1IRKA

Crystal structure of the tyrosine kinase domain of the human insulin receptor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
303
Chain Sequence
b'SSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INSULIN RECEPTOR TYROSINE KINASE DOMAIN
publication title Crystal structure of the tyrosine kinase domain of the human insulin receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase (phosphotransferase)
total genus 99
structure length 303
sequence length 303
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1995-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1irkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1irkA01
3R28A 2C4GA 4M69B 2J0IA 3QKMA 5H3QA 2UW3A 4M84A 5ANDA 4YMJA 5M55A 4ZTMA 3Q6UA 5KNJA 3M2WA 3F3WA 4J53A 3W2CA 5E92A 4UY9A 5EK7A 3QD3A 2HZ4A 3ZM4A 5EQPA 2WMRA 1OPJA 3QCYA 2PVHA 3WF7A 2YZAA 3HA8A 4S2ZA 5FP5A 4FTTA 1PMEA 4X2KA 4XLIA 3UOLA 4O7SA 4GEOA 4AOJA 3ZOSA 1Q24A 2HOGA 4U43A 3ACJA 3FAAA 4QMTA 5M06A 5CEPA 3TTJA 4RJ4A 1ZLTA 3O8TA 3KY2A 3K5UA 1OL7A 3NCGA 3D9VA 4DFXE 4RLKA 4FZ6A 3UG1A 3ZXZA 4FKUA 5TR6A 1B38A 3WZDA 4ARKA 4NSTA 4WOVA 2GFSA 3QQFA 4WBOA 3TT0A 4GFGA 2X2LA 2JDTA 3CD8A 4XMOA 3V5QA 3G2FA 2VU3A 3DK7A 3GBZA 4D9TA 1Q61A 2PK9A 3IG7A 3V8SA 3CQUA 4QQ5A 3MH0A 3OVVA 1PW2A 4BBMA 4YZDA 4XG3A 2VD5A 2FA2A 1BKXA 3P4KA 4Z7GA 4ZZOA 1V1KA 3Q9WA 3D4QA 4AT4A 5EYDA 1XBBA 3PIYA 2VN9A 1M14A 4JVGA 4D28A 3D2IA 3IK3A 3QLFA 3DBDA 5CF6A 5JGBA 4U5JA 3SLSA 4IVCA 4C33A 5CSWA 4DGGA 2DUVA 5DYJA 3EQDA 4GJ3A 4S32A 2BDWA 4F6SA 4RX7A 4GU9A 3BHVA 1U4DA 1XH8A 4BTKA 4WT6A 2XYUA 4FOBA 1XR1A 3RBWA 4DGOA 5J9LA 3SDJA 1J91A 2EWAA 3H0YA 3FQSA 2XBAA 3UGCA 3OXTA 1LEWA 3PVGA 4D4YA 3UNZA 3PPKA 2HXLA 2YFXA 4NFNA 5CYIA 5AV4A 