4ACGA

Gsk3b in complex with inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
350
structure length
350
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Discovery of novel potent and highly selective glycogen synthase kinase-3 beta (GSK3 beta ) inhibitors for Alzheimer's disease: design, synthesis, and characterization of pyrazines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4acgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4acgA01
4BGGA 2EXMA 1I44A 5CSXA 4WO5A 4FIJA 1H1SA 3BEGA 4ZZOA 5B2KA 4HCUA 3ENHA 3ZFXA 3RK5A 5JGAA 1PXIA 3A7JA 3OXZA 4F9WA 3LMHA 1T45A 1V1KA 2VTIA 4PRJA 4Q2AA 4LOOA 4RJ5A 4E1ZA 2J7TA 2RFEA 2GNFA 4PDOA 4D58A 5HKMA 4KBCA 4CZYB 3GFWA 3LXLA 4MX9A 3ZUTA 4R3CA 3CXWA 2YABA 1H0WA 4DFNA 1UVRA 2E9VA 4IX6A 1PF8A 4FV9A 1OPJA 4BL1A 5IQDA 4NM0A 5E8VA 3O51A 3EYGA 3ZRKA 3L8VA 4BF2A 4JDJA 3D4QA 3FLWA 3BYSA 5AM6A 2JD5A 2VX3A 4QMUA 5CSHA 2XS0A 3QTWA 4ZTHA 4EQUA 4EWQA 2IZRA 5FEDA 5GZ9A 4FG8A 3MESA 2UW9A 1O6YA 3VUIA 3MJ1A 2JBPA 5HO6A 2IG7A 3MFSA 4TPTA 4JLCA 3PRIA 1UV5A 2BHHA 2I40A 5E4HA 3KXMA 4LMNA 3UBDA 2BIKB 4FTQA 4M7IA 3P08A 1SM2A 3E88A 3MA6A 4Y8DA 5J79A 5LVPA 3EFWA 1URCA 1XJDA 2RFDA 2BVAA 3OCTA 4D5HA 2UVZA 3BE9A 4GT4A 2JFMA 4QD6A 3G5DA 2W1DA 5AEPA 2H9VA 3TZ8A 4QPMA 1PXJA 1F3MC 3C4ZA 3RHXA 4KUJA 2NP8A 4BTKA 1M2RA 5IUIA 4FNZA 5D10A 3EL8A 3UMWA 2VTAA 3PYYA 5J1WA 1OKYA 4R5YA 4AZVA 4GCJA 5AP3A 2J0LA 4Y83A 2OJIA 2QLUA 3CTJA 4DTKA 2XRUA 2C5VA 4RJ8A 4M84A 1JSVA 3VS1A 3G90X 5D1JA 4BCMA 2DUVA 3MTFA 5DNRA 3V3VA 4CT1A 4XG2A 1O6KA 3TM0A 5FG8A 4X2FA 4L9IA 4NYEA 2BDWA 3VUDA 5L2IA 5TT7A 5FTQA 4ZP5A 5HLPA 1GNGA 4EJNA 3S0OA 4FZ7A 3WZJA 2PK9A 3BI6A 4K33A 2W06A 4P4CA 5AP0A 4RIOA 3QQKA 5LVLA 4C02A 5AA8A 5K0XA 3FQSA 4UZDA 5M4CA 2BROA 1H8FA 4TKSA 4WBOA 2HW6A 5AP5A 1O6LA 4L7SA 3QKMA 1OBGA 3ATSA 1WFCA 3MA3A 4EC9A 4PPAA 4UWCA 3LFBA 5AV2A 4BTMA 4DEHA 1BKXA 4X2KA 2PYWA 2R3LA 4RQKA 5FDPA 4F0IA 2GFCA 1Y57A 4V04A 3DZOA 2VO6A 3GCSA 3R83A 4ZEGA 3RGFA 5J7BA 4QQJA 2QVSE 5G1XA 2GTMA 4IEBA 5M55A 3HVCA 2X6EA 3I1AA 4RMZA 4ANMA 4YU2A 5CU0A 1BMKA 2Y0AA 1KE6A 3FKOA 3WYXA 3ZYAA 4FSYA 3F9NA 4MD7E 2G2IA 3R30A 3F5GA 3Q4UA 2DQ7X 2R3FA 4QTAA 4YLLA 4YZNA 2V7AA 1A9UA 3BU5A 5JGDA 3QQFA 1MQBA 2X2KA 5E91A 4X6RA 1M14A 2GPHA 3R7UA 4IH8A 4RX9A 1J91A 3EQIA 5E92A 3VS4A 3AOXA 3VUGA 4J53A 3TNQB 4ZSGA 4QP6A 3BYVA 3EHAA 1YXTA 3P9JA 4YHTA 2P4IA 5LJJA 4IAKA 1A06A 3VS3A 5J8IA 3RPOA 3V5JA 1W82A 4PTCA 4F08A 4MKCA 2JGZA 4JX7A 2XCKA 4PMTA 3RCJA 4L7FA 2OZOA 3ROCA 2B55A 1NW1A 5IQFA 4Y85A 4PQNA 3TTJA 1PYXA 3LJ0A 2P2HA 3Q9ZA 4F6WA 3KF7A 4LI5A 5CEKA 3ZEWA 5AUTA 1OMWA 2R3OA 1LP4A 3QZHA 5CNOA 4Z9LA 4AUAA 3OWJA 4EOMA 4FTTA 3Q9WA 2CDZA 3Q3BA 3QUEA 2X8IA 1QPCA 1Q3WA 3QQUA 2R4BA 3UODA 3HDMA 3OOGA 3VULA 4CFXA 4CYJA 4AA0A 3AG9A 2P3GX 2NRYA 2CCHA 2XNEA 5JT2A 1NVRA 2FYSA 3O2MA 3MGYA 3MW1A 5HTIA 4Q9SA 2B9JA 1V0PA 3Q2MA 2OGVA 2W1IA 3TACA 3WE8A 4BDIA 4C59A 2X6DA 4U9AA 3PLAE 3AT4A 5HBHA 4PTGA 4YTHA 5DRDA 3TI1A 4BZOA 4EBVA 3BELA 4EQMA 2C1BA 3C13A 2QG5A 3KF4A 5AFVA 4DCEA 2AUHA 4IZYA 1IEPA 1R0EA 1UNLA 3EQGA 2HZIA 3WZEA 3ORZA 2BALA 5CVGA 5AV4A 4FEWA 1KSWA 4OGRA 3QF9A 4KS8A 1JKKA 2BILB 3CGOA 3TV6A 2PUUA 4B8LA 3CD8A 3AC4A 4D2VA 4OTFA 5TE0A 1SMHA 4TW9A 3ZFYA 3DFAA 4BDBA 2FH9A 1VYZA 2OSCA 4IX3A 5EDPA 1ZYSA 3GU8A 4YC6A 4O96A 1Q8YA 4E5WA 2RG5A 5M07A 4LL5A 3TKUA 2WMBA 4JAJA 3CJGA 4GEOA 4FUXA 4OUCA 5HLWA 4WNKA 3MY1A 1YI6A 2VN9A 3VS6A 2Z8CA 3TEIA 1OM1A 3DXNA 3PG1A 3IECA 3E8DA 4EHGA 2NPQA 4X7QA 4QTDA 3F6XA 4FKVA 4AZEA 4FZ6A 4TRLA 3QAME 2RFNA 1XH6A 2B9IA 1E1VA 4QMNA 3IGGA 3BLQA 3LCSA 3O50A 4EH5A 3UNJA 2YM6A 3MBLA 3JPVA 2OICA 3BRBA 3IPHA 3W2SA 4U44A 4W4YA 5AIKA 4A4LA 2VTHA 4GV1A 2R5TA 3U9NA 3DJ7A 3KU2A 3NNXA 2XK4A 2BTSA 2EXCX 2WGJA 4W4WA 4XOZA 3VRZA 3IDCA 5DOSA 3GUBA 2WHBA 1H28A 2PU8A 1OL5A 2P2IA 4IFGA 3VS2A 5CTPA 4FGBA 3SOCA 4PPCA 3QC4A 4XG4A 4Y5QA 4FI1A 3EFJA 3H0ZA 2RGPA 1BL6A 1YXUA 3NYNA 4FL3A 5A9UA 2IPXA 4LUEA 4JG8A 5M51A 3QD0A 2OXXA 5I3RA 4FKLA 3ZLSA 4QYGA 4L67A 4EK6A 2R3NA 2A2AA 3PPJA 4RG0A 4IC8A 4FGRA 2R0IA 4DH1A 1Z57A 2V5QA 4BB4A 2O2UA 3S00A 1ZLTA 3DLZA 2GS7A 5EQEA 4K6ZA 2YCRA 1FINA 3DCVA 4HOKA 2WTJA 4O0UA 2XB7A 5AR5A 3NLBA 2VNWA 2XYUA 5DR2A 3WF8A 2I1MA 3ORKA 1FVVA 3TTIA 3K5UA 3KFAA 5AJQA 5ICPA 3VBYA 1OKWA 3C1XA 3ANQA 1LR4A 4FTAA 2AYPA 3LPBA 3DBCA 2BAQA 3QX4A 4H39A 2H6DA 4K2RA 4LV8A 4O83A 3D2IA 4EH8A 3V5WA 3DB6A 3PVUA 4XV1A 2PE1A 2W96B 4ZY5A 5HU3A 4FTLA 3CC6A 4FTIA 2XMYA 2JDTA 2X7GA 4UV0A 4C3PA 4BYIA 4E4XA 5IEXA 1M2QA 2CNUA 3R7YA 2YM7A 3MH2A 4ARKA 4HVGA 4ZSAA 4E6QA 3FPQA 2W1CA 4FV1A 3BU6A 3VQHA 5JGBA 1GZ8A 3PY0A 2QC6A 5CY3A 3D7ZA 1PXLA 2C0IA 1WBVA 3PPZA 4WSQA 5FD2A 1DI8A 5HX6A 3NS9A 2Y6MA 2PE0A 1P4FA 3LMGA 2QOLA 5FWKK 2PZPA 1YHWA 1UU3A 5D7AA 4RPVA 5DG5A 3C4FA 4L68A 4Y95A 2UW4A 3HV3A 1WAKA 4D1XA 3EN5A 1K9AA 1P5EA 3Q4ZA 4XCUA 5H8EA 4I0RA 3F5PA 3VNTA 4IACA 4IJ9A 5IMEA 3SLSA 2PPQA 3TNIA 2ITTA 4ASDA 1PXNA 4CLIA 4EOLA 3FYKX 4FIEA 3COKA 2RFSA 5AUZA 3KVXA 3MDYA 1KOBA 4QMSA 2W1ZA 4XP3A 4NUSA 2RSVA 2VTRA 4UB7A 4WNMA 5DEYA 1YWVA 4CV9A 3NUAA 4CG9A 4CG8A 2WMVA 1FGIA 2J0IA 3IW7A 4L00A 4AGWA 4AOJA 