4ACGA

Gsk3b in complex with inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
350
structure length
350
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Discovery of novel potent and highly selective glycogen synthase kinase-3 beta (GSK3 beta ) inhibitors for Alzheimer's disease: design, synthesis, and characterization of pyrazines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4acgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4acgA01
2I6LA 3ACKA 4APPA 4DHFA 4UZDA 3AD6A 3UP2A 3H4JA 3R1YA 5AUUA 3UNZA 3Q53A 4NJDA 3V8TA 3MH0A 2GNGA 5I9WA 5CF5A 4JQ7A 5EYMA 3CD8A 3E3PA 3OWKA 3W2QA 4PNIA 3N4TA 4BCOA 3VBQA 3VWAA 3F5GA 4UYAA 4F70A 4OTHA 1YXVA 4BIDA 1R0PA 3R7GA 4NKSA 3HA8A 4L3PA 4M8TA 4PPCA 3W16A 5JFSA 4AT5A 5LVOA 3QQJA 4GVJA 1ZLTA 4N0SA 4ZK5A 3TDWA 3EQIA 2WD1A 4JLCA 3PUPA 3ZUVA 4C2WA 3AT2A 5A4QA 3NNWA 2YDIA 4C4EA 4DE4A 4BDGA 3DS6A 3CQUA 2ZM3A 2BILB 2YLFA 1Y91A 4FT0A 3VJNA 4IWPA 4IDVA 5GIOE 1Z57A 3H9RA 3ACJA 4L8MA 4TYEA 2PVJA 5FXSA 2B9FA 5A9UA 2CKPA 3FZRA 3GU8A 3L8SA 2YIWA 5KMLA 1Q8UA 2E9UA 4M3QA 2XJ1A 4R5SA 5FM2A 3E64A 4JRVA 3RWPA 3HL7A 4A4LA 2OJ9A 3BLRA 4GIIA 4BGGA 4E4XA 5K9IA 4NCTC 3EWHA 5LVMA 1JAMA 4HYUA 4EUUA 1XBCA 5JN2A 2WMSA 4EUTA 4IVBA 4EI4A 4JI9A 2F7ZE 3FZOA 5FWKK 3VUIA 2W4KA 5E92A 2UZWE 3JY0A 3VS5A 4M0ZA 4I24A 2R3KA 4ZTNA 3E88A 5J9LA 4I1ZA 2CNUA 2WKMA 3LPBA 4YJRA 1FGKA 5A46A 3ZRMA 2J0IA 4JBQA 4R5YA 4ZSAA 4IZ5A 4J71A 4N4SA 4Y5HA 3D14A 4RWKA 4FEXA 3RGFA 4UMTA 3U6IA 1WBVA 2OJGA 2JKQA 2UW9A 1UVRA 2QU5A 2XNOA 2R7IA 1ERKA 3RPVA 5A54A 4YP8A 1M7QA 2R3MA 4C4IA 2XM9A 1CKPA 1S9JA 3BGQA 4RMZA 3NNVA 4DC2A 2OICA 4FIFA 5ITAA 5IU2A 2C5XA 2C5OA 1BMKA 4ZS0A 2OZOA 5G6VA 3I79A 1CTPE 4RJ3A 3DJ7A 5DGZA 4A9SA 2QOLA 4O0UA 1OM1A 4RJ7A 4QP8A 3B8QA 5DR6A 3HGKA 2NRUA 2F2UA 4FG9A 2PL0A 4D0XA 2W1EA 5CSHA 4BGQA 2ITPA 3I7BA 4WRSA 3SQQA 5KKRB 4QQJA 5E8XA 3ULZA 1G3NA 2C68A 4FT9A 2J6MA 4Q2AA 3A60A 4BDAA 3F3ZA 5IUIA 4QP7A 5CALA 3V5LA 5HIEA 5EDQA 2QR7A 4FG8A 3FY0A 4WRGA 3AT3A 1ZYDA 4QYEA 4KIKA 4YTFA 3KXXA 4RWLA 3ZFYA 1OKWA 5C27A 2WGJA 3G15A 2YERA 3UQFA 3Q4CA 2W5HA 4JL9A 4BCQA 3FQSA 3OOMA 3OMVA 3C0HA 4IBMA 4CYIA 2ITUA 2WIPA 4X3FA 3N4UA 4AGWA 2IVUA 4FC0A 3COHA 3LXLA 2BRBA 4TT7A 5CU0A 3NNUA 3QKKA 4WT6A 3QHWA 3MY1A 1TVOA 4Q5EA 3ZSGA 4RJ8A 3HZTA 4C36A 3CSVA 5IEXA 3ITZA 3A7JA 4XCUA 2QNJA 4BHZA 4KBKA 1B38A 5I9VA 4AZSA 2B53A 4B8LA 4BWXA 5CVHA 5FD2A 4PDYA 4DITA 3T3VA 2PE1A 4TYHA 3PPKA 5C01A 3V5PA 3DXQA 1H8FA 2VWYA 3G51A 3U4WA 3L9NA 4D2WA 3GU4A 5HTIA 3FI4A 4P7EA 4V04A 2VTOA 2I0EA 3LAUA 3HAMA 2VV9A 1YHSA 3C1XA 3NYVA 4C8BA 2W1GA 2XB7A 4EOOA 1R78A 4AGDA 3PE1A 3SW7A 3SGCA 3PVUA 1ZAOA 3VC4A 2YWPA 4A06A 4ASXA 3PIYA 5FDXA 5HE0A 1J7IA 4JR7A 4RGJA 4BZNA 3UODA 3RAKA 3ZUUA 5AR3A 2WZJA 3V3VA 5DIAA 3VS1A 3TJCA 3R9OA 4GT5A 4AW2A 3F66A 4MBIA 2BTSA 3D2IA 4NWMA 5TT7A 5AP4A 2PUIA 1UKIA 4O1PA 4ITHA 1U54A 5E8SA 4O81A 3U54A 3PDTA 1ZMVA 4Z3VA 4KIQA 2G1TA 3CKXA 3LXPA 4YZNA 4CMTA 3G33A 1YXTA 4M69B 5A4TA 5KO1A 3R7EA 2I40A 4RQKA 3FC1X 4R7HA 3FI2A 4R1VA 1Q62A 2C6KA 3UZRA 4FR4A 3Q9YA 5E1EA 3JPVA 5IUHA 3R1QA 1GIHA 3V6SA 5HG5A 3ZH8A 2YZLA 4CFWA 1BL6A 4KBCA 5HBJA 2Q83A 4FTLA 4PWNA 3FL4A 2WMRA 5M4FA 4GK2A 4OTIA 2B7AA 2HWOA 4PV0A 2EXMA 2BR1A 2B0QA 3WIGA 3QA8A 2OFUA 2VD5A 3FMHA 3ZC5A 1Z9XA 4LMNA 4PPAA 1KE8A 3PVGA 3F88A 4G16A 3A99A 4R3RA 5TOZA 3EFKA 4EHZA 5K4JA 4MH7A 3WZUA 3RI1A 3E92A 4XS2A 4AA4A 3ALOA 3G90X 3UIUA 3FE3A 5GJDA 4E8AA 1M2RA 5DH3A 4FEQA 4D28A 5IG1A 2XNEA 3HA6A 2VX0A 4FKVA 2UVYA 4QYYA 4K6ZA 4FEVA 2XCHA 2EB3A 4XV9A 2A1AB 5G1XA 4ZY5A 3JS2A 3LMIA 5IQHA 1WZYA 5FTQA 5IMXA 2Z7QA 1V0BA 4BCJA 3CP9A 2YCRA 4GMYA 3UP7A 2QO2A 2RFDA 3ZS5A 4PMPA 4IC8A 4IANA 2J0LA 3D5WA 1FOTA 1DI8A 2BAKA 4XG4A 5HE2A 3SXSA 1OL5A 3UVPA 1VYWA 3R04A 5M4UA 4RFYA 3E63A 3K2LA 5I3OA 5HX6A 3DNEA 4AN9A 4CMUA 3PZHA 1J7LA 3UOKA 3GGFA 2VWWA 3E7OA 2CGUA 4EOKA 3BQRA 5L8KA 1XO2B 4CLJA 4XG3A 3BLQA 3C50A 4FNZA 4JNWA 4QYGA 4EONA 4F08A 4USEA 4XOYA 4X6RA 5J87A 3KCKA 3DJ6A 3R1SA 2FA2A 1QPDA 2JEDA 1R3CA 2C6IA 5EHYA 3ZO3A 4HVGA 3F5UA 3CXWA 2BROA 3FMJA 3MVHA 2GDOA 1Q8YA 3PY1A 5I9ZA 1J3HA 4OTQA 4V0GA 5JZNA 3RAIA 4I0SA 1FBNA 4U43A 1YRPA 4OBQA 4AA0A 1YI3A 4ACGA 1CSNA 5AM7A 3DQWA 2X1NA 4FL1A 4RPVA 4WIHA 3II5A 1F0QA 3A8WA 3R63A 5ANIA 2WMWA 1Q8WA 2WMTA 4OBPA 2UV2A 2VX3A 2YAAA 3QUDA 4IM0A 3F2RA 3DCVA 3G6HA 3EIDA 3S3IA 4DTKA 2O8YA 4L46A 3QQHA 2HXQA 4KS7A 4PP9A 5ETCA 1H25A 4FKSA 2HYYA 5TKDA 4IB0A 1JVPP 2JIIA 4I6HA 3VVHA 5FGKA 4JG6A 1BI7A 5JFWA 2PHKA 4XV2A 3QD4A 4IAFA 3VUMA 3C4WA 5CT7A 3ZEPA 4ZLOA 3VUHA 3F69A 4YPDA 1ZYCA 4XH6A 2J0JA 3OD6X 3VUGA 4ACDA 4HGLA 3VBYA 4A9RA 3IDCA 2OXXA 3IW8A 3CKWA 3QD0A 3QWKA 3IGOA 4GS6A 5ACBC 2A4LA 4UMUA 4EH5A 3TUCA 2J90A 4DA5A 3UBDA 2ITYA 3P7BA 4B7TA 3IKAA 4RIXB 5J5TA 3VS7A 2R0IA 3A4PA 4PQNA 2LAVA 2PMNX 3HV4A 3RAHA 3DGKA 5M4CA 2V0DA 2FSMX 2E9VA 3R2BA 4YTCA 1NVRA 4MAOA 3ANRA 3QRUA 3R0TA 3DK3A 3LCDA 5HVYA 2ZDTA 4OTPA 3U4UA 4M68A 2AC3A 3QLGA 3KREA 4LL5A 4EH2A 3IK3A 5FTOA 2BAQA 2QOIA 3PJ1A 5DOSA 3LOKA 4Y73A 4QT1A 3VUDA 1UWJA 1OPLA 3PXFA 4AFEA 4U79A 3P79A 4EH4A 2IVVA 4KWPA 1KE7A 3G0EA 3DLSA 4YO6A 5CAVA 