4AXAA

Structure of pka-pkb chimera complexed with (1s)-2-amino-1-(4- chlorophenyl)-1-(4-(1h-pyrazol-4-yl)phenyl)ethan-1-ol
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
335
Chain Sequence
b'SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title At13148 is a Novel, Oral Multi-Agc Kinase Inhibitor with Potent Pharmacodynamic and Antitumor Activity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4axaA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axaA02
3F2RA 4WBBB 2PVNA 5CT7A 5BMMA 3ODYX 4JLCA 1KUTA 1KE9A 2HZIA 4CKIA 2OW3A 4G16A 3RI1A 3REPA 5LMKA 3FI8A 4DCAA 4S30A 3QCSA 5ANEA 4EK5A 3HA6A 1S9IA 4I6HA 5DG5A 2JDSA 4U80A 2CMWA 5AUVA 2H9VA 2AYPA 3HV6A 1VEBA 4DFNA 3QQKA 1IAJA 3PPKA 4L68A 4M8TA 2BZJA 3KXZA 1QMZA 4XLIA 3QTIA 5EW9A 4ENYA 1NW1A 4XHKB 4YR8A 4BZDA 3PIYA 3CEKA 1W0XC 3UZPA 3KXHA 3UNKA 4M84A 3V5WA 4AP7A 3TDVA 4Z3VA 2JFMA 4HZSA 2IW9A 3BBWA 5LXMA 1OUYA 3R28A 2UW6A 2UW0A 2X9FA 3SXSA 5LOHA 4BCFA 4JRVA 2UZTA 5FXRA 3I1AA 2OF2A 1ZLTA 4LFIA 3UVQA 4CFUA 3TCPA 3TJCA 4OUCA 4AFEA 4J1RA 4AN2A 2YIQA 3MVLA 4ZY6A 4BCKA 3KK9A 2GCDA 3QTRA 1H25A 4NWMA 5K3YA 4QP1A 4WSYA 2WKMA 3MJ1A 4H3BA 3TG1A 2AUHA 3CQWA 2A27A 2UZOA 4BZNA 4CRLA 4IAZA 3UZTA 3KMWA 4FA2A 4L6QA 2JBPA 4IM0A 5HU9A 3C4WA 4YHFA 1PHKA 5HO7A 2YCRA 4F70A 4FNYA 2HW6A 3IOKA 5CT0A 5DBXA 3QTZA 4C57A 4MHAA 3UJGA 3W2PA 5IA5A 5IUGA 3SX9A 4S32A 3UPXA 4ZMFA 3ORXA 3WF6A 2C6DA 4TNDA 3V8SA 3GEQA 2XYNA 2BROA 4O7YA 3PSDA 3DNEA 1OL5A 4FICA 4LG4A 4C4EA 4CYJA 4DE4A 3UC3A 4FUYA 3CJGA 4EUTA 3R9RA 3GCQA 5HTCA 5M06A 1STCE 3MIAA 4DCEA 3MWUA 4E1ZA 4KABA 4GFMA 5KHXA 3D5VA 4IBMA 4P5ZA 4IAKA 5BNJA 3ZUUA 4O83A 2WEIA 2YITA 2C68A 3ZSHA 1OL2A 4BBFA 3ZMMA 4LRJA 4FKOA 5CANA 4K8AA 3ZO1A 5KKRC 3JPVA 3PJ1A 2QHNA 5HTBA 5J5TA 3DPKA 3HZTA 1SNUA 4YC3A 3R7YA 3TIYA 2CCHA 3WE4A 4AGUA 5C8KA 1Z57A 3E62A 3FZRA 3P79A 3OCGA 3QC4A 3SC1A 4TYIA 2R9SA 3OFMA 3GU4A 3W16A 4D4VA 2BZKB 2Z7QA 4QRCA 3KRRA 4UBAA 4X7QA 5E8SA 1JAMA 3NUSA 4I4FA 3RAHA 3CD3A 2J0LA 3B2WA 4H1JA 4UALA 3ALNA 1CSNA 3FBVA 3Q4ZA 3D94A 4ANMA 4EOOA 3DLZA 1WFCA 3P23A 4HCTA 4PV0A 3VNTA 1PW2A 4ANOA 1LEZA 4O0XA 2P55A 3GI3A 4FTRA 5CSWA 3VO3A 4QQTA 3C5UA 4YC6A 5HIDA 3TV6A 2J6MA 4D5HA 2YABA 5IUIA 4WSQA 2GU8A 3ANQA 4BCJA 2YAKA 3HMMA 3AXWA 3R63A 5BUIA 4RX8A 3OHTA 5KUPA 4DFUA 3KRXA 3L1SA 1Q61A 3QQJA 4AS0A 5JQ8A 3LQ3A 2VTSA 1Q8TA 3SXRA 2YZAA 4U9AA 3ROCA 1TVOA 3DOGA 4KINA 3NZ0A 4EQMA 5AV4A 1Y6AA 4BN1A 3UQCA 5J7HA 3LOKA 4TWCA 4TWPA 2PMIA 4JDJA 3ZSIA 2UZNA 3DGKA 4YNEA 1PMNA 2QI8A 2EB3A 3QZHA 4Y83A 3HMNA 5B2LA 2PMOX 3E93A 3P7CA 4W9WA 1XH5A 1OKVA 3A8XA 2W5HA 3CY2A 3FHRA 4RX5A 2QG5A 4DEHA 4L42A 1KSWA 3P0MA 1UWHA 5AX9A 4FOCA 5KBRA 4TL0A 2OWBA 4I3ZA 4ZSEA 3VJNA 5AP2A 2I7QA 4UWBA 2WELA 5EYDA 3L9MA 5JFXA 3FI2A 3C4FA 2WXVA 5EHOA 4KWPA 3LFAA 2R3GA 3MY5A 4FIEA 4ZJJA 4EH3A 5L3AA 3EKKA 4GSBA 4FG7A 4WBOA 2F7EE 4X2GA 2GMXA 4O91A 3L9LA 1AGWA 3V01A 3ZRMA 1BI7A 2ZYBA 3QC9A 1KOAA 4TTHB 4J98A 2V22A 1WBNA 5E8VA 4AOTA 3D5XA 5EFQA 4N4SA 2ITTA 2QOHA 2OJGA 2VWIA 3HNGA 2YN8A 5AUUA 3W33A 2ESMA 3BBTB 3G0FA 4PRJA 4TXCA 3UO6A 5IA1A 2A19B 3IK3A 4BVUA 5ACKA 4JG8A 3R71A 3F5PA 3VS4A 4I6BA 4OBPA 4YZCA 1W7HA 4L3JA 5AP7A 4LYNA 3KMMA 2BKKA 2XVDA 1AQ1A 5J7BA 3EFLA 4QQCA 4YZNA 2XCKA 4MF1A 4YO4A 4R78A 3DJ6A 3KU2A 2F49A 3K2LA 4H3QA 2FO0A 4K9YA 2GPHA 4UMTA 4GT3A 2H96A 1OIUA 3TKIA 4HVSA 4U45A 3R9DA 3WZEA 3KQ7A 4F0IA 3RNIA 2IPXA 4MYGA 2VGOA 3ANRA 3E3PA 1B6CB 3HAVA 1BL7A 4FTUA 5FXQA 3BELA 3LFBA 2XNBA 4FZFB 4JQ7A 4O21A 5K4IA 3KCKA 3AT2A 3UYSA 3Q52A 4IMYA 4EH4A 2QR7A 3ATTA 1XH8A 4IC7A 1NVSA 5AR7A 4D58A 3QRKA 2B1PA 3NUNA 4BCGA 5HO8A 2PTKA 2PZRA 5ACBC 4ENXA 3ZEPA 2W0JA 4F63A 2ONLC 2QC6A 3NUYA 4D4SA 2HZ4A 1FVTA 3FJQE 4G6NA 2PULA 1WBOA 1W84A 4EH9A 3C50A 4OTDA 3MTLA 3U8WA 3MI9A 3Q6UA 4IE9A 4QP6A 2Y4IB 5L4QA 2Z7SA 5E90A 4EH5A 4Z7HA 4QMPA 2UZWE 3FXXA 4D9TA 3QWKA 3UP2A 2X6DA 4RLKA 2I0YA 3PJ3A 3GGFA 4IHPA 4EYJA 1DAYA 2PUNA 4HVHA 2F7XE 4FKRA 4KA3A 5CF5A 1Q5KA 2JGZA 1J7LA 2X0GA 4F7JA 4ZZOA 4KD1A 3W1FA 3PVGA 4H05A 3P86A 1SYKA 2BRGA 4RVTA 4MXOA 3P5KA 4TWOA 4BDFA 1K2PA 2J50A 3DTWA 1YWVA 2PE0A 5CSVA 1GOLA 2J51A 4QP9A 3WIGA 5JMSA 1PXKA 2ZDTA 4KSPA 5F20A 4DH1A 4F9CA 4RIYA 4K2RA 2W4KA 4ASEA 4GH2A 3DKOA 2OF4A 3E3BX 3HECA 4ZSJA 4NJDA 3F88A 4V04A 1Y8GA 4O7VA 2OXXA 3MPTA 3BGPA 1GJOA 3NCZA 4MCVA 3TXOA 5KMIA 3UVPA 3VS6A 2PYWA 4QPSA 2F9GA 4A4OA 2XNPA 2EWAA 3DQWA 5HBJA 1P5EA 3TUBA 4Y85A 4WNPA 3FL5A 3LMIA 5E8UA 2H34A 4FYNA 1UKHA 1BYGA 4RWLA 3IW6A 4DITA 4A4XA 5IA4A 3E63A 3V8TA 4C36A 5J1WA 2JIUA 3F3UA 4MKCA 5LVOA 3Q2JA 4CG9A 1Q3DA 4DTBA 2VO6A 1FOTA 3I6UA 4ACDA 3LM5A 4FTCA 1G8AA 3P08A 4DGLC 5G1XA 3EQBA 1OMWA 4EC8A 4JBQA 3BI6A 1ZOGA 3FQEA 3IQ7A 3F3ZA 2BUJA 3L8VA 3PPJA 5I9UA 3RCJA 3VULA 4WIHA 4GRBA 5ETIA 4NCTA 4I0SA 5FGKA 2F4JA 3DK3A 3E7OA 1PXIA 4X2JA 2VAGA 4X2NA 5DRBA 4U97A 4XS2A 2JFLA 2XRWA 4I41A 4LRMA 5AV0A 1Q8YA 4G9RA 2Y8OA 4AUAA 3AGLA 5BVOA 3MH1A 4ZMEA 4GG5A 4AAAA 4HGEA 3GC8A 4NZWB 3BIZA 3FMDA 3PVUA 3M11A 1DM2A 4LQMA 4QTAA 2WPAA 4TT7A 3T9TA 1GY3A 4II5A 3QQFA 3I7BA 3PE2A 4O0SA 4XP2A 3PXYA 4RC3A 4BCNA 1QPCA 4NKSA 4BDGA 4CCBA 2JIVA 