2H34A 3OHTA 1OL6A 2ZMCA 5ACKA 3VW8A 3PA4A 5CT7A 2CNVA 3G15A 3U54A 3DK6A 4JRNA 3AC1A 4KIKA 4DEBA 3F82A 5KHXA 3W2QA 2ZJWA 2PTKA 1YRPA 4GU6A 2B0QA 3A60A 4X0MA 2YIQA 2OI4X 3S95A 5KO1A 5I3OA 4FSQA 4D0WA 4BDHA 3JVRA 4QMVA 4ALWA 1OKVA 4GRBA 4JRVA 1L8TA 4CZTA 4Z3VA 5J9YA 5IA1A 5M53A 1DS5A 5EW8A 3EIDA 4QO9A 3MPTA 3KL8A 3LLTA 2WMRA 2VWVA 5DT4A 4IADA 3OWKA 3R8UA 5AA9A 1IASA 2CN5A 1CKJA 3QD3A 5EYMA 4ZOGA 4BVUA 1M52A 1NA7A 4PNIA 4OT6A 3RJCA 5J95A 1X8BA 4JAIA 2X0GA 2QKWB 3EN9A 4C57A 4DEEA 4IZ5A 2PSQA 3E8CA 4Z7HA 4NK9A 5I9WA 4MNEB 3ULZA 3R8VA 4PTEA 4JG7A 3CQEA 3GFEA 3HMOA 2VWXA 4XHKB 3NRMA 4TY1A 5HTBA 2EXEA 3W16A 3MVMA 1ZZLA 3R9NA 3G6HA 1V0OA 4K0YA 5DEWA 4Y46A 4MXYA 4QQTA 3LZBA 4U5JA 1QCFA 1UU7A 2IWIA 3G0FA 4RC4A 3ORLA 4L46A 4XG9A 2UZBA 4FSRA 4GFMA 4KD1A 3UNKA 4O38A 3SRVB 4KAOA 2WELA 2C0TA 3AMBA 4CFFA 4YP8A 5CU2A 2Z02A 4BICA 5L8KA 1YI4A 4FKJA 2FSOX 4YHFA 4F7NA 5ETCA 1TKIA 4GL9A 1F5QA 1FVRA 1P4OA 3R9HA 3BBWA 3UC4A 1DI9A 3G33A 3JS2A 5HE0A 3HECA 3UO5A 3FY2A 4BKJA 5GJFA 2UZEA 1ERKA 2XK3A 3Q2JA 2V7OA 1LEZA 4FEVA 5IH6A 4O81A 2WEIA 5IUGA 1YXSA 1CM8A 2GS6A 4FIGA 5ETFA 2HXQA 4A9TA 5CASA 5CSVA 4KINA 4FKPA 3OCSA 4QP1A 3CQWA 3QUDA 4FTJA 5A4LA 1IA9A 2E9OA 2ZB0A 2QOQA 4EONA 3PSCA 2R3GA 3Q4CA 2HZNA 4I93A 1OITA 4YUQA 3BHVA 3BQCA 4I41A 4TXCA 4YSMA 5G6VA 1Q97A 5LMAA 4MXCA 4P2KA 5CI7A 3TZMA 1GY3A 2F2UA 4BDEA 4BN1A 3SA0A 3NIZA 2UZWE 1K2PA 1PMEA 4GVJA 4QYHA 5GIOE 4DFXE 5F9EA 2JKOA 2E9UA 2VGPA 5M4UA 2HWOA 2UW8A 5IQBA 5DWRA 4FT9A 2CKQA 2J5FA 4E20A 2W0JA 4C61A 1YOJA 4BWKA 5GJGA 3LFFA 4HJOA 3OMVA 3TIZA 2CJMA 3NSZA 3NZ0A 3EN4A 2XK6A 1YW2A 3FL4A 3O8UA 3KKVA 4TYEA 4APCA 5CF5A 2E2BA 3MH0A 2OW3A 1YVJA 3PA5A 2F7XE 3RI1A 4J8MA 4I0SA 1OZ1A 4TWPA 4IM0A 4L3JA 3WOWA 4QT1A 2VU3A 4DEAA 4WNPA 5AAGA 5I9ZA 3VBWA 4ZLZA 2J0KA 3BHUA 2HY81 3QQHA 3R0TA 4HVDA 5I9VA 4FTKA 5HX8A 5F94A 3PXRA 5M06A 4RWLA 2ZOQA 3A8XA 3R71A 3Q4TA 4RIXA 4LRKA 1ZYDA 4AZFA 3FHRA 5CAUA 3H0YA 4AE6A 2XNBA 3ZRMA 2WFYA 4ZMFA 2BTRA 2QNJA 5C8MA 5GZ8A 3LFCA 3UMXA 5A4CA 4IX4A 2X9FA 3SC1A 4BDFA 3ANRA 3UC3A 2JAVA 4F4PA 3AXWA 4YPSA 1ZWSA 3MI9A 3E3PA 4YZMA 4DEDA 5IA0A 4AZSA 1Z5MA 3ELJA 4EQCA 4ZSLA 4AX8A 4D2RA 4IAIA 4CV8A 3ZONA 1KE7A 4IQ6A 4XYFA 3CLYA 3POOA 1SNXA 2BZIB 3OF0A 4Q5EA 4W4XA 1H27A 4J99A 3RINA 1R78A 4AG8A 3LCTA 4M0YA 5IQHA 4HCTA 3OTUA 3HX4A 1JWHA 5EQYA 4RGJA 4DCAA 4WOVA 3R6XA 1OL2A 2XA4A 3OEZA 3QTQA 3D5UA 3QQLA 5M57A 4FNXA 3DDPA 3TZ9A 4YC8A 4BTJA 1Q41A 3QQGA 2G15A 3QWKA 4QMWA 3BIZA 3FMHA 4BZNA 3COHA 4ZXTA 5FLFA 4BI2A 3KXGA 4D2SA 3KREA 4NCTA 4U45A 4I23A 5AP2A 3CR0A 2FVDA 3TCPA 4C62A 3D94A 3IOKA 4EYMA 3BHHA 3QRJA 4QYFA 4YPDA 4KIQA 1H25A 1MRVA 4ZY6A 2WMAA 4AWIA 4E7WA 3E63A 1CTPE 2ACXA 2Y6OA 4GFOA 4O0WA 3LCKA 3SKCA 3V5TA 2JBOA 5LWNA 3ATTA 4O7YA 2RF9A 3UTOA 1WBPA 1OIQA 1QL6A 4OTWA 3KXZA 3TN8A 4UMUA 5B2LA 2ESMA 3RVGA 5C8KA 4GUBA 4EHVA 3R1QA 2VWUA 5CF4A 1M17A 3QKLA 4D9UA 4RLLA 3GC0A 3KB7A 3QZIA 3UGCA 1HCLA 3MFRA 3PXYA 4D0XA 2PL0A 3PJCA 4F6UA 4ZZNA 4UY9A 4HCVA 5HG9A 1BX6A 1NVSA 3FV8A 4YJQA 4BDAA 1H24A 4EH3A 5IU2A 3ORIA 2G2FA 2JIIA 3PA3A 4HGEA 2EWAA 2YCQA 3WARA 2BRMA 5D9HA 4D28A 4ENYA 4BHZA 2BRBA 3A7IA 2VNYA 3F88A 3A8WA 4IB3A 3AQVA 2BKZA 4BCIA 3EN7A 4D4SA 4A07A 3CP9A 5EM5A 3PZHA 4BCFA 3ZO4A 4HYSA 3PWYA 4ZSJA 2QOFA 1ZY5A 3RM6A 4GT5A 2WMSA 2J4ZA 3UDBA 3BHYA 3GCUA 3MIYA 3Q53A 3GC8A 4UMRA 3BGPA 3FLSA 3NEWA 2BHEA 4KWPA 4OBPA 3D2KA 4LGGA 4ACGA 4AN2A 4FKWA 4DTAA 1ZZ2A 4OW8A 4R7IA 1WVWA 3PJ8A 4CNHA 4PL3A 3I5NA 3DA6A 4NT4A 2GDOA 4O0XA 1P2AA 1SZMA 2WAJA 4FZDB 4TWNA 4BYJA 3MFUA 5IH5A 3FI4A 4QQ5A 3NYOA 3ZOSA 4XX9A 5AX9A 2WOUA 5EYDA 5H8BA 2AC3A 5AX3A 3VF8A 1XH5A 3GOPA 3EJ1A 5HE3A 2PVMA 4Q9ZA 2VGOA 5I0BA 4FTUA 3AT2A 3LE6A 3RAKA 4E26A 4C4FA 2XVDA 1ZMUA 1SNUA 2YJRA 2ERKA 2XUUA 4IWDA 4WD5A 3ZSGA 1PMUA 5HE1A 5KMOA 5AWMA 2NRUA 3VUMA 4O1OA 4AW0A 4MNFA 5CSPA 1H0VA 4O2ZA 1OPLA 1U5RA 2WQNA 4R5SA 1RE8A 4F70A 3G0EA 5C26A 2GHMA 2GNJA 3O17A 2CLQA 2UW5A 3ROYA 4AGCA 1FVTA 4K9YA 2JFLA 3PPKA 3UIBA 4EWHA 3OVVA 5ANIA 5L2SA 1Q24A 1JOWB 1XO2B 3ZDIA 4BDJA 4KB8A 1OIUA 3WZUA 4EKLA 3B2WA 4ID7A 4JQ7A 1KE9A 4XV9A 4NFNA 3LXNA 2UW7A 3HRFA 5H3QA 2WTVA 3UVRA 3CKXA 5CXHA 1IAHA 1AD5A 4ZTMA 3C4EA 3WYYA 3QL8A 5J7HA 4O0VA 3R8MA 3F3TA 3UVPA 3VIDA 1XBCA 3F2RA 3D5WA 4ASZA 3EFLA 4AW2A 4CFVA 3BQRA 4L3PA 4RFYA 2RL5A 3BGZA 4AP7A 4WRSA 5L8LA 3QCXA 3C4WA 3P7AA 2GSFA 3QXOA 4MQ2A 4ZZMA 4PP9A 4V05A 5BUIA 1G8AA 3HMNA 1H1PA 4ZTSA 2RIOA 4TYIA 4B0GA 3L8PA 2HZ4A 4DGOA 3P5KA 4QMMA 5AIRA 4B8MA 1A48A 3QALE 1MRYA 3C0IA 4IW0A 3DK7A 5EI8A 3BBTB 4FV6A 4B6LA 4KBKA 3GB2A 5B0XA 5TKDA 1ATPE 1WMKA 5LCJA 4UALA 4XP0A 3R02A 4G6LA 4CKIA 3MVLA 3NAYA 4KIOA 3KXHA 4AAAA 2ITUA 4L42A 4CZUA 3LOKA 4M12A 4ANQA 2QQ7A 4IAFA 4YJRA 5I5ZA 2PVYA 2OJJA 3GT8A 5AUVA 4UN0C 5C4LA 4GG5A 1Z9XA 2QD9A 2WIPA 4LUDA 5JKGA 3IG7A 3UZRA 1KOAA 4WG4A 1R39A 4FR4A 2G2HA 2I0VA 5KMIA 1STCE 1YWRA 2IW6A 1NVQA 2ONLA 4CMTA 2BCJA 2GNHA 4S34A 3UOJA 3DOGA 3REPA 3R21A 3HNGA 4F64A 4FG7A 5BMMA 2QOIA 3RK7A 1Q8UA 2VTQA 5F20A 4ASEA 2YDKA 4CFNA 4G34A 3IONA 2R3HA 4ONAA 2PZIA 3WZKA 3EQCA 5JRQA 3O23A 2GMXA 3VBXA 3IS5A 2Q0BA 3S2PA 3QRTA 4O0SA 