3DDQA 4NW5A 4QRCA 1U5QA 2WTIA 4AGUA 4S33A 5FBNC 3UNKA 2J0MB 2PU8A 4X2GA 4CG9A 5B7VA 1ZOEA 4TWCA 4RRVA 1A9UA 3FJQE 3DZOA 4QPMA 3HV7A 4BCPA 2X9FA 3KRRA 4JXFA 4R8QA 2H34A 2HZ0A 2XEZA 4JDJA 3MI9A 4C4JA 4EQCA 2XEYA 4XG6A 3QZHA 1QL6A 3FV8A 3FMKA 1KV2A 3T3UA 3HVCA 4JIAA 5D1JA 3LQ8A 3T9IA 2BALA 2CMWA 3LJ2A 1BYGA 4G6LA 4LUEA 3W33A 2XP2A 3WZDA 4EORA 3WARA 5B2MA 5C8KA 1LR4A 1P5EA 4AQCA 4DLIA 2HAKA 4GSBA 2XCKA 1F3MC 4BY9E 5HU9A 1XH5A 4EOJA 3PJCA 3NW5A 4RIWB 3GQIA 3TNIA 3C4ZA 3ZLSA 2G2FA 4ZTMA 4YJOA 4Z55A 4JDKA 5KMMA 1OMWA 3OCGA 3DXPA 3P08A 2EXEA 2WMQA 3OW3A 2XMYA 4RX9A 3KF4A 2P2IA 4YURA 5IA4A 5AV3A 3Q4UA 4MTAA 2OXYA 4YR8A 5CEQA 2DQ7X 4BIEA 3VRZA 5M06A 5IKWA 2C6MA 5EI2A 2W1FA 2Y8OA 3NLBA 2C4GA 1GY3A 2E9NA 4ANBA 2CSNA 3ENMA 2QLQA 2GS7A 4OLIA 4EZ3A 2UW7A 4CZTA 3UOHA 2UZDA 1Y8YA 4NCTA 4CKRA 3GFEA 4GV1A 3I81A 4FK6A 4AOTA 2AYPA 4CQGA 5BNJA 2W7XA 1JKTA 4U3ZA 2VGOA 2JLDA 4FV0A 2ZMDA 5LMAA 4C3RA 4R77A 2JBPA 4CTBA 4FK3A 2VAGA 3SG8A 5TE0A 4EK5A 5CEPA 3AMBA 2W1CA 3Q96A 5DG5A 5H8BA 3QHRA 3FLQA 4GL9A 2OIQA 2RFNA 4MHAA 3CY3A 4UYNA 5E7RA 4LG4A 2OK1A 3QQGA 4L44A 4BI1A 3O0GA 3R7YA 3GC7A 3PRIA 3SLSA 4DGOA 4BDBA 4ZLZA 2YDKA 1GIJA 2YDJA 3EN6A 3Q9WA 3UZPA 3NUNA 4O7RA 4FTOA 4HGTA 5M08A 3D7ZA 3DAEA 3FXWA 5AR8A 3IW5A 4CEGA 4F1TA 4IWQA 4AZTA 2G15A 4EQMA 2HZIA 4KA3A 4TNBA 5ANJA 2UZOA 1XKKA 2G2HA 1Y8GA 5IQBA 3HYHA 4I0TA 3BI6A 3QUPA 3ET7A 4RZVA 4TWPA 1M7NA 4NFMA 2XKEA 3CQWA 4FL3A 4NTSA 4O38A 3VBWA 4Z7HA 3OY3A 5HG8A 2XYNA 1H08A 4B6LA 3FC2A 3MVJA 4H3PA 4L3JA 5AP0A 1GIIA 2VWIA 4U3YA 3FMMA 3PLAE 3DDPA 3FLWA 5AX9A 1TQMA 3H3CA 5M57A 3Q60A 4O0YA 4E6QA 2VTQA 4XEYA 5E8ZA 4YMJA 4UEUA 3NWWA 3QTQA 5HD7A 5A4CA 3LE6A 3SXFA 4ZSGA 1BUHA 5BQ0A 3K5VA 4K2RA 5CAUA 5L2QA 4H36A 5BVNA 3UIBA 5IH6A 2IVTA 3H0ZA 3PP0A 2UZVA 4I5HA 1O6LA 1W82A 5EW9A 2QOQA 3IW7A 2XM8A 3KGAA 3WE4A 2IN6A 2R9SA 4EK4A 4CGAA 3BIZA 2I0VA 3KXHA 3GEQA 2WMVA 4DH7A 4FZDB 4E73A 1IASA 4CVAA 4I92A 3EFWA 5A3XA 4RIXA 5EI8A 3TJDA 4F4PA 3QTIA 2DUVA 1URWA 1RJBA 2WU7A 3O8PA 3MJ2A 4BTJA 3TNPC 3WBLA 4ZMFA 4I22A 5I4NA 4V01A 5HG7A 4OTDA 2G01A 2R3RA 2UW4A 3EKNA 3LXKA 1ZXEA 4CFVA 3ZOSA 3O17A 3UVQA 1ZRZA 4RC3A 1ZOHA 3V5TA 2Z60A 4X7QA 3ZXZA 5E1SA 3PSDA 5KCVA 3OXIA 3G2FA 2XIYA 3Q9XA 3W2RA 5M4IA 4XRLA 3NUAA 3EQFA 4GFMA 2QODA 4NM5A 2BDWA 4UX9A 1DI9A 5HESA 3LZBA 1Q61A 2R7BA 3M42A 4G3FA 4MXYA 3MY0A 1E1VA 3RTPA 5IH5A 4M13A 3EL8A 5TF9A 2QCSA 4GH2A 4FUYA 4O6EA 4WG4A 5BMMA 3A2CA 3PVBA 3U6HA 4XJ0A 3TI1A 3TN8A 3AC3A 1YOLA 4QMQA 3KN5A 3TTJA 4I20A 3FQHA 2OJFE 3PY3A 1H1SA 3O7LD 4D2TA 4D9UA 2C0OA 3TNWA 4FE2A 3DBFA 3NUSA 3I6UA 2XNBA 3ZFXA 5ANKA 1PHKA 5CZIA 1DAYA 2F4JA 3GCQA 3ORMA 5IMEA 5GIPE 2B1PA 4E6CA 2YM6A 5HORA 3ZLWA 2HZ4A 4KKGA 5BYYA 3ALNA 3D5VA 3R8ZA 2C6EA 3BYUA 4X2FA 3UO6A 2PY3A 3ERKA 4CTCA 5JGAA 3FY2A 3HLLA 2JAMA 4J53A 4J96A 3R8LA 3SAYA 4BDIA 5AEPA 1CKIA 4H3BA 3GU5A 2ITWA 4UBAA 2YCQA 2BDFA 3QU0A 2XYUA 3T8OA 3TUDA 2EXCX 3NEWA 1J1BA 3UMXA 3ZC6A 4PMMA 2I0YA 5AP5A 2B9IA 4XBUA 3LFAA 5M07A 2HZNA 3D7TA 4D4YA 4M12A 2GQSA 4DBXA 2OXDA 3DFCB 3FMEA 4QMYA 3WF6A 3BYOA 4CG8A 3GT8A 2YABA 3TIZA 4O7VA 4NTTA 4AZWA 2QKRA 2C1BA 4O83A 1PXJA 4C62A 1KUTA 3TXOA 4EOIA 3BE9A 4FV2A 4ZSJA 3KXMA 4W4VA 4FV4A 3RHKA 4P4CA 1XJDA 2A27A 5CF6A 4IC7A 3CJGA 4F63A 3QKMA 3UJGA 2IO6A 5L4QA 3WZEA 2F7EE 3RZBA 2XJ2A 2O3PA 2XRUA 4FODA 2BHHA 2EVAA 5L6PA 3FEGA 5E8YA 4RC4A 5EW8A 4BWPA 1A48A 4ZS4A 2VTNA 4FSTA 1SVGA 3PP1A 4FTNA 5H9BA 4BKYA 2UW8A 4RC2A 3AC1A 3RPRA 1ZZ2A 4G3EA 4WBOA 3GOKA 2G9XA 4G9CA 5KHXA 2QU6A 2W1IA 3E8DA 5J5SA 3PIXA 3KFAA 4YTIA 4KBAA 4TPTA 4EH8A 3TM0A 4D1XA 4IAYA 4EL9A 2V7AA 3PJ8A 4WG5A 5AUTA 3AOXA 3RK9A 3GQLA 4S31A 2YIYA 4W9XA 3ZTXA 2NRYA 3DK6A 2WMXA 1JSUA 4YHTA 5EQEA 5CT0A 4K77A 3KXZA 5AADA 3UDBA 3E8CA 2R0UA 4ITJA 4RA5A 4FIHA 4MCVA 2VTLA 3LCSA 4HZSA 4U8ZA 4WHZA 5JEBA 4NL0A 1MQ4A 2RG6A 3I0QA 4ZLYA 2EU9A 4F1MA 1WBOA 4NM7A 4ZMEA 3F5PA 4F7NA 4O27B 3DZQA 4R7IA 4AUAA 1WMKA 5DE2A 3IW6A 4RJ5A 3NAYA 3N4VA 3OTVA 3R2YA 3DPKA 3EH9A 3OWLA 2NP8A 4GK4A 4C4FA 4TRLA 3R8VA 4RSSA 1XHAA 3SRVA 3TWJA 4IX3A 1H28A 2GNJA 3KVWA 3L9MA 4Y95A 1AGWA 5LVPA 2BFXA 4FKUA 5DLSA 2OSCA 3KRJA 3T9TA 3ZHPC 4BCHA 4XP0A 2EWAA 2X2MA 3CTJA 2XNPA 3V5QA 4F9BA 3IDBA 4J8MA 5IF1A 4C34A 4LGGA 1Q8TA 3KRLA 1J1CA 2X6DA 4NJ3A 4RJ4A 2FH9A 4LYNA 4ERKA 2QG7A 4HGEA 3ZZWA 4X21A 3FYJX 4Z7GA 1UWHA 4CSVA 4LI5A 3COKA 4RLKA 2XRWA 4XP2A 5L6OA 5KNJA 2IW6A 5HCYA 3FWQA 1PXPA 4AFJA 3BGZA 3V04A 1NA7A 2XKFA 3FLNC 3AC8A 1WBPA 1BLXA 3WYXA 4EZ7A 4L67A 4FT3A 3U8WA 2DWBA 4LGDA 3S4QA 3VHKA 3QWJA 4AW1A 3OW4A 4EZ5A 3R83A 4FTIA 4TYIA 2O64A 1WAKA 3IOPA 3FDNA 2IWIA 5ETIA 3C5IA 4BKZA 1F5QA 3VS6A 3BEGA 4BF2A 4FTMA 4MKCA 2JAVA 2PMOX 1KOBA 4MQ2A 1ZWSA 3JVRA 4OGRA 5EYCA 3R8UA 3SKCA 4C37A 2C6DA 4CT2A 3FQEA 4CD0A 2Y0AA 5EM5A 4D0WA 4I41A 4A4OA 4ZEGA 3ZYAA 3SOCA 5D9HA 3GBZA 5IA3A 4E20A 1G8AA 3QF9A 1OIUA 3CEKA 4WBBB 5AWMA 2IW9A 4E6DA 4ZP5A 2F9GA 4PTGA 2BMCA 2PVLA 3TIYA 4GCJA 1Q3DA 4AE6A 2VWZA 3O50A 3OCBA 5A6NA 4G17A 4ALUA 5M44A 4QMZA 5E90A 4EK6A 3F61A 4IZYA 5DT4A 1TKIA 3EZRA 1YXUA 1JKSA 3V8WA 2WQMA 3ZONA 4IW0A 1XH6A 2X2KA 4BZOA 4OBOA 5AUXA 3MTFA 4J8NA 