3O51A 3DFAA 5A6OA 4PPCA 3ULIA 4ZY5A 5HE1A 3SW7A 5H8BA 1OPLA 2R0UA 3DK7A 4QYHA 4HOKA 2WAJA 1FGIA 4RJ3A 3W10A 4E3CA 2VV9A 1OIYA 3HMIA 3D4QA 1GZOA 4PP9A 3R8VA 4FTMA 2Z7LA 2WU7A 3AD6A 5AMNA 1PKGA 4YPSA 2YJSA 4BKYA 4KRDA 2P2HA 5JFVA 4RC4A 1TKIA 5EHYA 4FIFA 5HE0A 2HZ0A 2ACXA 4R5YA 4CFMA 5CVFA 4DEDA 4TNBA 4OGRA 1U46A 2UVXA 3HX4A 2IJMA 1XH7A 4I1ZA 1UNGA 5LVLA 4DH5A 4AA0A 2EXCX 1H00A 3O0GA 3D0EA 3DDQA 1J1CA 2WQOA 4IXPA 4FNWA 3ZLWA 5BYYA 4FVPA 4EK3A 4GKHA 3AOXA 4XX9A 1UU9A 2C6OA 3OOGA 3VQHA 4ACHA 4EH6A 2WEVA 4PDSA 1HCLA 4C3PA 2VWBA 1YI6A 3OT3A 4D0WA 1YOJA 5M4IA 4M69B 2O5KA 4FEWA 3O7LD 1UNHA 5JK3A 3R6XA 4O6LA 5A4TA 3C0HA 5C26A 3QAME 4XG7A 3A62A 3BWFA 4L01A 5DFPA 3CJFA 1HCKA 3C9WA 1Y57A 2HW7A 3BHHA 3E64A 3OTUA 3P9JA 4FV3A 2OGVA 4M12A 4CSVA 4F6UA 5T3QA 4RJ5A 5EI6A 4ACCA 2HXLA 4ID7A 3UNJA 3WI6A 4O27B 2VRXA 5AJQA 3E8EA 3TNWA 3UNZA 3VBVA 5CAQA 4CQEA 1M7QA 2BAQA 2H6DA 3UBDA 3VBYA 3RAIA 4P2KA 2DYLA 3RPOA 3EN7A 5ETCA 4QYFA 3QHWA 4BBEA 2X1NA 4QMWA 3H0YA 3W55A 4YHTA 3QXOA 2GNGA 4FTQA 2GFSA 4PL3A 4C2VA 5I4NA 2VO0A 4QNAA 2BHEA 4BRXA 2X8IA 3GBZA 3IDPA 2C3KA 5HNGA 3RK9A 4FV2A 2WMQA 4Q5HA 4RVKA 2OJFE 3GC0A 4FTLA 4RA4A 4V05A 4EJNA 4EOLA 3CLYA 3EHAA 2VGPA 2XK3A 3HDMA 3IG7A 3S1HA 1KE5A 3GCVA 1CKPA 3ORPA 4RBLA 3RVGA 2GS6A 3IGOA 1VZOA 4PNIA 5FTGA 2BRMA 4LI5A 2Y7JA 3D2KA 1GNGA 1OITA 2YCFA 4JQEA 5IH6A 3I0QA 4FC0A 4Y5QA 4FV6A 1FINA 1P14A 3ZC6A 3KREA 3EYHA 4QPAA 3KN5A 3LQ8A 4MWIA 5C4KA 2PZ5A 4IADA 4QMSA 3ORTA 1H1SA 4O7ZA 3GCPA 5HKMA 3QA8A 3F3WA 3UOKA 2VUWA 2WOTA 4IB3A 3LXPA 3R2YA 1S9JA 3LM0A 4DGOA 3L9PA 4FI1A 2PMNX 3FWQA 4TPTA 3AC2A 3ENMA 4IDVA 3DU8A 3KRJA 5JH6A 2PY3A 3EZRA 5HE2A 4B0GA 2E9PA 3QBNA 4I4EA 3VIDA 4M67A 3O96A 3TNQB 3AMAA 4L8MA 2J0JA 4APPA 3BEAA 4KIKA 4FSMA 3UOJA 4XOZA 3VHEA 3BEGA 4BICA 3FPMA 1JKTA 5D41A 3OUKA 4C37A 2R3OA 3RAKA 3QKKA 4RT7A 5AP3A 2WMTA 1P4OA 4ARKA 4G3CA 1PMEA 1PMVA 4QTEA 1DI8A 3FE3A 4C38A 2ETRA 4BDAA 5LVMA 2G1TA 2RGPA 4U8ZA 5AV2A 1URCA 1OL7A 2ZM1A 5M44A 3EQGA 3NYNA 3NYVA 5I9XA 4PTEA 5AM6A 2XF0A 3LLTA 3UIUA 1GIHA 4YLKA 1DAWA 4YZ9A 2W1FA 3RZFA 3TIZA 2PPQA 4MX9A 1Y8YA 2HY81 3PXRA 4L7SA 3CPBA 4GK3A 4R77A 3FMKA 3G6HA 3PSBA 3VUDA 2QHMA 2QLQA 3ET7A 2XRUA 4HPTE 2UZUE 1XR1A 2C5NA 4GU6A 4IVAA 1E1VA 3EN5A 4GCJA 2VZ6A 2WIHA 1OPJA 5M51A 3HEGA 3TTIA 3OWLA 1FVRA 3CKWA 3R9HA 2W05A 2QVSE 2LGCA 3SD0A 3E8CA 5A4CA 5EM7A 3HV4A 2WTJA 2R3RA 5HI2A 4YO6A 2A4LA 4IWDA 5DEWA 3RMFA 4E5BA 4CTCA 3OP5A 1APME 4L7FA 4LUEA 3R7UA 4AFJA 4CZTA 2B54A 5AP1A 3HAMA 2EVAA 1ZMWA 3BYSA 1H27A 2R7BA 3I6WA 4XRJA 4LOQA 3G33A 4ONAA 4C8BA 4XV9A 1XHAA 3DBDA 4BHNA 4NIFB 4M97A 3LFFA 3F69A 5A46A 3BYOA 4R1YA 4RFMA 5DOSA 3EFWA 3T8OA 2WTKB 2X2LA 3F7ZA 3QTSA 5IQIA 2GQGA 4BDCA 4UV0A 4D0XA 4FK6A 4KNBA 4BCHA 4ZLOA 5IISA 1JSUA 4CKJA 4FSTA 4XG8A 1BKXA 2XCHA 2W1DA 5EK7A 4JJRA 1OKYA 4IB0A 3H30A 2B53A 3NWWA 1T46A 5CU0A 1Q97A 3FLSA 3N4TA 3G9LX 4D2SA 4ZS0A 2WNTA 3ACKA 3COKA 3FLNC 3K3JA 2IZRA 3CC6A 4IANA 2W99B 4RZWA 3D7TB 2Y4IC 4DHFA 5JT2A 4OT6A 1VJYA 2BKZA 4LV8A 3DFCB 3BE9A 4U7ZA 3UG2A 3ZZWA 5AM7A 2YWPA 4BBMA 4EOKA 2ZB1A 2W4OA 3FLYA 5CASA 4RRVA 5ETAA 3BQRA 3A7GA 3LPBA 5AUWA 4A4LA 4AXAA 1Q4LA 2CGXA 4EBVA 5IA2A 4Z16A 4F09A 3QUPA 2PU8A 3QWJA 1OL6A 5F4NA 3N4VA 1KV1A 2PVHA 2QR8A 3R30A 5HNBA 4IH8A 3PWYA 4CZUA 1NVQA 3LCDA 4OAUC 1M7NA 4HGTA 3WF5A 1YXVA 4JIAA 4DGNA 3R83A 4YJTA 4O0WA 4OR5A 2YCQA 5HIBA 3UIMA 4S2ZA 4TZRA 5HORA 2KTYA 2KULA 2XBAA 4DGMA 5AAFA 4J71A 4DTKA 4NSTA 4EQUA 2YM3A 3QUEA 3C1XA 2XH5A 3EFKA 5ANKA 5I3OA 3COMA 3WYYA 2WMWA 2QOQA 4WUNA 4FBXA 3BU5A 4PY1A 1T45A 3A7HA 4FSWA 2HZNA 2YIXA 1JSVA 2RG5A 3ZC5A 3S00A 2C5VA 3F6XA 3A2CA 3HV7A 3G90X 1JSTA 4WG3A 2JDRA 3D9VA 3SRVA 3Q32A 2XM9A 5L2SA 5BYZA 5I3RA 3FL4A 2ONLA 4DEIA 2ITXA 2B0QA 3PA3A 3O71A 4O0VA 4EZ3A 4YJPA 1FMOE 5H3QA 1Q24A 2Y0AA 3IDBA 3QTQA 2BTSA 4X3JA 3EYGA 3LCSA 3W2QA 4AACA 4CNHA 5BVWA 2XMYA 3E7VA 2EU9A 3FMEA 1A06A 3ZLYA 5JKGA 2W7XA 4XOYA 4CRSA 4G5JA 2UZBA 3BWJA 5J1VA 4U44A 3VRZA 1NXKA 2C0IA 3FLZA 3O8UA 3DKCA 2E9VA 2VTHA 1MQBA 3H0ZA 4JBOA 4JVGA 4FKUA 2UV2A 4PDOA 3CE3A 4JAJA 4IM3A 2VTRA 4QMUA 5TF9A 1XH6A 4FEQA 4G5PA 5I5ZA 4S34A 2R64A 3MY1A 1REKA 5AUTA 2FSTX 3LE6A 1CM8A 5CS6A 2PVJA 5CAPA 2E2BA 3DLSA 4IZ7A 5BUJA 4TRLA 4PWNA 2C6TA 4XBUA 1PXJA 3UODA 4ITIA 5KMOA 4E20A 4JG7A 2HIWA 2IZTA 4FKWA 4IM2A 4M15A 4TYJA 5KMKA 4O1OA 4R8QA 4FGRA 4MEDA 4YHJA 4ZTHA 5BVKA 3Q3BA 2YM8A 4DH8A 2HK5A 5FP6A 5HCYA 4CLJA 4WNMA 2C69A 4WNKA 1BMKA 4D5KA 2XA4A 3V04A 4C02A 2OO8X 2VWYA 5CI6A 4IIRA 3K54A 1UA2A 3UZRA 5JZJA 4JXFA 1M2RA 3W8QA 5CSHA 3POOA 1SVHA 3PRIA 4FNZA 5G6VA 3WARA 3UG1A 3QRUA 3LFQA 4QMYA 4G6OA 4EOJA 4MNEB 3UDBA 1JKKA 2J5FA 1JLUE 4BYJA 4EK8A 2JLDA 4FVRA 4L53A 2G2FA 4BI1A 2HENA 4FV1A 4L44A 3ZBXA 5LARA 2X81A 4UYAA 4D4YA 4Q9SA 5F94A 4HPUE 3FC2A 2WQNA 4R7HA 3NAXA 2E9NA 3TJDA 2ZVAA 4E7WA 3QFVA 2QOIA 5LWMA 4IACA 3SV0A 5IMEA 3R1YA 4PPAA 4F9WA 4H39A 1WAKA 2ITQA 3OCTA 4YBKA 2JKOA 3ZRKA 3I0OA 2OFUA 5HTIA 3FC1X 2ITZA 3BRBA 2HWOA 3DA6A 3U51A 4XG4A 3MH0A 4DYMA 2QOFA 4UX9A 2Q83A 4YMJA 4RIXA 3GUBA 1ERKA 2R3MA 4FG8A 5JZNA 5E92A 4RLLA 3WZUA 4EYMA 2XKDA 4G17A 1FVVA 3VS3A 2DS1A 