5HIDA 5TF9A 3RM7A 4R1YA 4O7NA 2OWBA 3AGMA 3QYZA 4O0YA 3D0EA 4C0TA 4ZAUA 3OOMA 2WD1A 3KRLA 5T3QA 4E6CA 4O7VA 2Y8OA 3FZ1A 3O8PA 4I94A 5IISA 4H3QA 1Q61A 1H07A 4PL5A 3ODZX 3SG9A 4ANSA 4W8DA 2P55A 3A7GA 4O0RA 4PF4A 3H9FA 3PJ2A 5KCVA 3EKNA 2XYNA 3OW4A 5LWMA 4WUNA 5CU3A 4UMPA 4A06A 4L8MA 2XZSA 5IEYA 2Y4IB 5DN3A 1ZMWA 2ZM3A 4N57A 3NIEA 5LARA 3DXPA 5ACBC 3R7EA 4BZDA 4C4JA 4AE9A 3RNIA 4D2TA 2J5EA 5LOHA 4NU1A 4AZWA 1SVEA 5GJDA 1OECA 4RA4A 2QCSA 5K5NA 2BZHB 4GK3A 3CY2A 3QZGA 3HEGA 3TNHA 1JSUA 4MK0A 3G51A 3MPAA 2XNNA 4GIIA 4JR7A 2QHNA 1U5QA 2VX1A 3FLYA 3LQ8A 3R73A 4R7BA 4NJ3A 4WIHA 2HZ0A 2FSTX 4C4EA 4DTBA 5AV3A 2UV2A 2VWZA 3RK9A 1H1WA 3P86A 3P1AA 4XG6A 3ORNA 2UW0A 1NY3A 2JDVA 4UXLA 3ZM4A 4JQEA 3OBGA 3HV4A 2B54A 3HUCA 5JRSA 5L4QA 2CSNA 2OIQA 2A4LA 2UW3A 3Q5IA 3MS9A 3HRCA 3WF6A 3PDTA 3LHJA 2W7XA 3MV5A 4G3GA 4ANBA 3QTIA 5HD7A 4PMSA 1YDSE 4O2PA 2R7IA 3D15A 5AADA 2X7OA 1K3AA 4I24A 4NCTC 4O22A 5HCYA 4RQVA 3TUDA 5HLNA 2CN8A 3LIJA 3VS0A 3V04A 2QI8A 4ZJIA 2C69A 3VW6A 2HENA 1U4DA 4Y72A 5GNKA 3ZRLA 4BCJA 4EZ7A 2ETMA 3NW7A 3F7WA 4GVAA 4XH6A 2GNIA 2ZB1A 2J6MA 4N6ZA 3PIZA 1UU9A 3W55A 1REKA 3EN6A 4ACHA 2DWBA 5F95A 3UPXA 3NPCA 3SVVA 5LCKA 4DITA 3MB7A 3ZH8A 3BKBA 3CIKA 4CRLA 4FT0A 3WBLA 4FUYA 5HESA 2W5AA 3GOKA 2WB8A 3COIA 3RAWA 5JN2A 5FP6A 4CVAA 3WF9A 3MSSA 4QP9A 4EZ3A 4FTRA 2Z2WA 2O3PA 4AF3A 4AT4A 5BVKA 2OJFE 3GXLA 4RVLA 2GTNA 4S31A 4OTQA 3G2FA 3C5UA 5HG5A 3I4BA 2CPKE 3QX2A 1WBWA 4R8QA 1TQMA 2W5HA 3Q60A 2FSLX 3CTQA 4JVGA 4BWPA 4DFLA 3C9WA 2PVJA 4YHJA 5BVOA 3BGQA 4EK5A 3FBVA 1ZYJA 3ZBFA 4OTPA 2XIYA 2CCIA 1IRKA 1E1XA 4MBJA 1DAYA 4CCUA 1PRYA 4IVCA 4I5CA 5A6NA 3TV4A 5L3AA 4RFMA 4F6SA 4O7ZA 2PMLX 4PMMA 3PE2A 4TYJA 3FMEA 3EQRA 5E8UA 4S30A 5L2QA 1G3NA 4TZRA 3RWQA 4FSUA 4ACDA 2W9ZB 2EB2A 3CKWA 5IZFA 2O64A 1WVYA 2Y7JA 5AP6A 2VO3A 1W7HA 3A2CA 2C4GA 4RZWA 4S32A 2UVYA 1FBNA 5GINE 2YISA 3R8ZA 4C4IA 5J1VA 3R7IA 3Q9XA 2FSMX 2YACA 3F7ZA 4JXFA 4KKEA 4E4MA 3ZZWA 1BUHA 3U6HA 4R78A 5LMBA 4ZTNA 2ITYA 2JKMA 4NTSA 5A54A 2W1HA 4J96A 4AGDA 1F0QA 2GNLA 4CTCA 5IG1A 4OTGA 4FVPA 3FMNA 4K1BA 2EUFB 3JY0A 4ZMEA 5E1EA 4CYIA 4GG7A 4CSVA 4KKGA 2HY0A 4A4OA 4CCBA 5M4IA 4FIFA 4J71A 4F9CA 2J0MB 3KVWA 3A61A 3C4CA 4K18A 5IH4A 1MQ4A 1R1WA 2UZNA 5AMNA 1XH4A 4FYOA 3CQUA 2UUEA 4FOBA 3HYHA 3Q6UA 3MTLA 5GIPE 3NYXA 3RPVA 5LMKA 1PXOA 2WTIA 3FUPA 2PUPA 4HGTA 5AM7A 3F3VA 3O8TA 4EOIA 3DJ5A 4KIKB 1QPJA 2VTSA 4M97A 2I0HA 4RJ3A 3O7LB 5CZHA 4EYJA 2VTNA 3TDVA 1KE5A 3RMFA 1KWPA 2B7AA 3DLSA 4GYGA 3R9RA 4F9YA 3KRJA 4YTCA 3KN6A 1G5SA 3UZTA 4BCNA 3PJ1A 4IAAA 4O7LA 4X21A 4CFWA 5BVFA 4J97A 3GP0A 3BLHA 4MQ1A 4QMLA 4EKKA 4YO6A 2ETRA 3IGOA 2YITA 2V22A 3Q04A 4O86A 2R2PA 5KKRC 3F69A 3WI6A 4O1PA 4G3EA 3AC3A 4V0GA 2NNWB 3I60A 3NVMB 3BEAA 4NFMA 3BHTA 2W9FB 1UKHA 5CX9A 4C3RA 2WO6A 4FV5A 2BPMA 3CTHA 3FQHA 5DRBA 2Y4PA 3HV6A 2XIXA 4BIDA 4E4LA 4O27B 2CGVA 1RJBA 4QMZA 1OL1A 4NKSA 4TWOA 3IKAA 3OEFX 1RDQE 5IUHA 5C9CA 2WU6A 1PMVA 5IQCA 5FXRA 2XCHA 5BMSA 3PXFA 4FTCA 4TYGA 5ANDA 1UA2A 3T8OA 4F99A 2R3MA 5LVOA 5JQ5A 4YJPA 5HO8A 3H4JA 1TVOA 2C68A 3QRKA 3R7OA 3LQ3A 5D12A 3T9TA 3ZMMA 4D1ZA 4OR5A 4FF8A 3KQ7A 4FV8A 2C6OA 2OF2A 4DH3A 4PUZA 4O0TA 2JITA 3BWJA 2H96A 4TTHB 4E3CA 4DH7A 4I92A 4QMYA 3FZOA 5EM7A 2WTDA 1ZXEA 3VBQA 1RQQA 5CQUA 3CGFA 4Z7GA 3ZM9A 3QBNA 3QTZA 4J1RA 4F7LA 3P0MA 1WVXA 3OY3A 4DLJA 1FGKA 3DNDA 5L6OA 3E8NA 3ERKA 5FP5A 5JZNA 1B39A 3RAHA 4E6AA 3A7FA 2QOOA 4IAYA 4ITHA 4TYHA 3BZ3A 2F57A 4FTMA 3TUCA 4ZLYA 5BUEA 3LW0A 3BYOA 2X2MA 3UP2A 2QOKA 3SHEA 2UVXA 3ZEPA 1J7LA 2XNGA 2ZVAA 4WUAA 4AU8A 4DEGA 1NXKA 3PXZA 5TO8A 3LKMA 1SYKA 2VV9A 3SV0A 3FYJX 3TXOA 2RKUA 1YXXA 2B52A 3NNWA 5DGZA 2EB3A 3QTXA 4AS0A 4F7JA 4C8BA 4RBLA 4FICA 2C1AA 2CGWA 3CD3A 3VC4A 4B9DA 4D4YA 4IE9A 2XIKA 5KZ0A 4ALUA 2X9EA 3LAUA 2F4JA 2X39A 3L8XA 2HELA 4I6HA 4LGDA 4RIWA 2E9NA 4MBIA 4ZTLA 1AGWA 3DAJA 4YC3A 4CXAA 2XJ1A 2HWPA 4QP3A 4AZTA 4CMUA 2WTKB 3R9OA 3ZUVA 2BAKA 4OBQA 4R1VA 4WNOA 4JT3A 1YHVA 3SDJA 3U9CA 2YAKA 4DG3E 4LYNA 1REJA 2F2CB 2B4SB 5E8TA 1OB3A 2A19B 3DBDA 4FX3A 5IF1A 5IQGA 3FXWA 1JLUE 2OH0E 5CT0A 5HG7A 3VUKA 3K3JA 2FUMA 3LVPA 4CEGA 2VO7A 4HGLA 2BDJA 2F9GA 2PMNX 3FHIA 2OBJA 4YMJA 4P90A 2XK8A 1WBSA 4XBUA 1CKIA 3UG1A 2V55A 2C3IB 3KULA 4C37A 3VN9A 3UYSA 5A4TA 3EKKA 3RPYA 3ZS5A 4BRXA 4QMPA 2YM3A 2RG6A 3KRRA 3MWUA 4RIXB 4APPA 4R77A 2Z7LA 4QPAA 2WU7A 5C4KA 4QP8A 4PX6A 3DKFA 4F65A 4BWXA 1QPDA 2A27A 1Q3DA 3Q96A 3IW6A 2PY3A 4TN6A 3U8WA 3W8LA 3ZUUA 5HICA 3EZRA 4BIBA 3DK3A 3R00A 3R63A 2VTJA 2CGXA 4DFBA 4DG0E 3M11A 1XR1A 5M4FA 1ZOHA 4NM7A 3NX8A 4MVFA 5BX0A 3ORPA 4QP4A 2ITWA 2W17A 1UU8A 2R3IA 4W8EA 5HO7A 2R3QA 3PP1A 3V5PA 3R1NA 3D7TA 3UVQA 5EFQA 4FKUA 5AUWA 4BCGA 3AD4A 4DFZE 3GGFA 2BFYA 4UMQA 2ETKA 5EI6A 3TWJA 1GIJA 3DKOA 3OCGA 4IBMA 4DGLC 2QHMA 2XKDA 3EL7A 1GJOA 3F3UA 4XEYA 4CKRA 5A4EA 3PUPA 4K77A 4BCQA 1WZYA 4ERWA 4PL4A 3FKNA 4I3ZA 4W4VA 4E5BA 3JVSA 4U42A 1GIHA 1BL7A 5CU4A 3MB6A 3PFQA 3GCQA 4MXXA 3V6RA 3H10A 2C3KA 4ITIA 5HEZA 2ERZE 4EI4A 3AC8A 4G3CA 4EHZA 4S33A 3Q52A 3E64A 5ANKA 4PDSA 2Y4IC 3PSBA 1Y6BA 1NT2A 3NUSA 5HQ0A 3L8SA 1H1QA 3R2YA 4BBFA 2Z60A 4F9BA 4D1SA 