4ID7A 3LXNA 2OF4A 4OTWA 3E3BX 3QQUA 4F9WA 1LP4A 1PXOA 2FO0A 2X8IA 1UA2A 4PPBA 4AT4A 4O0SA 4C02A 2B9JA 4I94A 3QXPA 4QMVA 1UU8A 4ONAA 4ZSEA 3KL8A 2HY81 2Y9QA 5BVKA 3C7QA 4Y83A 3IPHA 5D12A 5JFXA 5L2SA 3ATSA 5M53A 1NVSA 4AP7A 3ULIA 2WEIA 3OEFX 2VWXA 4CCUA 5IPJA 3M11A 2J5EA 3D4QA 3MW1A 4JAJA 2UVZA 4M66A 1NXKA 3Q6WA 5DBXA 5HO7A 4A7CA 3BELA 4XX9A 4A9YA 2XVDA 4IFGA 4JX7A 1EH4A 4LFIA 4LUDA 3W2PA 4PTCA 3ORPA 5L2IA 2OJJA 4C3PA 2Z7LA 3BBWA 2O65A 1OL6A 4AOJA 4WOVA 4AZVA 2R3PA 2W06A 4XYFA 4FT5A 3E87A 1K2PA 4DFYA 3GU6A 4I6QA 4ARKA 5IEVA 1ZOGA 3W2SA 4PDOA 5J7BA 3QQLA 4IM3A 3WOWA 4EYJA 2ZM1A 3PTGA 4MK0A 3AD4A 5JRSA 3UGCA 3KK8A 5GZAA 4NM0A 3HDMA 3NIZA 4BCGA 4D4RA 1H07A 2QVSE 4FT7A 3QXOA 3BHHA 3PFQA 4YJUA 3TL8A 5JZJA 3F2NA 5IQDA 1OKYA 2IZUA 4IAAA 3R00A 3VIDA 4O21A 2OI4X 3U55A 3TZ8A 2ZJWA 5TO8A 1OIRA 1H4LA 3UNJA 1NVQA 1SMHA 2PVMA 3RWQA 5DR2A 2WMBA 1Q8ZA 2JBOA 3D9VA 4USDA 4FTCA 3DB6A 3GNIB 4FTUA 4J97A 4QD6A 4ZTHA 4PMTA 3VS2A 3DTCA 4WNKA 4WNPA 5HOAA 4YO4A 4QP9A 5TR6A 4EHEA 3FKLA 1W7HA 4UXLA 2VTIA 3MV5A 4EH9A 4FL2A 2XKCA 2QOBA 2UW6A 4FVPA 3CS9A 3NCZA 3L8PA 2QKWB 3OT8A 4L42A 2GCDA 4O0WA 4FTRA 3C4CA 3DKOA 4R7BA 4FF8A 1W98A 2WOUA 3TTIA 3PWYA 4MWHA 4BGHA 4FSWA 3SD0A 3WIKA 4FICA 2PUUA 4FKTA 3S2PA 5CSVA 5HIBA 4BN1A 2O5KA 3PA3A 4BKJA 3GB2A 1Y6AA 1Q41A 2WHBA 3FMDA 3SVVA 4U97A 5IISA 3KMUA 5KZ0A 5KHWA 4BBEA 3A8XA 4PX6A 4AW0A 3WE8A 3G0FA 3MBLA 4EC9A 4F65A 1FVTA 4H1JA 3EQCA 2Y7JA 3AGMA 1SZMA 3LCKA 3RVGA 4XNEA 3AC5A 4AW5A 2F2CB 4QP4A 3QALE 3R7IA 3IQ7A 5CU3A 3EQDA 3DA6A 3NYXA 2OF2A 4GW8A 4L45A 3P78A 5A6OA 4DFBA 1I44A 3F82A 4FNYA 2EUFB 1OIQA 3CGFA 1PMEA 2GHMA 2UZUE 5CNNA 2IG7A 2C3JA 4XG8A 3DBEA 3DKCA 1OPJA 3MN3A 2BFYA 3OBJA 2YM7A 4NT4A 4PDSA 4RIOA 4X0MA 4BRXA 5K4IA 1L8TA 2BUJA 3KRWA 4L00A 1L3RE 3ZMMA 4NEUA 3ORNA 3N51A 4YJVA 2PZRA 4JRNA 2XZSA 1WCCA 3RPYA 4EK3A 1OB3A 5AIKA 1XQZA 4LGHA 4BYIA 4ANQA 3VW6A 3QCQA 5JQ8A 5BUJA 4FI1A 1DS5A 4HJOA 5L2WA 2SRCA 1I09A 1JOWB 4L7SA 4NW6A 3SX9A 4WUAA 4X2NA 4GKHA 3R7OA 2ZDUA 4W4WA 5HICA 1UNLA 5HVJA 3DT1A 4C7TA 2PMIA 4YHJA 3QGYA 1OZ1A 5AA8A 2J50A 2J4ZA 5HO6A 3CTHA 5K0KA 4D2SA 4FKOA 1IR3A 4W8DA 5IEYA 3BWJA 3P5KA 3SV0A 5FEDA 5KZIA 5E91A 5JGDA 4IX6A 4X2KA 4IAKA 4QQTA 4CCBA 3BRBA 2ONLC 3UMWA 3ZZEA 4GJ3A 4ANSA 3KK9A 5FTGA 2C3IB 4MXCA 4ZTRA 2W5AA 3HUBA 5FUTA 3O51A 4ORKA 4AXAA 4A9TA 4AG8A 3KA0A 3QYZA 4XG2A 2FSTX 3UQCA 1XH4A 2VU3A 5IH4A 4KSPA 4BYJA 2VO0A 3BX5A 4LOQA 4XUFA 3FYKX 1K9AA 2HCKA 2C5NA 4YZBA 4YC3A 5LARA 3LLAA 5GZ8A 3IECA 3I0OA 2ITOA 3A61A 3KCFA 3OBGA 3OT3A 4GVAA 5F9EA 4OTFA 3R9NA 1ND4A 3D83A 4XG7A 2CNVA 3HMPA 4Y85A 5AUZA 4KABA 1H1WA 1MUOA 5BMSA 4K18A 3HV3A 2Y6OA 3RMFA 3Q04A 4OTRA 4FKRA 2R3NA 4EJNA 3NSZA 3S0OA 4HNFA 4H39A 4YJSA 3L1SA 4ZJVA 2VNYA 2VTHA 3VUTA 4CZUA 3FLYA 4O0TA 3IG7A 4MD8E 4EWQA 3A7FA 4WSQA 1U59A 3ZCLA 5GJGA 3CC6A 4DEBA 4NH1A 3MTLA 3LFSA 1QCFA 4QMTA 2CLXA 4HOKA 1YI6A 3PYYA 2PULA 2ERKA 5EOBA 4D4VA 4EH3A 3OFMA 2GHGA 5CX9A 5DPVA 5F94A 4HCVA 5CENA 2W99B 3OCTA 4FZ6A 3D94A 4PL3A 3ZDIA 2WXVA 4IX5A 2P0CA 5CSPA 1MRYA 3MA6A 2R3LA 3MFSA 3PVWA 3VF9A 4IX4A 5GJFA 1XBBA 2PVNA 2WEVA 4FKPA 3R7VA 3FZTA 1A06A 2ZYBA 4RLLA 4LQMA 2R3JA 3O71A 2E9PA 2X8EA 4GG7A 5HNBA 4ASDA 2IVSA 5JMSA 5DNRA 3U51A 3UE4A 1KSWA 2WB8A 1KOAA 1OL1A 1H01A 4U45A 4E93A 2OIBA 4DBNA 2WTCA 3VN9A 5KMOA 2Z7SA 5E4HA 2VO3A 3DU8A 1GZOA 3QTSA 3C4FA 3EN4A 1IRKA 2CGWA 3BKBA 4FTAA 3L8XA 4DFZE 3E62A 3PXZA 4IJ9A 1R0EA 3A7IA 1OBDA 1OKVA 5FEEA 3DLZA 3TV6A 4X6QC 4A07A 3DJ5A 1CDKA 2W17A 3F3UA 1V1KA 4CXAA 2OIDA 2OFVA 5DN3A 2XK4A 3DXNA 3OXTA 4N6ZA 4JG8A 1Q3WA 5CANA 4AE9A 2ZB0A 3KULB 5BVEA 3VBVA 4MNEB 4QTAA 1T45A 5HKMA 2CPKE 3LMHA 2PZPA 4WA9A 5CXZA 4DFUA 4RVLA 4HYIA 5CQUA 2REIA 2UW0A 1YVJA 3ZSHA 2WQBA 1Y57A 4DCEA 3HRCA 3V51A 3LM5A 3CIKA 3KEXA 4M69A 4RJ6A 3QUEA 2RKUA 3D0EA 4KKEA 4C0TA 3C0IA 2J5FA 2XK7A 4JBVA 3QFVA 4JOAA 1G8SA 5HNIX 1WVXA 3UOLA 1TQIA 3UZTA 2JD5A 3EN7A 4GEOA 4NSTA 4UMPA 3LFBA 4QP6A 3LLTA 3E8EA 4QP1A 4O7ZA 1T46A 5AV0A 5AA9A 3LFEA 3NX8A 4BCNA 3V5JA 4BVUA 2VWBA 5K5XA 4U80A 4PY1A 4IB5A 3A7GA 4XG9A 3A7HA 3Q2MA 2EB2A 3P1AA 1YOJA 1U4DA 2CLQA 5EDPA 3TZMA 4DEEA 4YNOA 4CFMA 1PXMA 2YACA 5B2KA 1OIYA 3C5UA 4HVDA 2GS6A 3F5XA 3MH3A 2VO7A 1YHWA 5CSXA 2UZTA 1K3AA 4FV1A 5F1ZA 1O6YA 5CASA 5E8WA 3RHXA 1YWVA 1ZZLA 4YZDA 2R3QA 3NUUA 4L3LA 5HD4A 5FP5A 4BDDA 5DRBA 4PNKA 3PG3A 4FV7A 3ENHA 4DFLA 3VW8A 1PRYA 2R3IA 3R1NA 2R3OA 3U87A 4MXAA 1V0PA 1STCE 2ERZE 3LFFA 3AMYA 3NW7A 4PRJA 4FZFB 2UW3A 1YDRE 4DEDA 3BEAA 4IVAA 4DH8A 5JRQA 1IAJA 4KUJA 4R78A 3LCTA 3COIA 3OVVA 3HV6A 4XMOA 5J9ZA 2RF9A 4IVDA 3BU6A 4D1SA 3TCPA 4BCKA 2WAJA 4FKWA 5AV4A 5KMIA 5KBQA 4EOQA 3FSKA 1FGIA 2Q0BA 3A62A 3UTOA 5J1WA 3REPA 5CU2A 4JDIA 4TY1A 2LGCA 5FDPA 5L6WL 5M55A 5E9EA 4UN0C 2ZV2A 3MPMA 3BU3A 4TZRA 5CYIA 3QTXA 4EOLA 5LCKA 2DYLA 3PXKA 4IAIA 4WG3A 5L8JA 4EEVA 1PXKA 2WTJA 3C0GA 4RIYB 3UIXA 4RVMA 2IZSA 2JC6A 2ZV7A 3CTQA 2KTYA 2WFYA 3MFUA 4G31A 2BKZA 3HMOA 4QMSA 4RFMA 2IW8A 1WBSA 4ACHA 2O2UA 3TKUA 2YM3A 3ZO2A 4DG0E 1PJKA 5D10A 2WNTA 1R39A 3FAAA 1YW2A 3Q4ZA 4HPTE 4YZ9A 3H0YA 4BWKA 1ZYSA 3EYHA 5M09A 4IFCA 4YU2A 3QYWA 1R1WA 