2GHMA 1H1QA 2C6EA 3G2FA 2XK9A 5JSMA 1CKIA 5AEPA 1XO2B 4XV1A 2RSVA 3QCYA 4J97A 4FSRA 5D9HA 1XH9A 2W06A 2FSLX 3GNIB 4QMMA 2PVLA 3DZOA 3LFSA 4FL3A 4G3GA 1KE7A 5AADA 5CF4A 4IZ5A 3ZXZA 5AR2A 3SVVA 1R39A 4FIHA 3R7OA 2GS7A 4A9YA 3NNXA 4QMXA 1XWSA 3AMYA 4J52A 1H01A 4O84A 4CFNA 2QU5A 2OJ9A 4FIGA 3ORKA 4AZWA 3EQPA 3UPZA 4GK2A 3RPRA 4I20A 5BUEA 2I6LA 4L67A 3R8LA 3NYOA 3CTJA 3COHA 3PY1A 3PSCA 1GIIA 5IEVA 3C4CA 3NS9A 3D2IA 3Q04A 4MNEA 1UV5A 3QYZA 4RQVA 4AQCA 2WMAA 3QTWA 3LCOA 3ZYAA 2BILB 4AGWA 1QPDA 5EDPA 3ZS5A 2BZHB 3LXLA 4DLIA 2FB8A 2PMLX 4FUXA 4K0YA 3SG8A 4CGAA 4Q2AA 2W9ZB 4HGSA 2ITOA 3F5XA 5DWRA 3O8TA 2YDJA 1J1BA 2I1MA 5L8LA 3FLWA 5CU6A 5AIRA 4LUDA 3R8UA 4J8NA 2P3GX 4CT2A 3NUUA 1K3AA 1Z9XA 2W1IA 4EZ5A 3BX5A 1NVRA 3Q2MA 3BYMA 1JQHA 2O3PA 2UZVA 2W5BA 4FSNA 2PUUA 1OKZA 3QX2A 1P4FA 2UW9A 5AP6A 4EKKA 2DWBA 2BZIB 3QYWA 4QYEA 4GUEA 4ZTMA 2XS0A 5F9EA 4NYEA 3JXWA 5FG8A 3EQRA 4EH8A 2Z7RA 2R3LA 1PXNA 4JIKA 4D2PA 2YIWA 2G01A 3H9RA 1Q8WA 3DQXA 4LM5A 5CVHA 4B8LA 3ATSA 3IW4A 3MVMA 1VR2A 1IRKA 3KFAA 4KKHA 3QTUA 4XMOA 2CNQA 3CQEA 4DEGA 1JOWB 3LCKA 4J53A 3DAEA 3O23A 4IEBA 3B8QA 4HCUA 3DCVA 2BAJA 3FMLA 4KS8A 3KA0A 3IOPA 4ZXTA 4ZS4A 3VF9A 5CYIA 4YJVA 2VTQA 4NH1A 4WG4A 1MP8A 3BCEA 4NJ3A 3LFNA 2W1CA 4TY1A 3UE4A 2CGVA 2GTMA 1U59A 4YSJA 1ZYJA 4EC9A 4GFOA 5LVNA 5HICA 3KRLA 3V3VA 2WMRA 4G9CA 4E26A 3DXPA 1WZYA 2VWZA 3B2TA 4BZOA 3I60A 4MTAA 5DN3A 3C0IA 3VBTA 4LRKA 1YOLA 2WD1A 3HV5A 4KBKA 3BU6A 4HGLA 3R2BA 5JGBA 4FTNA 5EYCA 3EQCA 4L43A 4IVDA 4J8MA 4G6LA 3QKMA 2C5XA 3WZDA 4G31A 2VN9A 4O2PA 5KCVA 4HYSA 2HYYA 3Q5IA 5JQ5A 4ZTSA 4QNYA 3H3CA 2XJ2A 1QPEA 2IO6A 2OFVA 4GEOA 5E8TA 3LAUA 2WTKC 3QD3A 3DTCA 3GXLA 3AC1A 3DXNA 4J95A 4ZJIA 3Q9ZA 3QTXA 2WMBA 5HVYA 2OK1A 3UQGA 4Y72A 2VTAA 4I24A 4ZZNA 5DR6A 3QGWA 4YTIA 3BKBA 3L8SA 3LVPA 2VTLA 3QLFA 2PZIA 3VS0A 3FZSA 1HOWA 3HV3A 2VNWA 3UC4A 5HE3A 5CEIA 1ZMUA 3V5TA 3KVXA 2CKOA 5BQ0A 3KEXA 3THBA 3NVKI 4RFYA 5AUXA 3AC8A 4RFZA 4WNOA 3V5JA 4E4XA 1I44A 4M0ZA 2X8EA 2R5TA 4OTQA 3RWQA 4ASXA 2ERZE 5EOLA 4U42A 3CQUA 3IONA 2PZYA 3ZONA 4F6SA 3AD5A 3UGCA 4OT5A 3D15A 4Q9ZA 2WTCA 4NFNA 2BHHA 4IWPA 4OTRA 3R1NA 4NU1A 5E8WA 4MK0A 2J4ZA 4EEVA 1CDKA 2C6LA 5L2QA 4QPMA 4IB5A 3WF9A 1H28A 2PUIA 2IW8A 3V51A 4DEAA 4D4RA 2C3LA 3KCFA 4FT5A 3VC4A 4C4HA 3C4EA 5LCJA 1W82A 3SLSA 4TYEA 3MTFA 2R2PA 1Q3WA 5GIPE 4GMYA 4R7IA 3QA0A 3EKNA 3E87A 3HKOA 4IFCA 4CFWA 5E4HA 3SG9A 3MA3A 4EZ7A 5HVJA 4X3FC 1UU7A 4GVAA 5EDRA 1MRUA 1YHWA 3BV3A 2YIYA 2EXEA 4PUZA 3GC7A 3VUGA 5HIEA 1JNKA 2W96B 2QQ7A 5HBHA 3EQDA 5HCZA 4O2ZA 4BTKA 3BLHA 4Z7GA 4X6RA 4O7LA 3GFWA 4GIHA 4JDKA 4D1SA 3AQVA 3CTQA 3NIZA 2Z2WA 3M42A 2BR1A 3IDCA 4I93A 3QUDA 4AA5A 3UVRA 1E9HA 2B9IA 2FGIA 2GHGA 3PE1A 4GJ3A 3NNUA 4HYIA 3ZU7A 5AWMA 1YDRE 3DBCA 2XBJA 4Y5HA 4UMQA 5CEOA 3QGYA 2EB2A 3CBLA 5TE0A 4EHGA 4MD9E 5LMKC 3CKXA 4MXZA 2V5QA 3E8NA 3ZFYA 5E7RA 3LJ1A 4FTKA 4BDEA 3OW4A 2Y9QA 3TZ9A 1PXLA 4E5AX 1KE6A 5FDXA 5BVFA 4TYGA 2W4JA 5CQUA 5GZ8A 2R4BA 4JBVA 5LCKA 3UIBA 3D14A 1YDSE 3BPRA 4FT0A 4O7WA 4JL9A 3TI1A 5FD2A 4I5HA 4OLIA 4NM5A 3ZM4A 4QTBA 2WOUA 2BIKB 5DT0A 3GFEA 4LGDA 3U55A 4FSYA 5FUTA 2Z8CA 4CFVA 4DG3E 2IZUA 3TUCA 4BYIA 5CXZA 4XG3A 4GG7A 5CF8A 3F66A 2C0OA 3RWPA 5D7VA 4XV2A 5HG8A 1KE8A 3DT1A 2OZAB 3LXNA 2CN8A 1XJDA 5E1EA 2WZJA 1PJKA 3WIKA 3FI3A 3BHVA 4HW7A 4ZY4A 2XKFA 3RBWA 2VWWA 3ZH8A 4D9UA 2VTMA 4L3PA 3WILA 2JDVA 1E1XA 2BALA 2AC5A 5EKOA 3MVHA 3R00A 1M52A 2NPQA 3ORLA 2WQEA 3HUCA 5M55A 5CI7A 1IA9A 3IECA 4HCVA 5IPJA 1IA8A 5CY3A 1YW2A 3ORIA 4KRCA 1U5QA 5EQPA 3MIYA 2C6MA 4P90A 4GU9A 4MD8E 3U6JA 4E73A 5HD7A 1QCFA 4E4MA 4C33A 2ITPA 4FV8A 1ZMVA 3RCDA 3W2CA 4FEVA 1H1RA 4NTSA 2YEXA 5F1ZA 3PZHA 4NM0A 3ZO3A 2GNFA 2IG7A 3LFEA 5DLSA 2CLXA 2VTIA 2YM6A 3POZA 5L2IA 4A07A 3VRYA 4R3PA 3HMPA 4MXYA 4BFMA 3QU0A 4C0TA 2ZM4A 4EOQA 4O1PA 5TT7A 4QMOA 4NW6A 1LPUA 1PYEA 3S95A 4GIIA 2IWIA 1YI4A 5KBQA 5GJFA 3IPHA 4NFMA 5EM8A 1O9UA 3R73A 4V0GB 4EKLA 1GIJA 3NUAA 5KMNA 2C1BA 3OY3A 4E6DA 3R22A 5CNOA 3F3TA 5JRQA 4BI2A 2VWXA 3I5ZA 1OBDA 3DXQA 4IX6A 4JT3A 2XEZA 5I9YA 3NRMA 2J5EA 5CLPA 4AF3A 5AA9A 4LGGA 3VWAA 3FUPA 4QYYA 5A4QA 1ZY4A 3TN8A 3EH9A 1Q8ZA 5HD4A 4RWKA 2P4IA 4YJOA 4C3RA 1ND4A 3BE2A 3VUMA 2CGWA 2XNGA 3PUPA 1YXXA 1ZYDA 2IVTA 2Q0BA 2ZAZA 1U54B 3COIA 4IAIA 4QQ5A 4BGHA 4BIDA 3WE8A 2IW6A 5EHLA 4BR3A 3E5AA 4ZEGA 4FSQA 1YXUA 5K0KA 1CTPE 2GQSA 3BYUA 4O81A 3V6SA 4YNOA 5E1SA 4RIOA 2CGUA 1OUKA 3WYXA 5FM3A 1JKLA 3NUXA 4GL9A 4L46A 5ETFA 2RF9A 1Y6BA 2IN6A 4R3RA 2UZDA 3RM7A 4QD6A 3MY0A 1U5RA 4B6LA 4BIBA 4C58A 4HJOA 3FAAA 4X0MA 4XJ0A 3OT8A 4K18A 5J95A 3JVRA 4ZK5A 4B4LA 4I5PA 5A4EA 4ALWA 4H36A 3IW8A 4QP3A 5CVGA 1ZWSA 2DQ7X 5IQEA 4UN0C 5K5XA 2GHLA 4C59A 3ROYA 2YA9A 3KULB 3A7JA 3UYTA 4BHZA 5BVDA 3BU3A 3ZFXA 1LEWA 4FSUA 4RIWB 3QLGA 4RJ6A 4FR4A 2R3JA 3SDJA 3VUTA 4I21A 4RG0A 3V5PA 4WT6A 2CLQA 3AC4A 3MV5A 4M69A 5HZNA 3ZSGA 5KHWA 4F1TA 3ODZX 2PVMA 4FNXA 2IVSA 1H0WA 3HDNA 5CZHA 4ANBA 4EOSA 3OROA 3OXTA 3BV2A 2NO3A 3VVHA 4XG6A 2J2IB 3R1SA 2C6IA 1XQZA 4QMQA 1BUHA 2VX0A 1PKDA 1QPJA 1A9UA 3QL8A 4YJRA 3RM6A 2XEYA 4MBJA 3QZFA 3OW3A 5I0BA 2FVDA 5JN2A 4ALVA 4BF2A 4DFBA 1JKSA 3GQLA 