3FXZA 4DG2E 4XRLA 5JZJA 4KIPA 3LM5A 3NUYA 2IJMA 2DS1A 2YCFA 5IKWA 2JKQA 2ZV8A 3TNWA 4FC0A 5IQAA 3P78A 4FKTA 4IFCA 4ITJA 4LOPA 4D2WA 5JK3A 4I5PA 3A7HA 4G5JA 4IDTA 2WQMA 4F1MA 4ZK5A 3ULIA 3KMWA 4N70A 3O96A 1M7QA 4FZFB 2WQBA 3QGYA 4BC6A 1VR2A 3FI3A 2YIRA 4AOTA 2YFXA 4M15A 3R7GA 4FK3A 4XG8A 4CTBA 3SW4A 1UKIA 4RVKA 4YJVA 4R3PA 2P33A 2C5YA 2PVNA 2XEZA 4QMXA 4EZ5A 3I7CA 3DDQA 3NYVA 4IM3A 2XK9A 2XM9A 4JG6A 4PPBA 3FLZA 1ZY4A 2PVRA 3ORXA 4H58A 2PZ5A 3HLLA 4FSTA 4JJRA 3UO6A 1RW8A 3KGAA 3OWLA 3RHKA 4F1TA 1PJKA 3MVHA 4D4VA 3PG3A 2ZV7A 2JDOA 3O7LD 3QCYA 5HU9A 4HYIA 3RZFA 4MAOA 4BKYA 4D55A 4HVHA 1YQJA 3MIAA 3ENMA 3N4VA 2QO2A 4ORKA 5E7RA 4PDYA 3QRIA 4RA5A 2UZDA 4QP7A 5LMKC 3U55A 2WMWA 4GS6A 3DS6A 3CY3A 4NW6A 1XKKA 3ZO2A 3C5IA 3KRXA 5EH0A 3HV7A 3U87A 3UO4A 4NW5A 4G31A 4FEXA 2PZRA 3SAYA 1CMKE 3GENA 3SW7A 1PKDA 5AR2A 2C0OA 3PSDA 1YOMA 3CE3A 4FSWA 3ZLYA 3FZTA 5DA3A 1J3HA 3LCDA 3ZLWA 3IW5A 3P7CA 4KA3A 2PVLA 5DPVA 4C38A 4BI1A 4XLIA 5B7VA 4OTDA 4RZVA 3EOCA 3S1HA 5BYLA 5TOZA 2JIUA 4YBKA 1UNGA 3KXNA 5IA4A 1M7NA 2OXDA 4C4HA 4MEDA 2XNMA 4AA4A 2OFUA 2CKEA 5C1QB 2C3JA 3SOAA 2ITQA 2ZMDA 4YJUA 3ZBXA 2WNTA 4AGUA 3VQUA 3F5UA 4AT3A 3CSVA 5HVJA 4M66A 2PMOX 5HNIX 5KE0A 5DI1A 1UWHA 3DBFA 4MWIA 4AXAA 4II5A 4AFEA 4FVQA 4RX7A 2VTMA 4H1JA 1W83A 1XH8A 3NNUA 3R8LA 4FL1A 3LLAA 3LJ1A 3UQCA 1UNHA 4USDA 2WIHA 5J5TA 3ZLXA 3FMJA 5EOLA 3UOHA 3TIYA 3QUPA 2HK5A 3HDNA 4IDVA 3T3VA 4O91A 3TJDA 5DLSA 2YZLA 2UZOA 1W84A 4ZTRA 2FO0A 3OD6X 2ZM1A 4QTEA 3KMUA 3EH9A 3QLFA 4C7TA 4QTCA 3DPKA 1BLXA 3VJNA 5CZIA 4FV2A 3RWPA 3SX9A 1AQ1A 3IQ7A 4A9RA 4M13A 1ZARA 4HNFA 3OW3A 1XH9A 5D41A 5E1SA 3NW5A 3U4UA 2IZUA 3D5VA 5A6OA 3GQIA 3ALNA 1CKPA 1KUTA 3RPSA 4QMQA 3ZZEA 5JFSA 4NWMA 5CLPA 1YHSA 4U80A 2W4KA 2BRGA 2VZ6A 5KKRB 2QOBA 5M44A 2OZAA 3UOLA 3DXQA 4FIIA 2YERA 2YHVA 1JSTA 2IZTA 2XKEA 2XK7A 4WG5A 3DBQA 4RWJA 4RJ4A 5BPYA 1TQPA 2H8HA 2Z7SA 3BCEA 1FMKA 3NUPA 4LL0A 1O9UA 5IA5A 4F0GA 3G6GA 4JS8A 2XRWA 3DTWA 4I0TA 4KS7A 3T3UA 5HVKA 2XKCA 3KA0A 4RX8A 4XJ0A 5FM3A 5DVRA 3ZU7A 3MYGA 4QPSA 5HI2A 1H26A 1VZOA 3W2PA 4PV0A 1QPEA 3FSKA 3A62A 4FKGA 4WG3A 3LM0A 1PKGA 3HAVA 2R0UA 4GFGA 2IVVA 4L6QA 3PP0A 5M09A 2OJ9A 3ORMA 5HHWA 2YWPA 1OIYA 2R64A 5KX8A 4RJ6A 4XOYA 1P14A 3ZDUA 4HW7A 5T68A 2ZV2A 4FG9A 4XMOA 4AQCA 1IG1A 1XWSA 1JBPE 2OU7A 4HGSA 4IWQA 4BBEA 4L53A 4IVAA 5IQIA 3CPCA 5TR6A 2WEVA 3QLGA 1HCKA 3KEXA 3MVJA 4RIYA 4A9SA 4G6NA 2C47A 1ND4A 4M69B 2PZYA 3MPMA 3I79A 4HZSA 4U81A 3VF9A 2O63A 4ANOA 5HOAA 5LXMA 5F4NA 3MH1A 3V51A 4L3LA 3C50A 3GEQA 4X3FA 1PYEA 3F3ZA 3I5ZA 4RVTA 3ZHPC 4MF1A 2X4ZA 3W2OA 2OK1A 4GK4A 4W9WA 5CEOA 5HD4A 1SVHA 3PVWA 2W4JA 3EYHA 1WBOA 4ZJVA 3IO7A 4EEVA 3COMA 5JEBA 1WBNA 2YWVA 4KABA 3FI2A 4YZDA 2WQOA 2OO8X 4MWHA 2G1TA 2BAJA 5B2MA 5L2TA 2ITZA 4JNWA 5ANJA 3PY3A 4I21A 4L52A 4HPUE 1PXMA 3VUHA 4G9RA 4FNWA 1OGUA 3W32A 3THBA 4U6RA 4XBRA 2HW7A 5FEQA 2XBJA 4IAZA 4EK8A 4XLVA 3AMAA 4C2VA 1ZOEA 4FBXA 4QQCA 2Y9QA 3CJFA 3VS5A 5BVWA 4DAWA 3WF7A 4OAVB 4H05A 4DBXA 3LFAA 3NR9A 4M67A 3QHWA 3I0OA 4FEUA 4FK6A 3PZEA 2C6DA 1PXKA 5IA2A 4G3DA 3L9MA 4CLJA 5IPJA 4ASXA 2IZSA 5KNJA 4XV3A 3E7VA 4XG3A 1Y6AA 3Q9YA 4YJOA 3GQLA 3HKOA 4EHEA 2W1GA 3IW8A 5JSMA 3KCFA 5CEIA 3DZQA 3DQWA 2C6LA 3BE2A 4XV2A 4YGAA 4IIRA 4YO4A 3IDPA 1XH7A 4I6QA 4CFUA 4DGMA 2F7EE 3E8EA 3LXKA 4JDKA 5C03A 3TV7A 3WIGA 3VBTA 3GU6A 2ITOA 4EUUA 4DFUA 4DYMA 3N4TA 5FM2A 3V5LA 4OT5A 4M14A 4YZCA 1J7UA 5K5XA 5FTGA 5HG8A 3UIUA 3P79A 1IA8A 5I9XA 4D5KA 3EZVA 4A9UA 3L9PA 4DEIA 3EFKA 2WTKC 3R04A 4BY9E 2GNGA 5FBOA 5CSWA 5AV1A 2WMTA 3QHRA 4USEA 2ZV9A 1U54A 3Q32A 2QR8A 4F0FA 4JIAA 4YLJA 4WRGA 2BMCA 2V0DA 3OROA 3R8PA 2UZUE 2VAGA 3I6WA 4M69A 4U40A 3PIXA 4O6EA 5CWZA 5DHJA 4CD0A 4ACMA 3EQBA 3OWPA 3DNEA 4G5PA 3PVBA 4ZY4A 1GZOA 5BVDA 1YDRE 4FSNA 2ITPA 3K2LA 2BFXA 4MHAA 4KRCA 5DT0A 5KMLA 4BCKA 2VUWA 3SXRA 5DE2A 3JXWA 4CRSA 3QCQA 4EH9A 3MH3A 2CLXA 3MN3A 4ANLA 1CSNA 4U3YA 3N51A 4IX5A 2BKKA 1MUOA 3GU5A 4QMOA 2IW8A 2I7QA 4FNYA 3FLQA 4RC3A 4O7SA 3HV5A 1J1BA 3I6UA 1Y8YA 4FOCA 4V01A 5EDRA 5HNGA 2W05A 1PY5A 4JI9A 5CEQA 3FC1X 4I4EA 5FRIA 4NIFB 4JBPA 3V8WA 3D9VA 5KBRA 4BR3A 4LM5A 1Q8ZA 3R7VA 4EH7A 2VX0A 4JL9A 2YM5A 4UMTA 2CKOA 1Q4LA 2OH4A 3QGWA 3RBWA 2Z7QA 3BU3A 2BDFA 3EQHA 5E8ZA 4X6QC 4C4GA 1GZNA 4NKAA 5EI2A 4DBNA 3UJGA 2UZTA 3N4UA 4WBBB 4IVDA 2BIYA 5HBEA 3L9LA 2XBAA 1YOLA 2XNOA 3HA8A 5DH3A 5HIBA 4DN5A 2YIWA 2J0JA 4LRMA 4MBLA 2C5XA 4C33A 2ZAZA 3O0GA 2HYYA 4I5HA 2WMUA 2PHKA 2VWBA 2XIZA 3DAKA 3QTRA 4TNBA 5CQWA 4FT3A 4QYYA 5EKOA 5EYKA 3DTCA 3KC3A 3I0QA 3BV2A 5HVYA 5CAVA 5IQEA 1ZYLA 4NJDA 4XUFA 3RPRA 5JH6A 2ZDTA 2XH5A 5I9YA 1T46A 3VHEA 3IOPA 3FMKA 3KK8A 2PMIA 3DY7A 2BRNA 2YM4A 3M1SA 1U59A 3RALA 5FQDC 1YKRA 2G01A 1CDKA 2NO3A 2FB8A 4MD9E 5EW3A 3OXIA 4YBJA 1Q8TA 2LGCA 4E93A 2B1PA 4Z16A 2GHGA 3LFNA 3G9LX 4UYAA 2VTTA 4WT6A 4D4RA 3ZXZA 5HORA 2CGUA 4QMTA 4EC8A 4OTIA 2PUNA 2AC5A 5E8YA 3BPRA 3QD4A 4QNYA 3V6SA 4EORA 3R28A 2IW9A 2QKRA 3TDWA 3UPZA 5CYIA 3V01A 2R3PA 5HCZA 4BDGA 2Z7RA 1BI7A 2CKPA 3M2WA 2OIDA 3SD0A 4ZS4A 4EH2A 4DINA 4ZIMA 1OPKA 4C35A 4H3PA 4GJ2A 3GCPA 4ZS0A 4PMPA 2VTOA 2XP2A 3NMUF 2GS2A 3QTUA 