 5LMKA 4KINA 1YI3A 2VWIA 4BDJA 3UIMA 3OWPA 2BZIB 1JKTA 1M7QA 3G9NA 4FZAB 1G8SA 2OFVA 3FHRA 3QKLA 4GT4A 4BDAA 5IH6A 5J79A 4ENXA 5EM7A 4UALA 4A9SA 4J99A 3ZSIA 5E8ZA 2ZB0A 1NXKA 1OUYA 3MTLA 1GZOA 2IJMA 3BYMA 2PK9A 5F95A 1XO2B 4WHZA 2YA9A 2RFDA 3Q53A 4IACA 4Y83A 3MPMA 4EHVA 4CKJA 2R3NA 3VQUA 2BRHA 1OKYA 2X1NA 4O7VA 4FG7A 4S32A 3QRTA 4AW1A 3QC4A 4DFLA 1TQIA 5BVFA 3IS5A 3ZH8A 3ANRA 5CSVA 3WOWA 2GHMA 5AEPA 3C5UA 4WUAA 4FNZA 1QPJA 3FI3A 3HRFA 3F2RA 4BCOA 4AN3A 1GIJA 3PXKA 3OHTA 4KKHA 2BHHA 4MXOA 2QO7A 4XP0A 2ERKA 4ACCA 5C8KA 2OKRA 3HA6A 1ZMUA 1REKA 2JKKA 4YTHA 1OGUA 2QR8A 4GVAA 2VTOA 2ZB1A 2C47A 3MTFA 4IIRA 1QPDA 4Y8DA 3R8PA 4E5BA 2UW6A 3DBEA 4R3CA 3O51A 3PZHA 3IECA 4MXZA 5DEYA 2DWBA 5DE2A 4CYJA 5HZNA 1ZOHA 3H4JA 3NYNA 2QR7A 5BVNA 5LVPA 4CG8A 4GFGA 4MBIA 4F64A 2VTSA 3BGQA 3WE8A 2GMXA 2ZMCA 4QPAA 4ANQA 2OG8A 4YGAA 4O7NA 4GKHA 4EHGA 4IX6A 4DBXA 3TIZA 3FMKA 4KD1A 3ZO3A 3ZLWA 3OY1A 4NM0A 2XK8A 4BBEA 4IX3A 5EG3A 3ZFXA 4CLJA 2QOFA 3LCOA 4RGJA 2I0HA 5EKNA 3LFBA 3QCSA 4QMZA 4NM7A 4GL9A 3H0YA 3C7QA 4USEA 4D28A 3HX4A 3ORNA 4C7TA 4H3PA 4CEGA 4W4YA 3M1SA 4D55A 2WGJA 3WZKA 3A60A 2OIDA 4U81A 4ZSLA 5CSHA 4YTFA 2RG5A 4LL5A 3C0GA 3FJQE 3EN5A 3GC9A 2F7EE 3ZSGA 3FMMA 3OXIA 5L2WA 5GJGA 2YEXA 3VW8A 2A1AB 2RF9A 1WBWA 4ZTLA 4A4LA 4I94A 2QOCA 3H9RA 4FKWA 4U79A 3UYTA 3DCVA 1U4DA 1FBNA 3V51A 5AP3A 4EWHA 3SX9A 4C35A 3IG7A 2W1EA 5AAFA 4R8QA 1LP4A 2VO3A 3ZM9A 4M13A 3C50A 4OAVB 3F88A 2F2CB 2ZAZA 2ITZA 4UMTA 5CVGA 5DFPA 5IA3A 4M69B 4XX9A 5B7VA 3PXQA 4C36A 1OIYA 5HBEA 4MXAA 3V6RA 3MB7A 3FZ1A 3EJ1A 4FR4A 4E6AA 2UZLA 2JAMA 5AR8A 3R9RA 4HYUA 3E63A 4W4WA 4FX3A 3TT0A 3LQ8A 2GNIA 4TYIA 4BTMA 2J6MA 1FGKA 2JKQA 4LOPA 4FNWA 4X3FC 4YZDA 5IA4A 3OOGA 2QU6A 4LUDA 4K11A 4HYSA 5AM7A 2GPHA 5LWNA 2B53A 5HU9A 5DNRA 4ZTNA 5K5XA 3AMBA 4F1OA 3OW3A 5AX3A 4I1ZA 2EVAA 3ROYA 3O8UA 5IEYA 2P4IA 2YAAA 5CU3A 3K5UA 4CMTA 3RCJA 2X8IA 1Q8ZA 3GEQA 3N4TA 2VTMA 4FKTA 3R8VA 3ALNA 4HPUE 4I4FA 2UW5A 4O0YA 2CLXA 4WSYA 4GYIA 2IW6A 4XG2A 4EH5A 5A6OA 2XKCA 3QQKA 3RK5A 1YQJA 3RPVA 3JYAA 1W7HA 3ZO1A 3R83A 1XH7A 3K3JA 2VO7A 1GZKA 3IPHA 4G31A 1KSWA 4ZTRA 3KC3A 4FL1A 2PUPA 3HMNA 2BMCA 4UBAA 3IW5A 4P2KA 5IEVA 3PVGA 2YFXA 4F9CA 4M0YA 3V8WA 5AP6A 5E8VA 2X9FA 1XH5A 3KVXA 4FKSA 4CVAA 4CG9A 2I1MA 1JPAA 3ZTXA 3Q60A 2PMOX 5IUGA 5HCXA 2RGPA 4LQMA 3HP5A 4X2JA 4TY1A 4A06A 2VTLA 1PJKA 1VZOA 4JVGA 4O0RA 2VN9A 3A8WA 1F0QA 4LFIA 4Y5QA 3N4UA 4RSSA 5DPVA 5AV2A 2PVKA 3DKFA 3UO5A 3OZ6A 5AV4A 3HVCA 4EYMA 5A9UA 4NYEA 3R73A 2WTJA 4MD7E 3QQUA 3M2WA 4AF3A 2J5EA 3IONA 1O9UA 2BCJA 2C0IA 2E9NA 3L8SA 4X2NA 5EKOA 3D83A 3Q3BA 3TJDA 1WBOA 1NA7A 3TJCA 3QGWA 4XLIA 4ASXA 3P7AA 3UPXA 3NR9A 3Q5ZA 4ZLYA 4U3ZA 3EYHA 4WKQA 3F5UA 5ETCA 4EK4A 2QVSE 3TNPC 3DT1A 4L01A 3TG1A 2XS0A 3SXSA 4TN6A 5E8XA 1WBPA 3Q4UA 2X2KA 4EK6A 4WSQA 1GIHA 3DS6A 1UNHA 3G9LX 1BL7A 2Q0BA 3FBVA 3KF7A 3RK7A 5AAGA 3HKOA 1BYGA 3TL8A 5BMSA 3O50A 3LXKA 1SVEA 3U6IA 2B9HA 3GGFA 4C8BA 5LQFA 1ZYDA 4FODA 4XG3A 5DRBA 4OGRA 5EM8A 2DYLA 3F69A 2XKFA 4C62A 2BPMA 3EZVA 4FSRA 4MF0A 4QPSA 4Y72A 3UQCA 1Y57A 2GQSA 2YM8A 4ZJJA 2WFYA 5CU6A 3QCYA 2Y0AA 3HGKA 4R7IA 3L9MA 2J5FA 3FXWA 2OXXA 2JKOA 5FD2A 3NNVA 2HCKA 3DJ6A 3OW4A 2X8EA 3KRWA 4FT7A 3LCTA 4F6WA 3F3VA 5CZIA 3SVVA 1QPEA 3E3PA 3GQIA 4B7TA 3EQPA 4BKYA 2C5OA 2IG7A 5FTGA 3HV6A 5KE0A 2R4BA 2XYNA 5J95A 4AP7A 4WRSA 4ZEGA 3TZ8A 3CPCA 4BCMA 2J50A 3MY5A 5LMBA 3QBNA 4DH7A 5EM6A 4R3RA 1UVRA 4WIHA 3DBDA 4OBOA 5CANA 3GU7A 1WAKA 4TW9A 1OIRA 3D5WA 3DLSA 2EU9A 2YM4A 2ITQA 5BVDA 2QHMA 3VUMA 1M2RA 5M53A 3AGMA 3HRBA 3TDWA 4XV1A 2YIXA 4BI2A 3UODA 3EFLA 4IAFA 4R1YA 2H34A 3FPMA 3KRRA 3SQQA 5CALA 2VO0A 3Q04A 4BWKA 1KE7A 2O0UA 4NFMA 4U6RA 2R3FA 4CYIA 5K4IA 3DFAA 4OBPA 3UMWA 5LXMA 5J87A 3ORXA 3MY0A 3ZFMA 2RSVA 2PUUA 3VBQA 4RT7A 5JGDA 4AOTA 3LZBA 3P1AA 2VTQA 4PDPA 3ZHPC 2E9VA 3R9OA 3RNIA 2EUFB 4CLIA 1OIQA 4EQCA 3PYYA 4H36A 1YKRA 2C69A 3QLGA 2GCDA 1H26A 4FKLA 4OTRA 4WG3A 3KA0A 3ZOSA 5A4CA 3MS9A 4R5SA 1YXTA 2XKEA 5JQ8A 4KIQA 4YJSA 3R8UA 2HW7A 4OLIA 3IDCA 3QXOA 1MUOA 3CKXA 3AGLA 5H8EA 3RWPA 4O86A 4J7BA 2UZTA 4X0MA 5AUXA 5FM2A 4EH8A 5I3RA 3COKA 4PP9A 4DG0E 4YJUA 5M51A 5HGIA 4UX9A 5CAVA 4AAAA 4IJPA 4EOJA 3DZQA 2OIBA 1W82A 2XIZA 4QP7A 1QCFA 5HIEA 4RJ4A 5M57A 2UV2A 4KS7A 3T8OA 2HYYA 4Y73A 2V7AA 1H24A 3PWYA 2KTYA 4QP1A 2B1PA 2RFSA 4TYJA 3EQDA 4XMOA 5CF8A 3W1FA 4O7SA 3EIDA 5IPJA 3SW7A 3E92A 2XIRA 4IZ7A 1YHWA 3R6XA 3LCSA 2G01A 2X4ZA 3JY0A 5LOHA 2X8DA 3CC6A 4HVIA 4HJOA 1MP8A 2CCIA 2WB8A 2XM9A 2R3IA 4YJTA 2BRNA 4QTCA 2WQOA 2E2BA 4XH6A 5C8MA 4EHEA 4RIYA 3JXWA 1V0PA 1WVYA 3R04A 1R3CA 2PVYA 4IWPA 2YLFA 3MSSA 4MWIA 3NPCA 3P4KA 5JGBA 4QQCA 4AA0A 5B2LA 2WTKC 5M4UA 3OFMA 3KN5A 3RZBA 4KWPA 5AR3A 3LFEA 4AX8A 4ZTSA 4O22A 4OR5A 3WYXA 4E6CA 1ND4A 3HDNA 3ZBFA 3QQGA 4WG4A 2E9UA 4RZWA 5IG1A 3AMYA 1XBBA 5L2IA 2WOUA 2CGUA 3FMLA 5CENA 3S3IA 5L2SA 4M14A 2Y4PA 4FEVA 2YZAA 1PMNA 2ITVA 4BI1A 3QX4A 1CKPA 1V1KA 4H3BA 4RBLA 3BHUA 1YOMA 2F4JA 2G15A 1Q61A 1PXOA 3GT8A 4J96A 