1YXXA 2FB8A 4DLJA 3L9PA 2YHVA 2JGZA 4FIJA 3A4OX 1IA9A 4NYEA 5IQEA 5E8UA 4OAUC 3IONA 2W5BA 3DKGA 2GTMA 3HMMA 4GRBA 1OUKA 4IACA 4E7WA 3I7CA 4E1ZA 3HAVA 3OUNB 2ITQA 2JKOA 5F95A 4QTCA 3KY2A 3VBTA 3OF0A 4BDCA 3MS9A 5JH6A 5T3QA 1P2AA 3OXZA 3OS3A 3PSCA 4M0YA 4P5QA 1DAWA 5EG3A 4TL0A 5HTCA 3LQ3A 4MXOA 3TACA 4PF4A 4O7SA 5AUVA 1VEBA 5A14A 3QZFA 2BZIB 4FYOA 5D7VA 1B6CB 1JKLA 4BFMA 4CRLA 1MP8A 3DAJA 1KV1A 3NAXA 5AP6A 5D41A 3AC2A 4I3ZA 4YLKA 1UU3A 5LMKC 1YDTE 4FV8A 3W2OA 4RZWA 4IEBA 4GKIA 1H1QA 4IB3A 4BTKA 3C13A 4LRJA 3F3TA 3VS3A 1QPEA 4I5PA 1URCA 3P7CA 4PP7A 5GNKA 5EQYA 2GHLA 4I5MA 3DAKA 5AR4A 4BICA 3ELJA 5IA5A 2IPXA 5LXMA 3RM6A 2XIZA 2X0GA 5LWNA 3DFAA 3CPCA 3KULA 5HBEA 2ZMCA 1LUFA 3UVRA 5KE0A 4IQ6A 4F64A 2BRMA 3ORTA 3F7WA 3KMMA 3JYAA 3OCSA 4UMQA 3B2WA 4ZZOA 5CEMA 3FHRA 2RGPA 4LV5A 1UNGA 3O2MA 4NFNA 4NM3A 3OZ6A 1XH9A 3EQBA 3E7VA 3P9JA 3ZSIA 5C8NA 2UZLA 3FMLA 4ANOA 5AV1A 3Q3BA 4AGCA 2Z2WA 2PVHA 4U9AA 4C4GA 2BPMA 5EFQA 5DI1A 3SC1A 4BDEA 4I0RA 3W8QA 3MB6A 3COMA 3PXYA 5HNGA 5IA1A 5BVWA 5C9CA 4K33A 4ASZA 4DEAA 4RIWA 2CN5A 3CQEA 4UALA 2BIKB 3PWDA 3ZUTA 4C59A 2PWLA 3ID6C 1WBWA 3DK7A 4DINA 3RNYA 3NYNA 2OJIA 3DB8A 5HLWA 1H27A 3QTRA 3UIMA 3KN6A 3LHJA 4W4YA 5DHJA 4ZJJA 5EQPA 3NGAA 3NIEA 5AR5A 4ZTQA 4BBMA 2PVYA 2AUHA 4E26A 1P4OA 4YJTA 1M17A 2RL5A 5HE3A 3FBVA 3L9LA 2W96B 4FV9A 3R02A 2R5TA 4CNHA 3QX2A 1YHVA 3H30A 3RPSA 4C35A 3LVPA 1O9UA 3Q4TA 1CKJA 3QTZA 3S95A 1P4FA 1YKRA 5CS6A 5CQWA 5CU6A 1FINA 4HZRA 4AACA 4N70A 5GZ9A 3UPXA 4F6WA 1YQJA 2C0IA 4IE9A 2BCJA 1SVEA 4B9DA 4MBJA 5BUEA 2XK6A 3QZIA 5A4LA 4KIOA 4QPSA 3BBTB 4XOZA 4XV3A 3RK5A 4E5BA 2CNQA 2YZAA 4GYGA 2RSVA 4NUSA 4F0FA 5IZFA 2ONLA 4Y8DA 2RFEA 4FNXA 4QPAA 3GI3A 4ANLA 3BYVA 5I9YA 3WYYA 1Q4LA 3BU5A 4FA2A 4QTDA 2HW6A 2FVDA 1KE5A 4O0VA 5AP1A 4YUQA 3MH1A 1IG1A 5H2UA 3THBA 4QNYA 4F0IA 2GTNA 2J0KA 2RG5A 2WELA 3K5UA 4C33A 5BVDA 3MYGA 5K0XA 2R3HA 2JFMA 5CNOA 4GT4A 4YBJA 3RCDA 3R73A 5CI6A 3OEZA 2W1HA 5AJQA 2H96A 2GNFA 2QOKA 4GK3A 4DF3A 2JIUA 2P2HA 4LRMA 1NT2A 2I0HA 4MEDA 4DGLC 2JDVA 2WPAA 4IADA 3QBNA 3IO7A 1RE8A 2JITA 4EBWA 4F6UA 3EZVA 3O8UA 4QMMA 5J9YA 3R7UA 4MVFA 4DGNA 4DYMA 1FMOE 3UO4A 5EYDA 2XA4A 3PJ3A 1ZY4A 4I23A 3WZJA 5AUWA 3E5AA 3GFWA 4FV6A 2XNGA 4KIKB 4F09A 5HX8A 4ACCA 4O7YA 3JY9A 3R9HA 4CFFA 4YNEA 1PY5A 3QGWA 1FMKA 4O0XA 4FYNA 4L9IA 5LCJA 4MQ1A 4JIKA 4G6OA 4ACMA 3TZ7A 5HZNA 3K54A 3L8VA 4F7JA 4U5JA 2CHLA 1BKXA 3BHUA 4OT5A 3PJ2A 4ZTLA 5J95A 5I0BA 1BL7A 1GOLA 4RX7A 4FUXA 2P3GX 4YLJA 1S9IA 4IZ7A 3Q6UA 4TKSA 5CI7A 4F0GA 3P4KA 3OTUA 2X8DA 4DCAA 2B52A 4Y72A 4BL1A 2XK9A 5HI2A 3I1AA 3ZRLA 4AN2A 5IA2A 2H8HA 2YIXA 4G3CA 3SHEA 1IEPA 4E3CA 5L3AA 3OC1A 4WD5A 2BRGA 3LFNA 4XRJA 3QRIA 1JWHA 3KMWA 4CZYB 4J98A 2ITXA 3BV3A 4RQVA 1WBTA 1U5RA 5JGBA 5C8MA 3QRKA 3OP5A 4TYHB 1LEWA 2I7QA 1XBAA 4YHFA 3GUBA 2B54A 3UO5A 4NU1A 4JAIA 4G9RA 3HDNA 5IDPA 4EHGA 3QRTA 4BDKA 4M84A 4D1ZA 1SM2A 4ZJIA 4LOPA 3O23A 4K0YA 5HHWA 2GS2A 4MYGA 4QOXA 3QA0A 2XBAA 3R71A 4BR3A 4O0RA 2ZM4A 3DNDA 5AUYA 4H05A 4KRCA 5AMNA 3TKHA 4FV5A 4FIGA 5ANDA 3NMUF 4O96A 1UNHA 1U54B 4F99A 2WIHA 3AD5A 4HVSA 1W0XC 5CF8A 5AAGA 4AZEA 4HGSA 4R1YA 5FEQA 4ZY6A 2G2IA 4U6RA 3EB0A 4IHPA 4XV1A 3FPQA 4FKIA 4OW8A 5DWRA 1JSTA 4O2PA 1GZKA 3KB7A 4FSRA 3RKBA 5HLNA 1OKZA 4IMYA 1Q99A 1UU7A 2PZ5A 3OHTA 5ANEA 2FSLX 2UW5A 4PUZA 4D2VA 2VZ6A 2X4ZA 4FTKA 3POOA 4E6AA 5ACKA 5C4KA 2V7OA 1KWPA 4QNAA 1FVRA 3FZ1A 3JUHA 2V62A 3W55A 4AA5A 5L2TA 3R22A 4FIEA 2AC5A 3R8PA 3MDYA 4YPSA 1G5SA 3NVMB 3GXLA 4M7IA 4EWHA 5IA0A 2CJMA 3QZGA 4YTHA 3BV2A 4EOSA 2CKQA 4C61A 5DT0A 4DAWA 3CLYA 2XNMA 4R3PA 5DR9A 5H8EA 1DM2A 3DBCA 2GU8A 2J9MA 3Q32A 2YIRA 3O96A 4QYHA 4YC6A 1XH8A 4NK9A 1JNKA 4WSYA 4BCIA 5AAFA 4II5A 3ZM9A 3QQKA 1WVWA 5HE1A 1BI8A 4O84A 2YIQA 2PVKA 3EQHA 3FXZA 4JJRA 4JQ8A 5CAPA 3GU7A 3BLHA 5HTBA 5AP3A 4GU6A 1M2PA 4QMUA 4DTAA 3VS4A 1HCLA 3C51A 3CD3A 4D2RA 3RINA 4G5PA 4YGAA 3D15A 4JBPA 4BZDA 5FXRA 4NKAA 2C5YA 5CAOA 5AR2A 4J95A 4U40A 2QOHA 3FLSA 3V6RA 2F7XE 2W05A 3EHAA 4C38A 2BRHA 5HU3A 2CDZA 5IQFA 3LFCA 1YOMA 2YLEA 3PE2A 2HELA 3ZDUA 3R8MA 3ZLXA 4BDJA 4ERWA 4ZAUA 1RW8A 3BWFA 4BI0A 3W10A 4APCA 1PYXA 4HW7A 3FHIA 3TV7A 3AXWA 4DG3E 4ALVA 5DEWA 4AU8A 2YM5A 4M97A 3UYSA 4EQUA 4XBRA 1HOWA 2X4FA 3NR9A 4FSUA 4Y5QA 3FKOA 4CFNA 2PYWA 4CT1A 2QLUA 3AQVA 5HGIA 4V0GB 3G6GA 2ITNA 4TNDA 4EH7A 2VTMA 2GQGA 4LOOA 3R21A 4F1OA 4HVHA 3EQGA 3QC9A 1SVHA 2Z8CA 4HCTA 4J99A 4MD9E 4A9UA 2ZAZA 4IAZA 4RX8A 5IUGA 4XHKB 5HG9A 2Z02A 2V55A 2FYSA 4RA4A 3OWJA 4AS0A 2HENA 2WU6A 4GYIA 4RG0A 4C58A 4I93A 2ITVA 4Z16A 4EOMA 1PF8A 3I6WA 5EHLA 4I21A 3F6XA 4YC8A 5ETFA 3UOJA 2VWVA 3AC4A 3UG1A 3NNXA 4RWJA 4I6BA 1IAHA 2FUMA 3ETAA 1OI9A 1UV5A 3FXXA 1GNGA 1ZARA 3QTUA 3HV5A 3MJ1A 4U81A 2F49A 1GZ8A 2C3LA 3HP5A 3OUKA 5LWMA 2WQOA 2VTAA 2C6OA 2A0CX 3LMGA 2J2IB 3HKOA 3IW4A 3FKNA 1E9HA 3AG9A 3QC4A 3ZEWA 1NY3A 2XIKA 3IOKA 2PZIA 3U9NA 2CKEA 3D2KA 2OKRA 2VN9A 3GCUA 1APME 3NCGA 1YI4A 3Q9ZA 4G5JA 4IDTA 5LVLA 4F9CA 4O7NA 4EHVA 5IQAA 1WFCA 4FSMA 3HUCA 3SDJA 5BVFA 4N57A 1MRUA 4FSNA 3RNIA 4FBXA 3R9DA 2PUNA 3ROYA 4EJ7A 3GVUA 2R3GA 1YWNA 3SW4A 4AOIA 3K3JA 5JK3A 4KNBA 1WVYA 