4K8AA 2I6LA 2BZKB 3GI3A 4UZHA 5K0KA 2C6MA 5FEEA 3AD5A 2WQEA 2XF0A 3DGKA 3S3IA 3TT0A 3FQEA 1FMOE 4AN3A 2JKKA 2OG8A 3S4QA 3VAPA 2E9PA 2BRHA 4X3JA 3QTSA 3WILA 3L9NA 4FT7A 5BYZA 4A7CA 5D7VA 2A1AB 4V0GB 4DGNA 3HRBA 4G9CA 3GC9A 2OF4A 4EL9A 5A3XA 1S9IA 2B9FA 4LGHA 3NUNA 1LPUA 3C0GA 3U4WA 4F1OA 3NW6A 3GBZA 4JDHA 4NIFA 2YCSA 2W99B 1Q5KA 5AAEA 4YURA 3TZ7A 5K4JA 4J8NA 1OVEA 1LEWA 4PWNA 3Q6WA 4C2WA 3KMMA 4ZLOA 4O7RA 3TJCA 3UNZA 2VWWA 2OLCA 2IO6A 4F09A 1KE8A 4AT5A 2OIBA 5FGKA 4I4FA 3RTPA 5JQ8A 3G9NA 2YLFA 3KCKA 4FE2A 3H9OA 3MFTA 3VHKA 2FA2A 4HPTE 3GNIB 5DR9A 3F66A 4FSMA 4JBVA 4BDDA 4QRCA 4U8ZA 3UZPA 5JMSA 2J2IB 4Y73A 3C4XA 3DJ6A 3E3BX 3BYUA 3RAIA 1H1RA 4HNIA 5AP7A 5DYJA 2OKRA 5K3YA 5IEVA 3B8RA 4JBQA 4XP2A 5BYYA 3DKGA 3EMGA 2G9XA 4ALVA 3QWJA 2PVKA 4QTBA 3W18A 4YSJA 4MXAA 5EM6A 1KV1A 2O65A 3DKCA 2OJGA 3GU4A 4IZ7A 3VVHA 4XRJA 4BBMA 4YR8A 5HIEA 4X3FC 1WBTA 3SXSA 3E62A 4EH4A 5DR6A 4TYHB 1W0XC 3AMYA 4GKIA 1DAWA 3QU0A 4MYGA 3OS3A 3U51A 2C3LA 2V62A 5L6PA 2HOGA 3ORTA 4FZAB 3TG1A 2GQRA 2IVUA 4I6BA 3DU8A 3F2NA 4TWCA 2Q83A 4IJPA 4IZAA 1H08A 4P7EA 3AC2A 5EHOA 4CQGA 3HMPA 3ITZA 4GK2A 5IDNA 2PE2A 5E9EA 3ZSHA 5C01A 2WTCA 4NM5A 4WA9A 5AUXA 5HCXA 1JKTA 2CMWA 4LFIA 3HUBA 4B99A 4O7TA 4O7WA 2XIRA 4A4XA 4RIWB 3W33A 2UW6A 5HGIA 2J9MA 3EQDA 4TNDA 4EOQA 3KK9A 4A9YA 3OUKA 3R22A 4RX5A 3FZRA 2JDSA 3JUHA 3LJ2A 4UWBA 4CMOA 1E9HA 4I5MA 2YLEA 3AT3A 2F7ZE 3UP7A 3FSFA 5KBQA 2QU5A 2YDJA 3AGLA 3UIMA 2ITVA 2UZVA 4FKRA 3OXTA 3JYAA 5CENA 3R9DA 4EBWA 5AV0A 5A46A 5HBJA 5EHYA 4OTRA 1OKZA 1J1CA 5EW9A 4CGAA 2XNPA 2XEYA 5DFPA 1M2PA 3GU7A 3P23A 2B53A 4BDCA 1YXVA 4GW8A 3TKHA 1H4LA 4ANNA 3KULB 3CEKA 4F63A 3E5AA 3NCGA 3UYTA 5K9IA 2J90A 5BNJA 5LVMA 3ID6C 4R3RA 4FIHA 3VRYA 4FV3A 3PJ3A 2C6IA 2ONLC 3F5XA 4BCPA 2R9SA 2C6KA 5DBXA 1ZYCA 2QR7A 5M56A 2QO9A 2O0UA 4UX9A 1H01A 3FPMA 3H9RA 5AP4A 3UIXA 3HGKA 4FEQA 4U0IA 2EU9A 3ZCLA 5DMZA 5CEMA 5J9ZA 1S9JA 3BX5A 1Q8WA 1LUFA 2KTYA 3NWWA 5E8XA 1L3RE 4EJ7A 3C7QA 3CS9A 3ZXTA 1TQIA 5E8SA 4QP2A 3KN5A 4TT7A 1JKLA 3VJOA 3QCSA 4X2NA 5ETIA 4I6FA 2I0YA 3VWAA 4IB5A 3D7TB 3QKKA 3DFCB 2X1NA 3LCOA 2XJ2A 1OUYA 3N9XA 4BFMA 3FZSA 4BI0A 3D14A 4FA2A 3ACJA 3W8QA 2PVHA 3DT1A 5K4IA 3I7BA 3UQFA 4O6LA 2GQGA 3M42A 3B8QA 3EQFA 3QD2B 4IB1A 3Q5ZA 4MF0A 2OFVA 4EUTA 1Y8GA 4AA5A 4UBAA 4UEUA 4DC2A 3UE4A 3R1SA 3AD6A 1H00A 3WIKA 4E73A 3R1YA 5ITAA 3ZFMA 2ZM4A 4IHPA 4RVMA 4U97A 3K54A 2VTPA 4HYUA 4LQMA 2VTLA 4GSBA 5DIAA 3A99A 4EOKA 3TUBA 3LFEA 4HZRA 2JDRA 5F1ZA 3VBVA 4TL0A 4G1WA 4C3FA 2IVSA 4CT2A 5CXZA 3JR1A 1IAJA 2O5KA 4P5QA 3QRUA 4GT3A 1EH4A 4O21A 2W5BA 2C30A 3H3CA 4EK3A 5EQPA 5JFXA 2KULA 5D11A 3NNVA 5E90A 3VS7A 2WPAA 5JFVA 5IMXA 3OTVA 3ZO1A 4BIEA 4DLIA 4QOXA 1MP8A 3PWDA 3OUNB 3CPBA 3K3IA 4BDKA 3IW4A 5KMKA 5M08A 2UZLA 3E93A 3MJ2A 2C6EA 3PY1A 4G2FA 4YTIA 3DV3A 4X2GA 4YLKA 1GOLA 3FLNC 3GCVA 4MXOA 2GU8A 5KUPA 4S2ZA 2BUJA 4E5AX 1JQHA 3DBEA 4C34A 3E92A 2FGIA 4AW1A 4U41A 4L45A 3BV3A 5T6KA 1G8SA 3GVUA 4NH1A 3JY9A 3QYWA 5BVNA 2BR1A 2O8YA 1XHAA 2YIXA 4FMQA 1GAGA 5ANOA 4WHZA 4F7SA 5EM8A 4EOPA 5GZAA 4XS2A 4ZTQA 1Q99A 5LVNA 3W10A 3HP5A 4BCHA 3BLRA 3HP2A 4GUEA 3A4OX 2QURA 3ZC6A 3HA6A 4NL0A 5EK7A 4G17A 1B38A 2X81A 4H3BA 4FTNA 5AP1A 2YM8A 3NUXA 4U7ZA 3FMMA 4FSZA 2CNQA 5HNBA 2QO7A 5ANEA 3OT3A 3FI8A 4L44A 4I22A 4M8TA 2A0CX 4L43A 5L2WA 1ZOGA 4LOQA 4YNOA 4U3ZA 3PXKA 4FKOA 3PXQA 3EB0A 2QLQA 2PWLA 3FC2A 3LFDA 4OLIA 2YJSA 4WKQA 4G16A 2VRXA 3FEGA 4JQ8A 4FVRA 5CVFA 2Q0NA 1B6CB 3NGAA 5FTOA 5FBNC 5CALA 1HOWA 2C6TA 3IDBA 4ZJJA 1ZRZA 4PDPA 3BWFA 4DA5A 4DT9A 5L6WL 1I09A 2YEXA 4IM2A 2ZYBA 3IK3A 4IWPA 5CVHA 5KZIA 4BGHA 2VO0A 5KMJA 5AR4A 3AC5A 3QZFA 4H1MA 4Z55A 3L1SA 4Q5HA 4O82A 4DFYA 1OUKA 1APME 3VO3A 3LFQA 4C36A 4FKSA 4FTOA 4NSTA 4UXQA 4YNEA 4G6OA 3VUTA 3FE3A 4U79A 1FOTA 2QONA 4J98A 3I81A 3PE1A 4AACA 4AW5A 4ERKA 3MY5A 4BGQA 2QU6A 3HL7A 4M68A 5EHLA 5AAFA 4XG7A 2YAAA 1FPUA 2X8DA 4RC2A 4E8AA 1ZAOA 4ENXA 3HZTA 1PHKA 4C58A 3SGCA 4DT8A 4FYNA 4I20A 4EH6A 4D9TA 5JFWA 2R3KA 3PIYA 3TNPC 1V0BA 2GFSA 4WSYA 3HMMA 5CF6A 3ODYX 4GIHA 4NZWB 3OCBA 3F3WA 3ZSIA 3OG7A 1XBBA 4DH8A 2VWYA 4ZSEA 5LQFA 4LRJA 4MTAA 4O84A 3FL5A 1R0PA 2I0EA 5AR3A 4IWOA 4RSSA 3W2CA 1W98A 2GCDA 4PNKA 3ACKA 2JC6A 3V8TA 1WCCA 2JEDA 4RJ7A 4MH7A 2OZAB 4J95A 4G3FA 5J9LA 5FUTA 5ETAA 4MXZA 2WTWA 2R7BA 3CCNA 4YZ9A 3D5XA 3OC1A 4UWYA 4W9XA 2GHLA 1OBDA 2SRCA 5FXQA 4AFJA 3ZO3A 4OBOA 5HE2A 4CKJA 4IC7A 4NEUA 4RT7A 2WMQA 4KBAA 1VYWA 1JPAA 4GMYA 4IANA 2PUIA 1GIIA 5DT3A 3PTGA 3A4PA 4MNEA 2PVFA 3RP9A 5KMNA 3U6IA 4FKIA 5C27A 5BUJA 2R3JA 4KSPA 4QYEA 5L8JA 3EQPA 2F49A 4HVIA 2X8EA 2YA9A 4RIYB 2W4OA 1OL7A 3R2BA 3TL8A 3C0HA 3FAAA 1ZMVA 3SRVA 3U6JA 4FL2A 1OI9A 3FKLA 3K5VA 1MRUA 3F61A 3KXXA 3HMIA 3NCZA 2X2LA 3FDNA 2WZJA 2HIWA 4KNBA 2J51A 4GKHA 4HVSA 2VWIA 2JAMA 1YWNA 4X3FB 3NDMA 5BQ0A 2IVTA 4XNEA 4R7HA 3ETAA 2LAVA 4R6VA 4GJ3A 4JBOA 3HAMA 5AUUA 1DM2A 3H30A 1IR3A 3FMLA 2HAKA 3SG8A 3KRWA 2W1EA 3OY1A 4DE4A 3ALOA 5J87A 4RLKA 2CHLA 3FMDA 4EOOA 2BZJA 5AR7A 3CBLA 4KSQA 4KKHA 1U46A 2XKFA 4FV7A 4U43A 5EDQA 5CAOA 3DB8A 3LMIA 4J7BA 4E4NA 3UOKA 5EOBA 3OFMA 5AUYA 4J52A 2HXLA 3UG2A 3RCDA 