4M66A 3CIKA 5CT7A 4YPDA 4GK3A 4IEBA 5EDPA 2HZNA 4FKJA 1IAJA 1FMOE 1MQBA 2XIYA 1VEBA 3BWJA 4TXCA 1Q3WA 2WIPA 5L2TA 3A2CA 1KE5A 5T68A 5EOLA 5HE1A 3OG7A 3EQRA 3V5JA 1YWNA 4FIIA 5EW3A 4E4MA 5JMSA 4FUYA 3PVWA 3FUPA 4EYJA 2HOGA 2J9MA 3GBZA 3RPYA 3QQHA 3QC9A 5DGZA 5DR9A 3MIAA 2YERA 3VS1A 4CQGA 3GENA 3HDMA 1S9JA 2F7ZE 2J4ZA 3KRJA 4GJ2A 4QOXA 4U0IA 3QTRA 2WD1A 3RPSA 4ASDA 1ZYJA 2C6LA 4BY9E 2ONLC 3C4FA 4F0GA 3PPJA 3UNZA 5CEOA 5CSPA 2OW3A 2JEDA 3VW6A 4EZ7A 4JOAA 5D7AA 3ELJA 3UVQA 1FQ1B 2UZWE 3LM0A 4PQNA 1W83A 2ZDUA 2C1BA 1DI9A 3I0OA 4MCVA 5DVRA 5EW8A 3UQGA 3WE4A 4O7LA 1YRPA 2IVSA 4EH4A 3KL8A 4GW8A 3R8LA 3TNHA 4QP3A 4H05A 2I6LA 3IDPA 3QUDA 4HCVA 3CPBA 3PSDA 1K2PA 2ETMA 2GTMA 2X9EA 3AC8A 4FSZA 5IQHA 1URWA 3D94A 4FVPA 3TKHA 5ETFA 2OJIA 5DT4A 4ALWA 4F1TA 3CGOA 1L3RE 5C4LA 3LVPA 3EOCA 4ZSJA 5BUJA 3TDVA 3FYJX 1JBPE 1KV1A 4IDTA 4QQJA 3G15A 3HMIA 4FBXA 3PJ1A 4PDYA 3UVRA 3DDPA 2WMUA 4F6SA 3PRIA 3QRUA 3U87A 4O7RA 5CEIA 1JAMA 2GSFA 2BIKB 2VTTA 3DU8A 3COIA 3JVSA 4D1ZA 1Q41A 2ITXA 4KRCA 3IW4A 3DA6A 3Q9XA 2OIQA 4I21A 4FTNA 5AM6A 1OI9A 4FKVA 1PKGA 3G0FA 2YIYA 1OKWA 4FT5A 5ETAA 4G17A 3FZOA 4XEYA 3OP5A 3FKNA 3I6WA 5E8TA 4J52A 2X7GA 2W9ZB 3CGFA 4G9RA 4Q9SA 5KHWA 1J91A 1R78A 2PMIA 1PHKA 2EXCX 1SM2A 3ZO4A 1IRKA 3LM5A 1V0OA 5A4EA 2JKMA 5EW9A 5HVJA 1HCLA 3CQWA 4PY1A 4CMOA 4ZS0A 5IQCA 1CMKE 3ZRMA 4BCNA 3MIYA 3PVBA 5LVMA 4GRBA 4MBJA 3RM7A 4QTBA 2ITNA 5FTQA 2IW9A 2X81A 3VVHA 4DG3E 3MA3A 5IZFA 3P79A 3U8WA 2VTPA 1TQPA 2R3QA 2C30A 1Q99A 4YSMA 4DFZE 4OTQA 3IK3A 3WZEA 4AU8A 3SGCA 4X3FB 5A4TA 2NNWB 3QUEA 2C5VA 2HENA 5EM5A 4DFUA 5M4FA 4KNBA 5HHWA 3UOHA 4USFA 3G51A 3BI6A 4OT6A 4DH1A 2QOBA 1J7LA 1PXMA 2R3MA 4EK3A 4U7ZA 3V8TA 3GNIB 4LRKA 3OD6X 2RIOA 2B52A 4FG9A 2WMWA 2OXDA 3FPQA 4CFXA 4HGTA 4AA5A 3UVPA 4L9IA 3ODZX 3SD0A 5HVKA 3WZDA 1ZMVA 4DTBA 1Y6AA 2VWWA 4CZTA 2HW6A 3BGPA 5IU2A 4GUBA 4HVGA 3O71A 4N57A 4CV8A 2YIRA 3ETAA 2UZUE 2JBPA 4S33A 2OSCA 1O6LA 5CI6A 5IUIA 4PF4A 4MXCA 1E1XA 1IASA 2ZYBA 3L8PA 3ZXZA 1JWHA 4CV9A 4EH6A 4FC0A 3I0QA 2IZTA 2Q83A 4U9AA 5ANEA 5AR2A 4K1BA 3VS2A 4X6RA 3Q52A 1OBGA 2R3HA 4A7CA 4DEDA 3AD5A 3FHIA 2O2UA 3WF5A 2FB8A 3LFQA 4C61A 4DC2A 4F4PA 3UE4A 3FAAA 4RJ7A 4MF1A 1PYXA 4Y85A 5EYDA 4D2PA 4D4YA 4EJNA 4K77A 4CXAA 4DHFA 1PKDA 2UW3A 4MWHA 4QYYA 3I4BA 3KXMA 3PIYA 1YDSE 3D9VA 2R3PA 3Q2MA 4ZSAA 2CGXA 2VO6A 3HLLA 4XOYA 3R01A 4JBPA 3PY0A 4EOIA 4FK3A 4D1XA 2BFYA 3OUKA 4KIKA 1P2AA 4FKIA 2XB7A 4FYNA 4O91A 4D9UA 4IZYA 4WD5A 3V5WA 4M7IA 4C4JA 5CAOA 2C0TA 3UC3A 2XCKA 3GU8A 4OTHA 4TWCA 5AP1A 4GIIA 4PP7A 5KUPA 1LEZA 1XWSA 2VWVA 4A9UA 4ZAUA 2XH5A 5I4NA 4FICA 2O63A 1OPKA 2CKOA 3QA0A 4BIDA 4M8TA 2VAGA 4R7HA 4I6FA 3QYWA 3V6SA 4L52A 3DQXA 5K4JA 3V8SA 1OIUA 1YXXA 4M68A 4EORA 3SXRA 4ALUA 5CU2A 4X3JA 3A7JA 4CFWA 3KULB 1BI8A 4NM3A 3FSFA 3RHKA 4EOPA 1U54B 4ZLOA 1H1QA 4UYAA 4BIEA 3DXQA 2YM6A 2X0GA 5AP2A 3DXPA 4JRNA 3UC4A 3ZU7A 4IQ6A 2FGIA 2PVNA 5CQUA 5DT0A 2ZJWA 3CE3A 1QMZA 3E3BX 3N51A 2Z8CA 1BI7A 5AV1A 5KMKA 3R28A 3VNTA 5HLNA 2UVZA 3GC0A 4YZNA 3DPKA 3NNWA 1CDKA 2H9VA 5IH4A 2WQEA 3F7ZA 4EOSA 2YM7A 4JX3A 3Q2JA 5JRSA 4RX8A 4IHPA 4C3RA 3ACJA 3LFSA 5C03A 5HCZA 2P55A 4D2SA 4DGGA 1M17A 2ZV7A 4CKRA 3PXRA 3UP7A 3LE6A 4GT3A 5HLPA 4E4LA 4KSQA 4CRLA 3W55A 2NRYA 5HTBA 4NJDA 1WVWA 4FV9A 5J5SA 2B9JA 5AP7A 3NUNA 3PSCA 1XR1A 3BEAA 3E87A 5EI6A 5C27A 3WBLA 2FVDA 4FTKA 5IQAA 3NS9A 3BHHA 3FQSA 3ZMMA 4M67A 3FLNC 4BFMA 2BFXA 2E9PA 4LOQA 2IVUA 3I81A 1VYWA 4I22A 4RZVA 5CASA 5IEXA 2CMWA 4RIWA 2CNUA 2PSQA 4LGGA 2G9XA 3QKMA 4I5CA 4RJ5A 4X2FA 1Q8UA 1XJDA 2OICA 3Q4TA 1GAGA 4LV8A 3T3UA 4Z7GA 3MFUA 4ACMA 3UIUA 4S31A 3K2LA 4EOLA 5HNIX 4QYHA 5K0KA 1T45A 5HLWA 5J9YA 2ITWA 3BPRA 3G6HA 3HP2A 1UNLA 3QLFA 3GU6A 4IFCA 4ZY5A 3DAEA 4HCTA 3VULA 3DKOA 4O6LA 3R7GA 2FH9A 4ZZNA 3RCDA 3TZ9A 1REJA 2J0LA 5EYMA 1PMVA 5J7BA 3QTXA 4BHNA 2WTDA 4CZYB 3AQVA 5M4IA 5TR6A 3RI1A 3W2CA 3TWJA 4QQTA 4I5HA 4UYNA 3R2BA 4ZTHA 4F6UA 4F9WA 3HUBA 3O7LD 3A62A 1CM8A 4BZOA 2PZRA 3SC1A 3FY0A 1NY3A 4PL4A 1Q62A 4GEOA 3F5XA 5ETIA 3CQEA 5IF1A 2HIWA 2F57A 4QMLA 2ZVAA 2W7XA 5BYLA 3CXWA 1PXIA 4I6BA 3VQHA 5GIOE 1YWRA 4I93A 3Q32A 1CSNA 2JIVA 3HV7A 4OTGA 3EQHA 4RFMA 3RZFA 5DR2A 2XK6A 3F3TA 4D9TA 2W1ZA 4C02A 2PVJA 3GU4A 4DFXE 3QD2B 1WBNA 4G3EA 4DEAA 2QCSA 4EI4A 4B8LA 2QODA 1A06A 4MQ1A 2PUNA 2XNPA 2VRXA 4AS0A 3QRKA 1CKIA 3BE9A 5KKRC 3MDYA 4OTFA 2C6IA 5A4LA 4L45A 4RLLA 4GT5A 4K2RA 2J0IA 4RX5A 3EWHA 3C5IA 3MYGA 2I40A 4UWYA 2O65A 4BDDA 2GU8A 2WTCA 2GS6A 1KOAA 3PSBA 4FKGA 3GUBA 4G9CA 2XNGA 4JG8A 3P0MA 4XYFA 1H8FA 3F7WA 3UG2A 2JLDA 3VBTA 1H25A 1K9AA 2QOIA 3F66A 4ASZA 4C4GA 2QHNA 4IZAA 1YHVA 4NUSA 4F7NA 3NVMB 2QOLA 4WA9A 4DTAA 2C6OA 4GMYA 4O38A 1H01A 4AWIA 3ZZEA 1ZOEA 4L3PA 4FGBA 4XG7A 1YVJA 2YJSA 5CSXA 3ZO2A 2QC6A 4RJ6A 2W4KA 3PLSA 1XBAA 4HGLA 4JDHA 4IWQA 5BVWA 3RVGA 3VAPA 4U3YA 4C57A 3P7CA 3FXZA 1DS5A 4JS8A 4C4IA 5HX8A 1OMWA 1G8AA 2PY3A 1FOTA 2FUMA 4UMPA 3PE1A 4JDKA 3ORMA 4BCKA 4Z3VA 2HY81 2X2MA 3HL7A 3TV6A 4BWPA 4DN5A 5KNJA 