4WBBB 3JR1A 4RVKA 4KIPA 3WBLA 5HD7A 5AR5A 5CNNA 1Y6AA 2PTKA 1Z57A 4O1PA 4CFWA 4GIIA 4O84A 1RDQE 3NIZA 4IHPA 4OGRA 4Q9SA 3W18A 3DXQA 1MQBA 3BHYA 2JFMA 3OCGA 3TKUA 4GCJA 3NNWA 5BVDA 4IAAA 5CWZA 4QP3A 4AW5A 4FTKA 3P5KA 4OTIA 5CSHA 5H2UA 4TYHB 2P0CA 2PE2A 3QGYA 3ALOA 4BDCA 4NFMA 5HD4A 3P0MA 3RTPA 5EHLA 3LKMA 3CY3A 2V22A 4JQEA 4IANA 4FKIA 3T9TA 1O6LA 3UIMA 4BDAA 3VS1A 4AU8A 4L44A 4FMQA 5LQFA 3G15A 2W1DA 3GC9A 3W55A 4EEVA 1H1RA 1XH6A 4DLJA 3G9NA 3O0GA 2YDKA 2PUNA 4IAYA 1R39A 4FEQA 2JKMA 4I6BA 3R8LA 3QQKA 4DG0E 2C5XA 5C1QB 3F66A 4LUEA 2W7XA 1KE5A 3H30A 4IEBA 1SVEA 4K33A 3UODA 2UW6A 3CR0A 5IISA 3QU0A 2ONLC 4O0XA 3AGLA 2W1EA 3GFWA 3MJ2A 3DB8A 3OWKA 3P23A 5CVFA 4AN3A 1ERKA 2V62A 1JVPP 3ZC6A 1G8SA 3KXZA 5EM7A 5D1JA 2OJIA 2VO7A 3MH3A 4KWPA 4OTHA 1MRUA 5M57A 3U6HA 2IPXA 3ORMA 1KE9A 4EHZA 3G33A 5EM5A 3E8DA 2WTKC 4P4CA 3FJQE 2IVTA 4PNIA 1OPLA 2BRMA 3G9LX 1R3CA 3I81A 3PIXA 2O2UA 3NUPA 1HCLA 4DEDA 5K5NA 5A3XA 4CYJA 2OXDA 3FMJA 3LHJA 4IE9A 4IM3A 1BL6A 4WG5A 2P3GX 4M68A 5JMSA 4K2RA 3VC4A 4I3ZA 4ZMFA 2OZAB 1JAMA 3QCQA 4BDJA 2XK7A 2GNHA 2WMXA 3W2PA 4KRCA 3NWWA 3ORNA 2GNFA 4A06A 3ZTXA 5EM6A 3VBWA 5F94A 4JIKA 3DKOA 4OBOA 1JBPE 1BI7A 3PXQA 4GU6A 4MD9E 4A9SA 3PWDA 4J8NA 4R3PA 5CTPA 3PUPA 3TKIA 4N4SA 3DFCB 4GG7A 4NTSA 5AAGA 2XKDA 4CCUA 1JWHA 2YJRA 3FWQA 4EKKA 3HVCA 4JIAA 3SOCA 2YDIA 5HNIX 4FV6A 4IB1A 4BBFA 4BCNA 2IZSA 4RMZA 4AS0A 4C7TA 5CS6A 4ZJJA 4RFYA 3TV4A 2UZUE 1H07A 4AZEA 2WMBA 5IEXA 3ZBXA 5J95A 2BIYA 4IIRA 4S31A 4BGHA 1PRYA 3QF9A 4PTGA 4V04A 5HE1A 4CLJA 2B9HA 3FDNA 1W8CA 2GS7A 2R3GA 3P9JA 5AJQA 5DI1A 5EI2A 5HNGA 2HW6A 1MP8A 4EUTA 3BHTA 1Y57A 1PKGA 3GP0A 4IJPA 4KKEA 2CDZA 4CMTA 4FTUA 5M08A 3JS2A 4A7CA 4O0YA 1E1XA 4JQ8A 4FT7A 4HCTA 3ZEPA 