3WF5A 5HZNA 3QXPA 3ZC5A 1XBAA 4BHNA 4MCVA 5E8WA 1VJYA 4BTFA 4JIKA 2X4FA 3PVGA 3B2TA 5H8GA 1BI8A 1Y91A 2XJ0A 3E87A 4M0ZA 4YJTA 4F9AA 1OIRA 2JIVA 5I9UA 4RWIA 4OAUC 3QA0A 5IDPA 3NAXA 4HYHA 3T9IA 2W1FA 3F2AA 4P5ZA 1JNKA 5CNNA 5A4QA 1URWA 5CAQA 4M3QA 5CI6A 3OBJA 1KV2A 3E7OA 2QOCA 3SXFA 5A14A 5KMMA 4RRVA 4AOIA 2PULA 3PRFA 3UQGA 3RNYA 3SQQA 3KY2A 4GU9A 4H36A 4PP7A 1YI3A 4GYIA 3EWHA 4NTTA 3FJQE 3TKIA 2YZAA 4K11A 4YZBA 3W1FA 5CEPA 3II5A 2C5NA 5FDXA 4D2PA 2J50A 4LMUA 3WE4A 2EVAA 3RKBA 3POZA 3FY0A 4RFZA 4FKQA 4YTFA 5H9BA 4CFMA 4IVBA 1Q62A 2WMXA 4IMYA 4IXPA 4LG4A 4EOJA 4KRDA 1UWJA 3WZDA 4E6DA 3BYMA 3QFVA 4B4LA 2B9HA 3RZBA 1U54B 3ET7A 3O71A 5HTCA 2X7FA 3V8SA 4DGGA 4UYNA 4FODA 5KHWA 2XM8A 2YN8A 3DAEA 1SVGA 5EKNA 2WKMA 1R3CA 2YDIA 3LFSA 3C51A 3QA8A 1JKSA 4FV0A 2WXVA 3PLSA 4FV4A 4OTHA 5ANGA 3OP5A 3V5QA 4BCOA 2DYLA 2ITNA 4IB0A 2QG7A 3FXXA 2GQSA 2R3RA 1XQZA 3MY0A 4L01A 5H2UA 1BYGA 1VEBA 1J7IA 2WOTA 3NUUA 5CAPA 3OZ6A 4DHFA 4DF3A 5FXSA 5CF8A 5BVEA 5EYCA 5CU6A 4PY1A 2QODA 4DH5A 5C8NA 4Y5HA 5AR8A 5CANA 3LQ5A 4AN9A 2ZDUA 3QC9A 3ZTXA 5I4NA 5EG3A 4JR3A 4YJSA 1JAMA 4YJNA 4QNAA 3P7BA 4CQEA 3FZPA 4MD8E 3OT8A 2REIA 4ACCA 2VD5A 2HCKA 4NM3A 5CS6A 4EOSA 1PMNA 3R01A 5J5SA 4JDIA 5IA3A 1JVPP 4N4SA 1GZKA 3NVKI 2JLDA 3GC7A 4N0SA 1W8CA 2OXYA 1PW2A 1PXPA 3DQXA 3P4KA 4RWKA 2ITXA 3FWQA 1FQ1B 4X2JA 4BKZA 4N6YA 4FT5A 4EK4A 4USFA 4GH2A 2IN6A 4LV5A 4JX3A 5GHVA 2QOHA 1QMZA 3LXPA 2YIYA 2P0CA 1YDTE 2C5OA 3D83A 4B7TA 3W2RA 4I1ZA 4JOAA 3QQJA
chains in the Genus database with same CATH superfamily
4BGGA 2EXMA 1I44A 5CSXA 4WO5A 4FIJA 1H1SA 3BEGA 4ZZOA 5B2KA 4HCUA 3ENHA 3ZFXA 3RK5A 5JGAA 1PXIA 3A7JA 3OXZA 4F9WA 3LMHA 1T45A 1V1KA 2VTIA 4PRJA 4Q2AA 4LOOA 4RJ5A 4E1ZA 2J7TA 2RFEA 2GNFA 4PDOA 4D58A 5HKMA 4KBCA 4CZYB 3GFWA 3LXLA 4MX9A 3ZUTA 4R3CA 3CXWA 2YABA 1H0WA 4DFNA 1UVRA 2E9VA 4IX6A 1PF8A 4FV9A 1OPJA 4BL1A 5IQDA 4NM0A 5E8VA 3O51A 3EYGA 3ZRKA 3L8VA 4BF2A 4JDJA 3D4QA 3FLWA 3BYSA 5AM6A 2JD5A 2VX3A 4QMUA 5CSHA 2XS0A 3QTWA 4ZTHA 4EQUA 4EWQA 2ZFYA 2IZRA 5FEDA 5GZ9A 4FG8A 3MESA 2UW9A 1O6YA 3VUIA 3MJ1A 2JBPA 5HO6A 2IG7A 3MFSA 4TPTA 4JLCA 3PRIA 1UV5A 2BHHA 2I40A 5E4HA 3KXMA 4LMNA 3UBDA 2BIKB 4FTQA 4M7IA 3P08A 1SM2A 3E88A 3MA6A 4Y8DA 5J79A 5LVPA 3EFWA 1URCA 1XJDA 2RFDA 2BVAA 3OCTA 4D5HA 2UVZA 3BE9A 4GT4A 2JFMA 4QD6A 3G5DA 2W1DA 5AEPA 2H9VA 3TZ8A 4QPMA 4BJJB 1PXJA 1F3MC 3C4ZA 3RHXA 4KUJA 2NP8A 4BTKA 1M2RA 5IUIA 4FNZA 5D10A 3EL8A 3UMWA 2VTAA 3PYYA 5J1WA 1OKYA 4R5YA 4AZVA 4GCJA 5AP3A 2J0LA 4Y83A 4O4BB 2OJIA 2QLUA 3CTJA 4DTKA 2XRUA 2C5VA 4RJ8A 4M84A 1JSVA 3VS1A 3G90X 5D1JA 4BCMA 2DUVA 3MTFA 5DNRA 3V3VA 4CT1A 4XG2A 1O6KA 3TM0A 5FG8A 4X2FA 4L9IA 4NYEA 2BDWA 3VUDA 5L2IA 5TT7A 5FTQA 4ZP5A 5HLPA 1GNGA 4EJNA 3S0OA 4FZ7A 3WZJA 2PK9A 3BI6A 4K33A 2W06A 4P4CA 5AP0A 4RIOA 3QQKA 5LVLA 4C02A 5AA8A 5K0XA 3FQSA 4UZDA 5M4CA 2BROA 1H8FA 4TKSA 4WBOA 2HW6A 5AP5A 1O6LA 3W0PA 4L7SA 3QKMA 1OBGA 3ATSA 1WFCA 3MA3A 4EC9A 4PPAA 4UWCA 3LFBA 5AV2A 4BTMA 4DEHA 1BKXA 4X2KA 2PYWA 2R3LA 4RQKA 5FDPA 4F0IA 2GFCA 1Y57A 4V04A 3DZOA 2VO6A 3GCSA 3R83A 4ZEGA 3RGFA 5J7BA 1OGYA 4QQJA 2QVSE 5G1XA 2GTMA 4IEBA 5M55A 3HVCA 2X6EA 3I1AA 4RMZA 4ANMA 4YU2A 5CU0A 1BMKA 2Y0AA 3BL9A 1KE6A 3FKOA 3WYXA 3ZYAA 4FSYA 3F9NA 4MD7E 2G2IA 3R30A 3F5GA 3Q4UA 2DQ7X 2R3FA 4QTAA 4YLLA 4YZNA 2V7AA 1A9UA 3BU5A 5JGDA 3QQFA 1MQBA 2X2KA 5E91A 4X6RA 1M14A 2GPHA 3R7UA 4IH8A 4RX9A 1J91A 3EQIA 5E92A 3VS4A 3AOXA 3VUGA 4J53A 3TNQB 4ZSGA 4QP6A 3BYVA 3EHAA 1YXTA 3P9JA 4YHTA 2P4IA 5LJJA 4IAKA 1A06A 3VS3A 5J8IA 3RPOA 3V5JA 1W82A 4PTCA 4F08A 4MKCA 2JGZA 4JX7A 2XCKA 4PMTA 3RCJA 4L7FA 2OZOA 3ROCA 2B55A 1NW1A 5IQFA 4Y85A 4PQNA 3TTJA 1PYXA 3LJ0A 2P2HA 3Q9ZA 4F6WA 3KF7A 4LI5A 5CEKA 3ZEWA 5AUTA 1OMWA 2R3OA 1LP4A 3QZHA 5CNOA 4Z9LA 4AUAA 3OWJA 4EOMA 4FTTA 3Q9WA 2CDZA 3Q3BA 3QUEA 2X8IA 1QPCA 1Q3WA 3QQUA 2R4BA 3UODA 3HDMA 3OOGA 3VULA 4CFXA 4CYJA 4AA0A 3AG9A 2P3GX 2NRYA 2CCHA 2XNEA 5JT2A 1NVRA 2FYSA 3O2MA 3MGYA 3MW1A 5HTIA 4Q9SA 2B9JA 1V0PA 3Q2MA 2OGVA 2W1IA 3TACA 3WE8A 4BDIA 4C59A 2X6DA 4U9AA 3PLAE 3AT4A 5HBHA 4PTGA 4YTHA 5DRDA 3TI1A 4BZOA 4EBVA 3BELA 4EQMA 2C1BA 3C13A 2QG5A 3KF4A 5AFVA 4DCEA 2AUHA 4IZYA 1IEPA 1R0EA 1UNLA 3EQGA 2HZIA 3WZEA 3ORZA 2BALA 5CVGA 5AV4A 4FEWA 1KSWA 4OGRA 3QF9A 4KS8A 1JKKA 2BILB 3CGOA 3TV6A 2PUUA 4B8LA 3CD8A 3AC4A 4D2VA 4OTFA 5TE0A 1SMHA 4TW9A 3ZFYA 3DFAA 4BDBA 2FH9A 1VYZA 2OSCA 4IX3A 5EDPA 1ZYSA 3GU8A 4YC6A 4O96A 1Q8YA 4E5WA 2RG5A 5M07A 4LL5A 3TKUA 2WMBA 4JAJA 3CJGA 4GEOA 4FUXA 4OUCA 5HLWA 4WNKA 3MY1A 1YI6A 2VN9A 3VS6A 2Z8CA 3TEIA 1OM1A 3DXNA 3PG1A 3IECA 3E8DA 4EHGA 2NPQA 4X7QA 4QTDA 3W0NA 3F6XA 4FKVA 4AZEA 4FZ6A 4TRLA 3QAME 2RFNA 1XH6A 2B9IA 1E1VA 4QMNA 3IGGA 3VONA 3BLQA 3LCSA 3O50A 4EH5A 3UNJA 2YM6A 3MBLA 3JPVA 2OICA 3BRBA 3IPHA 3W2SA 4U44A 4W4YA 5AIKA 4A4LA 2VTHA 4GV1A 2R5TA 3U9NA 3DJ7A 3KU2A 3NNXA 2XK4A 2BTSA 2EXCX 2WGJA 4W4WA 4XOZA 3VRZA 3IDCA 5DOSA 3GUBA 2WHBA 1H28A 2PU8A 1OL5A 2P2IA 4IFGA 3VS2A 5CTPA 4FGBA 3SOCA 4PPCA 3QC4A 4XG4A 4Y5QA 4FI1A 3EFJA 3H0ZA 2RGPA 1BL6A 1YXUA 3NYNA 4FL3A 5A9UA 2IPXA 4LUEA 4JG8A 5M51A 3QD0A 3PUFC 2OXXA 5I3RA 