1ZY5A 3NDMA 5AUZA 4QP8A 2GFSA 3VS0A 2QOOA 2B54A 3FEGA 1M2PA 2PVFA 2V62A 3DK7A 4PTEA 4G5PA 4FTIA 3FZPA 3GVUA 4FTJA 5EHLA 3KEXA 3IO7A 1UWJA 2PVRA 5KMLA 3I1AA 3SDJA 5CXZA 5E8YA 5AFVA 5DG5A 4FEQA 3LLTA 5FXSA 5H8BA 3OT8A 1BLXA 3MVMA 2CKEA 4M12A 4BBMA 2HXQA 1MRYA 2JFLA 4ALVA 3NNUA 2CKQA 3OT3A 3SRVB 3MFTA 1OVEA 2YM3A 3NUPA 3EHAA 5E8SA 4BDIA 4K8AA 2YWVA 4CD0A 4V0GA 3VBWA 2GFCA 1J1CA 4FTUA 4G3FA 3QZHA 4YC3A 2QURA 4AE6A 4IDVA 2WMAA 3BCEA 3K5VA 2FSLX 3KN6A 5CF5A 3EL8A 1UV5A 4MD9E 3I5NA 5ACKA 3FC1X 3LCKA 3TEIA 4YZ9A 4EUUA 3ZC5A 2NPQA 3QUPA 3FMDA 3NW6A 4OTWA 4Q5HA 5HBHA 5CF6A 3ZDUA 5JEBA 4R78A 3PA5A 4XP2A 3MH0A 2PWLA 4RMZA 5TKDA 4BTKA 4KSPA 3KF4A 4JX7A 4L8MA 2R64A 4BDBA 4DH5A 2HY0A 4XV2A 3I7CA 1JKLA 1P14A 4AQCA 4IAAA 3FQHA 5EH0A 4WNKA 4I0TA 3E7OA 3U9NA 4E7WA 3LFDA 1H07A 3TI1A 3VBXA 3KB7A 5IQFA 5M44A 4O84A 2OWBA 4PNIA 2CPKE 2R2PA 5I9WA 2B4SB 5EYCA 4KB8A 5H2UA 3W2QA 4YUQA 5IQDA 4FT0A 3PDTA 5E9EA 4O81A 4UWBA 3LW0A 2CN8A 4FV1A 1MQ4A 2YDIA 4P5QA 3RINA 1A48A 2PTKA 1KUTA 3FLWA 3V5PA 4FSQA 2PU8A 2WIHA 2UW8A 3Q9YA 3UMXA 3R7VA 5AUTA 2R0UA 2YCSA 2P2HA 1IR3A 5F1ZA 5AA8A 4RPVA 5AUUA 3R02A 2G2FA 3ULZA 4D0XA 3NMUF 5E8WA 1KE9A 2VU3A 5D41A 3BV3A 4N6ZA 5FLFA 4QYEA 3TUDA 4R77A 3ZRLA 3LXLA 4AZEA 4IX4A 4DEIA 1A9UA 3HMOA 4QMWA 4DFYA 2XBJA 1WFCA 2GNGA 4YZCA 1BUHA 3LPBA 2QKRA 3RP9A 4APPA 3PIXA 4FIFA 4QNYA 3EL7A 3KFAA 4GG7A 3W8QA 3G90X 5AX9A 2C6MA 2XM8A 4AGDA 4CZUA 1ZAOA 4DH3A 2B9FA 3ENHA 1SMHA 3DXNA 5HBJA 5EYKA 2XRUA 4FV8A 4DGMA 3TIYA 5HO7A 5L6OA 2XP2A 2BHEA 4GV1A 2XK4A 4CTBA 1IAHA 4FNYA 2CJMA 5T3QA 2Z7SA 3QGYA 1KOBA 3ZDIA 2O3PA 3LCDA 4ITHA 3V5TA 2XVDA 3BV2A 3WILA 4GKIA 1Q8WA 2ETRA 2ZDTA 3I7BA 1JKKA 3PE2A 3MWUA 4UB7A 4ZK5A 4FZ6A 5M06A 2HWOA 4PPAA 4BI0A 5BVOA 3V3VA 5DIAA 3KRLA 5LCJA 2PPQA 3ERKA 3Q4ZA 4I24A 5A6NA 1SVHA 5I9YA 1FGIA 5HIBA 1L8TA 3SLSA 2C6EA 3GXLA 3SG8A 5HG8A 3HUCA 4BTFA 2HAKA 2BZKB 2SRCA 2HZ4A 4NEUA 3W18A 2H96A 2C3KA 1FMKA 3MB6A 4A9YA 3MFSA 2UW7A 5KHXA 3A7FA 1QL6A 2WU6A 4N6YA 2OZAA 4B0GA 4B8MA 5F9EA 3UPZA 3BGZA 3EKKA 4KBAA 4W9XA 4E8AA 3B8RA 2BVAA 4O7TA 3IOPA 5HO8A 2BUJA 3EQGA 5AP5A 1BKXA 3R00A 3R7OA 4ZXTA 2WXVA 3OOMA 3KXNA 3I60A 2OXYA 3NAXA 5DR6A 5B2MA 5FDPA 3H9OA 3P86A 2QQ7A 4FSTA 3UNJA 2C0OA 4AN9A 4BDFA 2Y8OA 3SAYA 2WMXA 4DAWA 4F0IA 1OL2A 4IWOA 5AMNA 2BZJA 2JDVA 3G6GA 3HMMA 1Q24A 3BU6A 3ZYAA 3D7TA 3NGAA 2CNVA 1GZ8A 1YI6A 2P33A 3FWQA 3A4PA 4DYMA 4YP8A 4EQUA 2EXEA 5CTPA 1VYZA 5C26A 4U80A 3KRXA 4A9RA 2UUEA 2XNMA 3R71A 4QYGA 4QP9A 3OEFX 4G3DA 4C58A 4E5WA 4EZ3A 5M09A 2UVXA 5FG8A 2W5AA 3AT2A 4BGQA 2WPAA 2BZHB 4FTLA 3A4OX 3TUBA 4RIXA 2C5NA 2XA4A 3BYOA 5HICA 2OU7A 2VWZA 4XUFA 3R9DA 3DK6A 2YCQA 1I44A 4BWXA 3QAME 5EI2A 4HOKA 2W1HA 4B6LA 1FPUA 3F5PA 1NT2A 4YO4A 3ATTA 3GC8A 2VD5A 4C4EA 1GZNA 3P78A 2RFEA 2VX0A 5KMNA 4LMNA 3D5XA 1PXJA 3MVHA 3NW5A 4GH2A 4TWOA 2QKWB 5L3AA 4NL0A 1H1SA 2EB3A 4YU2A 4X2KA 1NW1A 5G1XA 3O17A 4U5JA 2V55A 2VTAA 3ZC6A 5JK3A 5CXHA 4FV7A 3VF9A 3KULA 4EH3A 5GINE 4RJ3A 4C2WA 4BCPA 4YTIA 4YJNA 2I7QA 4C37A 5KZ0A 3CY3A 4YC8A 4V0GB 4E6QA 3PJ2A 4QMPA 5LARA 3VUDA 3OC1A 2LGCA 4L67A 4I0SA 2PVHA 1XH4A 2A4LA 3UJGA 3MBLA 1UU3A 2XK3A 3VBYA 2OF2A 3FSKA 3PFQA 4I92A 4U45A 1AD5A 1RDQE 3AG9A 4NTTA 4EWQA 2CN5A 3QA8A 5HNBA 5HO6A 1Q5KA 2H6DA 1J7UA 4IB3A 2Y6MA 4JJRA 5E92A 2C3LA 4J8MA 4TNDA 3L9NA 1ZYCA 4ZP5A 3LFNA 4XRLA 1URCA 2P3GX 4YZMA 2HK5A 3EZRA 5EOBA 3FI4A 2CHLA 4RVKA 4L42A 2QO9A 4PTGA 2I0YA 3OWLA 3ULIA 4ANOA 2UW0A 3MVJA 4FKQA 4KAOA 3FV8A 4TTHB 3VC4A 2UZOA 4P90A 1TQMA 4HZSA 2YDKA 3BQRA 3RNYA 4MD8E 5KX8A 5KBRA 3QALE 1OL1A 3GCQA 2J0JA 4L6QA 5CVHA 1GY3A 3JVRA 3BE2A 3JS2A 3C13A 5FEQA 4RX7A 1NVRA 1Z57A 3Q6WA 3I79A 1Y91A 3UO6A 3PP0A 3NYVA 3NX8A 2BKKA 4ZZOA 4TYHB 4F9AA 2GNFA 2OO8X 3DLZA 4OTPA 4LM5A 3VF8A 4ONAA 3C51A 4J53A 1R0PA 4HVDA 4QPMA 3EYGA 3LKMA 1OM1A 1UKHA 5HQ0A 3KMUA 5CF4A 4JR7A 4FKUA 4I5PA 5FDXA 4YBKA 2BRMA 5FEEA 1PMUA 4AFEA 4O2ZA 4YNOA 3DAKA 4IVDA 2PVLA 3DB8A 3NEWA 3VS4A 4JNWA 4FA2A 2G2HA 4FV5A 3A7HA 1W84A 4ARKA 4ZY4A 3FZRA 2YITA 3L8VA 4C38A 4XG9A 4JQEA 2OZOA 2PZ5A 4E6DA 4I4EA 1ZLTA 2G2IA 3G33A 5B0XA 2J51A 4FIEA 5DHJA 5A3XA 2R7BA 5FP6A 3A99A 3IDBA 2W9FB 3ZS5A 5HESA 2DQ7X 4M84A 5HTCA 4M15A 5CU0A 4JBOA 5DOSA 2VTNA 3UO4A 2IPXA 4TYEA 2XBAA 3COMA 2GS7A 4YO6A 4I3ZA 2HXLA 4RG0A 3RALA 3TNIA 4PMPA 2Y4IB 4ITJA 4NIFB 1K3AA 1YW2A 2BIYA 4EH7A 4O7ZA 1W0XC 4U44A 4WNOA 2OF4A 3W2OA 1ZARA 4FT9A 2XF0A 2OK1A 4XBRA 3ZUTA 5CT0A 4LL0A 3B2WA 5JN2A 2A27A 4FL3A 4BCIA 4HZRA 1OZ1A 4QMTA 3JY9A 4GSBA 4TKSA 3LLAA 4O0VA 5HI2A 1ERKA 4YJOA 3SRVA 5CX9A 4ZS4A 1YWVA 4BICA 5ANKA 1Q8YA 1CKJA 2QLUA 1B6CB 3OWJA 3QYZA 5BQ0A 4AXAA 4EBWA 5IQIA 2PL0A 4W4XA 4JQ7A 3UNKA 3E8EA 1S9IA 5D1JA 3W10A 4YURA 3PY1A 4MX9A 5E91A 4BR3A 3EH9A 2C3IB 5AAEA 1UNGA 3FI8A 2Z2WA 3IQ7A 4U43A 3MPAA 4AW2A 5AUYA 4L00A 3RWQA 5CQWA 1H0VA 4RQKA 3I6UA 4FEXA 4ZMFA 4U41A 1XH9A 1V0BA 3HYHA 3OCTA 1H08A 3W32A 3HZTA 1U46A 1T46A 3BX5A 5BYYA 2WMSA 5GZ9A 2REIA 3BBWA 3OWKA 1JOWB 4IM3A 4FYOA 3BWFA 4D2TA 4O1OA 