1KV2A 3GCUA 4L45A 3A4PA 1SZMA 4M68A 4MNFA 1EH4A 3FZTA 2R3HA 5HHWA 4ANSA 3VJOA 1V1KA 5M4CA 3FZOA 4F9YA 5CAOA 4DT8A 2WFYA 2ZM3A 1B38A 4O0UA 4WD5A 3ZM9A 2JKQA 4YGAA 2WTDA 3OOMA 3OVVA 4PL5A 5HG9A 5KZ0A 4PDYA 4F7LA 1OKWA 3GU6A 1IAHA 3FPQA 2R3NA 4I6FA 3QCXA 3KL8A 5CXHA 4ZTNA 4ACGA 4IZAA 4RZVA 4YP8A 3Q9YA 3FV8A 3NEWA 4DA5A 4FEUA 4ITHA 3U9CA 2V7OA 3ITZA 4DGGA 1FPUA 4HVDA 5J9LA 3VS7A 1Z5MA 2BDWA 3N4UA 2OSCA 3KXNA 2J7TA 4AZSA 4EI4A 2CN5A 2YISA 4IX4A 3A7IA 4ERKA 4C34A 1FBNA 1YI3A 1ZOHA 1OIQA 3OCBA 5CU3A 5IDNA 2C6KA 3CS9A 2ZOQA 5ITAA 2VTPA 3NW5A 2PHKA 3FI4A 3MW1A 3R0TA 2EXMA 3GCSA 4IDTA 4NK9A 3QRJA 2VWUA 4P7EA 5J79A 3P7BA 5FBOA 3OEFX 2YWVA 4XEYA 1WBPA 2ITVA 3MPMA 2NNWB 4IB1A 4X2KA 5DR9A 2A1AB 5T6KA 4EHZA 2UZLA 4ANNA 4R7BA 3TUDA 1XH4A 5D1JA 2O0UA 3DBQA 2ZV2A 5EKNA 4IX5A 4EOIA 5EQYA 4BIEA 4O0TA 1NT2A 1SVEA 4HZRA 4HVIA 5EI8A 4PMMA 1X8BA 5CENA 2R3IA 3I79A 4FKQA 3FMHA 3ZHPC 3EOCA 5LMAA 4IZYA 2Y6OA 4ZLZA 2QODA 4AZVA 1OI9A 4TYHB 3RPSA 1YOMA 2WMXA 2BFYA 5D7AA 2W1EA 1J3HA 2W17A 3DY7A 4QQJA 3C0GA 5IU2A 3CGOA 4EH2A 1R3CA 3R7GA 4O96A 2UZEA 2FYSA 3BLRA 4FIJA 4I92A 3D83A 4J7BA 4CMTA 2JDOA 4AN3A 4JRNA 4WRSA 4U6RA 3PXFA 1PMUA 4W4WA 3MGYA 3EQIA 5C03A 3KK8A 5ANJA 5B2KA 3EB0A 4WO5A 3R8ZA 5IMXA 5C1QB 3VS2A 4F7NA 2VTTA 3ORNA 4QP2A 4IJPA 4L9IA 4D55A 3MFRA 2UW3A 5IH4A 3PFQA 2OI4X 4RWJA 3KF7A 4HNIA 1DS5A 5LVPA 2OICA 3NCGA 4PL4A 2WIPA 4O82A 2XIKA 4YZMA 4O7SA 2GNHA 3EQHA 3EN6A 4N0SA 4RJ7A 1BX6A 3PA4A 2XUUA 3T3VA 5IF1A 5I9WA 3G51A 4ORKA 2OJIA 2XNMA 3C4ZA 2HAKA 4F7SA 2QNJA 5DR2A 5HGIA 1ZY5A 1OBGA 3QKLA 4KSQA 4QP7A 1VYZA 2ITUA 4ZOGA 5HCXA 2YACA 4I5CA 3FKLA 4CEGA 3CY3A 4S33A 2GS2A 3A99A 1PF8A 2ITYA 4ALUA 3EMGA 3BHTA 4NCTC 4O86A 4XUFA 3PYYA 5M07A 1O6YA 2ZMDA 2BRHA 4X3FB 3I7CA 4NIFA 2VU3A 2JKMA 5CSXA 4I0TA 3RKBA 3VBQA 4DLJA 5AIKA 5GNKA 4MQ2A 3PTGA 4AN9A 3PZEA 2REIA 3FXWA 3RHXA 4FIIA 2R3KA 3HGKA 5AX3A 4BWPA 2UW7A 2HELA 2XNNA 4NW5A 4K11A 3SXFA 4AW2A 3D7ZA 1F5QA 4BTMA 5BX0A 5L8KA 2PK9A 2GNIA 4FT9A 4YJQA 2YM4A 5CNNA 5M4FA 3SKCA 3GU5A 2PZPA 3VBXA 4F4PA 2IVUA 2RKUA 3GC9A 4CV9A 1WMKA 1H24A 3DNDA 2XZSA 3FEGA 3V5QA 2OBJA 3D7TA 2QOCA 4M7IA 4UZHA 4EQCA 3QRIA 3LKMA 3FZPA 4I6QA 4DEEA 4JI9A 1F0QA 4E5WA 4JS8A 3TNPC 5IQDA 3SW4A 4KS7A 4L00A 2VTJA 1L8TA 1PYXA 4RMZA 2X4FA 3B8RA 4QYGA 2XB7A 5IH5A 2P33A 4FKVA 3Q53A 5HESA 4KBCA 3R01A 1V0PA 4BL1A 5GZ9A 4IJ9A 5L8JA 4APCA 1G5SA 3RINA 3RTPA 2E9UA 3MSSA 3P7AA 4NTTA 4IQ6A 5FEDA 3MDYA 5AA8A 2YM5A 5DT4A 2FSMX 5JFWA 3Q4UA 4FSZA 2BPMA 1TQPA 4BDKA 3QQUA 1UKIA 4D28A 3MVJA 1NA7A 2XK4A 2CKEA 2QONA 2YLEA 3MN3A 5CSPA 3ID6C 5D10A 3V6RA 4DFYA 2J0KA 2ZV9A 3U9NA 4XG9A 3EJ1A 3AT3A 4ZAUA 4JDHA 2XM8A 2B9FA 2ZV7A 4GUBA 2YCSA 2VTNA 4D2TA 3VN9A 2X2KA 4AZEA 5TOZA 3TNHA 4V01A 3C51A 4PMTA 2QO9A 4F99A 2O2UA 4EH7A 5KMJA 4GKIA 1W8CA 1ZARA 3DAJA 3IW5A 3O7LB 3BLQA 3OWKA 3PIXA 4A06A 4MH7A 4RVMA 5IZFA 3PG1A 4B8MA 3BYVA 2YERA 5M56A 3MFUA 4RX7A 2WMSA 2R7IA 2XK6A 3E8DA 4E4NA 1BLXA 5AUYA 3Q9XA 2JKKA 3AMBA 2JAMA 3LW0A 3ORZA 5HO6A 2GTNA 3TM0A 4F0FA 3OS3A 1K9AA 2PVFA 1H07A 4BB4A 5IG1A 5IQHA 5EW3A 2OH0E 2R0IA 3IO7A 4XNEA 4CV8A 5CALA 5EDQA 3DBFA 5HX8A 5C8MA 3SA0A 5L2WA 3D5UA 5KMLA 4DINA 3AC5A 3RAWA 3LFCA 2Z02A 2X7GA 5GIOE 1OZ1A 1ZYLA 4IC8A 5FRIA 3FKNA 3NYXA 2HXQA 3R04A 4ZZMA 1BI8A 2OJJA 2G9XA 2BCJA 3EZVA 3VBWA 4IVBA 4EOPA 4A9RA 5EYKA 5AAGA 1H8FA 4E6AA 5HG5A 3NNVA 3ZUVA 5BPYA 3DJ7A 3PG3A 3KN6A 5HNIX 3KXXA 4DEBA 1ATPE 3EN9A 4C4FA 3GOKA 4AT3A 4BDHA 1UNLA 4YSMA 4O7TA 1I09A 1TQIA 3PY3A 4QMLA 4U79A 4ZSLA 4FL1A 2VO3A 1Y91A 2UW8A 4FKGA 4I94A 2GSFA 4KKEA 3VQUA 4U43A 4YUQA 4IAYA 2QO2A 1JVPP 1MQ4A 4FV9A 5L6PA 3MB6A 2YZLA 1ZZ2A 5CQWA 4GYGA 4AZFA 1G3NA 2GFCA 5AR8A 4QTCA 1P2AA 2PVRA 4EJ7A 2OZOA 3HRCA 3II5A 1RJBA 3NIEA 4NM7A 5E8ZA 1WVWA 5CAVA 3LMHA 4U81A 5KE0A 3PRFA 3ZXTA 4C35A 4N57A 2P2IA 4FKPA 3GQIA 5IEYA 2WU6A 3NR9A 3VUHA 1FGKA 5EM5A 4E6QA 4TN6A 3A61A 3NGAA 3FMJA 3PXQA 1ZYSA 2QOBA 4PMPA 1JBPE 3S0OA 4FT3A 2UUEA 4LOPA 4USDA 5EQEA 3BHUA 3KMUA 3PY0A 4WUAA 3OMVA 3TZMA 4G3DA 4E93A 4F08A 4FOBA 4QMTA 4XBRA 2HWPA 3TT0A 5HQ0A 2RL5A 4ZTRA 3JS2A 4HYUA 3QXPA 4PX6A 5H8GA 1F3MC 4BGGA 4PPBA 2G2IA 2F2CB 3KXGA 3PWDA 4DG2E 4A9SA 4FEXA 2B9HA 4NKAA 3ZDUA 5HU3A 4U41A 1YDTE 3F5GA 4CXAA 5IDPA 3ZLXA 2Y6MA 4GW8A 2BIYA 4RQKA 4K6ZA 3WF8A 1YXTA 2BFXA 4HVGA 2BTRA 3LMGA 2YDKA 3PLAE 3GT8A 4MXAA 5A4LA 2VX3A 5KX8A 3QALE 4HNFA 4MXCA 2JAVA 4FZDB 2ETKA 1XKKA 4GK4A 4M0YA 3ZOSA 4UMPA 5K0XA 3NSZA 3UP7A 3ETAA 2B52A 2W1ZA 4R1VA 5CTPA 1A48A 4FV0A 3G5DA 4QO9A 5E91A 4DF3A 5BMSA 2P0CA 2Q0NA 3Q9WA 4M13A 4C4IA 3NDMA 1ZRZA 4K77A 4AE9A 4CLIA 1YRPA 2JDTA 4B99A 3UO4A 3R7VA 4USFA 5B0XA 3BGZA 3QQGA 4E8AA 4BY9E 5L6OA 5E9EA 1ZZLA 4UB7A 4GV1A 1M2PA 4MQ1A 4F1MA 2BRBA 5D12A 4DT9A 4L52A 3RK5A 2J0MB 5C8NA 5L2TA 3ZZEA 2PWLA 1J91A 4AG8A 2VO7A 3HUBA 3U4UA 2NRYA 4TWNA 4YJNA 2V55A 3RZBA 3R7EA 4G3EA 4ZTQA 3CTHA 5J9YA 4PMSA 4UMUA 5DGZA 5CF6A 3GP0A 4XYFA 4AU8A 5IQFA 3SGCA 1B39A 2X2MA 1PXPA 3DZQA 1KWPA 3CCNA 1LUFA 4WOVA 3W18A 2OG8A 3VUKA 4N6YA 3K3IA 4C62A 4RJ8A 4JQ8A 4O7RA 3EL8A 4AGCA 5HLPA 2CCIA 4JX3A 4CKRA 2ETMA 2OXDA 3JY9A 3QCQA 4H1MA 2QO7A 4J99A 4MD7E 