2QO9A 2XH5A 3G9NA 4QP2A 2ETMA 2UUEA 3EN5A 2XK8A 3UG2A 5LMKA 2HK5A 3HRBA 2OBJA 4MBLA 2QD9A 2VX1A 3RALA 3MGYA 1QPJA 3CY2A 4MX9A 1UKHA 4D58A 4E4LA 4Q9ZA 3M1SA 5C26A 2UZNA 2ZV8A 2V22A 3RBWA 2O0UA 5I3RA 1ZYLA 4FX3A 4AX8A 1SNUA 3BZ3A 3OOGA 2OH4A 4GU9A 5HO8A 3ZRKA 4CKJA 4LV8A 2OZAB 5I9UA 2E2BA 4PDPA 4G34A 5AM6A 3MY5A 3PXRA 4AF3A 4CRSA 2VTSA 2QR8A 5KMJA 3C4EA 5CSWA 1JQHA 5FXQA 3SOAA 3CPBA 3LCOA 4FVQA 3NUYA 4W9WA 4NZWB 2BRNA 3U9CA 4BCMA 1KE9A 3QAME 3JVSA 4USFA 2NPQA 3LQ5A 4DEHA 4KD1A 4DTBA 1GJOA 2ESMA 1QMZA 3U6JA 4O82A 1X8BA 4P90A 3LIJA 3UC4A 2PVRA 1YWRA 2ETRA 3PIZA 4GFOA 4HYSA 3CBLA 4QMOA 4Y46A 1CMKE 2BIYA 3S00A 4F9AA 3CGOA 4AWIA 2BTRA 4E5WA 4ZSLA 3PG1A 1OGUA 4L53A 3F2AA 4DEIA 4UMRA 2PE0A 4YBKA 2HXLA 3GCVA 5CWZA 5DA3A 4MNFA 5I5ZA 4DN5A 4QP3A 3HMIA 2HY0A 3IS5A 3LM0A 4TYJA 5HBHA 2GNHA 1H0WA 3W32A 4G3GA 4RWIA 4B4LA 4EC8A 2YITA 3PA5A 3R9RA 3LKMA 2XNNA 4K1BA 4BDHA 4DT8A 2PSQA 5J79A 2BZKB 4ZTSA 5AP7A 2C30A 5EM6A 3MPAA 4G3DA 2ZOQA 3LJ0A 2IJMA 4HNIA 2VTPA 1CM8A 1REJA 3DY7A 4F6SA 4S32A 3P7AA 2VTRA 3MPTA 3HMNA 5CY3A 4MD7E 4CQEA 3RP9A 3I5ZA 2XUUA 3CE3A 2XIXA 3WZKA 3W2CA 3NW6A 5ANOA 2PZYA 3EKKA 2ETKA 3JXWA 3EN9A 3FL5A 5LVNA 2C5VA 3HECA 2PVFA 4GUEA 2YN8A 3ORKA 4QMWA 3HRFA 4QO9A 4ANNA 4FZAB 3ATTA 4L68A 3EFJA 2W1DA 3ZFMA 4WO5A 3UQGA 3SA0A 1H1RA 1W83A 3QCXA 1OBGA 1E1XA 3ORLA 3PLSA 4GG5A 4PTEA 3WI6A 5KBRA 4QQ5A 3KXGA 2WTVA 5J8IA 4ASEA 2C6TA 3TNQB 4BB4A 4FEWA 1Y6BA 4FTJA 3W18A 4B99A 4IJPA 3TG1A 4F7SA 4UB7A 4BBFA 1PMUA 4JG7A 4QTEA 1O6KA 4DGMA 5J7HA 4BC6A 4DT9A 4S30A 3RCJA 4WNMA 3TUBA 3BYSA 4IWOA 1PMVA 3I4BA 3WILA 3NYOA 4M15A 5H3QA 2YWVA 4EOPA 4EKKA 2BVAA 3KKVA 4OR5A 4OT6A 1FQ1B 5EI6A 1WBNA 2GFCA 4ZY4A 3LFQA 2WQEA 2WMUA 3HEGA 4BDFA 4UWYA 2KULA 4BTFA 3D5UA 2WOTA 2GFSA 3VHEA 4IZAA 2RFSA 5B2LA 2QO7A 2W1ZA 3PY0A 4D2PA 3K3IA 1M2QA 4YJPA 2YJRA 1GAGA 5CEKA 5HVKA 4HCUA 2YEXA 4JQEA 2J7TA 4CFXA 5FQDC 1VR2A 4PL5A 3DTWA 5FM3A 2C69A 4TYGA 2VTTA 4FV3A 4UXQA 1H24A 3Q5IA 1XH7A 2JFLA 3VO3A 2WTWA 4K8AA 3JR1A 3HNGA 2X6EA 2GQRA 3QCYA 1JLUE 2RIOA 3EOCA 1HCKA 5CVFA 3V5WA 3CCNA 1XR1A 4L6QA 4DH3A 3MFRA 2YA9A 4ZXTA 4O7LA 3MIAA 5CLPA 4FTTA 4FMQA 5HLPA 3QTWA 1J91A 4I5CA 4IB1A 1TQPA 3LW0A 4LRKA 4QYFA 2BHEA 2CGXA 5E8VA 2DS1A 3DV3A 1ATPE 4FGBA 4FKJA 2UVXA 4RBLA 3B2TA 3VUKA 5KUPA 3TKIA 2PMLX 4H1MA 5DT3A 4ENYA 3MA3A 2XKDA 4FKGA 1ZMUA 4TWNA 4FZ7A 1XWSA 3NUPA 2UZEA 5J1VA 2CCIA 3PPZA 3GC8A 4AZFA 3FI3A 1Q5KA 4CMOA 2YM8A 2XJ0A 1VYZA 5AIRA 4TXCA 4CKIA 5CU4A 2OZAA 2ZB1A 5EHOA 3QCSA 1OL2A 2B55A 4OTGA 1W8CA 2BAJA 4W4XA 5EH0A 1VZOA 2BKKA 3ZO4A 3ORXA 5JSMA 5I9XA 2OG8A 2YM4A 4Z9LA 1M14A 3MESA 4IM2A 3UPZA 5CF4A 3P0MA 4I4EA 4IWDA 2OU7A 5ETAA 3G5DA 4E4MA 2E9OA 3EJ1A 1U46A 2XIRA 3QQFA 2QHMA 1PYEA 4JX3A 2QI8A 3QX4A 5CAQA 4ZIMA 2Q0NA 4C4HA 4DFNA 1H26A 5D11A 2HW7A 2QHNA 3IDPA 4GJ2A 4O2ZA 3TZ9A 2WTKC 3EYGA 3RPOA 3VQUA 3R28A 2JKMA 3MB7A 4O22A 3M2WA 4I6FA 4L43A 3F7ZA 4K11A 3QD3A 4ANMA 4U41A 5D7AA 4ZZNA 2C3KA 2QURA 5LMBA 2Y4IC 4N6YA 4YLLA 5AV2A 4KSQA 4O91A 4FOBA 3D7TB 2FGIA 4U42A 2F57A 1OITA 5BVOA 5BYZA 2FSOX 4E4NA 3QL8A 5IQGA 4FIIA 5AX3A 4DEGA 2XK3A 3HP2A 5LJJA 1BX6A 4FG7A 2C47A 1PXLA 2H6DA 3BGPA 3H9FA 4ITIA 4JVGA 2NO3A 4MWIA 4QQCA 5CZHA 5LQFA 4C3FA 3I5NA 3KVXA 2X2LA 1H1PA 4AT3A 3ZO1A 2A2AA 2OH0E 5FLFA 2NNWB 4FKQA 5GHVA 4JR3A 4KRDA 1OPKA 3S1HA 4BCFA 3P23A 4A4XA 2W4OA 2WQNA 2X7OA 3F9NA 2C6LA 3SG9A 5EM7A 3O8TA 5A4EA 1RDQE 4KKHA 4RT7A 5AP2A 4EBVA 2YFXA 5E8TA 3KC3A 3TT0A 5L8LA 3ORIA 4EKLA 3FZSA 3KU2A 2VUWA 1SNXA 1OVEA 1ZMWA 2R2PA 3NS9A 4P5ZA 5DFPA 3LJ1A 2GNLA 2VO6A 3AT4A 3FZPA 3MH2A 3O7LB 3P86A 4LL0A 4J1RA 5EYKA 3RZFA 4EYMA 4DFXE 2VTJA 4DH1A 1AQ1A 2YJSA 3OG7A 3OROA 5LOHA 2ITTA 4X3FC 5IDNA 3GCSA 4S2ZA 4NIFB 2JKKA 1PKDA 3ODZX 3R30A 3VRYA 3VNTA 4UY9A 4K9YA 2HIWA 2JDOA 2VGPA 5JT2A 2UZBA 3FLZA 3EL7A 4QMPA 3ORZA 4JS8A 5KMKA 2GMXA 4V05A 3TNHA 2QC6A 3BCEA 5F4NA 1IA8A 3BHVA 3ZBXA 3MSSA 4EK8A 3FI8A 3PPJA 4BIBA 1YDSE 3DBQA 2X39A 4M14A 1M52A 2O63A 3D5XA 5CEIA 4CYJA 3NZ0A 3GCPA 2VWUA 3DQXA 4B8MA 2PTKA 5ANGA 3SRVB 4ALWA 5T68A 5H8GA 5DVRA 4FVRA 4MF0A 1JBPE 1Q97A 1QPCA 2X9EA 3GC9A 3V8SA 4F9YA 4L01A 4RVTA 3W8LA 2YCSA 5GINE 4R6VA 1OL7A 4UWCA 5DYJA 1P14A 4QMLA 3FSFA 3KXNA 3N9XA 3PA4A 3MWUA 3BE2A 4FSYA 3EFLA 4G1WA 4KINA 4X3JA 4CFUA 5KMNA 2W0JA 3FUPA 4R3CA 3NDMA 5DMZA 4XP3A 2PE2A 3QRJA 3BPRA 1MRVA 1ZYJA 3B8RA 4IXPA 2R4BA 1AD5A 1KE6A 2C0TA 2X7FA 4O86A 3NUXA 4MNEA 4O7WA 2CN8A 3UYTA 2I1MA 5CEOA 4FNWA 4YSMA 4IH8A 5EKOA 3ZM4A 2ZVAA 2J51A 1Z5MA 3NRMA 2VNWA 3MIYA 3PSBA 1PKGA 4KIPA 1V0OA 5FRIA 4QMNA 4GIHA 2ITZA 3C9WA 3R6XA 3GC0A 2XS0A 1JPAA 4XLIA 5BPYA 3LFDA 5EKNA 2B9HA 3RM7A 4DG2E 2QONA 3GENA 3DOGA 4TN6A 4YZCA 4E5AX 4FTQA 1B39A 4LM5A 4D5HA 2P33A 3F3VA 2JDRA 3CR0A 4L52A 1PMNA 2WO6A 5DEYA 4YSJA 5JFVA 1ZY5A 4U0IA 5EM8A 5T6KA 2GPHA 1RQQA 3E93A 5HCZA 5KX8A 3ZLYA 2P55A 3PRFA 5JKGA 1MQBA 2W4JA 3BQCA 3DKFA 3RK7A 2VRXA 3NVKI 4MF1A 3F3WA 4HPUE 5F20A 4UV0A 4WKQA 4C2VA 4RFZA 3DBDA 5CTPA 4FKLA 4TWOA 2PPQA 3H10A 4U44A 3R01A 4KS8A 4W8EA 4H58A 3UC3A 5BUIA 5ICPA 3MVLA 1LEZA 2QOOA 3AGLA 4U7ZA 3CJFA 3ZBFA 2C1AA 3TDVA 3WF7A 5M51A 4MXZA 1FVVA 