5H3QA 4NU1A 3D4QA 3UQFA 1ZYSA 4AT4A 4J98A 4DEHA 4A07A 2UZEA 4GVJA 5KZIA 3GCSA 4BYJA 3UDBA 4KIPA 4AGUA 5HX6A 4UXLA 5LMAA 2WMBA 4JIKA 3QD4A 2JC6A 4YJVA 2HZIA 2P2IA 2BROA 3HA8A 4JL9A 3QU0A 5AUWA 3DDQA 1JVPP 4I41A 5CEPA 4R7BA 4YMJA 2X6EA 1PXPA 3E64A 4I6QA 2OH4A 4F7LA 5IMEA 3QCXA 4UMUA 3FLQA 1RW8A 4ZTQA 3R1YA 1SZMA 5D12A 5E8UA 2XIXA 4FK6A 4IVBA 3WZUA 3CY2A 4DT9A 4U97A 4HCUA 2Y9QA 4FSWA 2BDFA 3S4QA 2OFUA 2GDOA 3R21A 3VIDA 3TM0A 4IADA 3EFKA 3ZM4A 2DS1A 4FTQA 4MVFA 1OKZA 2VV9A 2WQNA 4JBVA 2RL5A 3GP0A 4LRMA 3H30A 4U40A 2BRGA 3PA4A 4L46A 4UZHA 5EDQA 3UOLA 4BDKA 1IA8A 5KCVA 2UW4A 4G34A 4RC4A 3RTPA 3C9WA 5HG5A 3F82A 3DY7A 2IO6A 4G2FA 4D4SA 3DTWA 2R3OA 2A0CX 2X6DA 4DEGA 2PMNX 3ZZWA 1BL6A 3H10A 4PWNA 5EQYA 4UWCA 4GG5A 4RIYB 3LFAA 2W1GA 4YHTA 2GS2A 5ANOA 3MPTA 4IH8A 3W8LA 3II5A 3QL8A 2Z02A 4JBQA 3IW8A 2QLQA 4RFYA 4D58A 2R0IA 3THBA 2ITTA 3A61A 3V5LA 5CYIA 3TV4A 4OBQA 4MKCA 3ORIA 3AC2A 4WBOA 1DAWA 1Q3DA 1UU7A 4XOZA 4KIOA 3NSZA 4IAYA 3BLRA 4D1SA 3QZFA 2GNJA 4RIWB 1CTPE 3NW7A 4FKRA 4FSNA 2F9GA 5IA1A 5AUVA 4BCHA 4CCUA 4CFMA 3WF9A 4AUAA 4G16A 2A19B 2W1FA 1ZOGA 4L43A 3RAHA 4FSUA 3FKOA 3AT3A 5DBXA 1TKIA 2VTJA 3IKAA 4ITIA 5AR4A 2X7OA 2BTRA 4YJPA 4DG2E 4UMQA 4ANNA 4LOOA 4JG7A 4F7SA 3GCVA 4X7QA 4DINA 4D4VA 2OI4X 3E5AA 4FV0A 5CEQA 4EOMA 4FV2A 4K6ZA 4O0UA 4D2WA 4GU6A 5AP0A 2R3JA 2W06A 2G1TA 3QTSA 4BRXA 1OECA 4XV3A 1Y8GA 5HE2A 3HEGA 5BPYA 4FE2A 2XK7A 2YN8A 4BL1A 4NCTA 4FOCA 2KULA 5K5NA 2PYWA 4RQVA 5L8JA 2VWXA 4H1MA 3UTOA 5L4QA 4BTJA 2PULA 2IW8A 4EOKA 3U55A 4MK0A 5I3OA 4YBJA 1LR4A 4W8EA 2WZJA 4U8ZA 3D5VA 4I23A 4HVHA 3C0IA 4X6QC 4KBCA 4JRVA 4RC2A 3R9NA 4ZMEA 1UU8A 2GHGA 3DKCA 3M42A 5F94A 3MFRA 5DMZA 5IMXA 2PE0A 5IQGA 2BR1A 5M07A 4FEUA 5F4NA 3JR1A 3GI3A 5F20A 1U54A 1ZWSA 4QMSA 2XEYA 5A46A 4BKJA 4QRCA 1YDTE 3B2TA 2UZVA 3LJ1A 4LYNA 2W1CA 1R39A 2QG5A 2WAJA 4DF3A 3O8TA 1G3NA 1OPLA 1ZMWA 1WBSA 3FL4A 3ROCA 3HECA 4BDCA 2XNBA 2Q0NA 4Q2AA 2C5YA 3ZEWA 5T6KA 3ZBXA 4QTDA 1UWHA 2J7TA 3F3WA 5KMMA 4HGEA 5K9IA 1DM2A 5JT2A 4TYGA 5C4KA 3BELA 3TXOA 4ZSGA 3HV5A 3MH1A 3UZTA 4V01A 3GC7A 1SVGA 5C01A 2R3LA 1Z9XA 1JKSA 4Z7HA 3U54A 5CNNA 3R8ZA 4O82A 3KXGA 4JT3A 2XZSA 4EH2A 1APME 4JAIA 3MH2A 3EN6A 1J3HA 4CSVA 2BALA 5B2KA 2Y4IC 3BHVA 2AC3A 4XNEA 4DFNA 3E88A 3BBTB 3FLSA 4ACGA 5CEMA 1KV2A 5J9ZA 4FSYA 1YXUA 4ASEA 3R2YA 5EHYA 4EBVA 4C3FA 4XG8A 3ZRKA 3UBDA 2QOKA 4I0RA 4BDHA 2FSOX 4RLKA 2BAKA 1F3MC 3G2FA 5JH6A 3QTUA 4G1WA 4K18A 4NKAA 5LVOA 2WTVA 4RFZA 1TVOA 4J95A 2YJRA 3AC5A 4RRVA 1Q97A 3CTJA 5IA0A 4D0WA 4RVTA 4M0ZA 1JSUA 3KU2A 4EC9A 4AT5A 3OS3A 4C59A 2WKMA 4NM5A 4C3PA 1ZYLA 2FSTX 2W1IA 5EQEA 2IZRA 3IW6A 4H39A 4BIBA 4G3CA 4KKEA 3D15A 5AA9A 4I20A 4J1RA 4F08A 4BN1A 3FZTA 3ID6C 1XHAA 4FF8A 4FV3A 3ZXTA 4OUCA 5JZNA 4LGHA 3NWWA 2WTWA 3QZGA 4PPBA 3RPRA 3KCKA 4BCJA 5K0XA 2OGVA 3ZUVA 4EK5A 4EOOA 4L7FA 3BLHA 4UZDA 2YDJA 4RIXB 1LUFA 2XJ1A 2VGPA 3DK3A 5EFQA 3BU3A 4X21A 5FBNC 3E62A 1H00A 4LRJA 3VHKA 3RK9A 4AGWA 4MBLA 3R1NA 3R1SA 4F1MA 5A4QA 1OKVA 4AZTA 5CAPA 3COHA 3ET7A 2IVVA 4EKKA 4DCAA 3NUUA 2F2UA 3VUTA 2C68A 4GYGA 4XG6A 2RG6A 4XLVA 2BDJA 4IANA 2XUUA 3VUGA 2ERZE 5TT7A 2A2AA 3OXZA 1VR2A 4OTIA 4R6VA 4E20A 2X7FA 4MHAA 3GU5A 3NUXA 4JG6A 3U51A 3WARA 4A9TA 2I0EA 3L1SA 3QTWA 4MTAA 3UZPA 3DBFA 1OL6A 3S0OA 4BYIA 4TRLA 2ZM3A 1MRUA 4LMUA 4ANLA 4C33A 4FUXA 5H9BA 3ZUUA 3MA6A 5JGAA 2YIQA 4NKSA 4FKOA 2O64A 4AW5A 4PX6A 3CTHA 1FVVA 4U42A 3LJ0A 1OITA 2P0CA 4GK4A 5AIKA 4D5HA 4QMYA 3DFCB 2WQMA 3LFCA 4FNXA 4A4XA 3CD8A 3VS6A 4W4VA 4XJ0A 1KE8A 4L7SA 2PZYA 4LI5A 4FZDB 5D11A 3RBWA 3ZONA 3GB2A 4J8NA 4B9DA 2QONA 4BKZA 2YWPA 4AT3A 3QTIA 4K9YA 5G6VA 5HG9A 5KBQA 4YLLA 5J9LA 3FY2A 5HOAA 2VTIA 4TPTA 5L6PA 3D2IA 4YZBA 3RAWA 4NTSA 1Y6BA 4V05A 3RJCA 5AV3A 4KKGA 4ZIMA 3TTJA 2EWAA 1YDRE 3DBQA 3GFEA 3P9JA 4FTAA 4ZY6A 4AOJA 4AZSA 2JFMA 4DEBA 4YSJA 4HVSA 4WOVA 4LUEA 5AV0A 4B99A 4DGOA 4EC8A 3WF8A 5TE0A 1P5EA 3AOXA 3O8PA 4ZLZA 3R30A 5HVYA 4FT3A 4QT1A 3Q9ZA 1ZZLA 3DV3A 1X8BA 4YLKA 2JDTA 3G0EA 3DNEA 3ZLYA 2YAKA 3VN9A 3NLBA 3QQFA 1HOWA 3QF9A 4DLJA 3QQLA 2C3JA 3HRCA 1BMKA 3NCZA 2XNEA 3CLYA 4E3CA 4CNHA 1O6YA 3ZFYA 4A4OA 3ALOA 3EMGA 4IJ9A 3SOAA 3JPVA 4FTRA 4GS6A 3C0HA 4BBFA 5CEKA 1AGWA 1P4OA 4DFBA 3ENMA 4BDGA 2C6DA 3DJ7A 3OY3A 5I9UA 3FKLA 4GFMA 4QD6A 1PY5A 2BTSA 4FMQA 3CEKA 4YTCA 2GQRA 5D10A 5ANJA 1H4LA 3IOKA 3FQEA 4NJ3A 4CT2A 5HE0A 3NIEA 3EQBA 4TWNA 4O1PA 3QD0A 2XK9A 4TYHA 3VBVA 4Y95A 2BKZA 4LG4A 3FZSA 2JBOA 2WEVA 4TWPA 2W99B 4B4LA 4NSTA 2CDZA 3E8NA 3MI9A 4OT5A 1E9HA 1W8CA 3FMNA 3P23A 5BUEA 3FMJA 4G6OA 5CSWA 2V5QA 3DJ5A 5AJQA 4BZNA 2XEZA 3LJ2A 4MNFA 4E1ZA 5JFSA 3MW1A 2C5XA 2OJJA 1R0EA 1QPCA 3C4CA 1H0WA 4V04A 5CAQA 4ERWA 2JAVA 4O27B 3AC1A 3NVKI 2UZBA 2W0JA 3FDNA 4IVAA 4O0TA 5EHOA 2W17A 4ACHA 5ANIA 5CS6A 4YC6A 4APCA 4W9WA 3G5DA 3DOGA 2W5HA 3D7ZA 4AOIA 4G6LA 4IB1A 3E8CA 2WU7A 3LQ5A 5FBOA 5J8IA 3REPA 4ACDA 2XJ2A 4CQEA 4PDOA 4CGAA 2XNOA 4L44A 4RWLA 4JR3A 4MNEB 3NCGA 5D7VA 3NAYA 5FRIA 2FYSA 4TZRA 4DGNA 2R3RA 5TOZA 