4OW8A 3S3IA 3A60A 3OZ6A 2A2AA 3SOCA 4CMUA 2CNUA 4FF8A 4O7NA 3Q5ZA 1XBAA 5ANDA 1M2QA 1WBWA 2QU6A 3ZEWA 4XH6A 2W1HA 4LMNA 5AP0A 2JITA 4B9DA 1CMKE 4JDIA 5F95A 1M17A 4EUUA 3VHKA 4RPVA 2C5YA 3P1AA 4XG2A 3PJ8A 5KNJA 4KAOA 5DNRA 3TKUA 2G15A 4LOOA 4W8DA 4EL9A 2BDFA 3F2AA 5HLWA 4OTWA 4EOMA 5FP5A 4CQGA 5DE2A 3EN4A 3DB6A 4JX7A 4YZDA 3PIZA 3C13A 4OTFA 5J9ZA 3P4KA 3QD4A 4C2WA 4RSSA 2C0TA 3OF0A 1UU3A 2UVYA 4J96A 5DRDA 2X7FA 4Z9LA 1UVRA 5E8XA 3PP0A 3QD2B 4JAIA 3N9XA 2WHBA 2NRUA 2PSQA 4DFLA 4Y8DA 4O6EA 5HBEA 4YTFA 4YC8A 1REJA 3BQCA 4EONA 3M2WA 2IVVA 4ITJA 5FTQA 3NW7A 4XP3A 5IA0A 3K5VA 4BGQA 2O8YA 3P78A 4AT5A 2GQRA 4MF0A 3WZKA 1QL6A 1WBVA 5DIAA 5FDPA 3GB2A 3MFSA 4EHEA 3FQSA 3I81A 4K33A 2CNVA 4R3CA 4WKQA 5JEBA 2QD9A 5JFSA 3RPVA 5K9IA 3LXKA 1LP4A 3PLSA 4NUSA 2XNEA 4GVJA 2RFEA 3AC3A 5DT3A 2YFXA 3MESA 4BCOA 4NL0A 2I0VA 4G34A 1YXSA 5ANGA 1W98A 5FXSA 3NX8A 2GNJA 4G2FA 4C7TA 4MBLA 2UW4A 3OTVA 2UW5A 1FQ1B 1UWJA 4M14A 4F65A 3DK6A 1PXOA 3RJCA 3ZLSA 2FA2A 3Q4TA 4BDDA 4PF4A 4TW9A 5H2UA 2NP8A 5ICPA 4OTGA 3FQHA 3CGFA 2RG6A 3DKGA 3IGGA 3NMUF 2RFDA 4QP8A 4R5SA 3PXZA 4U3ZA 3F82A 4FKIA 5DYJA 4IAFA 2XJ0A 3G9NA 3LJ0A 4GFGA 2QKRA 2WQMA 2ZV8A 3HYHA 3PVWA 2YIRA 3FHIA 3I4BA 3R8PA 4DC2A 4UXQA 2H8HA 1YHVA 3OWJA 2WGJA 4QMVA 4LV5A 2VD5A 3ACJA 3UMXA 3JR1A 2BDJA 2C30A 2W1GA 3KRWA 3TACA 2R3PA 4Y73A 4FODA 2PE1A 3C4XA 1IASA 5A3XA 4ACMA 2OH4A 3UIXA 4BTFA 1U4DA 1XBBA 4BDJA 4JBPA 1RDQE 3V5LA 4CG8A 3ZO4A 4DAWA 5DEYA 4OAVB 2W5AA 1R1WA 3RK7A 2RFNA 4OTPA 4FL2A 5CAUA 5AV3A 4A9UA 3OY1A 2LAVA 2J0IA 3NVMB 2UVZA 1H4LA 1IEPA 1OB3A 2XKEA 4GS6A 3WOWA 5M4UA 3HRBA 5HLNA 1GZ8A 5GJGA 5I9VA 2O65A 4FG9A 3R7IA 3OBJA 3FXZA 3QZGA 4U5JA 3UOHA 3AG9A 4RC2A 1MRYA 3PPZA 4MBIA 3DS6A 5A6NA 2G2HA 4YU2A 4F9AA 4AOIA 2Y4PA 2XYUA 2PVKA 4ASZA 4C4GA 3R1QA 3FSFA 3E92A 2O63A 2F7ZE 2GDOA 2YJRA 4I22A 4IFGA 4UEUA 3ZFMA 1Q41A 3ZRLA 4K1BA 3CPCA 2QCSA 4CD0A 4O38A 2CKQA 2VX1A 3R9NA 2OKRA 4ZJVA 1JWHA 5IQCA 2X9EA 1RQQA 2OIBA 2C3JA 2SRCA 1ZAOA 3TL8A 5C4LA 5IEXA 4RIYB 4FKJA 3L8PA 4CFFA 1OVEA 3NPCA 3T9IA 3L8XA 4LGHA 4QMZA 2FSOX 2YLFA 1JPAA 2WO6A 4EK6A 3ZCLA 1OECA 3FYJX 4O0YA 4RVLA 2I0HA 5HVKA 3JY0A 5CWZA 3ULZA 1ZXEA 4AT4A 2E9OA 2QLUA 4EK4A 3VS1A 3VF8A 2AC3A 4JG6A 4W8EA 5TR6A 2WTWA 4WHZA 5CEPA 1WVXA 1H1PA 3A7FA 4FTAA 3OUNB 3BHYA 3VW6A 5T68A 3N51A 4KB8A 1M14A 4F9BA 4LL0A 5M57A 3LIJA 4BI0A 3UOLA 2C5OA 4FTJA 1SMHA 3QQLA 4H58A 3DKFA 5FEEA 3F61A 4AA4A 1Q8UA 5KZIA 3ZBFA 5KMMA 3U6IA 3UO5A 5FEQA 4BCPA 2WTVA 3R21A 3KB7A 5AR4A 1SM2A 4FV4A 3U87A 4Z55A 5IQAA 3SQQA 2YM7A 5BYLA 1PY5A 4TKSA 3OCSA 3MJ2A 2XIXA 4FZAB 4KIQA 3O17A 2OZAA 1VYWA 4M66A 5H8EA 4PDPA 3D5WA 4Y46A 5EI2A 3CP9A 3W2SA 5IQBA 3RALA 2ZDUA 4PTCA 4AOJA 3UTOA 3NAYA 3TWJA 1W83A 3FMMA 4IX3A 5CU4A 5CX9A 4FTIA 4CZYB 1H08A 1IG1A 2Z60A 4BCMA 4EWQA 3GENA 3KF4A 2QG7A 5AAEA 3TZ7A 1KOBA 4GYIA 4XCUA 4CTBA 4KUJA 1MUOA 2YDIA 2JC6A 2I40A 4RGJA 1OPKA 4Q5EA 3K5UA 4ERWA 3E88A 3G6GA 4FTOA 2ZB0A 5ANOA 2F2UA 2HOGA 3ZTXA 4BDIA 3OD6X 4EWHA 5M53A 3ELJA 2BMCA 4D1XA 3L9NA 1SVGA 4RJ4A 3S2PA 3WBLA 4DFXE 2XIYA 4ZLYA 5J87A 4G1WA 5A54A 3ZO2A 1YHSA 3RP9A 4L3LA 2EUFB 2VTOA 4KIKB 4BWKA 3KC3A 1R0PA 3KXMA 4UXLA 3QHRA 4WRGA 2XK7A 3R9OA 5IKWA 2O64A 2ITWA 4C4JA 4YJSA 4FYOA 4BWXA 3TV7A 3MB7A 5JRSA 4FVQA 2VNYA 5FBNC 2YAAA 2C3IB 2FUMA 3PDTA 4O0RA 3JYAA 2J90A 2V0DA 4V0GA 3WF7A 5EG3A 2QOLA 3RNYA 3R02A 4YTCA 3NW6A 4BDBA 3TZ8A 5DI1A 4AX8A 4QMNA 2PE2A 4S31A 1WVYA 2XK8A 4RA5A 5JGAA 3GOPA 3PP1A 3QX4A 3G0EA 2YHVA 4W4VA 3IS5A 4NEUA 5KKRB 3FY0A 3OXZA 4DBNA 4IVCA 4H3PA 1ZYCA 2XJ1A 5DA3A 5TO8A 5D11A 1WCCA 5FQDC 4IWQA 1Q99A 4ZSAA 4DTAA 3O2MA 3AD4A 1J7IA 4X6QC 4W4YA 3FLQA 4JR3A 4N6ZA 5DH3A 4NT4A 1U54A 4N70A 3VW8A 3EQFA 3TV4A 2OLCA 3FDNA 3CD8A 2X8DA 4FV7A 2I0EA 4QTDA 1H0VA 5A14A 3MH3A 3KKVA 5EM6A 4BKJA 3Q4CA 3I5NA 3HA8A 3Q6WA 3KVWA 1GZNA 5FM2A 3ZDIA 4PQNA 1DI9A 4ZSGA 4EBWA 4AZTA 4FE2A 2HCKA 4X2FA 4ZIMA 3QZIA 4QOXA 1PRYA 4XP0A 5A9UA 1YVJA 2XKCA 1CKJA 2ZMCA 3QRTA 3AT4A 4QP4A 4YJUA 3DBEA 5CEQA 3G15A 4KIOA 5EW8A 3H10A 4FMQA 3BGQA 3OG7A 3LHJA 2CDZA 1WBSA 2JD5A 4RWIA 4I23A 2JIIA 5AFVA 4DH3A 3F2NA 3PJ2A 2FH9A 3KULA 4MXXA 4FTTA 3U54A 3CR0A 4RIWA 3ZUTA 5KO1A 4MWHA 4BCIA 2CKPA 4FZ7A 4UWYA 2C47A 2F57A 2QURA 3EWHA 3ENHA 3EFJA 3FKOA 3OXIA 4YTHA 4AWIA 3F9NA 4I5MA 5CU2A 3V8WA 3QF9A 4CVAA 3SOAA 4F1OA 2XNOA 3EL7A 4IW0A 3U4WA 4FX3A 4UZDA 4BTJA 3O50A 4F64A 3OC1A 2B4SB 5J8IA 2QKWB 2QOOA 3AGMA 3GU7A 1URWA 4YLJA 5AP4A 2BVAA 2XIZA 3PVBA 1YKRA 3F7WA 3ERKA 3CSVA 2PVYA 3W32A 5K5NA 3PXKA 5BVEA 4DG0E 3EIDA 4W4XA 1R78A 3A8WA 3C7QA 1H26A 4JOAA 4FKSA 5EOBA 3WZJA 3PA5A 1ZOEA 5C01A 4OTHA 3TKHA 5AR5A 3VUIA 4BKZA 4CCUA 1G8SA 4U40A 1OIRA 1V0OA 5L6WL 4DH7A 3NNWA 3BZ3A 2IZSA 3SHEA 4F6WA 1RE8A 3DV3A 3HRFA 5DHJA 5C27A 4C3FA 2A0CX 3MH2A 3KGAA 3KY2A 3MS9A 1LR4A 4E6CA 5IUHA 3DJ5A 4KKGA 5LQFA 2OIDA 5LMBA 2CSNA 4OTIA 4YPDA 5CZIA 3ORMA 3R8MA 2XP2A 3H9FA 5AV1A 3MYGA 3F3VA 3FYKX 5BVNA 1J7UA 5FWKK 4CT1A 1L3RE 4OBQA 2C4GA 1XBCA 4PP7A 5EYMA 4CYIA 5K4JA 3RHKA 1RW8A 1WBTA 4WA9A 4AW1A 5LWNA 3UQFA 2VWVA 3C5IA 5B7VA 2GNLA 2RFSA 4RX9A 4NM3A 4XRLA 4GJ2A 3DAKA 3TEIA 4MVFA 3HL7A 4ZP5A 