4PMSA 4F7LA 5HQ0A 5AR7A 5EOLA 2WTKB 3EQRA 5JQ5A 2PUPA 4BI2A 1JSVA 5AAEA 3PXQA 3VAPA 4Q9SA 2Y4PA 4BTMA 4AAAA 3RJCA 5IQIA 3HX4A 3OWPA 2HOGA 3KQ7A 5C4LA 1Q24A 5K3YA 2XBJA 5HIDA 2Y4IB 3FPMA 4HYHA 4Q5HA 3V01A 4H3QA 5K5NA 3PZEA 2QOFA 3FMNA 3TV4A 4D9TA 3ZU7A 2P4IA 4YJQA 2QQ7A 4GFGA 2JDSA 2QOCA 3ROCA 5BX0A 3QKLA 4B0GA 2YCFA 4S34A 2B4SB 1SYKA 4ZOGA 1OUYA 4UWBA 2OW3A 4GT3A 3ODYX 4J7BA 2CGVA 4LMUA 4ENXA 1H0VA 2X81A 5EK7A 4CLIA 5BYLA 4FSQA 3SXRA 3RAWA 3GP0A 4J52A 3POZA 4D55A 3Q5ZA 4OUCA 3IGGA 4O6LA 5FBOA 1OECA 4D4SA 5B0XA 2BZHB 3QD2B 5KKRC 5EW3A 1YXSA 3VJOA 1REKA 2JIVA 4KAOA 1W84A 4RVKA 3VBXA 3VF8A 3ZXTA 2H9VA 4RIYA 3W1FA 3NPCA 4G6NA 4CV8A 4D5KA 5IQCA 5HCXA 2BDJA 4XLVA 2V5QA 3WF5A 2JDTA 2YAKA 1J7UA 2CKOA 2ACXA 2W9ZB 2CCHA 2WMAA 4L7FA 4WNOA 1PW2A 3QLFA 2R64A 4FOCA 4UZHA 4WUNA 2BZJA 2GNIA 4C57A 4FEUA 2W9FB 2GSFA 2XF0A 4RX5A 1JKKA 5HEZA 4CV9A 2Y6MA 3EQPA 1UU9A 4P2KA 4O7TA 5M56A 4BHNA 5DRDA 2YISA 3Q52A 2ZV9A 3C4XA 4G2FA 4QMXA 4X3FB 5FG8A 2X7GA 4NIFA 4OAVB 4HVIA 2OO8X 4M67A 2OWBA 4DGGA 2IZRA 1PXIA 4GUBA 2Z7RA 3WF8A 3Q2JA 1NW1A 5FP6A 2R3FA 3VQHA 4EH6A 4JBOA 5C1QB 3KRXA 2WTDA 4I4FA 4JT3A 1PXNA 2HWPA 5CXHA 4ZZMA 4X2JA 4JDHA 2QG5A 3BHTA 3BYMA 3KF7A 5C03A 4KB8A 3TEIA 4IVCA 4FSZA 4TW9A 4DH5A 4YZMA 1H00A 3H9OA 1VJYA 2IZTA 3WF9A 4MXXA 3GOPA 2OGVA 3G9LX 4IIRA 1FPUA 5CVGA 4AN3A 4QTBA 2PK9A 3I60A 3MVMA 1LPUA 3AMAA 4PL4A 1GZNA 4FGRA 4YJNA 3VS0A 2OLCA 4O1OA 2A19B 3BHYA 3ANQA 4TTHB 5AFVA 5EDRA 3OY1A 3VULA 3MFTA 3EMGA 3E8NA
chains in the Genus database with same CATH superfamily
2I6LA 3ACKA 4APPA 4DHFA 4UZDA 3AD6A 3UP2A 3H4JA 3R1YA 5AUUA 3UNZA 3Q53A 4NJDA 3V8TA 3MH0A 2GNGA 3W0PA 5I9WA 5CF5A 4JQ7A 5EYMA 3CD8A 3E3PA 3OWKA 3W2QA 4PNIA 3N4TA 4BCOA 3VBQA 3VWAA 3F5GA 4UYAA 4F70A 4OTHA 1YXVA 4BIDA 1R0PA 3R7GA 4NKSA 3HA8A 4L3PA 4M8TA 4PPCA 3W16A 5JFSA 4AT5A 5LVOA 3QQJA 2X0PA 4GVJA 1ZLTA 4N0SA 4ZK5A 3TDWA 3EQIA 2WD1A 4JLCA 3PUPA 3ZUVA 4C2WA 3AT2A 5A4QA 3NNWA 2YDIA 4C4EA 4DE4A 4BDGA 3DS6A 3CQUA 2ZM3A 2BILB 2YLFA 1Y91A 4FT0A 3VJNA 4IWPA 4IDVA 5GIOE 1Z57A 3H9RA 3ACJA 4L8MA 4TYEA 2PVJA 5FXSA 2B9FA 5A9UA 2CKPA 3FZRA 3GU8A 3L8SA 2YIWA 5KMLA 1Q8UA 2E9UA 4M3QA 2XJ1A 4R5SA 5FM2A 3E64A 4JRVA 3RWPA 3HL7A 4A4LA 2OJ9A 3BLRA 4GIIA 4BGGA 4E4XA 5K9IA 4NCTC 3EWHA 5LVMA 1JAMA 4HYUA 4EUUA 1XBCA 5JN2A 2WMSA 4EUTA 4IVBA 4EI4A 4JI9A 2F7ZE 3FZOA 5FWKK 3VUIA 4AXFA 2W4KA 5E92A 2UZWE 3JY0A 3VS5A 4M0ZA 4I24A 2R3KA 4ZTNA 3E88A 5J9LA 4I1ZA 2CNUA 2WKMA 3LPBA 4YJRA 1FGKA 5A46A 3ZRMA 2J0IA 4JBQA 4R5YA 4ZSAA 4IZ5A 4J71A 4N4SA 4Y5HA 1OGYA 3D14A 4RWKA 4FEXA 3RGFA 4UMTA 3U6IA 1WBVA 2OJGA 2JKQA 2UW9A 1UVRA 2QU5A 2XNOA 2R7IA 1ERKA 3RPVA 5A54A 4YP8A 1M7QA 2R3MA 4C4IA 4FRFA 2XM9A 1CKPA 1S9JA 3BGQA 4RMZA 3NNVA 4DC2A 2OICA 4FIFA 5ITAA 5IU2A 2C5XA 2C5OA 1BMKA 4ZS0A 2OZOA 5G6VA 3I79A 1CTPE 4RJ3A 3DJ7A 5DGZA 4A9SA 2QOLA 4O0UA 1OM1A 4RJ7A 4QP8A 3B8QA 5DR6A 3HGKA 2NRUA 2F2UA 4FG9A 2PL0A 4D0XA 2W1EA 5CSHA 4BGQA 2ITPA 3I7BA 4WRSA 3SQQA 5KKRB 4QQJA 5E8XA 3ULZA 1G3NA 2C68A 4FT9A 2J6MA 4Q2AA 3A60A 4BDAA 3F3ZA 5IUIA 4QP7A 5CALA 3V5LA 5HIEA 5EDQA 2QR7A 4FG8A 3FY0A 4WRGA 3AT3A 1ZYDA 4QYEA 4KIKA 4YTFA 3KXXA 4RWLA 3ZFYA 1OKWA 5C27A 2WGJA 3G15A 2YERA 3UQFA 3Q4CA 2W5HA 4JL9A 4BCQA 3FQSA 3OOMA 3OMVA 3C0HA 4IBMA 4CYIA 2ITUA 2WIPA 4X3FA 3N4UA 4AGWA 2IVUA 4FC0A 3COHA 3LXLA 2BRBA 4TT7A 5CU0A 3NNUA 3QKKA 4WT6A 3QHWA 3MY1A 1TVOA 4Q5EA 3ZSGA 4RJ8A 3HZTA 4C36A 3CSVA 5IEXA 3ITZA 3A7JA 4XCUA 2QNJA 4BHZA 4KBKA 1B38A 5I9VA 4AZSA 2B53A 4B8LA 4BWXA 5CVHA 4AXCA 5FD2A 4PDYA 4DITA 3T3VA 2PE1A 4TYHA 3PPKA 5C01A 3V5PA 1XMMA 1H8FA 3DXQA 2VWYA 3G51A 3U4WA 3L9NA 4D2WA 3GU4A 5HTIA 3FI4A 4P7EA 4V04A 2VTOA 2I0EA 3LAUA 3HAMA 2VV9A 1YHSA 3C1XA 3NYVA 4C8BA 3P5JC 2W1GA 2XB7A 4EOOA 1R78A 4AGDA 3PE1A 3SW7A 4LV7A 3PVUA 3SGCA 1ZAOA 3VC4A 2YWPA 4A06A 4ASXA 3PIYA 5FDXA 5HE0A 1J7IA 4JR7A 4RGJA 4BZNA 3UODA 3RAKA 3ZUUA 5AR3A 2WZJA 3V3VA 5DIAA 3VS1A 3TJCA 3R9OA 4GT5A 4AW2A 3F66A 4MBIA 2BTSA 3D2IA 4NWMA 5TT7A 5AP4A 2PUIA 1UKIA 4O1PA 4ITHA 1U54A 5E8SA 4O81A 3U54A 3PDTA 1ZMVA 4Z3VA 4KIQA 2G1TA 3CKXA 3LXPA 4YZNA 4CMTA 3G33A 1YXTA 4M69B 5A4TA 5KO1A 3R7EA 2I40A 4RQKA 3FC1X 4R7HA 3FI2A 4R1VA 1Q62A 2C6KA 3UZRA 4FR4A 3Q9YA 5E1EA 3JPVA 5IUHA 3UDZA 3R1QA 1GIHA 3V6SA 5HG5A 3ZH8A 2YZLA 4CFWA 1BL6A 4KBCA 5HBJA 2Q83A 4FTLA 4PWNA 3FL4A 2WMRA 5M4FA 4GK2A 4OTIA 2B7AA 2HWOA 4PV0A 2EXMA 2BR1A 2B0QA 3WIGA 3QA8A 2OFUA 2VD5A 3FMHA 3ZC5A 1Z9XA 4LMNA 4PPAA 1KE8A 3PVGA 3F88A 4G16A 3A99A 4R3RA 5TOZA 3EFKA 4EHZA 5K4JA 4MH7A 3WZUA 3RI1A 3E92A 4XS2A 4AA4A 3ALOA 3G90X 3UIUA 3FE3A 5GJDA 4E8AA 1M2RA 5DH3A 4FEQA 4D28A 5IG1A 2XNEA 3HA6A 2VX0A 4FKVA 2UVYA 4QYYA 4K6ZA 4FEVA 2XCHA 2EB3A 4XV9A 2A1AB 5G1XA 4ZY5A 3JS2A 3LMIA 5IQHA 1WZYA 5FTQA 5IMXA 2Z7QA 1V0BA 4BCJA 3CP9A 2YCRA 4GMYA 3UP7A 2NYAA 2QO2A 2RFDA 3ZS5A 4PMPA 4IC8A 4IANA 2J0LA 3D5WA 1FOTA 1DI8A 2BAKA 4XG4A 5HE2A 3SXSA 1OL5A 3UVPA 1VYWA 3R04A 5M4UA 3W0QA 4RFYA 3E63A 3K2LA 5I3OA 5HX6A 3DNEA 4AN9A 4CMUA 3PZHA 1J7LA 3W0SA 3UOKA 3GGFA 2VWWA 3E7OA 2CGUA 4EOKA 3BQRA 5L8KA 1XO2B 4CLJA 4XG3A 3BLQA 3C50A 4FNZA 4JNWA 4QYGA 4EONA 4F08A 4USEA 