5EI8A 4FICA 3FMMA 2XIRA 4EOKA 4EOJA 4XV1A 3R01A 4OT6A 3R0TA 2WQBA 2KTYA 3AT2A 4LGHA 3DJ5A 1M2QA 3OEZA 2WNTA 4FIHA 3NW6A 1PHKA 1UWJA 1O6YA 4DFNA 4UZHA 3U6IA 1OKVA 2RIOA 4IM2A 1PXJA 5AR8A 2QO7A 4EBVA 3AT4A 4XJ0A 4FKOA 5AX9A 1U5RA 3EN5A 2PY3A 3Q9YA 2C3KA 2W4KA 3S0OA 1J3HA 4ZJVA 4NH1A 5HLWA 4LL0A 3C5IA 3ZRMA 5GINE 3GC8A 4QD6A 2X4FA 1KV1A 5FTGA 3RVGA 2YAAA 2BAKA 3F5PA 4RIOA 2IW9A 4F7JA 2G2FA 3AOXA 3NPCA 3G90X 5D10A 3ENHA 3NCZA 4E7WA 4M69A 3ZHPC 3NVKI 1M52A 2PVKA 4I92A 4D1ZA 5DEYA 4OT5A 5J87A 4EK5A 2CN5A 4FKJA 4O83A 2X4ZA 3LCOA 5CU6A 4Z16A 1IR3A 3BQCA 1PXOA 5IMEA 2OW3A 4IZ5A 4M3QA 4WNPA 1XKKA 4D5KA 3CTQA 2PVNA 2W9FB 5EW3A 3EIDA 1FGKA 3KF7A 2PVRA 3DBQA 3RK7A 4AN9A 3ZZWA 5C8KA 3GVUA 4DA5A 4PL5A 5HIBA 4R78A 3RHKA 2W4JA 3VBQA 4FVPA 3GU4A 3SX9A 4NKSA 4BKYA 4EK8A 4XG2A 2QOBA 2GMXA 4GSBA 2XJ2A 3N51A 2YLEA 4W8EA 4U45A 4XG8A 2BTSA 4TXCA 4X3FC 1KE8A 2IZRA 4F9AA 4MWHA 3F2NA 5B2LA 5HQ0A 2C5VA 4CCBA 2UZNA 2OJJA 3THBA 1PKDA 2ZVAA 3OG7A 2VWYA 1GZ8A 4GT3A 3ORPA 4L46A 4CQEA 4MX9A 4U8ZA 4A4OA 4DITA 3HV5A 3BE9A 4P2KA 5BVNA 3W1FA 2WHBA 3DA6A 4IDVA 5CI6A 2XNMA 3VAPA 3HEGA 1H0WA 3QTZA 2R3HA 3F82A 4JJRA 2XS0A 4MKCA 4W4XA 3ZDIA 4UMUA 4H3PA 2QR8A 5L2IA 3LFQA 4UEUA 3R7IA 4AACA 4B99A 4BIEA 2V5QA 4GRBA 4ID7A 3SVVA 1FVRA 1BYGA 4QO9A 3UMXA 4M14A 4Z55A 4XCUA 2IJMA 1JKSA 5L2WA 3NDMA 3TDWA 4Y83A 4KBKA 3QRTA 3PLAE 3F3UA 3QHRA 4BCIA 2CLXA 1WBVA 4Y5QA 2YM6A 3KXXA 2XNOA 3OFMA 3AC8A 2VZ6A 4FKTA 2ITYA 3HYHA 4E4MA 4O7ZA 5AR4A 2G2HA 3TV6A 3B2TA 2CNVA 4O22A 5HG5A 4FTOA 2JFLA 3VBTA 4QP7A 3CPBA 3P79A 2JDOA 1KSWA 3QGWA 5AA8A 3LMHA 1LUFA 1G5SA 3F88A 4O0SA 3ZFXA 5CF5A 2OICA 2QCSA 4YSMA 3LLTA 5LVMA 1IA9A 4CFFA 4D5HA 2OH4A 2CHLA 3M1SA 3GCSA 3LAUA 4C4IA 2ITPA 3VUHA 3D5WA 4M97A 