5GINE 3CIKA 1OL1A 3F5UA 3HP5A 4MAOA 4AE6A 4USEA 4DBXA 5I9ZA 1AD5A 2CJMA 2OU7A 3U6HA 4FT7A 5GHVA 3QQHA 1FMKA 2X4ZA 4U3YA 4YURA 4W9XA 3FMNA 2BAKA 4FZ6A 4IWOA 4LL5A 3OWPA 4FK3A 4FKLA 4UWCA 4M3QA 4ANLA 4BC6A 2V62A 3MFTA 3DB8A 4XLVA 3SRVB 2W9FB 5M08A 4DFZE 1PXMA 5GZAA 1TQMA 1O6KA 1NY3A 2B55A 4F0GA 5AUZA 2PUPA 5E8YA 4ZTLA 2CHLA 3H4JA 3LFDA 2WMUA 2JEDA 4YBJA 2C1AA 3H9OA 4GT5A 4EHVA 5FLFA 5HEZA 3RPYA 1SNXA 3ALOA 4AGDA 4TYHA 3MA6A 5HOAA 4A9TA 4G3FA 2WB8A 2WQBA 3TDWA 3DDPA 4U0IA 2BRNA 4UYNA 3M1SA 5DPVA 4A7CA 4KIPA 5EH0A 4CFXA 3IKAA 4Y95A 1R0EA 3LZBA 4HYHA 1GAGA 4O22A 2ZJWA 3Q60A 3FY2A 3HP2A 5AP5A 4UMRA 4ASDA 4PTGA 2ITNA 4AW0A 3GVUA 3UMWA 1V0BA 2RIOA 5H9BA 2ERKA 4DN5A 3QD0A 5JGDA 2J9MA 3Q96A 2WTIA 2V7AA 3TTJA 5J5SA 5B2MA 4JNWA 3PJCA 3W2RA 4D1ZA 3MPAA 3JVSA 3NLBA 4JR7A 5LJJA 2B7AA 3HVCA 4P5QA 3TNIA 3W8LA 2XIRA 4I0RA 1OGUA 3HMOA 1O6LA 4CMOA 4LMUA 5DMZA 5M09A 2X39A 3MBLA 3RGFA 2WMVA 3VAPA 4EORA 2PL0A 1OM1A 3W2OA 4ANQA 2JBOA 4OBOA 4GT4A 2B9JA 4UY9A 4D2VA 4E4LA 4XV3A 1YWRA 1H1WA 5HG7A 1GZKA 3IW7A 4C61A 5ANIA 5TKDA 4PNKA 4KBAA 3O8PA 2X7OA 4X21A 4BCQA 2X6EA 1YQJA 3HLLA 2QOKA 1MRVA 4D2RA 4D2WA 3CXWA 3NUPA 4X3FA 2R3QA 3JUHA 5FTOA 5C9CA 5CEMA 2DUVA 1UU8A 3LCTA 3OEZA 3LLAA 4WG5A 4FV5A 3VS5A 1BL6A 3OBGA 4R6VA 2HY0A 1YWNA 3FZ1A 4YZBA 4AW5A 4B7TA 5CEKA 3LJ2A 5GJDA 3S4QA 2OXYA 1IR3A 5DVRA 3A4OX 2OIQA 4QT1A 4FKTA 3SAYA 3GU8A 2CPKE 2R3FA 4RIXB 4FGBA 5AR3A 5HX6A 4P4CA 3LQ5A 5IA3A 4YLLA 4IAAA 1Q62A 3FSKA 5IQGA 3T3UA
chains in the Genus database with same CATH superfamily
3F2RA 4WBBB 2PVNA 5CT7A 5BMMA 3ODYX 4JLCA 1KUTA 1KE9A 2HZIA 4CKIA 2OW3A 4G16A 3RI1A 3REPA 5LMKA 3FI8A 4DCAA 4S30A 3QCSA 5ANEA 4EK5A 3HA6A 1S9IA 4I6HA 5DG5A 2JDSA 4U80A 2CMWA 5AUVA 2H9VA 2AYPA 3HV6A 1VEBA 4DFNA 3QQKA 1IAJA 3PPKA 4L68A 4M8TA 2BZJA 3KXZA 1QMZA 4XLIA 3QTIA 5EW9A 4ENYA 1NW1A 4XHKB 4YR8A 4BZDA 3PIYA 3CEKA 1W0XC 3UZPA 4QDVA 3KXHA 3UNKA 4M84A 3V5WA 4AP7A 3TDVA 4Z3VA 2JFMA 4HZSA 2IW9A 3BBWA 5LXMA 1OUYA 3R28A 2UW6A 2UW0A 2X9FA 3SXSA 5LOHA 4BCFA 4JRVA 2UZTA 5FXRA 3I1AA 2OF2A 1ZLTA 4LFIA 3UVQA 4CFUA 3TCPA 3TJCA 4OUCA 4AFEA 4J1RA 4AN2A 2YIQA 3MVLA 4ZY6A 4BCKA 3KK9A 2GCDA 3QTRA 1H25A 4NWMA 5K3YA 4QP1A 4WSYA 2WKMA 3MJ1A 4H3BA 3TG1A 2AUHA 3CQWA 2A27A 2UZOA 4BZNA 4CRLA 4IAZA 3UZTA 3KMWA 4FA2A 4L6QA 2JBPA 4IM0A 5HU9A 3C4WA 4YHFA 1PHKA 5HO7A 2YCRA 4F70A 4FNYA 2HW6A 3IOKA 5CT0A 5DBXA 3QTZA 4C57A 4MHAA 3UJGA 3W2PA 5IA5A 5IUGA 3SX9A 4S32A 3UPXA 4ZMFA 3ORXA 3WF6A 2C6DA 4TNDA 3V8SA 3GEQA 2XYNA 2BROA 4O7YA 3PSDA 3DNEA 1OL5A 4FICA 4LG4A 4C4EA 4CYJA 4DE4A 3UC3A 4FUYA 3CJGA 4EUTA 3R9RA 3GCQA 5HTCA 5M06A 1STCE 3MIAA 4DCEA 3MWUA 4E1ZA 4KABA 4GFMA 5KHXA 3D5VA 4IBMA 4P5ZA 4IAKA 5BNJA 3ZUUA 4O83A 2WEIA 2YITA 2C68A 3ZSHA 1OL2A 4BBFA 3ZMMA 4LRJA 4FKOA 5CANA 4K8AA 3ZO1A 5KKRC 3JPVA 3PJ1A 4F78A 2QHNA 5HTBA 5J5TA 3DPKA 3HZTA 1SNUA 4YC3A 3R7YA 3TIYA 2CCHA 3WE4A 4AGUA 4BJJA 5C8KA 1Z57A 3E62A 3FZRA 3P79A 3OCGA 3QC4A 3SC1A 4TYIA 2R9SA 3OFMA 3GU4A 3W16A 4D4VA 2BZKB 2Z7QA 4QRCA 3KRRA 4UBAA 4X7QA 5E8SA 1JAMA 3NUSA 4I4FA 3RAHA 3CD3A 2J0LA 3B2WA 4H1JA 4UALA 3ALNA 1CSNA 3FBVA 3Q4ZA 3D94A 4ANMA 4EOOA 3DLZA 1WFCA 3P23A 4HCTA 4PV0A 3VNTA 1PW2A 4ANOA 1LEZA 4O0XA 2P55A 3GI3A 4FTRA 5CSWA 3VO3A 4QQTA 3C5UA 4YC6A 5HIDA 3TV6A 2J6MA 4D5HA 2YABA 5IUIA 4WSQA 2GU8A 3ANQA 4BCJA 2YAKA 3HMMA 3AXWA 3R63A 5BUIA 4RX8A 3OHTA 5KUPA 4DFUA 3KRXA 3L1SA 1Q61A 3QQJA 4AS0A 5JQ8A 3LQ3A 2VTSA 1Q8TA 3SXRA 2YZAA 4U9AA 3ROCA 1TVOA 3DOGA 4KINA 3NZ0A 4EQMA 5AV4A 1Y6AA 4BN1A 3UQCA 5J7HA 3LOKA 4TWCA 4TWPA 2PMIA 4JDJA 3ZSIA 2UZNA 3DGKA 4YNEA 1PMNA 2QI8A 2EB3A 3QZHA 4Y83A 3HMNA 5B2LA 2PMOX 3E93A 3P7CA 4W9WA 1XH5A 1OKVA 3A8XA 2W5HA 3CY2A 3FHRA 4RX5A 2QG5A 4DEHA 4L42A 1KSWA 3P0MA 1UWHA 5AX9A 4FOCA 5KBRA 4TL0A 2OWBA 4I3ZA 4ZSEA 3VJNA 5AP2A 2I7QA 4UWBA 2WELA 5EYDA 3L9MA 5JFXA 3FI2A 3C4FA 2WXVA 5EHOA 3BLAA 4KWPA 3LFAA 2R3GA 3MY5A 4FIEA 4ZJJA 4EH3A 5L3AA 3EKKA 4GSBA 4FG7A 4WBOA 2F7EE 4X2GA 2GMXA 4O91A 3L9LA 1AGWA 3V01A 3BL9A 3ZRMA 1BI7A 2ZYBA 3QC9A 1KOAA 4TTHB 4J98A 2V22A 1WBNA 5E8VA 4AOTA 3D5XA 5EFQA 4N4SA 2ITTA 2QOHA 2OJGA 2VWIA 3HNGA 2YN8A 5AUUA 3W33A 2ESMA 3BBTB 3G0FA 4PRJA 4TXCA 3UO6A 5IA1A 3PFYA 2A19B 3IK3A 4BVUA 5ACKA 4JG8A 3R71A 3F5PA 3VS4A 4I6BA 4OBPA 4YZCA 1W7HA 4L3JA 5AP7A 4LYNA 3KMMA 2BKKA 2XVDA 1AQ1A 5J7BA 3EFLA 4QQCA 4YZNA 2XCKA 4MF1A 4YO4A 4R78A 3DJ6A 3KU2A 2F49A 3K2LA 4H3QA 2FO0A 4K9YA 2GPHA 4UMTA 4GT3A 2H96A 1OIUA 3TKIA 4HVSA 4U45A 3R9DA 3WZEA 3KQ7A 4F0IA 3RNIA 2IPXA 4MYGA 2VGOA 3ANRA 3E3PA 1B6CB 3HAVA 1BL7A 4FTUA 5FXQA 3BELA 3LFBA 2XNBA 4FZFB 4JQ7A 4O21A 5K4IA 3KCKA 3AT2A 3UYSA 3Q52A 4IMYA 4EH4A 2QR7A 3ATTA 1XH8A 4IC7A 4LV7A 1NVSA 5AR7A 4D58A 3QRKA 2B1PA 3NUNA 4BCGA 5HO8A 2NYAA 2PTKA 2PZRA 5ACBC 4ENXA 3ZEPA 2W0JA 4F63A 2ONLC 2QC6A 3NUYA 4D4SA 2HZ4A 1FVTA 3FJQE 4G6NA 2PULA 1WBOA 1W84A 4EH9A 3C50A 4OTDA 3MTLA 3U8WA 3MI9A 3Q6UA 4IE9A 4QP6A 2Y4IB 5L4QA 2Z7SA 5E90A 4EH5A 4Z7HA 4QMPA 2UZWE 3FXXA 4D9TA 3QWKA 3UP2A 2X6DA 4RLKA 2I0YA 3PJ3A 3GGFA 4IHPA 4EYJA 1DAYA 2PUNA 4HVHA 2F7XE 4FKRA 4KA3A 5CF5A 1Q5KA 2JGZA 1J7LA 2X0GA 4F7JA 4ZZOA 4KD1A 3W1FA 