3ORZA 3FL5A 4D4RA 4HW7A 3S00A 3LMHA 4WNPA 5JFWA 5CNOA 4S2ZA 3PXYA 5CY3A 2I0VA 2OZAB 2QO2A 2QNJA 5IDPA 4FEWA 4E5AX 2VUWA 3V01A 3EKNA 5HORA 4IM0A 5IISA 5DA3A 5GNKA 2ZM1A 3ATSA 2VGOA 3D2KA 4GK2A 3WF6A 4ZSEA 4NWMA 4I6HA 3LXNA 5L2QA 4LGDA 4KIKB 2Z60A 3F2AA 3P5KA 3A7IA 4Z16A 2VNYA 3NUYA 4E93A 4JDJA 3FMHA 4QMNA 4DH8A 3EN9A 2ESMA 1J7IA 3KMMA 2ZM4A 3ORTA 2XYUA 4QMXA 3DKGA 2C6KA 2XCHA 3BHTA 3CKWA 4H3QA 4O96A 3SHEA 1J1BA 3CQUA 4TT7A 1MRVA 2Z7RA 4NFNA 5CI7A 5LWMA 4RWJA 2O8YA 3R9HA 3QRJA 4EK8A 2ZMDA 2YCRA 4BVUA 3CTQA 4E4XA 3W2SA 5EQPA 4QMUA 3BHYA 5I9ZA 4NCTC 3SKCA 5GZ8A 3LFFA 1DI8A 2CKPA 4FIHA 2RFNA 4PRJA 4O7WA 4F99A 5M08A 3MJ1A 4JI9A 4II5A 4HPTE 1IG1A 3DNDA 3KGAA 2AYPA 2ZV8A 3FI2A 2CGWA 1G5SA 4Q5EA 1WMKA 3H3CA 2W4JA 3LAUA 3W2PA 5IH5A 2V22A 4MNEA 2UZNA 4NZWB 3FYKX 4IXPA 4IVCA 4D2VA 5JZJA 2F7XE 3OROA 2WMVA 3KXXA 2XNNA 5DT3A 2FA2A 3WIGA 3AD4A 3OVVA 3FXXA 2IN6A 3MESA 2PMLX 1PXLA 3A7GA 3AMAA 1WBTA 4FZ7A 3DB6A 5IA2A 4BCQA 5KO1A 3N4VA 2PZIA 3TZ7A 4EZ5A 5IA5A 2XIKA 3KXZA 1HCKA 1U5QA 5C1QB 4YHJA 3SV0A 3TV7A 3ZEPA 1RJBA 4C4HA 3OF0A 4F0FA 3VS3A 5M56A 4E4NA 4QTAA 4AFJA 3VJNA 4YJRA 2PVMA 5BVEA 2Z7LA 3LHJA 2LAVA 4F70A 4IC8A 4C2VA 2QU5A 2V7OA 3KXHA 3NYXA 5IKWA 4CCBA 4WRGA 2BDWA 2GTNA 3Q96A 4ERKA 1OBDA 2CNQA 3R22A 1U59A 2OBJA 3AT4A 3EN4A 4KRDA 5ACBC 2YZLA 3TN8A 2CLQA 4ENYA 4JLCA 2WELA 1KE6A 2B9IA 4YR8A 5HKMA 4QYFA 1M7NA 2W05A 5M4CA 5FGKA 4QNAA 3R7EA 5HU3A 4F9BA 3WIKA 2JITA 3U4WA 2F49A 4AZWA 4UN0C 2PHKA 3DQWA 3NUSA 3IGGA 5C8NA 3BYSA 4KUJA 4J71A 3FC2A 2VWBA 4GCJA 2EB2A 2J90A 3PUPA 2VTHA 4GIHA 4E73A 5IDNA 4AGCA 5HNGA 3DZOA 3EQIA 4G5JA 5E1EA 3L9LA 2X4FA 2NP8A 5GIPE 3CJGA 5L8KA 4FV4A 4KS8A 1WBVA 3ORPA 4X3FA 4D2RA 2JDRA 4PDSA 1WCCA 4MH7A 2W96B 1F5QA 3D5UA 4DA5A 2DUVA 2JDOA 3CD3A 4WNMA 3EQCA 1B38A 3SOCA 4FTCA 3UIBA 2E9OA 1B39A 2EXMA 3DBCA 4HYHA 2JDSA 4XCUA 2O5KA 4QQ5A 2QG7A 2VNWA 5JQ5A 4G6NA 2H8HA 2R5TA 4ID7A 3K3IA 4OW8A 1OB3A 1Q4LA 5DEWA 4DBNA 5ICPA 4WG5A 4RWKA 4FG8A 4IAIA 5FUTA 5DI1A 1O6KA 3QX2A 3NRMA 3FE3A 5BNJA 4XBUA 5HD7A 4XV9A 2YHVA 2VTRA 4ZZMA 3MJ2A 5I9XA 1Q8TA 3PP1A 4PV0A 3IW7A 3RKBA 2XMYA 3BLQA 2GNLA 2VWUA 3KREA 3SG9A 3PG3A 4FVRA 4HNFA 4IFGA 4NIFA 1H28A 4WBBB 4CRSA 1XBCA 3OEZA 4AZVA 1STCE 2OLCA 4QO9A 3UZRA 4UMRA 3V04A 4M3QA 4MQ2A 5AR5A 5K3YA 2JD5A 3KQ7A 5DH3A 1VJYA 4QMQA 5FXRA 3HAVA 3CS9A 2YISA 4DEEA 2YLEA 4E26A 5AADA 1OL5A 1BX6A 4R1VA 4X2GA 5H8GA 3QXPA 4ANSA 5BVKA 3U6HA 4O2PA 4FI1A 4KA3A 2ITOA 3C4EA 3DTCA 3S95A 2XRWA 2UVYA 4J97A 3PVUA 4O7YA 2JIIA 5I9VA 5J1VA 4HGSA 5A54A 2C1AA 5AWMA 4M97A 4UY9A 5J5TA 1E1VA 3QWKA 4RX9A 4Z9LA 3H9FA 3PRFA 3SA0A 3QHWA 2PE2A 1IEPA 3WF7A 3HNGA 3QZIA 3FLYA 3ODYX 4QMVA 3U9CA 1Z5MA 4O0WA 3ORLA 4AW0A 3C1XA 5HIDA 4DCEA 3BYVA 3TKUA 4R3PA 4NH1A 2BAJA 4FOBA 3PXZA 1ZXEA 2Z7QA 4S30A 5GJDA 3UOKA 3UYSA 2ZV9A 5ANGA 3BYUA 1I09A 2X2LA 1W98A 5IUHA 3QTZA 3NNXA 1GIIA 3BIZA 4USDA 2ONLA 4K33A 3GFWA 3JUHA 5C9CA 1ZY4A 3A8XA 4EHZA 4D5KA 3OMVA 3VUHA 3VRYA 5DRDA 2WMRA 3ANQA 3TUCA 4EQMA 2B55A 5LMKC 4FIGA 1YOLA 5AIRA 5FWKK 3HV3A 4EONA 4GFOA 3LOKA 3PLAE 4FTTA 5E90A 3PPKA 1GOLA 2J2IB 5TO8A 1PRYA 2R3GA 5FTOA 3MN3A 4LV5A 1OUKA 2UW9A 4FSMA 3TKIA 3SW4A 4PL3A 3KK9A 5CLPA 4CTCA 3LQ3A 3TACA 4PTCA 2ITUA 3QHRA 2YIWA 3KK8A 4S34A 5LVLA 4PMMA 4Q9ZA 4C4FA 4RVLA 1XH8A 1M2QA 4IWDA 3FMEA 3AC3A 5CVFA 3QD3A 1H1RA 1FVTA 2PE1A 3VUIA 2WMQA 3O96A 1WZYA 3ZLXA 1XKKA 4IBMA 2WNTA 3OBJA 2J0KA 4UXQA 4WO5A 3KVWA 4ZJVA 4G3GA 3QCQA 4YJQA 2OH0E 4DGLC 3UP2A 5HCYA 4DLIA 2VX3A 3RAIA 4IM2A 3PZEA 3C4ZA 4PPCA 1UKIA 1RQQA 1XH6A 3TNWA 4IB5A 3BZ3A 4QP4A 4CFVA 3TCPA 2V0DA 3BQCA 5AR7A 3R7YA 3OCGA 3V5QA 4RWIA 3QWJA 1FINA 3POOA 2GNHA 4GU9A 2WTIA 3NYOA 4NK9A 2J0MB 5EK7A 3F2NA 4FTMA 5JKGA 3C4XA 4BGGA 4M69A 5I5ZA 3QRIA 2CSNA 4H1JA 3PA3A 3TZMA 1SNUA 1GJOA 2WO6A 3MV5A 3WYYA 3U6JA 3PJ8A 2OJGA 5CU4A 4IW0A 2FO0A 5BX0A 2FSMX 1WVXA 4FVQA 5EDRA 4CT1A 3E93A 4TNBA 4BB4A 1Y8YA 3VS5A 5HD4A 4QMMA 3MGYA 3O2MA 5GZAA 1KWPA 4FTOA 3F3UA 5FEDA 4JQ8A 1ZRZA 2WEIA 3OTVA 4DT8A 1XQZA 4NW6A 3TTIA 5AP4A 3HV4A 3D0EA 2YCFA 3LMGA 4IB0A 2B0QA 3UGCA 4IC7A 5JFVA 3C4WA 2Y6OA 5DN3A 1PF8A 3ZLSA 3P08A 4JAJA 2ACXA 4IZ5A 5KMOA 3P7BA 3EQFA 2W1DA 2HZ0A 3LXPA 2W5BA 2BRBA 3S1HA 2PUIA 3WI6A 1PW2A 5L8LA 2GQGA 4XHKB 2XKDA 4P5ZA 4BC6A 4L68A 3BRBA 5ANDA 3W33A 4CMUA 3O7LB 1YXVA 3RAKA 4P4CA 4DITA 1ATPE 4C34A 4O0XA 4AG8A 4PL5A 2IWIA 3T3VA 2WMTA 2OJFE 4N4SA 3NIZA 3W16A 4FV6A 3Q6UA 4O6EA 3T9TA 5IQEA 3QKKA 2Y7JA 3E8DA 3W2RA 3RPOA 4CFFA 4F7JA 3SXFA 5E7RA 4HYIA 2IVTA 2WQBA 3ITZA 4IAKA 5GHVA 1JQHA 5KMJA 3CP9A 4WUNA 4HNIA 1UA2A 4OAUC 3B8QA 5I0BA 2R9SA 1YHSA 3MY1A 3LMIA 4QMOA 4DE4A 3PTGA 3O0GA 1JSTA 5KKRB 2QI8A 4KABA 1UU9A 3VWAA 3R63A 3R7IA 3CJFA 2IZUA 2PZPA 4ANBA 3M11A 4F63A 4MXYA 2ETKA 5CWZA 1NVQA 1M52A 4BCGA 3RMFA 3OCSA 3F9NA 5BMMA 4K0YA 4EOQA 4H58A 4FL2A 3GOPA 2GHLA 1DAYA 3DAJA 1RE8A 4EH9A 1SNXA 2WHBA 3VJOA 3CR0A 4RVMA 3WZJA 3VHEA 2ZV2A 3EFJA 4NW5A 4CKIA 3UIXA 1IA9A 2R3KA 2RKUA 5FXQA 3FLZA 4W8DA 4PNKA 2BAQA 1OPJA 