3WZJA 4N57A 4KIQA 1L3RE 4QQCA 1ZWSA 4GYIA 3UO4A 2YITA 4TYHA 5LMKA 2WB8A 3WILA 1ZOGA 2BROA 1IRKA 2WELA 5H8GA 5L2QA 5ANIA 1OKWA 4OLIA 2H34A 3EFJA 3FLNC 3O8PA 4J99A 4WRGA 3HV7A 3QZGA 5IQBA 4XRLA 3F69A 4JNWA 5IDNA 3AD5A 4UXLA 3K3IA 3OOGA 5L8LA 4ZP5A 5FBNC 3N4UA 1WVXA 3BX5A 5FDPA 4ZEGA 2QG7A 3BU3A 4AA5A 4DCEA 1WBPA 4N70A 3F61A 3HV6A 4MTAA 2OG8A 4N0SA 4YZMA 3SC1A 4NIFB 5F95A 3JYAA 2QOHA 5EKOA 4FTAA 1VYWA 2VO0A 5DR6A 2WEVA 3SXFA 4BR3A 4B4LA 4DEIA 1H01A 1F0QA 3HMNA 2FVDA 4F9WA 3K5VA 1GOLA 1YXUA 2PU8A 3S4QA 3UZRA 3BWFA 4YJOA 4BDEA 4BCPA 2ZM3A 2ZV9A 2Y4IB 3H4JA 4MQ2A 2C5YA 3DQWA 4I5HA 4YTIA 3UC3A 4O7YA 1UVRA 2X9FA 4UYNA 4M13A 2VGPA 3NUSA 4PTCA 5CT0A 4EHEA 2PZ5A 1YI6A 5H8EA 5I9WA 2XKFA 3DY7A 3OD6X 3TUBA 3TNWA 4PX6A 4XX9A 5K0KA 1R1WA 4TL0A 5T3QA 3QKKA 1BI8A 1VR2A 1WBSA 5HVYA 2ZMCA 1W98A 3EN9A 2PVMA 4EH3A 4ERKA 3AD4A 5J5SA 3LCKA 2WTJA 3Q5IA 3WYYA 4IJ9A 3P7BA 3PY3A 1T46A 3T8OA 4QP8A 4EC9A 5M09A 3RCDA 1H27A 4YJNA 3RHXA 4NW5A 2ERKA 2ZMDA 3B8RA 4FIGA 4CKJA 4G31A 1ZXEA 4PPCA 4HVIA 3GC0A 5BQ0A 5LVPA 3CJGA 4BTFA 5DR9A 1PYXA 4O7WA 4EKLA 5D7VA 3ZXTA 1YHSA 3DQXA 2JIUA 5HU9A 4S34A 4J98A 3SHEA 5ETCA 4LV8A 3OC1A 3RJCA 5CSVA 2WO6A 5HI2A 4RJ8A 4Y46A 4FKVA 4JG7A 4MBLA 4PP9A 4BHZA 3WF6A 3NR9A 2YHVA 2YIYA 3CCNA 3R7VA 3WE8A 3LQ3A 3Q6WA 1H1PA 4O81A 4PF4A 3RM6A 4M15A 4DH7A 1OUYA 4PP7A 4O7NA 4PL3A 2WEIA 5EYCA 4CFMA 2R7BA 3TEIA 2W1ZA 3ALNA 5CEQA 3VQHA 3QTSA 2CGXA 2BZIB 4ZIMA 3R8PA 3TCPA 4W4VA 3FBVA 4LRKA 4YJSA 4YJTA 2J2IB 1YI4A 3CJFA 3E7VA 4CRLA 4ZTHA 2ITZA 2YABA 4UWYA 5KMMA 3FLWA 3PP1A 4PDOA 3MY1A 3PRFA 1P2AA 2JBPA 2W1FA 4TY1A 4RT7A 5JFSA 3QZHA 3NZ0A 4EH5A 3I4BA 4M66A 4C37A 3UIUA 3IGOA 4GT5A 2PUPA 2C5OA 2XCKA 3Q3BA 4I0RA 3ZO4A 5GZ8A 3WYXA 1KWPA 2YA9A 3GU5A 