3PVGA 4H05A 3P86A 1SYKA 2BRGA 4RVTA 4MXOA 3P5KA 4TWOA 4BDFA 1K2PA 2J50A 3DTWA 1YWVA 2PE0A 5CSVA 1GOLA 2J51A 4QP9A 3WIGA 5JMSA 1PXKA 2ZDTA 4KSPA 5F20A 4DH1A 4F9CA 4RIYA 4K2RA 2W4KA 4ASEA 4GH2A 3DKOA 2OF4A 3E3BX 3HECA 4ZSJA 4NJDA 3F88A 4V04A 1Y8GA 4O7VA 2OXXA 3MPTA 3BGPA 1GJOA 3NCZA 4MCVA 3TXOA 5KMIA 3UVPA 3VS6A 2PYWA 4QPSA 2F9GA 4A4OA 2XNPA 2EWAA 3DQWA 5HBJA 1P5EA 3TUBA 4Y85A 4WNPA 3FL5A 3LMIA 5E8UA 2H34A 4FYNA 1UKHA 1BYGA 4RWLA 3IW6A 4DITA 4A4XA 5IA4A 3E63A 3V8TA 4C36A 5J1WA 2JIUA 3F3UA 4MKCA 5LVOA 3Q2JA 4CG9A 1Q3DA 4DTBA 2VO6A 1FOTA 3I6UA 4ACDA 3LM5A 4FTCA 1G8AA 3P08A 4DGLC 5G1XA 3EQBA 1OMWA 4EC8A 4JBQA 3BI6A 1ZOGA 3FQEA 3IQ7A 3F3ZA 2BUJA 3L8VA 3PPJA 5I9UA 3RCJA 3VULA 4WIHA 4GRBA 5ETIA 4NCTA 4I0SA 5FGKA 2F4JA 3DK3A 3E7OA 1PXIA 4X2JA 2VAGA 4X2NA 5DRBA 4U97A 4XS2A 2JFLA 2XRWA 4I41A 4LRMA 5AV0A 1Q8YA 4G9RA 2Y8OA 4AUAA 3AGLA 5BVOA 3MH1A 4ZMEA 4GG5A 4AAAA 4HGEA 3GC8A 4NZWB 3BIZA 3FMDA 3PVUA 3M11A 1DM2A 4LQMA 4QTAA 2WPAA 4TT7A 3T9TA 1GY3A 4II5A 3AKKA 3QQFA 3I7BA 3PE2A 4O0SA 4XP2A 3PXYA 4RC3A 4BCNA 1QPCA 4NKSA 4BDGA 4CCBA 2JIVA 3O51A 4O4BB 3DFAA 5A6OA 4PPCA 3ULIA 4ZY5A 5HE1A 3SW7A 5H8BA 1OPLA 2R0UA 3DK7A 4QYHA 4HOKA 2WAJA 1FGIA 4RJ3A 4O4DA 3W10A 2VV9A 4E3CA 1OIYA 3HMIA 3D4QA 1GZOA 4PP9A 3R8VA 4FTMA 2Z7LA 2WU7A 3AD6A 5AMNA 1PKGA 4YPSA 2YJSA 4BKYA 4KRDA 2P2HA 5JFVA 2XAMA 4RC4A 1TKIA 5EHYA 4FIFA 5HE0A 2HZ0A 2ACXA 4R5YA 4CFMA 5CVFA 4DEDA 4TNBA 4OGRA 1U46A 2UVXA 3HX4A 2IJMA 1XH7A 4I1ZA 1UNGA 5LVLA 4DH5A 4AA0A 2EXCX 1H00A 3O0GA 3D0EA 3DDQA 1J1CA 2WQOA 4IXPA 4FNWA 3ZLWA 5BYYA 4FVPA 4EK3A 4GKHA 3AOXA 4XX9A 1UU9A 2C6OA 3OOGA 3VQHA 4ACHA 4LDTA 4EH6A 4FJVA 2WEVA 4PDSA 1HCLA 4C3PA 2VWBA 1YI6A 3OT3A 4D0WA 1YOJA 5M4IA 4M69B 2O5KA 4FEWA 3O7LD 1UNHA 5JK3A 3R6XA 4O6LA 5A4TA 3KIOC 3C0HA 5C26A 3QAME 4XG7A 3A62A 3BWFA 4L01A 5DFPA 3CJFA 1HCKA 3C9WA 1Y57A 2HW7A 3BHHA 3E64A 3OTUA 3P9JA 4FV3A 2OGVA 4M12A 4CSVA 4F6UA 5T3QA 4RJ5A 5EI6A 4ACCA 2HXLA 4ID7A 3UNJA 3WI6A 4O27B 2VRXA 5AJQA 3E8EA 3TNWA 3UNZA 3VBVA 5CAQA 4CQEA 1M7QA 2BAQA 2H6DA 3UBDA 3VBYA 3RAIA 4P2KA 2DYLA 3RPOA 3EN7A 5ETCA 2X0QA 3QHWA 4QYFA 2X1NA 4BBEA 4QMWA 3H0YA 3W55A 4YHTA 3QXOA 2GNGA 4FTQA 2GFSA 4PL3A 4C2VA 5I4NA 2VO0A 4QNAA 2BHEA 4BRXA 2X8IA 3GBZA 3IDPA 2C3KA 5HNGA 3RK9A 4FV2A 2WMQA 4Q5HA 4RVKA 2OJFE 3GC0A 4FTLA 4RA4A 4V05A 4EJNA 4EOLA 3CLYA 3EHAA 2VGPA 2XK3A 3HDMA 3IG7A 3S1HA 1KE5A 3GCVA 1CKPA 3ORPA 4RBLA 3RVGA 2GS6A 3IGOA 1VZOA 4PNIA 5FTGA 2BRMA 4LI5A 2Y7JA 3D2KA 1GNGA 1OITA 2YCFA 4JQEA 5IH6A 3I0QA 4FC0A 4Y5QA 4FV6A 1FINA 1P14A 3ZC6A 3KREA 3EYHA 4QPAA 3KN5A 3LQ8A 4MWIA 5C4KA 2PZ5A 4IADA 4QMSA 3ORTA 1H1SA 4O7ZA 3GCPA 5HKMA 3QA8A 3F3WA 3UOKA 2VUWA 2WOTA 4IB3A 3LXPA 3R2YA 1S9JA 3LM0A 2AQXA 3L9PA 4FI1A 2PMNX 3FWQA 4DGOA 4TPTA 3AC2A 3ENMA 4IDVA 3DU8A 3KRJA 5JH6A 2PY3A 3EZRA 5HE2A 4B0GA 2E9PA 3QBNA 4I4EA 3VIDA 4M67A 3O96A 3TNQB 3AMAA 4L8MA 2J0JA 4APPA 3BEAA 4KIKA 4FSMA 3UOJA 4XOZA 3VHEA 3BEGA 4BICA 3FPMA 1JKTA 5D41A 3OUKA 4C37A 2R3OA 3RAKA 3QKKA 4RT7A 5AP3A 2WMTA 1P4OA 4ARKA 4G3CA 1PMEA 1PMVA 4QTEA 1DI8A 3FE3A 4C38A 2ETRA 4BDAA 5LVMA 2G1TA 2RGPA 4U8ZA 5AV2A 1URCA 1OL7A 2ZM1A 5M44A 3EQGA 3NYNA 3NYVA 4DHIB 5I9XA 4PTEA 5AM6A 2XF0A 3LLTA 3UIUA 1GIHA 4YLKA 1DAWA 4YZ9A 2W1FA 3RZFA 3TIZA 2PPQA 4MX9A 1Y8YA 2HY81 3PXRA 4L7SA 3CPBA 4GK3A 4R77A 3FMKA 3G6HA 3PSBA 3VUDA 2QHMA 2QLQA 3ET7A 2XRUA 4HPTE 2UZUE 1G8JA 1XR1A 2C5NA 4GU6A 4IVAA 1E1VA 3EN5A 4GCJA 2VZ6A 2WIHA 1OPJA 5M51A 3HEGA 3TTIA 3OWLA 1FVRA 3CKWA 3UDTA 3R9HA 2W05A 2QVSE 2LGCA 3SD0A 3E8CA 5A4CA 5EM7A 3HV4A 2WTJA 2R3RA 5HI2A 4YO6A 2A4LA 4IWDA 5DEWA 3RMFA 4E5BA 4CTCA 3OP5A 1APME 4L7FA 4LUEA 3R7UA 4AFJA 4CZTA 2B54A 5AP1A 3HAMA 2EVAA 1ZMWA 3BYSA 1H27A 2R7BA 3I6WA 4XRJA 4AQKA 4LOQA 3G33A 4ONAA 4C8BA 4XV9A 1XHAA 3DBDA 4BHNA 4NIFB 4M97A 3LFFA 3F69A 5A46A 3BYOA 4R1YA 4RFMA 5DOSA 3EFWA 3T8OA 2WTKB 2X2LA 3F7ZA 3QTSA 5IQIA 2GQGA 4BDCA 4UV0A 4D0XA 4FK6A 4KNBA 4BCHA 4ZLOA 5IISA 1JSUA 4CKJA 4FSTA 4XG8A 1BKXA 2XCHA 2W1DA 5EK7A 4JJRA 1OKYA 4IB0A 3H30A 2B53A 3NWWA 1T46A 5CU0A 1Q97A 3FLSA 3N4TA 3G9LX 4D2SA 4ZS0A 2WNTA 3ACKA 3COKA 3FLNC 3K3JA 2IZRA 3CC6A 4IANA 2W99B 4RZWA 3D7TB 2Y4IC 4DHFA 5JT2A 4OT6A 1VJYA 2BKZA 4LV8A 3DFCB 3BE9A 4U7ZA 3UG2A 3ZZWA 5AM7A 2YWPA 4BBMA 4EOKA 2ZB1A 2W4OA 3FLYA 5CASA 4RRVA 5ETAA 3BQRA 3A7GA 3LPBA 5AUWA 4A4LA 4AXAA 1Q4LA 2CGXA 4EBVA 5IA2A 4AAYA 3W0SA 4Z16A 4F09A 3QUPA 2PU8A 3QWJA 1OL6A 5F4NA 3N4VA 1KV1A 2PVHA 2QR8A 3R30A 5HNBA 4IH8A 3PWYA 3P5JC 4CZUA 1NVQA 3LCDA 4OAUC 1M7NA 4HGTA 3WF5A 1YXVA 4JIAA 4DGNA 3R83A 4YJTA 4O0WA 4OR5A 2YCQA 5HIBA 3UIMA 4S2ZA 4TZRA 5HORA 2KTYA 2KULA 2XBAA 4DGMA 5AAFA 4J71A 4DTKA 4NSTA 4EQUA 2YM3A 3QUEA 3C1XA 2XH5A 3EFKA 5ANKA 5I3OA 3COMA 3WYYA 2WMWA 2QOQA 3W0OA 4WUNA 4FBXA 3BU5A 4PY1A 1T45A 3A7HA 4FSWA 2HZNA 2YIXA 3PUFC 1JSVA 2RG5A 3ZC5A 3S00A 2C5VA 3F6XA 3A2CA 3HV7A 3G90X 1JSTA 4WG3A 2JDRA 3D9VA 3SRVA 3Q32A 2XM9A 5L2SA 5BYZA 5I3RA 3FL4A 2ONLA 4DEIA 2ITXA 2B0QA 3PA3A 3O71A 4O0VA 4EZ3A 4YJPA 1FMOE 5H3QA 1Q24A 2Y0AA 3IDBA 3QTQA 2BTSA 4X3JA 3EYGA 3LCSA 3W2QA 4AACA 4CNHA 5BVWA 2XMYA 3E7VA 2EU9A 3FMEA 1A06A 3ZLYA 