3Q5IA 4RC3A 1H1WA 2VWYA 3OCBA 3F3ZA 5EI8A 5FP5A 4AZFA 4EUTA 3GCUA 4O83A 2HWPA 4CFNA 2B7AA 4F65A 3VRZA 4AE9A 4FGRA 3ZSHA 4EL9A 3K54A 4R5YA 1M14A 1FVRA 2AUHA 3I5ZA 2ITYA 1H1PA 4KBKA 3T9IA 3PWDA 2NO3A 3H0ZA 3R0TA 2NRUA 5E1SA 4IMYA 4EKLA 5JFXA 4GUEA 4BZDA 2C4GA 3CBLA 3DGKA 3KKVA 3KMWA 4JIAA 4YPSA 3PG1A 4FKPA 1LEWA 4JXFA 3F5GA 2YACA 4N70A 4EJ7A 4P7EA 3QFVA 1EH4A 1JLUE 4QP6A 3ZCLA 5CAUA 4PMSA 3ORKA 4YHFA 4C0TA 5J7HA 2R7IA 4TL0A 4BF2A 4ANMA 3QQJA 4IX5A 3GOKA 1PMEA 3UOJA 3OTUA 4O21A 5FM3A 4MAOA 5HEZA 3TNQB 1PXNA 5GJFA 4AACA 2VX1A 3N9XA 1OL7A 1YXSA 4GJ3A 4UEUA 4JDIA 4UV0A 5CZHA 3L9PA 3HMPA 2OJ9A 4XRJA 4YNEA 4AN2A 4Y5HA 2YM5A 3OBGA 2ITPA 4RA4A 4ZJIA 4AA4A 1LPUA 3F61A 4ZOGA 1JSVA 4BGHA 3PY3A 3KY2A 4O0SA 4WT6A 5HG7A 1GNGA 3AD6A 3MH3A 5JRQA 4QTEA 4XG4A 5HTIA 3UG1A 3RM6A 3O23A 2CCHA 5BYZA 3CSVA 4FIJA 3ACKA 5JSMA 3VUKA 4RIOA 4BHZA 3GQLA 5LVNA 1R1WA 5M55A 2HELA 3R1QA 4PMTA 4F9YA 2CGVA 3PJ3A 2C6TA 3OUNB 3Q9WA 3EN7A 3E7VA 3PIZA 2QOHA 2WOTA 1JNKA 2W4OA 5LCKA 3S2PA 3U4UA 5BUIA 4ORKA 4RA5A 3BKBA 2UZDA 2XJ0A 2QOQA 2YABA 4Y46A
chains in the Genus database with same CATH superfamily
5D9HA 3RHXA 3MVLA 4DTKA 4L3JA 3AC4A 3RGFA 3AKKA 3PXFA 2BILB 2QD9A 4IE9A 5TF9A 4IAZA 2JIUA 3PPZA 3L8XA 4F09A 3POZA 1P4FA 3AXWA 4RJ8A 4FZFB 5HE3A 2X0PA 1YOJA 1SYKA 4EEVA 5E4HA 3D7TB 4CFUA 4QP2A 3BEGA 5A14A 1PYEA 3VS7A 4MEDA 5IQBA 4PUZA 4MXXA 1PXKA 1H27A 2ZOQA 1NVSA 3KCFA 4L53A 4YLJA 4Z55A 3BU5A 4L3LA 3CCNA 4NT4A 1AQ1A 5DYJA 2VZ6A 4XS2A 5J1WA 4ZTMA 3HAMA 3LIJA 3NZ0A 3R8MA 2AC5A 2X39A 4MYGA 4I5MA 1YI4A 5KMIA 3OXTA 5L6WL 1U5RA 3Q4CA 3EFWA 5DWRA 3QTQA 4BCFA 4BDEA 1ZZ2A 4OTDA 4N0SA 2JGZA 3PJCA 3VO3A 2IZSA 3NUAA 3R7UA 4XP3A 2WTKB 3D14A 3IGOA 5FQDC 3EB0A 5LJJA 3GCPA 3F6XA 5DLSA 5LMKA 4KINA 1YI3A 2VWIA 4BDJA 3UIMA 3OWPA 2BZIB 1JKTA 1M7QA 3G9NA 4FZAB 1G8SA 2OFVA 3FHRA 3QKLA 4GT4A 4BDAA 5IH6A 5J79A 4ENXA 5EM7A 4UALA 4A9SA 4J99A 3ZSIA 5E8ZA 2ZB0A 1NXKA 1OUYA 3MTLA 1GZOA 2IJMA 3BYMA 2PK9A 5F95A 1XO2B 4WHZA 2YA9A 2RFDA 3Q53A 4IACA 4Y83A 4DHIB 3MPMA 4EHVA 4CKJA 2R3NA 3VQUA 2BRHA 1OKYA 2X1NA 4O7VA 4FG7A 4S32A 3QRTA 4AW1A 3QC4A 1G8JA 4DFLA 1TQIA 5BVFA 3IS5A 3ZH8A 3ANRA 5CSVA 3WOWA 2GHMA 5AEPA 3C5UA 4WUAA 4FNZA 1QPJA 3FI3A 3HRFA 3F2RA 4BCOA 4AN3A 1GIJA 3PXKA 3OHTA 4KKHA 2BHHA 4MXOA 2QO7A 4XP0A 2ERKA 4ACCA 5C8KA 2OKRA 3HA6A 1ZMUA 1REKA 2JKKA 4YTHA 1OGUA 2QR8A 3NFFB 4GVAA 2VTOA 2ZB1A 2C47A 3MTFA 4IIRA 1QPDA 4Y8DA 3R8PA 4E5BA 2UW6A 3DBEA 4R3CA 3O51A 3PZHA 3IECA 4MXZA 5DEYA 2DWBA 5DE2A 4CYJA 5HZNA 1ZOHA 3H4JA 3NYNA 2QR7A 5BVNA 5LVPA 4CG8A 4GFGA 4MBIA 4F64A 2VTSA 3BGQA 3WE8A 2GMXA 2ZMCA 4QPAA 4ANQA 2OG8A 4YGAA 4O7NA 4GKHA 4EHGA 4IX6A 4DBXA 3TIZA 3FMKA 4KD1A 3ZO3A 3ZLWA 3OY1A 4NM0A 2XK8A 4BBEA 4IX3A 5EG3A 3ZFXA 4CLJA 2QOFA 3LCOA 4RGJA 2I0HA 5EKNA 3LFBA 3QCSA 4QMZA 4NM7A 4GL9A 3H0YA 3C7QA 4USEA 4D28A 3HX4A 3ORNA 4C7TA 4H3PA 4CEGA 4W4YA 3M1SA 4D55A 2WGJA 3WZKA 3A60A 2OIDA 4U81A 4ZSLA 5CSHA 4YTFA 2RG5A 4LL5A 3C0GA 3FJQE 3EN5A 3GC9A 2F7EE 3ZSGA 3FMMA 3OXIA 5L2WA 5GJGA 2YEXA 3VW8A 2A1AB 2RF9A 1WBWA 4ZTLA 4A4LA 4I94A 2QOCA 3H9RA 4FKWA 4U79A 3UYTA 3DCVA 1U4DA 1FBNA 3V51A 5AP3A 4EWHA 3SX9A 4C35A 3IG7A 2W1EA 5AAFA 3BLAA 4R8QA 1LP4A 2VO3A 3ZM9A 4M13A 3C50A 4OAVB 3F88A 2F2CB 2ZAZA 2ITZA 4UMTA 5CVGA 5DFPA 5IA3A 4M69B 4XX9A 5B7VA 3PXQA 4C36A 1OIYA 5HBEA 4MXAA 3V6RA 3MB7A 3FZ1A 3EJ1A 4FR4A 4E6AA 2UZLA 2JAMA 5AR8A 3R9RA 4HYUA 3E63A 4W4WA 4FX3A 3TT0A 3LQ8A 2GNIA 4TYIA 4BTMA 2J6MA 1FGKA 2JKQA 4LOPA 4FNWA 4X3FC 4YZDA 5IA4A 3OOGA 2QU6A 4LUDA 4K11A 4HYSA 5AM7A 2GPHA 2XANA 5LWNA 2B53A 5HU9A 5DNRA 4ZTNA 5K5XA 3AMBA 4F1OA 3OW3A 5AX3A 4I1ZA 2EVAA 3ROYA 3O8UA 5IEYA 2P4IA 2YAAA 5CU3A 3K5UA 4CMTA 3RCJA 2X8IA 1Q8ZA 3GEQA 3N4TA 2VTMA 4FKTA 3R8VA 3ALNA 4HPUE 4I4FA 2UW5A 4O0YA 2CLXA 4WSYA 4GYIA 2IW6A 4XG2A 4EH5A 5A6OA 2XKCA 3QQKA 3RK5A 1YQJA 3RPVA 3JYAA 1W7HA 3ZO1A 3R83A 1XH7A 3K3JA 2VO7A 1GZKA 3IPHA 4G31A 1KSWA 4ZTRA 3KC3A 4FL1A 2PUPA 3HMNA 2BMCA 4UBAA 3IW5A 4P2KA 5IEVA 3PVGA 2YFXA 4F9CA 4M0YA 3V8WA 5AP6A 5E8VA 2X9FA 1XH5A 3KVXA 4FKSA 4CVAA 4CG9A 2I1MA 1JPAA 3ZTXA 3Q60A 2PMOX 5IUGA 5HCXA 2RGPA 4LQMA 3HP5A 4X2JA 4TY1A 4A06A 2VTLA 1PJKA 1VZOA 4JVGA 4O0RA 2VN9A 3A8WA 1F0QA 4LFIA 4Y5QA 1TZDA 3N4UA 4RSSA 5DPVA 5AV2A 2PVKA 3DKFA 3UO5A 3OZ6A 5AV4A 3HVCA 4EYMA 5A9UA 4NYEA 3R73A 2WTJA 4MD7E 3QQUA 3M2WA 4AF3A 2J5EA 3IONA 4DDIA 1O9UA 2BCJA 2C0IA 2E9NA 3L8SA 4X2NA 5EKOA 3D83A 3Q3BA 3TJDA 1WBOA 1NA7A 3TJCA 3QGWA 4XLIA 4ASXA 3P7AA 3UPXA 3NR9A 3Q5ZA 4ZLYA 4U3ZA 3EYHA 4WKQA 3F5UA 5ETCA 4EK4A 2QVSE 3TNPC 3DT1A 4L01A 3TG1A 2XS0A 3SXSA 4TN6A 5E8XA 1WBPA 3Q4UA 2X2KA 4EK6A 4WSQA 1GIHA 3DS6A 1UNHA 3G9LX 1BL7A 2Q0BA 3FBVA 3KF7A 3RK7A 5AAGA 3HKOA 4O4DA 1BYGA 3TL8A 5BMSA 3O50A 1ST0A 3LXKA 1SVEA 3U6IA 2B9HA 3GGFA 4C8BA 5LQFA 1ZYDA 4FODA 4XG3A 5DRBA 4OGRA 5EM8A 2DYLA 3F69A 2XKFA 4C62A 4QDVA 2BPMA 3EZVA 4FSRA 4MF0A 4QPSA 4Y72A 3UQCA 1Y57A 2GQSA 2YM8A 4ZJJA 2WFYA 5CU6A 3QCYA 2Y0AA 3HGKA 4R7IA 3L9MA 2J5FA 3FXWA 2OXXA 