2ITQA 4CT2A 4QYYA 4EOPA 3AG9A 5HTBA 3UOJA 2B9JA 5ANJA 5FTQA 3ZSHA 2Q83A 3I6UA 4F6UA 4QMLA 4BI2A 3I5ZA 5AP3A 5HE0A 5EW8A 2YJSA 3HA6A 2JDRA 4JR3A 1L8TA 3PY0A 3U4UA 4RZVA 2V55A 3F2AA 3NYXA 5FM2A 4YBKA 2JLDA 3KRXA 2CGUA 4P7EA 3SOAA 3TNPC 4YLKA 3KXNA 1QMZA 4HNIA 4X21A 5DN3A 4L7SA 1Z5MA 4AOTA 2OIBA 4KS8A 4F9CA 4F7SA 3LMGA 3O71A 3PRIA 5I9ZA 2Y8OA 3RPRA 3TZ7A 4EJ7A 3ZC5A 2A2AA 3FZOA 5A4LA 1QPEA 3FI4A 4JDKA 2EB3A 3D7TB 2YN8A 3OTUA 4FL1A 3NYOA 3QCSA 4YC3A 4ANOA 4WUAA 2IN6A 2ZYBA 4FT5A 3RINA 4X7QA 3HP2A 4QP9A 1PXMA 4PMTA 3RAHA 4N6YA 4JG8A 4KBAA 4H36A 1V0OA 4ZSGA 4BDHA 1SNUA 3MWUA 4QPSA 3JXWA 3DDPA 5EI6A 2GHLA 2UZEA 2B1PA 2GU8A 3F7ZA 4L3PA 4ZLYA 4IZYA 4Y73A 2IVSA 4K77A 3DLSA 4EK6A 4RVTA 2VX1A 4RWLA 5AUUA 4NJDA 5BPYA 4FSUA 4FR4A 4I6HA 1YWVA 4YZBA 1DI9A 4IWDA 5IKWA 2GNJA 2VTAA 3FLYA 5AA9A 5CEKA 2HELA 3OTVA 1JKLA 1H00A 4IZ7A 3D83A 4JAIA 3UQGA 3U9CA 3MSSA 1ZZLA 2QI8A 4U7ZA 3MPAA 4YZ9A 4BI0A 5KHXA 4BWKA 3FUPA 3NYVA 1YKRA 3BRBA 4DN5A 5HICA 1LP4A 5T68A 4CGAA 3KB7A 3DNEA 3GC7A 4RIWB 2I1MA 3U8WA 4QPAA 4CZYB 4BTJA 4RWKA 4YU2A 3VHEA 4Y8DA 5JEBA 3DFAA 5JRSA 4BDBA 2RSVA 4IC8A 1YI3A 4KS7A 4JBQA 4MBIA 3MN3A 4FNWA 4YJQA 3UP7A 5EH0A 4ZOGA 5BVEA 3I5NA 4O1OA 3AXWA 4LRJA 5TF9A 1PXLA 3AC1A 3LFBA 3NNXA 3R1SA 4J71A 3ZSGA 4BY9E 1UU8A 3A7GA 4ALVA 2ITWA 3W8LA 5DOSA 4P5ZA 2QD9A 4GUEA 2GS6A 2VTHA 3C4FA 3OWJA 2C6DA 4NK9A 4AX8A 4DTBA 4KNBA 4E6QA 2OF2A 3H9FA 2X8EA 3BYUA 3D94A 2VO3A 5E8ZA 3W2OA 1OBGA 2CKOA 2HZIA 3EQGA 2JC6A 4DH3A 5CAQA 2NNWB 1A06A 2BZJA 3PSDA 3R1QA 4MF1A 2C6LA 3O2MA 4Y72A 3V5TA 4D4VA 5JK3A 3F5XA 2JITA 3KXHA 4FYOA 1JPAA 3R2BA 4KSPA 4IMYA 4C2WA 4QMQA 4JQ7A 5CVHA 3DPKA 3G6GA 2AYPA 3MVJA 3E5AA 4FL3A 4BWPA 3NNVA 2OLCA 4IQ6A 3LPBA 5T6KA 5CX9A 1OECA 3Q53A 