4XOYA 4X6RA 5J87A 3KCKA 3DJ6A 3R1SA 1W2FA 2FA2A 1QPDA 2JEDA 1R3CA 2C6IA 5EHYA 3ZO3A 4HVGA 3F5UA 3CXWA 2BROA 3FMJA 3MVHA 2GDOA 1Q8YA 3PY1A 5I9ZA 1J3HA 4OTQA 4V0GA 5JZNA 3RAIA 4I0SA 1FBNA 2XALA 4U43A 1YRPA 4OBQA 4AA0A 1YI3A 4ACGA 1CSNA 5AM7A 3DQWA 2X1NA 4FL1A 4RPVA 4WIHA 3II5A 1F0QA 3A8WA 3R63A 5ANIA 4LDTA 2WMWA 1Q8WA 2WMTA 4MUQA 4OBPA 2UV2A 2VX3A 2YAAA 3QUDA 4IM0A 3F2RA 3DCVA 3G6HA 3EIDA 3S3IA 4DTKA 2O8YA 4L46A 3QQHA 2HXQA 4KS7A 4PP9A 5ETCA 1H25A 4FKSA 2HYYA 5TKDA 4IB0A 1JVPP 2JIIA 4I6HA 3VVHA 5FGKA 4JG6A 1BI7A 5JFWA 2PHKA 4XV2A 3QD4A 4IAFA 3VUMA 3C4WA 5CT7A 3ZEPA 4ZLOA 3VUHA 4QDVA 3F69A 4YPDA 1ZYCA 4XH6A 2J0JA 3OD6X 3VUGA 4ACDA 4HGLA 3VBYA 4A9RA 3IDCA 2OXXA 3IW8A 3CKWA 3QD0A 3QWKA 3IGOA 4GS6A 5ACBC 2A4LA 4UMUA 4EH5A 3TUCA 2J90A 4DA5A 3UBDA 2ITYA 3P7BA 4B7TA 3IKAA 4RIXB 5J5TA 3VS7A 2R0IA 3A4PA 4PQNA 2LAVA 1TZDA 2PMNX 3HV4A 3RAHA 3DGKA 5M4CA 2V0DA 2FSMX 2E9VA 3R2BA 4YTCA 1NVRA 4MAOA 3ANRA 3QRUA 3R0TA 3DK3A 3LCDA 5HVYA 2ZDTA 4OTPA 3U4UA 4M68A 4DDGA 2AC3A 3QLGA 3KREA 4LL5A 4EH2A 3IK3A 5FTOA 2BAQA 2QOIA 3PJ1A 5DOSA 3LOKA 4Y73A 4QT1A 3VUDA 1UWJA 1OPLA 3ML1A 3PXFA 4AFEA 4U79A 3P79A 4EH4A 2IVVA 4KWPA 4KUJA 1KE7A 3G0EA 3DLSA 4YO6A 5CAVA 3DDQA 4NW5A 4QRCA 1U5QA 2WTIA 4AGUA 4S33A 5FBNC 3UNKA 2J0MB 2PU8A 4X2GA 4CG9A 5B7VA 1ZOEA 4TWCA 4RRVA 1A9UA 3FJQE 3DZOA 4QPMA 3HV7A 4BCPA 2X9FA 3KRRA 4JXFA 4R8QA 2H34A 2HZ0A 2XEZA 4JDJA 3MI9A 4C4JA 4EQCA 2XEYA 4XG6A 3QZHA 1QL6A 3FV8A 3FMKA 1KV2A 3T3UA 3HVCA 4JIAA 5D1JA 3LQ8A 3T9IA 2BALA 2CMWA 3LJ2A 1BYGA 4G6LA 4LUEA 3W33A 2XP2A 3WZDA 4EORA 3WARA 5B2MA 5C8KA 1LR4A 1P5EA 4AQCA 4DLIA 2HAKA 4GSBA 2XCKA 1F3MC 4BY9E 5HU9A 1XH5A 4EOJA 3PJCA 3NW5A 4RIWB 3GQIA 3TNIA 3C4ZA 3ZLSA 3W0OA 2G2FA 4ZTMA 4YJOA 4Z55A 4JDKA 5KMMA 1OMWA 3OCGA 3DXPA 3P08A 2EXEA 2WMQA 3OW3A 2XMYA 4RX9A 3KF4A 2P2IA 4YURA 5IA4A 5AV3A 3Q4UA 4MTAA 2OXYA 4YR8A 5CEQA 2DQ7X 4BIEA 3VRZA 5M06A 5IKWA 2C6MA 5EI2A 2W1FA 2Y8OA 3NLBA 2C4GA 1GY3A 2E9NA 4ANBA 2CSNA 3ENMA 2QLQA 2GS7A 4OLIA 4EZ3A 2UW7A 4CZTA 3UOHA 2UZDA 1Y8YA 4NCTA 4CKRA 3GFEA 4GV1A 3I81A 4FK6A 4AOTA 2AYPA 4CQGA 5BNJA 2W7XA 1JKTA 4U3ZA 2VGOA 4F78A 2JLDA 1ST0A 4FV0A 2ZMDA 5LMAA 4C3RA 4R77A 2JBPA 4CTBA 4FK3A 2VAGA 3SG8A 5TE0A 4EK5A 5CEPA 3AMBA 2W1CA 3Q96A 5DG5A 5H8BA 3QHRA 2XANA 3FLQA 4GL9A 2OIQA 2RFNA 4MHAA 3CY3A 4UYNA 5E7RA 4LG4A 2OK1A 3QQGA 4L44A 4BI1A 3O0GA 3R7YA 3GC7A 3PRIA 3SLSA 4DGOA 4BDBA 4ZLZA 2YDKA 1GIJA 2YDJA 3EN6A 3Q9WA 3UZPA 3NUNA 4O7RA 4FTOA 4HGTA 5M08A 3D7ZA 3DAEA 3FXWA 5AR8A 3IW5A 4CEGA 4F1TA 4IWQA 4AZTA 2G15A 4EQMA 2HZIA 4KA3A 4TNBA 5ANJA 2UZOA 1XKKA 2G2HA 1Y8GA 5IQBA 3HYHA 4I0TA 3BI6A 3QUPA 3ET7A 4RZVA 4TWPA 1M7NA 4NFMA 2XKEA 3CQWA 4FL3A 4NTSA 4O38A 3VBWA 4Z7HA 3OY3A 5HG8A 2XYNA 1H08A 4B6LA 3FC2A 3MVJA 4H3PA 4L3JA 5AP0A 1GIIA 2VWIA 4U3YA 3FMMA 3PLAE 3DDPA 3FLWA 5AX9A 1TQMA 3H3CA 5M57A 3Q60A 4O0YA 4E6QA 2VTQA 1G8JA 4XEYA 5E8ZA 4YMJA 4UEUA 3NWWA 3QTQA 5HD7A 5A4CA 3LE6A 3SXFA 4ZSGA 1BUHA 5BQ0A 3K5VA 4K2RA 5CAUA 5L2QA 4H36A 5BVNA 3UIBA 5IH6A 2IVTA 3H0ZA 3PP0A 2UZVA 4I5HA 1O6LA 1W82A 5EW9A 2QOQA 3IW7A 2XM8A 3KGAA 3WE4A 2IN6A 2R9SA 4EK4A 4CGAA 3BIZA 2I0VA 3KXHA 3GEQA 2WMVA 4DH7A 4FZDB 4E73A 1IASA 4CVAA 4I92A 3EFWA 5A3XA 4RIXA 5EI8A 3TJDA 4F4PA 3QTIA 2DUVA 1URWA 1RJBA 2WU7A 3O8PA 3MJ2A 4BTJA 3TNPC 3WBLA 4ZMFA 4I22A 5I4NA 2AEGA 4V01A 5HG7A 4OTDA 2G01A 2R3RA 2UW4A 3EKNA 3LXKA 1ZXEA 4CFVA 3ZOSA 3O17A 3UVQA 2ZFYA 1ZRZA 4RC3A 1ZOHA 3V5TA 2Z60A 4X7QA 3ZXZA 5E1SA 3PSDA 5KCVA 3OXIA 3G2FA 2XIYA 3Q9XA 3W2RA 5M4IA 4XRLA 3NUAA 3EQFA 4GFMA 2QODA 4NM5A 3VONA 2BDWA 4UX9A 1DI9A 4DHZA 5HESA 3LZBA 1Q61A 2R7BA 3M42A 4G3FA 4MXYA 3MY0A 1E1VA 3RTPA 5IH5A 4M13A 3EL8A 5TF9A 2QCSA 4GH2A 4FUYA 4O6EA 4WG4A 5BMMA 3A2CA 3PVBA 3U6HA 4XJ0A 3TI1A 3TN8A 3AC3A 1YOLA 4QMQA 3KN5A 3TTJA 4I20A 3FQHA 2OJFE 3PY3A 1H1SA 3O7LD 4D2TA 4D9UA 2C0OA 3TNWA 4FE2A 3DBFA 3NUSA 3I6UA 2XNBA 3ZFXA 5ANKA 1PHKA 5CZIA 1DAYA 2F4JA 3GCQA 3ORMA 3BL7A 5IMEA 5GIPE 2B1PA 4E6CA 2YM6A 5HORA 3ZLWA 2HZ4A 4KKGA 5BYYA 3ALNA 3D5VA 3R8ZA 2C6EA 3BYUA 4X2FA 3UO6A 2PY3A 3ERKA 4CTCA 5JGAA 3FY2A 3HLLA 2JAMA 4J53A 4J96A 3R8LA 3SAYA 4BDIA 5AEPA 1CKIA 4H3BA 3GU5A 2ITWA 4UBAA 2YCQA 2BDFA 3QU0A 2XYUA 3T8OA 3TUDA 2EXCX 3NEWA 1J1BA 3UMXA 3ZC6A 4PMMA 2I0YA 5AP5A 2B9IA 4XBUA 3LFAA 5M07A 2HZNA 3D7TA 4D4YA 4M12A 2GQSA 4DBXA 2OXDA 3DFCB 3FMEA 4QMYA 3WF6A 3BYOA 4CG8A 3GT8A 2YABA 3TIZA 4O7VA 4NTTA 4AZWA 2QKRA 2C1BA 4O83A 1PXJA 4C62A 1KUTA 3TXOA 4EOIA 3BE9A 4FV2A 4ZSJA 3KXMA 4W4VA 4FV4A 3RHKA 4P4CA 1XJDA 2A27A 5CF6A 4IC7A 3CJGA 4F63A 3QKMA 3UJGA 2IO6A 5L4QA 3WZEA 2F7EE 3RZBA 2XJ2A 2O3PA 2XRUA 4FODA 2BHHA 2EVAA 5L6PA 3FEGA 5E8YA 4RC4A 5EW8A 4BWPA 1A48A 4ZS4A 2VTNA 4FSTA 1SVGA 3PP1A 4FTNA 5H9BA 4BKYA 2UW8A 4RC2A 3AC1A 3RPRA 1ZZ2A 4G3EA 4WBOA 3GOKA 2G9XA 4G9CA 5KHXA 2QU6A 2W1IA 3E8DA 5J5SA 3PIXA 3KFAA 4YTIA 4KBAA 4TPTA 4EH8A 3TM0A 4D1XA 4IAYA 4EL9A 2V7AA 5DFPA 3PJ8A 4WG5A 5AUTA 3AOXA 3RK9A 3GQLA 4S31A 2YIYA 4W9XA 3ZTXA 2NRYA 3DK6A 2WMXA 1JSUA 4YHTA 5EQEA 5CT0A 4K77A 3KXZA 5AADA 3UDBA 3E8CA 2R0UA 4ITJA 4RA5A 4FIHA 4MCVA 2VTLA 3LCSA 4HZSA 4U8ZA 4WHZA 5JEBA 1W2CA 4NL0A 