2JKOA 5FD2A 3NNVA 2HCKA 3DJ6A 3OW4A 2X8EA 3KRWA 4FT7A 3LCTA 4F6WA 3F3VA 5CZIA 3SVVA 1QPEA 3E3PA 3GQIA 4B7TA 3EQPA 4BKYA 2C5OA 2IG7A 5FTGA 3HV6A 5KE0A 2XALA 2R4BA 2XYNA 5J95A 4AP7A 4WRSA 4ZEGA 3TZ8A 3CPCA 4BCMA 2J50A 3MY5A 5LMBA 3QBNA 4DH7A 5EM6A 4R3RA 1UVRA 4WIHA 3DBDA 4OBOA 5CANA 3GU7A 1WAKA 4TW9A 1OIRA 3D5WA 3DLSA 2EU9A 2YM4A 2ITQA 5BVDA 2QHMA 3VUMA 1M2RA 5M53A 3AGMA 3HRBA 3TDWA 3UDSA 4O4BB 4XV1A 2YIXA 4BI2A 3UODA 3EFLA 4IAFA 4R1YA 2H34A 3FPMA 3KRRA 3SQQA 5CALA 2VO0A 3Q04A 4BWKA 1KE7A 2O0UA 4NFMA 4U6RA 2R3FA 4CYIA 5K4IA 3DFAA 4OBPA 3UMWA 5LXMA 5J87A 3ORXA 3MY0A 3ZFMA 2RSVA 2PUUA 3VBQA 4RT7A 5JGDA 4AOTA 3LZBA 3P1AA 2VTQA 4PDPA 3ZHPC 2E9VA 3R9OA 3RNIA 2EUFB 4CLIA 1OIQA 4EQCA 3PYYA 4H36A 1YKRA 2C69A 3QLGA 2GCDA 1H26A 4FKLA 4OTRA 4WG3A 3KA0A 3ZOSA 5A4CA 3MS9A 4R5SA 1YXTA 2XKEA 5JQ8A 4KIQA 4YJSA 3R8UA 2HW7A 4OLIA 3IDCA 3QXOA 1MUOA 3CKXA 3AGLA 5H8EA 3RWPA 4O86A 4J7BA 2UZTA 4X0MA 5AUXA 5FM2A 4EH8A 5I3RA 3COKA 4PP9A 4DG0E 4YJUA 5M51A 5HGIA 4UX9A 5CAVA 4AAAA 4IJPA 4EOJA 3DZQA 2OIBA 1W82A 2XIZA 4QP7A 1QCFA 5HIEA 4RJ4A 5M57A 2UV2A 4KS7A 3T8OA 2HYYA 4Y73A 2V7AA 1H24A 3PWYA 2KTYA 4QP1A 2B1PA 2RFSA 4TYJA 3EQDA 4XMOA 5CF8A 3W1FA 4O7SA 3EIDA 5IPJA 3SW7A 3E92A 2XIRA 4IZ7A 1YHWA 3R6XA 3LCSA 2G01A 2X4ZA 3JY0A 5LOHA 2X8DA 3CC6A 4HVIA 4HJOA 1MP8A 2CCIA 2WB8A 2XM9A 2R3IA 4YJTA 2BRNA 4QTCA 2WQOA 2E2BA 4XH6A 5C8MA 3VONA 4EHEA 4RIYA 3JXWA 1V0PA 1WVYA 3R04A 1R3CA 2PVYA 4IWPA 2YLFA 3MSSA 4MWIA 3NPCA 3P4KA 5JGBA 4QQCA 4AA0A 5B2LA 2WTKC 5M4UA 3OFMA 3KN5A 3RZBA 4KWPA 5AR3A 3LFEA 4AX8A 4ZTSA 3PFYA 4O22A 4OR5A 3WYXA 4E6CA 1ND4A 3HDNA 3ZBFA 3QQGA 4WG4A 2E9UA 4RZWA 5IG1A 3AMYA 1XBBA 5L2IA 2WOUA 2CGUA 3FMLA 5CENA 3S3IA 5L2SA 4M14A 2Y4PA 4FEVA 2YZAA 1PMNA 2ITVA 4BI1A 3QX4A 1CKPA 1V1KA 4H3BA 4RBLA 3BHUA 1YOMA 2F4JA 2G15A 1Q61A 1PXOA 3GT8A 4FRFA 4J96A 3CIKA 4M66A 5CT7A 4GK3A 4IEBA 5EDPA 2HZNA 4FKJA 1IAJA 1FMOE 1MQBA 2XIYA 1VEBA 3BWJA 4TXCA 1Q3WA 2WIPA 5L2TA 3A2CA 1KE5A 5T68A 5EOLA 5HE1A 3OG7A 3EQRA 3V5JA 3AKLA 1YWNA 4FIIA 5EW3A 4E4MA 5JMSA 4FUYA 3PVWA 3FUPA 4EYJA 2HOGA 2J9MA 3GBZA 3RPYA 3QQHA 3QC9A 5DGZA 5DR9A 3MIAA 2YERA 3VS1A 4CQGA 3GENA 3HDMA 1S9JA 2F7ZE 2J4ZA 3KRJA 4GJ2A 4QOXA 4U0IA 3QTRA 2WD1A 3RPSA 4ASDA 1ZYJA 2C6LA 4BY9E 2ONLC 3C4FA 4F0GA 3PPJA 3UNZA 5CEOA 5CSPA 2OW3A 2JEDA 3VW6A 4EZ7A 4JOAA 5D7AA 3ELJA 3UVQA 1FQ1B 2UZWE 3LM0A 4PQNA 1W83A 2ZDUA 2C1BA 1DI9A 3I0OA 4MCVA 5DVRA 5EW8A 3UQGA 3WE4A 4O7LA 1YRPA 2IVSA 4EH4A 3KL8A 4GW8A 3R8LA 3W0MA 3TNHA 2XAMA 4QP3A 4H05A 2I6LA 3IDPA 3QUDA 4HCVA 3CPBA 3PSDA 1K2PA 2ETMA 2GTMA 2X9EA 3AC8A 4FSZA 5IQHA 1URWA 3D94A 4FVPA 3TKHA 5ETFA 2OJIA 5DT4A 4ALWA 4F1TA 3CGOA 1L3RE 5C4LA 3LVPA 3EOCA 4ZSJA 5BUJA 3TDVA 3FYJX 1JBPE 1KV1A 4IDTA 4QQJA 3G15A 3HMIA 4FBXA 3PJ1A 4PDYA 3UVRA 3DDPA 2WMUA 4F6SA 3PRIA 3QRUA 3U87A 4O7RA 5CEIA 1JAMA 2GSFA 2BIKB 2VTTA 3DU8A 3COIA 3JVSA 4D1ZA 1Q41A 2ITXA 4KRCA 3IW4A 3DA6A 3Q9XA 2OIQA 4I21A 4FTNA 5AM6A 1OI9A 4FKVA 1PKGA 3G0FA 2YIYA 1OKWA 4FT5A 5ETAA 4G17A 3FZOA 4XEYA 3OP5A 3FKNA 3I6WA 5E8TA 4J52A 2X7GA 2W9ZB 3ML1A 3CGFA 4G9RA 4Q9SA 5KHWA 1J91A 1R78A 2PMIA 1PHKA 2EXCX 1SM2A 3ZO4A 1IRKA 3LM5A 1V0OA 5A4EA 2JKMA 5EW9A 5HVJA 1HCLA 3CQWA 4PY1A 4CMOA 4ZS0A 5IQCA 1CMKE 3ZRMA 4BCNA 3MIYA 3PVBA 5LVMA 4GRBA 4MBJA 3RM7A 4QTBA 2ITNA 5FTQA 2IW9A 2X81A 3VVHA 4DG3E 3MA3A 5IZFA 3P79A 3U8WA 2VTPA 1TQPA 2R3QA 3BL7A 2C30A 1Q99A 4YSMA 4DFZE 4OTQA 3IK3A 3WZEA 4AU8A 3SGCA 4X3FB 5A4TA 2NNWB 3QUEA 2C5VA 2HENA 5EM5A 4DFUA 5M4FA 4KNBA 5HHWA 3UOHA 4USFA 3G51A 4DHZA 3BI6A 4OT6A 4DH1A 2QOBA 1J7LA 1PXMA 2R3MA 3W0QA 4EK3A 4U7ZA 1VLRA 3V8TA 3GNIB 4LRKA 3OD6X 2RIOA 2B52A 4FG9A 2WMWA 2OXDA 3W0SA 3FPQA 2ZFYA 4CFXA 4HGTA 4AA5A 3UVPA 4L9IA 3ODZX 3SD0A 5HVKA 3WZDA 1ZMVA 4DTBA 1Y6AA 2VWWA 4CZTA 2HW6A 3BGPA 5IU2A 4GUBA 4HVGA 3O71A 4N57A 4CV8A 2YIRA 3ETAA 2UZUE 2JBPA 4S33A 2OSCA 1O6LA 3UDTA 5CI6A 5IUIA 4PF4A 4MXCA 1E1XA 1IASA 2ZYBA 3L8PA 3ZXZA 1JWHA 4CV9A 4EH6A 4FC0A 3I0QA 2IZTA 2Q83A 4U9AA 5ANEA 5AR2A 4K1BA 3VS2A 4X6RA 3Q52A 1OBGA 2R3HA 4A7CA 4DEDA 3AD5A 3FHIA 2O2UA 3WF5A 2FB8A 3LFQA 4C61A 4DC2A 4F4PA 3UE4A 3FAAA 4RJ7A 4MF1A 1PYXA 4Y85A 5EYDA 1XMLA 4D2PA 4D4YA 4EJNA 4K77A 4QEBA 4CXAA 4DHFA 1PKDA 2UW3A 4MWHA 4QYYA 3I4BA 3KXMA 3PIYA 1YDSE 3D9VA 2R3PA 3Q2MA 4ZSAA 2CGXA 2VO6A 3HLLA 4XOYA 3R01A 4JBPA 3PY0A 4EOIA 4FK3A 4D1XA 2BFYA 3OUKA 4KIKA 1P2AA 4FKIA 2XB7A 4FYNA 4O91A 4D9UA 2A98A 4IZYA 4WD5A 3V5WA 4M7IA 4C4JA 5CAOA 2C0TA 3UC3A 2XCKA 3GU8A 4OTHA 4TWCA 5AP1A 4GIIA 4PP7A 5KUPA 1LEZA 1XWSA 2VWVA 4A9UA 4ZAUA 2XH5A 5I4NA 4FICA 2O63A 1OPKA 2CKOA 3QA0A 4BIDA 4M8TA 2VAGA 4R7HA 4I6FA 3QYWA 3V6SA 4L52A 3DQXA 5K4JA 3V8SA 1OIUA 1YXXA 4M68A 4EORA 3SXRA 4ALUA 5CU2A 4X3JA 3A7JA 4CFWA 3KULB 1BI8A 4NM3A 3FSFA 3RHKA 4EOPA 1U54B 4ZLOA 1H1QA 4UYAA 4BIEA 3DXQA 2YM6A 2X0GA 5AP2A 3DXPA 4JRNA 3UC4A 3ZU7A 4IQ6A 2FGIA 2PVNA 5CQUA 5DT0A 2ZJWA 3CE3A 1QMZA 3E3BX 3N51A 2Z8CA 1BI7A 5AV1A 5KMKA 3P5JC 3R28A 3VNTA 5HLNA 2UVZA 3GC0A 4YZNA 3DPKA 