5B2MA 5KHWA 3F3ZA 1YXTA 5KKRB 4NM0A 5E8VA 3ZUUA 2BTRA 3D7ZA 3OT8A 1URCA 3UZPA 1OL1A 4EK3A 5GIOE 3AC4A 1OITA 1FINA 2ZV8A 4D2TA 2IVVA 3LFSA 4FSRA 4F64A 4ZY5A 4GL9A 5M4FA 4JR7A 3EL8A 3LJ0A 5CEIA 4ACMA 4YTFA 3F5UA 4YC8A 1NT2A 4YTHA 4FV8A 3TIZA 1JSUA 3FKLA 4LOOA 4G6LA 4MWIA 4WD5A 3BV3A 2WTDA 3UE4A 1E9HA 2XEYA 3M11A 2JAMA 3H9OA 4NIFA 5AWMA 4E4LA 3CS9A 3MVMA 2UW5A 4W9XA 2IG7A 3C0GA 4L53A 4OTGA 3MJ1A 2XCHA 3E7OA 5AR2A 1OIUA 4WA9A 4Q2AA 2C69A 4J96A 2P33A 2UZLA 3U6JA 1U5QA 3GCPA 4NZWB 4O2ZA 4KKHA 2XMYA 5L2TA 4W4YA 2BKZA 4R1VA 4BCFA 3R21A 1YXSA 3F7WA 4NJ3A 3EJ1A 4BGQA 4CFNA 3HL7A 3L8SA 4EYJA 1H1QA 3PJ1A 3R1YA 4RGJA 3QFVA 4ZTLA 4C3FA 4FI1A 3Q4ZA 3VUGA 5E9EA 5A46A 5AP6A 5DIAA 3ORKA 3OY1A 3EQPA 1HCKA 1UNHA 3GENA 3NUNA 4J8MA 3LXLA 5GZ9A 5BYLA 4U3ZA 2HWPA 5D7AA 4ZMEA 2YDJA 2ITTA 3LM0A 4EJNA 4ITIA 1IG1A 3I60A 5IA0A 1Q8UA 3LXKA 4AUAA 3OOMA 4HGLA 2G15A 2J5FA 3RZBA 2JKKA 4DGNA 4XOZA 4GFMA 4RBLA 1FPUA 5M44A 1RE8A 3KRLA 4CSVA 3Q60A 4BL1A 3FZRA 2YZLA 2QLUA 4WSQA 4MYGA 2RFSA 4LL5A 3KKVA 4JRVA 2OXYA 4FYNA 4G3CA 3ZLWA 4IFGA 5DT3A 2OKRA 3E8NA 2WQEA 2ETMA 3D5XA 4IACA 4XG7A 5KO1A 4WSYA 1H26A 4G5JA 5K3YA 3SA0A 4QP4A 3HAMA 2F57A 4RA4A 4M8TA 5DWRA 4ENXA 4NL0A 5I9YA 3V8TA 3FYKX 2I6LA 3SG8A 1XWSA 2GSFA 4GT4A 4I20A 3CGOA 4OW8A 5C03A 5JGAA 3O7LB 3PPJA 4RIXB 3ZM9A 5GJDA 4R77A 2XIZA 4K1BA 4ENYA 1JSTA 3I0QA 3SXSA 5IMXA 2X1NA 2C3JA 3BZ3A 3OWLA 3MFRA 3A7HA 4MF0A 4D55A 1Q41A 3L8VA 1P4FA 3UTOA 3O8UA 4ANMA 3C4XA 3GU8A 1J7LA 2BKKA 2WD1A 2GNLA 1CM8A 5CENA 4YPSA 5KBRA 1UA2A 3MTFA 2LAVA 4QTEA 1XH4A 1KE7A 5D11A 2NRYA 2C3LA 3VS4A 3PVUA 5EDRA 3QXPA 2GNIA 2FH9A 4D2SA 1YXVA 4ZSAA 1IAHA 3FMLA 4IFCA 3ZFMA 1P5EA 5CXHA 2HW7A 4C57A 5LWNA 4GV1A 3I7CA 4XNEA 4NCTA 2HY81 3QKLA 