4FKLA 3ZLSA 4QYGA 4L67A 4EK6A 2R3NA 2A2AA 3PPJA 4RG0A 4IC8A 4FRFA 4FGRA 2R0IA 4DH1A 1Z57A 2V5QA 4BB4A 2O2UA 3S00A 1ZLTA 3DLZA 2GS7A 2XAMA 5EQEA 4K6ZA 2YCRA 1FINA 3DCVA 4HOKA 2WTJA 4O0UA 2XB7A 5AR5A 3NLBA 2VNWA 2XYUA 5DR2A 3WF8A 2I1MA 3ORKA 1FVVA 3TTIA 3K5UA 3KFAA 5AJQA 5ICPA 3VBYA 1OKWA 3C1XA 3ANQA 1LR4A 4FTAA 2AYPA 3LPBA 3DBCA 2BAQA 3QX4A 4H39A 2H6DA 4K2RA 4LV8A 4O83A 3D2IA 4EH8A 3V5WA 3DB6A 3PVUA 4XV1A 2PE1A 2W96B 4ZY5A 5HU3A 4FTLA 3CC6A 4FTIA 2XMYA 2JDTA 2X7GA 4UV0A 4C3PA 4BYIA 4E4XA 5IEXA 1M2QA 2CNUA 3R7YA 2YM7A 3MH2A 4ARKA 4HVGA 4ZSAA 4E6QA 3FPQA 2W1CA 4FV1A 3BU6A 3VQHA 5JGBA 1GZ8A 3PY0A 2QC6A 5CY3A 3D7ZA 1PXLA 2C0IA 1WBVA 3PPZA 4WSQA 5FD2A 1DI8A 5HX6A 3NS9A 2Y6MA 2PE0A 1P4FA 3LMGA 2QOLA 5FWKK 2PZPA 1YHWA 1UU3A 5D7AA 4RPVA 5DG5A 3C4FA 4L68A 4Y95A 2UW4A 4O4FA 3HV3A 1WAKA 4D1XA 3EN5A 1K9AA 1P5EA 3Q4ZA 4XCUA 5H8EA 4I0RA 3F5PA 3VNTA 4IACA 4IJ9A 5IMEA 3SLSA 2PPQA 3TNIA 2ITTA 4ASDA 1PXNA 4CLIA 4EOLA 3FYKX 4FIEA 4DDGA 3COKA 2RFSA 5AUZA 3KVXA 3MDYA 1KOBA 4QMSA 2W1ZA 4XP3A 4NUSA 2RSVA 2VTRA 4UB7A 4WNMA 5DEYA 1YWVA 4CV9A 3NUAA 4CG9A 4CG8A 2WMVA 1FGIA 2J0IA 3IW7A 4L00A 4AGWA 4AOJA 2H34A 3OHTA 1OL6A 2ZMCA 5ACKA 3VW8A 3PA4A 5CT7A 1ST0A 2CNVA 3G15A 3DK6A 3U54A 4JRNA 3AC1A 4KIKA 4DEBA 3F82A 5KHXA 3W2QA 2ZJWA 2PTKA 1YRPA 4GU6A 2B0QA 3A60A 4X0MA 2YIQA 2OI4X 3S95A 5KO1A 5I3OA 4FSQA 4D0WA 4BDHA 3JVRA 4QMVA 4ALWA 1OKVA 4GRBA 4JRVA 1L8TA 4CZTA 4Z3VA 5J9YA 5IA1A 5M53A 1DS5A 5EW8A 3EIDA 4QO9A 3MPTA 3KL8A 3LLTA 2WMRA 2VWVA 5DT4A 4IADA 3OWKA 3R8UA 5AA9A 4DDIA 1IASA 2CN5A 1W2DA 1CKJA 3QD3A 5EYMA 4ZOGA 4BVUA 1M52A 1NA7A 4PNIA 4OT6A 3RJCA 5J95A 1X8BA 4JAIA 2X0GA 2QKWB 3UDZA 3EN9A 4C57A 4DEEA 4IZ5A 2PSQA 2NYAA 3E8CA 4Z7HA 4AAYA 4NK9A 5I9WA 4MNEB 3ULZA 3R8VA 4PTEA 4JG7A 3CQEA 3GFEA 3HMOA 2VWXA 4XHKB 3NRMA 4TY1A 4QDEA 5HTBA 2EXEA 3W16A 3MVMA 1ZZLA 3R9NA 3G6HA 1V0OA 4K0YA 5DEWA 4Y46A 4MXYA 3UDTA 4QQTA 3LZBA 4U5JA 1QCFA 1UU7A 3P5JC 2IWIA 3G0FA 4RC4A 3ORLA 4L46A 4XG9A 2UZBA 4FSRA 4GFMA 4KD1A 3UNKA 4O38A 3SRVB 4KAOA 2WELA 2C0TA 3AMBA 4CFFA 4YP8A 5CU2A 2Z02A 4BICA 5L8KA 1YI4A 4FKJA 2FSOX 4YHFA 4F7NA 5ETCA 1TKIA 2X0PA 4GL9A 1F5QA 1FVRA 1P4OA 3R9HA 3BBWA 3UC4A 1DI9A 3G33A 3JS2A 5HE0A 3HECA 3UO5A 4O4EA 3FY2A 4BKJA 5GJFA 2UZEA 1ERKA 2XK3A 3Q2JA 2V7OA 1LEZA 4FEVA 5IH6A 4O81A 2WEIA 5IUGA 1YXSA 1CM8A 2GS6A 4FIGA 5ETFA 2HXQA 4A9TA 5CASA 5CSVA 4KINA 4FKPA 3OCSA 4DHIB 4QP1A 3CQWA 3QUDA 4FTJA 5A4LA 1IA9A 2E9OA 2ZB0A 2QOQA 4EONA 3PSCA 2R3GA 3Q4CA 2HZNA 4I93A 1OITA 4YUQA 3BHVA 3BQCA 4I41A 4TXCA 4YSMA 5G6VA 1Q97A 5LMAA 4MXCA 4P2KA 5CI7A 3TZMA 1GY3A 2F2UA 4BDEA 4BN1A 3SA0A 3NIZA 2UZWE 1K2PA 1PMEA 4GVJA 4QYHA 5GIOE 4DFXE 5F9EA 2JKOA 2E9UA 2VGPA 5M4UA 2HWOA 1VLRA 2UW8A 5IQBA 5DWRA 4FT9A 2CKQA 2J5FA 4E20A 2W0JA 4C61A 1YOJA 4BWKA 5GJGA 3LFFA 4HJOA 3OMVA 3TIZA 2CJMA 3NSZA 3NZ0A 3EN4A 2XK6A 1YW2A 3FL4A 3O8UA 3KKVA 4TYEA 4APCA 5CF5A 2E2BA 3MH0A 2OW3A 1YVJA 3PA5A 2F7XE 3RI1A 4J8MA 4I0SA 1OZ1A 4TWPA 4IM0A 4L3JA 3WOWA 4QT1A 3W0OA 2VU3A 4DEAA 4WNPA 5AAGA 4AXFA 5I9ZA 3VBWA 4ZLZA 2J0KA 3BHUA 2HY81 3QQHA 3R0TA 4HVDA 5I9VA 4FTKA 5HX8A 5F94A 3PXRA 5M06A 4RWLA 2ZOQA 3A8XA 3R71A 3Q4TA 4RIXA 4LRKA 1ZYDA 4AZFA 3FHRA 5CAUA 3H0YA 4AE6A 2XNBA 3ZRMA 2WFYA 4ZMFA 2BTRA 2QNJA 5C8MA 5GZ8A 3LFCA 3UMXA 5A4CA 4IX4A 2X9FA 3SC1A 3TYKA 4BDFA 3ANRA 3UC3A 2JAVA 4F4PA 3AXWA 4YPSA 3W0SA 1ZWSA 3O5AA 3MI9A 3E3PA 4YZMA 4DEDA 5IA0A 4AZSA 1Z5MA 3ELJA 4EQCA 4ZSLA 4AX8A 4D2RA 4IAIA 4CV8A 3ZONA 1KE7A 4IQ6A 4XYFA 3CLYA 3POOA 1SNXA 2BZIB 3OF0A 4Q5EA 4W4XA 1H27A 4J99A 3RINA 1R78A 4AG8A 3LCTA 4M0YA 5IQHA 4HCTA 3OTUA 3HX4A 1JWHA 5EQYA 4RGJA 4DCAA 4WOVA 3R6XA 1OL2A 2XA4A 3OEZA 3QTQA 3D5UA 3QQLA 5M57A 4FNXA 3DDPA 3TZ9A 4YC8A 4BTJA 1Q41A 3QQGA 2G15A 3QWKA 4QMWA 3BIZA 3FMHA 3PFYA 4BZNA 3COHA 4ZXTA 5FLFA 4BI2A 3KXGA 4D2SA 3KREA 4NCTA 4U45A 4I23A 5AP2A 3CR0A 2FVDA 3TCPA 4C62A 3D94A 3IOKA 4EYMA 3BHHA 3QRJA 3TMOA 4QYFA 4YPDA 4KIQA 1H25A 1MRVA 4ZY6A 2WMAA 4AWIA 4E7WA 3E63A 1CTPE 2ACXA 2Y6OA 4GFOA 4O0WA 3LCKA 3SKCA 3V5TA 2JBOA 5LWNA 3ATTA 4O7YA 2RF9A 3UTOA 1WBPA 1OIQA 1QL6A 4OTWA 3KXZA 3TN8A 4UMUA 5B2LA 2ESMA 3RVGA 5C8KA 4GUBA 4EHVA 3R1QA 2VWUA 5CF4A 1M17A 3QKLA 4D9UA 4RLLA 3GC0A 3KB7A 3QZIA 3UGCA 1HCLA 3MFRA 3PXYA 4D0XA 2PL0A 3PJCA 4F6UA 4ZZNA 4UY9A 4HCVA 5HG9A 1BX6A 1NVSA 3FV8A 4YJQA 4BDAA 1H24A 4EH3A 5IU2A 3ORIA 2G2FA 2JIIA 3PA3A 4HGEA 2EWAA 2YCQA 3WARA 2BRMA 5D9HA 4D28A 4ENYA 4BHZA 2BRBA 3A7IA 2VNYA 3F88A 3A8WA 4IB3A 3AQVA 2BKZA 4BCIA 3EN7A 4D4SA 4A07A 3CP9A 5EM5A 3PZHA 4BCFA 3ZO4A 4HYSA 3PWYA 4ZSJA 2QOFA 1ZY5A 3RM6A 4GT5A 2WMSA 2J4ZA 3UDBA 3BHYA 3GCUA 3MIYA 3Q53A 3GC8A 4UMRA 3BGPA 3FLSA 3NEWA 2BHEA 4KWPA 4OBPA 3D2KA 4LGGA 4ACGA 4AN2A 4FKWA 2A98A 1ZZ2A 4DTAA 4OW8A 4R7IA 1WVWA 3PJ8A 4CNHA 4PL3A 3I5NA 3DA6A 4NT4A 2GDOA 4O0XA 1P2AA 1SZMA 2WAJA 4FZDB 4TWNA 4BYJA 3MFUA 5IH5A 3FI4A 4QQ5A 3NYOA 3ZOSA 4XX9A 5AX9A 2WOUA 5EYDA 5H8BA 2AC3A 5AX3A 3VF8A 1XH5A 3GOPA 3EJ1A 5HE3A 2PVMA 4Q9ZA 2VGOA 5I0BA 4FTUA 3AT2A 3LE6A 3RAKA 4E26A 4C4FA 2XVDA 1ZMUA 1SNUA 2YJRA 2ERKA 2XUUA 4IWDA 4WD5A 3ZSGA 1PMUA 5HE1A 5KMOA 5AWMA 2NRUA 3VUMA 4O1OA 