3NNWA 1CDKA 2H9VA 5IH4A 2WQEA 3F7ZA 4EOSA 2YM7A 4JX3A 3Q2JA 2X0OA 5JRSA 4RX8A 4IHPA 4C3RA 3ACJA 3LFSA 5C03A 5HCZA 2P55A 4D2SA 4DGGA 1M17A 2ZV7A 4CKRA 3PXRA 3UP7A 3LE6A 4GT3A 5HLPA 4E4LA 4KSQA 4CRLA 3W55A 2NRYA 5HTBA 4NJDA 1WVWA 4FV9A 5J5SA 2B9JA 5AP7A 3NUNA 3PSCA 1XR1A 3BEAA 3E87A 5EI6A 5C27A 3WBLA 2FVDA 4FTKA 5IQAA 3NS9A 3BHHA 3FQSA 3ZMMA 4M67A 3FLNC 4BFMA 2BFXA 2E9PA 4LOQA 2IVUA 3I81A 1VYWA 4I22A 4RZVA 5CASA 5IEXA 2CMWA 4RIWA 4DDGA 2CNUA 2PSQA 4LGGA 2G9XA 3QKMA 4I5CA 4RJ5A 4X2FA 1Q8UA 1XJDA 2OICA 3Q4TA 1GAGA 4LV8A 3T3UA 4Z7GA 3MFUA 4ACMA 3UIUA 4S31A 3K2LA 4EOLA 5HNIX 4QYHA 5K0KA 1T45A 5HLWA 5J9YA 2ITWA 3BPRA 3G6HA 3HP2A 1UNLA 3QLFA 3GU6A 4IFCA 4ZY5A 3DAEA 4HCTA 3VULA 3DKOA 4O6LA 3R7GA 2FH9A 4ZZNA 3RCDA 3TZ9A 1REJA 2J0LA 5EYMA 1PMVA 5J7BA 3QTXA 4BHNA 2WTDA 4CZYB 3AQVA 5M4IA 5TR6A 2X0QA 3RI1A 3W2CA 3TWJA 4QQTA 4I5HA 4UYNA 3R2BA 4ZTHA 4F6UA 4F9WA 3HUBA 3O7LD 3A62A 1CM8A 4BZOA 2PZRA 3SC1A 3FY0A 1NY3A 4PL4A 1Q62A 4GEOA 3F5XA 5ETIA 3CQEA 5IF1A 2HIWA 2F57A 4QMLA 2ZVAA 2W7XA 5BYLA 3CXWA 1PXIA 4I6BA 3VQHA 5GIOE 1YWRA 4I93A 3Q32A 1CSNA 2JIVA 3HV7A 4OTGA 3EQHA 4RFMA 3RZFA 5DR2A 2XK6A 3F3TA 4D9TA 2W1ZA 4C02A 2PVJA 3GU4A 4DFXE 3QD2B 1WBNA 4G3EA 4DEAA 2QCSA 4EI4A 4B8LA 2QODA 1A06A 4MQ1A 2PUNA 2XNPA 2VRXA 4AS0A 3QRKA 1CKIA 3BE9A 5KKRC 3MDYA 4OTFA 2C6IA 5A4LA 4L45A 4RLLA 4GT5A 4K2RA 2J0IA 4RX5A 3EWHA 3C5IA 3MYGA 2I40A 4UWYA 2O65A 4BDDA 2GU8A 2WTCA 2GS6A 1KOAA 3PSBA 4FKGA 3GUBA 4G9CA 2XNGA 4JG8A 3P0MA 4XYFA 1H8FA 3F7WA 3UG2A 2JLDA 3VBTA 1H25A 1K9AA 2QOIA 3F66A 4ASZA 4C4GA 2QHNA 4IZAA 1YHVA 4NUSA 4F7NA 3NVMB 2QOLA 4WA9A 4DTAA 2C6OA 4GMYA 4O38A 1H01A 4AWIA 3ZZEA 1ZOEA 4L3PA 4FGBA 4XG7A 1YVJA 2YJSA 5CSXA 3ZO2A 2QC6A 4RJ6A 2W4KA 3PLSA 1XBAA 4HGLA 4JDHA 4IWQA 5BVWA 3RVGA 3VAPA 4U3YA 4C57A 3P7CA 3FXZA 1DS5A 4JS8A 4C4IA 5HX8A 1OMWA 1G8AA 2PY3A 1FOTA 2FUMA 4UMPA 3PE1A 4JDKA 3ORMA 4BCKA 4Z3VA 2HY81 2X2MA 3HL7A 3TV6A 4BWPA 4DN5A 5KNJA 1ZY5A 3NDMA 5AUZA 4QP8A 2GFSA 3VS0A 2QOOA 2B54A 3FEGA 1M2PA 2PVFA 2V62A 3DK7A 4PTEA 4G5PA 4FTIA 3FZPA 3GVUA 4FTJA 5EHLA 3KEXA 3IO7A 1UWJA 2PVRA 5KMLA 3I1AA 3SDJA 5CXZA 5E8YA 5AFVA 5DG5A 4FEQA 3LLTA 5FXSA 5H8BA 3OT8A 1BLXA 3MVMA 2CKEA 4M12A 4BBMA 2HXQA 1MRYA 2JFLA 4ALVA 3NNUA 2CKQA 3OT3A 3SRVB 3MFTA 1OVEA 2YM3A 3NUPA 3EHAA 5E8SA 4BDIA 4K8AA 2YWVA 4CD0A 4V0GA 3VBWA 2GFCA 1J1CA 4FTUA 4G3FA 3QZHA 4YC3A 2QURA 4AE6A 4IDVA 2WMAA 3BCEA 3K5VA 2FSLX 3KN6A 5CF5A 3EL8A 1UV5A 4MD9E 3I5NA 5ACKA 3FC1X 3LCKA 3TEIA 4YZ9A 4EUUA 3ZC5A 2NPQA 3QUPA 3FMDA 3NW6A 4OTWA 4Q5HA 5HBHA 5CF6A 3ZDUA 5JEBA 4R78A 3PA5A 4XP2A 3MH0A 2PWLA 4RMZA 5TKDA 4BTKA 4KSPA 3KF4A 4JX7A 4L8MA 2R64A 4BDBA 4DH5A 2HY0A 4XV2A 3I7CA 1JKLA 1P14A 4AQCA 4IAAA 3FQHA 5EH0A 4WNKA 4I0TA 3E7OA 3U9NA 4E7WA 3LFDA 1H07A 3TI1A 3VBXA 3KB7A 5IQFA 5M44A 4O84A 2OWBA 4PNIA 2CPKE 2R2PA 5I9WA 2B4SB 5EYCA 4KB8A 5H2UA 3W2QA 4YUQA 5IQDA 4FT0A 3PDTA 5E9EA 4O81A 4UWBA 3LW0A 2CN8A 4FV1A 1MQ4A 2YDIA 4P5QA 3RINA 1A48A 2PTKA 1KUTA 3FLWA 3V5PA 4FSQA 2PU8A 2WIHA 2UW8A 3Q9YA 3UMXA 3R7VA 5AUTA 2R0UA 2YCSA 2P2HA 1IR3A 5F1ZA 5AA8A 4RPVA 5AUUA 3R02A 2G2FA 3ULZA 4D0XA 3NMUF 5E8WA 1KE9A 2VU3A 5D41A 3BV3A 4N6ZA 5FLFA 4QYEA 3TUDA 4R77A 3ZRLA 3LXLA 4AZEA 4O4FA 4IX4A 4DEIA 1A9UA 3HMOA 4QMWA 4DFYA 2XBJA 1WFCA 2GNGA 4YZCA 1BUHA 3LPBA 2QKRA 3RP9A 4APPA 3PIXA 4FIFA 4QNYA 3EL7A 1W2CA 3KFAA 4GG7A 3G90X 5AX9A 2C6MA 2XM8A 3W8QA 4AGDA 1ZAOA 4CZUA 2B9FA 3ENHA 1SMHA 3DXNA 4DH3A 5EYKA 2XRUA 4FV8A 4DGMA 3TIYA 5HO7A 5L6OA 3UDZA 2XP2A 2BHEA 4GV1A 2XK4A 4CTBA 1IAHA 4FNYA 2CJMA 5T3QA 2Z7SA 3QGYA 1KOBA 3ZDIA 2O3PA 3LCDA 4ITHA 3V5TA 2XVDA 3BV2A 3WILA 4GKIA 1Q8WA 2ETRA 2ZDTA 3I7BA 1JKKA 3PE2A 3MWUA 4UB7A 4ZK5A 4FZ6A 5M06A 2HWOA 4PPAA 4BI0A 5BVOA 3V3VA 5DIAA 3KRLA 5LCJA 4JMQA 2PPQA 3ERKA 3Q4ZA 4I24A 5A6NA 1SVHA 5I9YA 1FGIA 5HIBA 1L8TA 3SLSA 2C6EA 3GXLA 3SG8A 5HG8A 3HUCA 4BTFA 2HAKA 2BZKB 2SRCA 2HZ4A 4NEUA 3W18A 2H96A 2C3KA 1FMKA 3MB6A 4A9YA 3MFSA 2UW7A 5KHXA 3A7FA 1QL6A 2WU6A 4N6YA 2OZAA 4B0GA 4B8MA 5F9EA 3UPZA 3BGZA 3EKKA 4KBAA 4W9XA 4E8AA 3B8RA 2BVAA 4O7TA 3IOPA 5HO8A 2BUJA 3EQGA 5AP5A 1BKXA 3R00A 3R7OA 4ZXTA 2WXVA 3OOMA 3KXNA 3I60A 2OXYA 3NAXA 5DR6A 5B2MA 5FDPA 3H9OA 3P86A 2QQ7A 4FSTA 3UNJA 2C0OA 4AN9A 4BDFA 2Y8OA 3SAYA 2WMXA 4QDEA 4DAWA 4F0IA 1OL2A 4IWOA 5AMNA 2BZJA 2JDVA 3G6GA 3HMMA 1Q24A 3BU6A 3ZYAA 3D7TA 3NGAA 2CNVA 1GZ8A 1YI6A 2P33A 3FWQA 3A4PA 4DYMA 4YP8A 4EQUA 2EXEA 5CTPA 1VYZA 5C26A 4U80A 3KRXA 4A9RA 2UUEA 2XNMA 3R71A 4QYGA 4QP9A 3OEFX 4G3DA 4C58A 4E5WA 4EZ3A 5M09A 2UVXA 5FG8A 2W5AA 3AT2A 4BGQA 2WPAA 2BZHB 4FTLA 3A4OX 3TUBA 4RIXA 2C5NA 2XA4A 3BYOA 5HICA 2OU7A 2VWZA 4XUFA 3R9DA 3DK6A 2YCQA 1I44A 4BWXA 3QAME 5EI2A 4HOKA 2W1HA 4B6LA 1FPUA 3F5PA 1NT2A 4YO4A 3ATTA 3GC8A 2VD5A 4C4EA 1GZNA 1ST4A 3P78A 4O4EA 2RFEA 2VX0A 5KMNA 4LMNA 3D5XA 1PXJA 3MVHA 3NW5A 4GH2A 4TWOA 2QKWB 5L3AA 4NL0A 1H1SA 2EB3A 4YU2A 4X2KA 1NW1A 5G1XA 3O17A 4U5JA 2V55A 2VTAA 3ZC6A 5JK3A 3W0NA 5CXHA 4FV7A 3VF9A 3KULA 4EH3A