4TNBA 5E1EA 1JSVA 2EXMA 2GTNA 4DEEA 2HYYA 5CSXA 2I0HA 4BCQA 3ET7A 4JX3A 2XNEA 5IQDA 4XOYA 2F49A 3R30A 3R8UA 2E9NA 5LWMA 4JG6A 4P90A 1NA7A 1ZRZA 2DWBA 4PRJA 4F7LA 4MQ1A 2PWLA 4JOAA 2W9ZB 2OIQA 4RWIA 1UU7A 4A4LA 1KV2A 2R2PA 3CTJA 2VTNA 2XVDA 3VO3A 4F1TA 3OCSA 3S3IA 5F20A 4FTRA 3E63A 3NUXA 3GUBA 4TWOA 4XG4A 4G9CA 4B0GA 1U54B 2YLFA 5C01A 4U0IA 3UJGA 3ULZA 4O0RA 3S2PA 1UKIA 5AIKA 3UVRA 3ORTA 2W1CA 3QC9A 3UNJA 5A54A 3FC1X 3NMUF 3D7TA 3PSCA 5HTIA 4TT7A 5LVOA 2J6MA 3D5UA 3HMMA 1K3AA 2J9MA 2BAJA 2BPMA 4KIKB 5HLPA 3QCXA 2O64A 3CQEA 4XG6A 4BB4A 4BIBA 4RSSA 3SAYA 3F9NA 4I6FA 2AUHA 1XBCA 2FSMX 3FMDA 3LFAA 4QTDA 3CY2A 3ZLSA 3LVPA 3ROCA 3RPOA 1PMVA 2PZIA 3GNIB 4PDPA 3BQRA 5G6VA 3O50A 3OZ6A 4UMTA 3FSKA 4GG5A 5AV3A 3A60A 1OUKA 4PWNA 4G17A 3UIBA 4LMUA 1DM2A 2QKRA 2ESMA 2Z8CA 5AUWA 4O7VA 5I3RA 3FL4A 4FKQA 2YIXA 2PMIA 5KBQA 3UVQA 4F7NA 3AC5A 4PY1A 5AV0A 4DBXA 2B9FA 3LOKA 4QNAA 4O7TA 4I41A 4USFA 1Q8TA 1SYKA 3C13A 3R00A 4UWCA 4KSQA 4GK3A 4AGDA 2FO0A 1YOJA 5DGZA 4C3PA 1TVOA 5CEOA 2A19B 4QYEA 4CG9A 2NPQA 2WFYA 2ITUA 3OUNB 2XB7A 4FV9A 4M7IA 3REPA 1APME 1XQZA 4DTKA 4ZAUA 4O86A 1QPDA 4L3JA 3VW8A 5A4TA 5JQ5A 1KOBA 3ITZA 1M7QA 4BWXA 4FIJA 4G1WA 4V01A 2CCIA 1JQHA 4NEUA 1XH5A 3QQUA 4FNXA 4TYIA 5GIPE 1ND4A 2WMVA 2R3OA 2YCRA 4B9DA 1YOMA 3BYVA 3U55A 2OJFE 4BDIA 3W32A 1Y8YA 3PYYA 3LM5A 3FPQA 4CYIA 3HUBA 2R9SA 4DEAA 3TWJA 4RIYB 2OXXA 5AFVA 2QOFA 3V3VA 3MBLA 4ZZMA 3LIJA 3CTHA 2VTIA 3EOCA 5IZFA 1RW8A 3CQWA 2I40A 2UUEA 2YEXA 2J90A 3PVWA 5CAPA 3FV8A 4FKPA 4C4EA 2F7ZE 2YAKA 3CIKA 2GTMA 4FV4A 3ZZEA 2NP8A 4C4HA 4FBXA 5BVKA 2QODA 4FKRA 1XBAA 2XBJA 4GKIA 3MVLA 5KZIA 4PPBA 3WF9A 1ZOHA 4MNEB 4AT5A 1SVHA 3A4PA 2RFDA 5K5XA 1ZYJA 3VUTA 4JXFA 2XUUA 4WIHA 4YUQA 2GHMA 3FHRA 