5JKGA 2W7XA 4XOYA 4CRSA 4G5JA 2UZBA 3BWJA 5J1VA 4U44A 3VRZA 1NXKA 2C0IA 3FLZA 3O8UA 3DKCA 2E9VA 2VTHA 1MQBA 3H0ZA 4JBOA 4JVGA 4FKUA 2UV2A 4PDOA 3CE3A 4JAJA 4IM3A 2VTRA 4QMUA 5TF9A 1XH6A 4FEQA 4G5PA 5I5ZA 4S34A 2R64A 3MY1A 1REKA 5AUTA 2FSTX 3LE6A 1CM8A 5CS6A 2PVJA 5CAPA 2E2BA 3DLSA 4IZ7A 5BUJA 4TRLA 4PWNA 2C6TA 4XBUA 1PXJA 3UODA 4ITIA 5KMOA 4E20A 4JG7A 2HIWA 2IZTA 4FKWA 4IM2A 4M15A 4TYJA 5KMKA 4O1OA 4R8QA 4FGRA 4MEDA 4YHJA 4ZTHA 5BVKA 3Q3BA 2YM8A 4DH8A 2HK5A 5FP6A 5HCYA 4CLJA 4WNMA 2C69A 4WNKA 1BMKA 4D5KA 2XA4A 3V04A 4C02A 2OO8X 2VWYA 5CI6A 4IIRA 3K54A 1UA2A 3UZRA 5JZJA 4JXFA 1M2RA 3W8QA 5CSHA 3POOA 1SVHA 3PRIA 4FNZA 5G6VA 3WARA 3UG1A 3QRUA 3LFQA 4QMYA 4G6OA 4EOJA 4MNEB 3UDBA 1JKKA 2J5FA 1JLUE 4BYJA 4EK8A 2JLDA 4FVRA 4L53A 4QDEA 2G2FA 4BI1A 2HENA 4FV1A 4L44A 3ZBXA 5LARA 2X81A 4UYAA 4D4YA 4Q9SA 5F94A 4HPUE 3FC2A 2WQNA 4R7HA 3NAXA 2E9NA 3TJDA 2ZVAA 2XARA 4E7WA 3QFVA 2QOIA 5LWMA 4IACA 3SV0A 5IMEA 3R1YA 4PPAA 4F9WA 4H39A 1WAKA 2ITQA 3OCTA 4YBKA 2JKOA 3ZRKA 3I0OA 2OFUA 5HTIA 3FC1X 2ITZA 3BRBA 2HWOA 3DA6A 3U51A 4XG4A 3MH0A 4DYMA 2QOFA 4UX9A 2Q83A 4YMJA 4RIXA 3GUBA 1ERKA 2R3MA 4FG8A 5JZNA 5E92A 4RLLA 3WZUA 4EYMA 2XKDA 4G17A 1FVVA 3VS3A 2DS1A 2GHMA 1H1QA 2C6EA 3G2FA 2XK9A 5JSMA 1CKIA 5AEPA 1XO2B 4XV1A 2RSVA 3QCYA 4J97A 4FSRA 5D9HA 1XH9A 2W06A 2FSLX 3GNIB 4QMMA 2PVLA 3DZOA 3LFSA 4FL3A 4G3GA 1KE7A 5AADA 5CF4A 4IZ5A 3ZXZA 5AR2A 3SVVA 1R39A 4FIHA 3R7OA 2GS7A 4A9YA 3NNXA 4QMXA 1XWSA 3AMYA 4J52A 1H01A 4O84A 4CFNA 2QU5A 4AXCA 2OJ9A 4FIGA 3ORKA 4AZWA 3EQPA 3UPZA 4GK2A 3RPRA 4I20A 5BUEA 2I6LA 4L67A 3R8LA 3NYOA 3CTJA 3COHA 3PY1A 3PSCA 1GIIA 5IEVA 3C4CA 1TFFA 2X0PA 3NS9A 3D2IA 3Q04A 4MNEA 1UV5A 3QYZA 4RQVA 4AQCA 2WMAA 3QTWA 3LCOA 3ZYAA 2BILB 4AGWA 1QPDA 5EDPA 3ZS5A 2BZHB 3LXLA 4DLIA 2FB8A 2PMLX 4FUXA 4K0YA 3SG8A 4CGAA 4Q2AA 2W9ZB 4HGSA 2ITOA 3F5XA 5DWRA 3O8TA 2YDJA 1J1BA 2I1MA 5L8LA 3FLWA 5CU6A 5AIRA 4LUDA 3R8UA 4J8NA 2P3GX 4CT2A 3NUUA 1K3AA 1Z9XA 2W1IA 4EZ5A 3BX5A 1NVRA 3Q2MA 3BYMA 1JQHA 2O3PA 2UZVA 2W5BA 4FSNA 2PUUA 1OKZA 3QX2A 1P4FA 2UW9A 4DDIA 5AP6A 4EKKA 2DWBA 2BZIB 3QYWA 4QYEA 4GUEA 4ZTMA 2XS0A 5F9EA 4NYEA 3JXWA 5FG8A 3EQRA 4EH8A 2Z7RA 2R3LA 1PXNA 4JIKA 4D2PA 2YIWA 2G01A 3H9RA 1Q8WA 3DQXA 4LM5A 5CVHA 4B8LA 3ATSA 3IW4A 3MVMA 1VR2A 1IRKA 3KFAA 4KKHA 3QTUA 4XMOA 2CNQA 3CQEA 4DEGA 1JOWB 3LCKA 4J53A 3DAEA 3O23A 1W2DA 4IEBA 3B8QA 4HCUA 3DCVA 2BAJA 3FMLA 4KS8A 3KA0A 3IOPA 4ZXTA 4ZS4A 3VF9A 5CYIA 4YJVA 2VTQA 4NH1A 4WG4A 1MP8A 3BCEA 4NJ3A 3LFNA 2W1CA 4TY1A 3UE4A 2CGVA 2GTMA 1U59A 4YSJA 1ZYJA 4EC9A 4GFOA 5LVNA 5HICA 3KRLA 3V3VA 2WMRA 4G9CA 4E26A 3DXPA 1WZYA 2VWZA 3B2TA 4BZOA 3I60A 4MTAA 5DN3A 3C0IA 3VBTA 4LRKA 1YOLA 2WD1A 3HV5A 4KBKA 3BU6A 4HGLA 3R2BA 5JGBA 4FTNA 5EYCA 3EQCA 4L43A 4IVDA 4J8MA 4G6LA 3QKMA 2C5XA 3WZDA 4G31A 2VN9A 4O2PA 5KCVA 4HYSA 2A98A 2HYYA 3Q5IA 5JQ5A 4ZTSA 4QNYA 3H3CA 2XJ2A 1QPEA 2IO6A 2OFVA 4GEOA 5E8TA 3LAUA 2WTKC 3QD3A 3DTCA 3GXLA 3AC1A 3DXNA 4J95A 4ZJIA 3Q9ZA 3QTXA 2WMBA 5HVYA 2OK1A 3UQGA 4Y72A 2VTAA 4I24A 4ZZNA 3ML1A 5DR6A 3QGWA 4YTIA 3BKBA 3L8SA 3LVPA 2VTLA 3QLFA 2PZIA 3VS0A 3FZSA 1HOWA 3HV3A 2VNWA 3UC4A 5HE3A 5CEIA 1ZMUA 3V5TA 3KVXA 2CKOA 5BQ0A 3KEXA 3THBA 3NVKI 4RFYA 5AUXA 3AC8A 4RFZA 4WNOA 3V5JA 4E4XA 1I44A 4M0ZA 2X8EA 2R5TA 4OTQA 3RWQA 4ASXA 2ERZE 5EOLA 4U42A 3CQUA 3IONA 2PZYA 3ZONA 4F6SA 3AD5A 3UGCA 4OT5A 3D15A 4Q9ZA 2WTCA 4NFNA 2BHHA 4IWPA 4OTRA 3R1NA 4NU1A 5E8WA 4MK0A 2J4ZA 4EEVA 1CDKA 2C6LA 5L2QA 4QPMA 4IB5A 3WF9A 1H28A 2PUIA 2IW8A 3V51A 4DEAA 4D4RA 2C3LA 3KCFA 4FT5A 3VC4A 4C4HA 3C4EA 5LCJA 1W82A 3SLSA 4TYEA 3MTFA 2R2PA 1Q3WA 5GIPE 4GMYA 4R7IA 3QA0A 3EKNA 3E87A 3HKOA 4IFCA 4CFWA 5E4HA 3SG9A 3MA3A 4EZ7A 5HVJA 4X3FC 1UU7A 4GVAA 5EDRA 1MRUA 1YHWA 3BV3A 2YIYA 2EXEA 4PUZA 3GC7A 3VUGA 5HIEA 1JNKA 2W96B 2QQ7A 5HBHA 3EQDA 5HCZA 4O2ZA 4BTKA 3BLHA 4Z7GA 4X6RA 4O7LA 3GFWA 4GIHA 4JDKA 4D1SA 3AQVA 3CTQA 3NIZA 2Z2WA 3M42A 2BR1A 3IDCA 4I93A 3QUDA 4AA5A 3UVRA 1E9HA 2B9IA 2FGIA 2GHGA 3PE1A 4GJ3A 2XALA 3NNUA 4HYIA 3ZU7A 5AWMA 1YDRE 3DBCA 2XBJA 4Y5HA 4UMQA 5CEOA 3QGYA 2EB2A 3CBLA 5TE0A 3W0PA 4EHGA 4MD9E 5LMKC 3CKXA 4MXZA 4AXDA 2V5QA 3E8NA 3ZFYA 5E7RA 3LJ1A 4FTKA 4BDEA 3OW4A 2Y9QA 3TZ9A 1PXLA 4E5AX 1KE6A 5FDXA 5BVFA 4TYGA 2W4JA 5CQUA 5GZ8A 2R4BA 4JBVA 5LCKA 3UIBA 3D14A 1YDSE 3BPRA 4FT0A 4O7WA 4JL9A 3TI1A 5FD2A 4I5HA 4OLIA 4NM5A 3ZM4A 4QTBA 2WOUA 2BIKB 5DT0A 3GFEA 4LGDA 3U55A 4FSYA 5FUTA 2Z8CA 4CFVA 4DG3E 2IZUA 3TUCA 4BYIA 5CXZA 4XG3A 4GG7A 5CF8A 3F66A 2C0OA 3RWPA 5D7VA 4XV2A 5HG8A 1KE8A 3DT1A 2OZAB 3LXNA 2CN8A 1XJDA 5E1EA 2WZJA 1PJKA 3WIKA 3FI3A 3BHVA 4HW7A 4ZY4A 2XKFA 3RBWA 2VWWA 3ZH8A 4D9UA 2VTMA 4L3PA 3WILA 2JDVA 1E1XA 2BALA 2AC5A 5EKOA 3MVHA 3R00A 1M52A 2NPQA 2X0OA 2WQEA 3HUCA 3ORLA 5M55A 5CI7A 1IA9A 3IECA 4HCVA 5IPJA 1IA8A 5CY3A 1YW2A 3ORIA 4KRCA 1U5QA 5EQPA 3MIYA 2C6MA 4P90A 4GU9A 4MD8E 3U6JA 4E73A 5HD7A 1QCFA 4E4MA 4C33A 2ITPA 4FV8A 1ZMVA 3RCDA 3W2CA 4FEVA 1H1RA 4NTSA 2YEXA 5F1ZA 3PZHA 4NM0A 3ZO3A 2GNFA 2IG7A 3LFEA 5DLSA 2CLXA 2VTIA 2YM6A 3POZA 5L2IA 4A07A 3VRYA 4R3PA 3HMPA 4MXYA 4BFMA 3QU0A 4C0TA 2ZM4A 4EOQA 4O1PA 5TT7A