4AW0A 4MNFA 5CSPA 1H0VA 4O2ZA 1OPLA 1U5RA 2WQNA 4R5SA 1RE8A 4F70A 3G0EA 5C26A 2GHMA 2GNJA 3O17A 2CLQA 2UW5A 3ROYA 4AGCA 1FVTA 4K9YA 2JFLA 3PPKA 3UIBA 4EWHA 3OVVA 2IF8A 5ANIA 5L2SA 1Q24A 1JOWB 1XO2B 3ZDIA 4BDJA 4KB8A 1OIUA 3WZUA 4EKLA 3B2WA 4ID7A 4JQ7A 1KE9A 4XV9A 4NFNA 3LXNA 2UW7A 3HRFA 5H3QA 2WTVA 3UVRA 3CKXA 5CXHA 1IAHA 1AD5A 4ZTMA 3C4EA 3WYYA 3QL8A 5J7HA 4O0VA 3R8MA 3F3TA 3UVPA 3VIDA 1XBCA 3F2RA 3D5WA 4ASZA 3EFLA 4AW2A 4CFVA 3BQRA 4L3PA 4RFYA 2RL5A 3BGZA 4AP7A 4WRSA 5L8LA 3QCXA 3C4WA 3P7AA 2GSFA 3QXOA 4MQ2A 4ZZMA 4PP9A 4V05A 5BUIA 1G8AA 3HMNA 1H1PA 4ZTSA 2RIOA 4TYIA 4B0GA 3L8PA 2HZ4A 4DGOA 3P5KA 4QMMA 5AIRA 4B8MA 1A48A 3QALE 1MRYA 3C0IA 4IW0A 3DK7A 5EI8A 3BBTB 4FV6A 4B6LA 4KBKA 3GB2A 5B0XA 5TKDA 1ATPE 1WMKA 5LCJA 4UALA 4XP0A 3R02A 4G6LA 4CKIA 3MVLA 3NAYA 4KIOA 3KXHA 4AAAA 2ITUA 4L42A 4CZUA 3LOKA 4M12A 4ANQA 2QQ7A 4IAFA 4YJRA 5I5ZA 2PVYA 2OJJA 3GT8A 5AUVA 4UN0C 5C4LA 4GG5A 1Z9XA 2QD9A 2WIPA 4LUDA 5JKGA 3IG7A 1G8JA 3UZRA 1KOAA 4WG4A 1R39A 4FR4A 2G2HA 2I0VA 5KMIA 1STCE 1YWRA 2IW6A 1NVQA 2ONLA 4CMTA 2BCJA 2GNHA 4S34A 3UOJA 3DOGA 3REPA 3R21A 3HNGA 4F64A 4FG7A 5BMMA 2QOIA 3RK7A 1Q8UA 2VTQA 5F20A 4ASEA 2YDKA 4CFNA 4G34A 3IONA 2R3HA 4ONAA 2PZIA 3WZKA 3EQCA 5JRQA 3O23A 2GMXA 3VBXA 3IS5A 2Q0BA 3S2PA 3QRTA 4O0SA 5HIDA 5TF9A 3RM7A 4R1YA 4O7NA 2OWBA 3AGMA 3QYZA 4O0YA 3D0EA 4C0TA 4ZAUA 3OOMA 2WD1A 3KRLA 5T3QA 4E6CA 4O7VA 2Y8OA 3FZ1A 3O8PA 4I94A 5IISA 4H3QA 1Q61A 1H07A 4AQKA 4PL5A 3ODZX 3SG9A 4ANSA 4W8DA 2P55A 3A7GA 4O0RA 4PF4A 3H9FA 3PJ2A 5KCVA 3EKNA 2XYNA 3OW4A 5LWMA 4WUNA 5CU3A 4UMPA 4A06A 4L8MA 2XZSA 5IEYA 2Y4IB 5DN3A 1ZMWA 2ZM3A 4N57A 3NIEA 5LARA 3DXPA 5ACBC 3R7EA 4BZDA 4C4JA 4AE9A 3RNIA 4D2TA 2J5EA 5LOHA 4NU1A 1ST4A 4AZWA 1SVEA 5GJDA 1OECA 4JMQA 4RA4A 2QCSA 5K5NA 2BZHB 4GK3A 3CY2A 3QZGA 3HEGA 3TNHA 1JSUA 4MK0A 3G51A 3MPAA 2XNNA 4GIIA 4JR7A 2QHNA 1U5QA 2VX1A 3FLYA 3LQ8A 3R73A 4R7BA 4NJ3A 4WIHA 2HZ0A 3AKLA 2FSTX 4C4EA 4DTBA 5AV3A 2UV2A 2VWZA 3RK9A 1H1WA 3P86A 3P1AA 4XG6A 3ORNA 2UW0A 1NY3A 2JDVA 4UXLA 3ZM4A 4JQEA 3OBGA 3HV4A 2B54A 3HUCA 5JRSA 5L4QA 2CSNA 2OIQA 2A4LA 2UW3A 3Q5IA 3MS9A 3HRCA 3WF6A 3PDTA 3LHJA 2W7XA 3MV5A 4G3GA 4ANBA 3QTIA 5HD7A 4PMSA 1YDSE 4O2PA 2R7IA 3D15A 5AADA 2X7OA 1K3AA 4I24A 4NCTC 4O22A 5HCYA 4RQVA 3TUDA 5HLNA 2CN8A 3LIJA 3VS0A 3V04A 2QI8A 4ZJIA 2C69A 3VW6A 2HENA 1U4DA 4Y72A 5GNKA 3ZRLA 4BCJA 4EZ7A 2ETMA 3NW7A 3F7WA 4GVAA 4XH6A 2GNIA 2ZB1A 2J6MA 4N6ZA 3PIZA 1UU9A 3W55A 1REKA 3EN6A 4ACHA 4F78A 2DWBA 5F95A 3UPXA 3NPCA 3SVVA 5LCKA 4DITA 3MB7A 3ZH8A 3BKBA 3CIKA 4CRLA 4FT0A 3WBLA 4FUYA 5HESA 2W5AA 3GOKA 2WB8A 3COIA 3RAWA 5JN2A 5FP6A 4CVAA 3WF9A 3MSSA 4QP9A 4EZ3A 4FTRA 2Z2WA 2O3PA 4AF3A 4AT4A 5BVKA 2OJFE 3GXLA 4RVLA 2GTNA 4S31A 4OTQA 3G2FA 3C5UA 5HG5A 3I4BA 2CPKE 3QX2A 1WBWA 4R8QA 1TQMA 2W5HA 3Q60A 2FSLX 3CTQA 4JVGA 4BWPA 4DFLA 3C9WA 2PVJA 4YHJA 5BVOA 3BGQA 4EK5A 3FBVA 1ZYJA 3ZBFA 4OTPA 2XIYA 2CCIA 1IRKA 1E1XA 4MBJA 1DAYA 4CCUA 1PRYA 4AXCA 4IVCA 4I5CA 5A6NA 3TV4A 5L3AA 4RFMA 4F6SA 4O7ZA 2PMLX 4PMMA 3PE2A 4TYJA 3FMEA 3EQRA 5E8UA 4S30A 5L2QA 1G3NA 4TZRA 3RWQA 4FSUA 4ACDA 2W9ZB 2EB2A 3CKWA 5IZFA 2O64A 1WVYA 2Y7JA 5AP6A 2VO3A 1W7HA 3A2CA 2C4GA 4RZWA 4S32A 2UVYA 1FBNA 5GINE 2YISA 3R8ZA 4C4IA 5J1VA 3R7IA 3Q9XA 2FSMX 2YACA 3F7ZA 4JXFA 4KKEA 4E4MA 3ZZWA 1BUHA 3U6HA 4R78A 5LMBA 2X0QA 4ZTNA 2ITYA 2JKMA 4NTSA 5A54A 2W1HA 4J96A 4AGDA 1F0QA 2GNLA 4CTCA 5IG1A 4OTGA 4FVPA 4AXDA 3FMNA 4K1BA 2EUFB 3JY0A 4ZMEA 5E1EA 4CYIA 4GG7A 4CSVA 4KKGA 2HY0A 4A4OA 4CCBA 5M4IA 4FIFA 4J71A 2XANA 4F9CA 2J0MB 3KVWA 3A61A 3C4CA 4K18A 5IH4A 1MQ4A 1R1WA 2UZNA 5AMNA 1XH4A 4FYOA 3CQUA 2UUEA 4FOBA 3HYHA 3Q6UA 3MTLA 5GIPE 3NYXA 3RPVA 5LMKA 1PXOA 2WTIA 3FUPA 2PUPA 4LDTA 4HGTA 5AM7A 3F3VA 3O8TA 4EOIA 3DJ5A 4KIKB 1QPJA 2VTSA 4M97A 2I0HA 4RJ3A 3O7LB 5CZHA 4EYJA 2VTNA 3TDVA 1KE5A 3RMFA 1KWPA 2B7AA 3DLSA 4GYGA 3R9RA 4F9YA 3KRJA 4YTCA 3KN6A 1G5SA 3UZTA 4BCNA 3PJ1A 4IAAA 4O7LA 4X21A 4CFWA 5BVFA 4J97A 3GP0A 3BLHA 4MQ1A 4QMLA 4EKKA 4YO6A 2ETRA 3IGOA 2YITA 2V22A 3Q04A 4O86A 2R2PA 5KKRC 3F69A 3WI6A 4O1PA 4G3EA 3AC3A 4V0GA 2NNWB 3I60A 3NVMB 3BEAA 4NFMA 3BHTA 2W9FB 1UKHA 5CX9A 4C3RA 2WO6A 4FV5A 2BPMA 3CTHA 3FQHA 5DRBA 2Y4PA 3HV6A 2XIXA 4BIDA 4E4LA 4O27B 2CGVA 1RJBA 4QMZA 1OL1A 4NKSA 4TWOA 3IKAA 3OEFX 1RDQE 5IUHA 5C9CA 2WU6A 1PMVA 5IQCA 5FXRA 2XCHA 5BMSA 3PXFA 4FTCA 4TYGA 5ANDA 1UA2A 3T8OA 4F99A 2R3MA 5LVOA 5JQ5A 4YJPA 5HO8A 4I6LA 3H4JA 1TVOA 2C68A 3QRKA 3R7OA 3LQ3A 5D12A 3T9TA 3ZMMA 4D1ZA 4OR5A 4FF8A 3KQ7A 4FV8A 2C6OA 2OF2A 4DH3A 4PUZA 4O0TA 2JITA 3BWJA 2H96A 4TTHB 4E3CA 4DH7A 4I92A 4QMYA 3FZOA 5EM7A 3AKJA 2WTDA 1ZXEA 3VBQA 1RQQA 5CQUA 3CGFA 4Z7GA 3ZM9A 3QBNA 3QTZA 4J1RA 4F7LA 3P0MA 1WVXA 3OY3A 4DLJA 1FGKA 3DNDA 5L6OA 3E8NA 3ERKA 5FP5A 5JZNA 1B39A 3RAHA 4E6AA 4QEBA 3A7FA 2QOOA 4IAYA 4ITHA 4TYHA 3BZ3A 2F57A 4FTMA 3TUCA 4ZLYA 5BUEA 3LW0A 3BYOA 2X2MA 3UP2A 2QOKA 3SHEA 2UVXA 3ZEPA 1J7LA 2XNGA 2ZVAA 4WUAA 4AU8A 4DEGA 1NXKA 3PXZA 5TO8A 3LKMA 1SYKA 2VV9A 3SV0A 3FYJX 1XMMA 3TXOA 2RKUA 1YXXA 2B52A 3NNWA 5DGZA 2EB3A 3QTXA 4AS0A 4F7JA 4C8BA 4RBLA 4FICA 2C1AA 2CGWA 3CD3A <