1MQ4A 2RG6A 3I0QA 4ZLYA 2EU9A 4F1MA 1WBOA 4NM7A 4ZMEA 3F5PA 4F7NA 4O27B 3DZQA 4R7IA 4AUAA 1WMKA 5DE2A 3IW6A 4RJ5A 3NAYA 3N4VA 3OTVA 3R2YA 3DPKA 3EH9A 3OWLA 2NP8A 4GK4A 4C4FA 4AXEA 4TRLA 3R8VA 4RSSA 1XHAA 3SRVA 3TWJA 4IX3A 1H28A 4I6LA 2GNJA 3KVWA 3L9MA 4Y95A 1AGWA 5LVPA 2BFXA 4FKUA 5DLSA 2OSCA 3KRJA 3T9TA 3ZHPC 4BCHA 4XP0A 2EWAA 2X2MA 3CTJA 2XNPA 3V5QA 4F9BA 3IDBA 4J8MA 5IF1A 4C34A 4LGGA 4FJVA 1Q8TA 3KRLA 1J1CA 2X6DA 4NJ3A 4RJ4A 2FH9A 4LYNA 4ERKA 2QG7A 4HGEA 3ZZWA 4X21A 3FYJX 4Z7GA 1UWHA 4CSVA 4LI5A 3COKA 4RLKA 2XRWA 4XP2A 5L6OA 5KNJA 2IW6A 5HCYA 3FWQA 1PXPA 4AFJA 3BGZA 3V04A 1NA7A 2XKFA 3FLNC 3AC8A 1WBPA 1BLXA 3WYXA 4EZ7A 4L67A 4FT3A 3U8WA 2DWBA 4LGDA 3S4QA 3VHKA 3QWJA 4AW1A 3OW4A 1TFFA 4EZ5A 3R83A 4FTIA 4TYIA 2O64A 1WAKA 3IOPA 3FDNA 2IWIA 5ETIA 3C5IA 4BKZA 1F5QA 3VS6A 3BEGA 4BF2A 4FTMA 4MKCA 2JAVA 2PMOX 2XAOA 1KOBA 4MQ2A 1ZWSA 3JVRA 4OGRA 5EYCA 3R8UA 3SKCA 4C37A 2C6DA 4CT2A 3FQEA 4CD0A 2Y0AA 5EM5A 4D0WA 4I41A 4A4OA 4ZEGA 3ZYAA 3SOCA 5D9HA 3GBZA 5IA3A 4E20A 1G8AA 3QF9A 1OIUA 3CEKA 4WBBB 5AWMA 2IW9A 4E6DA 4ZP5A 2F9GA 4PTGA 2BMCA 2PVLA 3TIYA 4GCJA 1Q3DA 4AE6A 2VWZA 3O50A 3OCBA 5A6NA 4G17A 4ALUA 5M44A 4QMZA 5E90A 4EK6A 3F61A 4IZYA 5DT4A 1TKIA 3EZRA 1YXUA 1JKSA 3V8WA 2WQMA 3ZONA 4IW0A 1XH6A 2X2KA 4BZOA 4OBOA 5AUXA 3MTFA 4J8NA 4ID7A 3LXNA 3W0RA 2OF4A 4OTWA 3E3BX 3QQUA 4F9WA 1LP4A 1PXOA 2FO0A 2X8IA 1UA2A 4PPBA 4AT4A 4O0SA 4C02A 2B9JA 4I94A 3QXPA 4QMVA 1UU8A 4ONAA 4ZSEA 3KL8A 2HY81 2Y9QA 5BVKA 3C7QA 4Y83A 3IPHA 5D12A 5JFXA 5L2SA 3ATSA 5M53A 1NVSA 4AP7A 3ULIA 2WEIA 3OEFX 2VWXA 4CCUA 5IPJA 3M11A 2J5EA 3D4QA 3MW1A 4JAJA 2UVZA 4M66A 1NXKA 3Q6WA 5DBXA 5HO7A 4A7CA 3BELA 4XX9A 4A9YA 2XVDA 4IFGA 4JX7A 1EH4A 4LFIA 4LUDA 3W2PA 4PTCA 3ORPA 5L2IA 2OJJA 4C3PA 2Z7LA 3BBWA 2O65A 1OL6A 4AOJA 4WOVA 4AZVA 2R3PA 2W06A 4XYFA 4FT5A 3E87A 1K2PA 4DFYA 3GU6A 4I6QA 4ARKA 5IEVA 1ZOGA 3W2SA 4PDOA 5J7BA 3QQLA 4IM3A 3WOWA 4EYJA 2ZM1A 3PTGA 4MK0A 3AD4A 5JRSA 3UGCA 3KK8A 5GZAA 4NM0A 3HDMA 3NIZA 4BCGA 4D4RA 1H07A 2QVSE 4FT7A 3QXOA 4AQKA 3BHHA 3PFQA 4YJUA 3TL8A 5JZJA 3F2NA 5IQDA 1OKYA 2IZUA 4IAAA 4DHIB 3R00A 3VIDA 1VLRA 4O21A 2OI4X 3U55A 3TZ8A 2ZJWA 5TO8A 1OIRA 1H4LA 3UNJA 1NVQA 1SMHA 2PVMA 3RWQA 5DR2A 2WMBA 1Q8ZA 2JBOA 3D9VA 4USDA 4FTCA 3DB6A 3GNIB 4FTUA 4J97A 4QD6A 4ZTHA 4PMTA 3VS2A 3DTCA 4WNKA 4WNPA 5HOAA 4YO4A 4BJJB 4AAYA 4QP9A 5TR6A 4EHEA 3FKLA 1W7HA 4UXLA 2VTIA 3MV5A 4EH9A 4FL2A 2XKCA 2QOBA 2UW6A 4FVPA 3CS9A 3NCZA 3L8PA 2QKWB 3OT8A 4L42A 2GCDA 4O0WA 4FTRA 3C4CA 3DKOA 4R7BA 4FF8A 1W98A 2WOUA 3TTIA 3PWYA 4MWHA 4BGHA 4FSWA 3SD0A 3WIKA 4FICA 2PUUA 4FKTA 3S2PA 5CSVA 5HIBA 4BN1A 2O5KA 3PA3A 4BKJA 3GB2A 1Y6AA 1Q41A 2WHBA 3FMDA 3SVVA 4U97A 5IISA 3KMUA 5KZ0A 5KHWA 4BBEA 3A8XA 4PX6A 4AW0A 3WE8A 3G0FA 3MBLA 4EC9A 4F65A 1FVTA 4H1JA 3EQCA 2Y7JA 3AGMA 1SZMA 3LCKA 3RVGA 4XNEA 3AC5A 4AW5A 2F2CB 4QP4A 3QALE 3R7IA 3IQ7A 5CU3A 3EQDA 3DA6A 3NYXA 2OF2A 4GW8A 4L45A 3P78A 5A6OA 4DFBA 1I44A 3F82A 4FNYA 2EUFB 1OIQA 3CGFA 1PMEA 2GHMA 2UZUE 5CNNA 2IG7A 2C3JA 4XG8A 3DBEA 3DKCA 1OPJA 3MN3A 2BFYA 3OBJA 2YM7A 4NT4A 4PDSA 4RIOA 4X0MA 4BRXA 5K4IA 1L8TA 2BUJA 3KRWA 4L00A 1L3RE 3ZMMA 4NEUA 3ORNA 3N51A 4YJVA 2PZRA 4JRNA 2XZSA 1WCCA 3RPYA 4EK3A 1OB3A 5AIKA 1XQZA 4LGHA 4BYIA 4ANQA 3VW6A 3QCQA 5JQ8A 5BUJA 4FI1A 1DS5A 4HJOA 5L2WA 2SRCA 1I09A 1JOWB 4L7SA 4NW6A 3SX9A 4WUAA 4X2NA 4GKHA 3R7OA 2ZDUA 4W4WA 5HICA 1UNLA 5HVJA 3DT1A 4C7TA 2PMIA 4YHJA 3QGYA 1OZ1A 5AA8A 2J50A 2J4ZA 5HO6A 3CTHA 5K0KA 4D2SA 4FKOA 1IR3A 4W8DA 5IEYA 3BWJA 3P5KA 3SV0A 5FEDA 5KZIA 5E91A 5JGDA 4IX6A 4X2KA 4IAKA 4QQTA 4CCBA 3BRBA 2ONLC 3UMWA 3ZZEA 4GJ3A 4ANSA 3KK9A 5FTGA 2C3IB 4MXCA 4ZTRA 2W5AA 3HUBA 5FUTA 3O51A 4ORKA 4AXAA 4A9TA 4AG8A 3KA0A 3QYZA 4XG2A 2FSTX 3UQCA 1XH4A 2VU3A 5IH4A 4KSPA 4BYJA 2VO0A 3BX5A 4LOQA 4XUFA 3FYKX 1K9AA 2HCKA 2C5NA 4YZBA 4YC3A 5LARA 3LLAA 3TYKA 3W0MA 5GZ8A 3IECA 3I0OA 2ITOA 3A61A 3KCFA 3OBGA 3OT3A 4GVAA 5F9EA 4OTFA 3R9NA 1ND4A 3D83A 4XG7A 2CNVA 3HMPA 4Y85A 5AUZA 4KABA 1H1WA 1MUOA 5BMSA 4K18A 3HV3A 2Y6OA 3RMFA 3Q04A 4OTRA 4FKRA 2R3NA 4EJNA 3NSZA 3S0OA 4HNFA 4H39A 4YJSA 3L1SA 4ZJVA 2VNYA 2VTHA 3VUTA 4CZUA 3FLYA 4O0TA 3IG7A 4MD8E 4EWQA 3A7FA 4WSQA 1U59A 3ZCLA 5GJGA 3CC6A 4DEBA 4NH1A 3MTLA 3LFSA 1G8KA 1QCFA 4QMTA 2CLXA 4HOKA 1YI6A 3PYYA 2PULA 2ERKA 5EOBA 4D4VA 4EH3A 3OFMA 2GHGA 5CX9A 5DPVA 5F94A 4HCVA 5CENA 2W99B 3OCTA 4FZ6A 3D94A 4PL3A 3ZDIA 2WXVA 4IX5A 2P0CA 5CSPA 1MRYA 3MA6A 2R3LA 3MFSA 3PVWA 3VF9A 4IX4A 5GJFA 1XBBA 2PVNA 2WEVA 4FKPA 3R7VA 3FZTA 1A06A 2ZYBA 4RLLA 4LQMA 2R3JA 3O71A 2E9PA 2X8EA 4GG7A 5HNBA 4ASDA 2IVSA 5JMSA 5DNRA 3U51A 4O4DA 1KSWA 2WB8A 1KOAA 1OL1A 1H01A 3UE4A 4U45A 4E93A 2OIBA 4DBNA 2WTCA 3VN9A 5KMOA 2Z7SA 5E4HA 2VO3A 3DU8A 1GZOA 3QTSA 3C4FA 3EN4A 1IRKA 2CGWA 3BKBA 4FTAA 3L8XA 4DFZE 3E62A 3PXZA 4IJ9A 1R0EA 3A7IA 1OBDA 3AKKA 1OKVA 5FEEA 3DLZA 3TV6A 4X6QC 4A07A 3DJ5A 1CDKA 2W17A 3F3UA 1V1KA 4CXAA 2OIDA 2OFVA 5DN3A 2XK4A 3DXNA 3OXTA 4N6ZA 4JG8A 1Q3WA 5CANA 4AE9A 2ZB0A 3KULB 5BVEA 3VBVA 4MNEB 4QTAA 1T45A 5HKMA 2CPKE 3LMHA 2PZPA 4WA9A 5CXZA 4DFUA 4RVLA 4HYIA 5CQUA 2REIA 2UW0A 1YVJA <