3WIGA 3MB7A 4C35A 1GZNA 3DTCA 1UV5A 2X8DA 3C0HA 4IBMA 1JOWB 2WKMA 4YO6A 3V6SA 1BMKA 5JH6A 4BYJA 3VQUA 4QQTA 4EI4A 3LZBA 3P1AA 4DFLA 3QZFA 5IA1A 2FB8A 3WE4A 2WMSA 3BELA 3HLLA 4Q5EA 4I93A 5E7RA 2F7EE 4E5WA 5HOAA 4LI5A 4RPVA 3VUIA 3ZLXA 2R3KA 2WPAA 4CTBA 4CT1A 2G9XA 2VWVA 3QA8A 3U4WA 2F9GA 3L9MA 3ZBFA 4ACDA 5LCKA 5DT0A 4YHJA 1PMUA 2JKQA 5JFWA 2CKQA 4HVSA 2C1AA 2F2UA 3FHIA 3QL8A 4IAFA 5C26A 2X2KA 4I6QA 4Y85A 2WTIA 4CTCA 3IDBA 4FK3A 5M4CA 4QMXA 3V5LA 5HCYA 4ASZA 2J0MB 3N4TA 2FUMA 3QTRA 4AA4A 3MFTA 3OXIA 3KFAA 3Q9ZA 1STCE 2A0CX 2UW9A 3FPMA 1H24A 3KMWA 1REKA 5FEDA 3IPHA 3RWPA 3SV0A 3T3UA 1OMWA 3BU5A 4DFYA 1AQ1A 5CQUA 2VWIA 5FDXA 1OVEA 4USDA 3UOKA 5B7VA 2HZNA 2B55A 2BILB 4FTCA 1CTPE 4G3GA 5BVWA 5FQDC 3QX2A 1WZYA 1T45A 3MW1A 2O65A 3E3PA 4D1XA 5J79A 2OH0E 4BN1A 2PZRA 3ZEWA 5I0BA 2XYNA 3AMAA 4D2WA 4DFBA 5EYKA 5K4IA 1Q4LA 3CSVA 5TOZA 2VO6A 1NY3A 3FL5A 3Q52A 2BRBA 3W2QA 4MNFA 3A8XA 2O5KA 5FEQA 3EQFA 4RIXA 4QP2A 4KKGA 4M0YA 5EM8A 5ANGA 5IH4A 2XRWA 2BRNA 4IAZA 1CSNA 4APPA 4F1OA 2OGVA 4UWBA 5IUGA 1YW2A 4QMVA 1FGIA 5BMSA 3CBLA 2EU9A 2WIHA 2Z02A 4GVAA 2PUIA 2IZTA 2YISA 3UMWA 4AFEA 4O27B 3O17A 5L6WL 4Y95A 2OFVA 5E4HA 3M42A 4BVUA 5L2SA 1O6KA 3RKBA 1PY5A 4IX5A 3LJ1A 4NM5A 3TKHA 3SD0A 4YLLA 4E8AA 2C0IA 5D9HA 2IO6A 4K18A 5FXSA 3UC4A 2IW6A 4B6LA 2Z2WA 4IM0A 2ZJWA 2WQNA 2CSNA 4IVDA 5A4CA 1Q3WA 4GVJA 1BX6A 5EOLA 3KN6A 1H0VA 1KOAA 3C5UA 3KULB 3PXYA 4AFJA 3GCQA 5EW9A 1QPCA 2Q0NA 3VIDA 2VAGA 5KMNA 3DKGA 3NUUA 3HNGA 4D9UA 1OPKA 3TIYA 5HZNA 2O8YA 4YPDA 5DBXA 3DGKA 3D14A 3R8VA 2P4IA 2BIKB 5HIDA 4UN0C 2ZDTA 3R9NA 4E4XA 5IG1A 1M2PA 5GNKA 1K9AA 2W96B 4O21A 4F4PA 5BUEA 5DE2A 1U54A 4HYSA 3CGFA 4GUBA 2WTVA 4U42A 4YSJA 2FGIA 5KMJA 2CNUA 3GT8A 5HVJA 2X2MA 3W8QA 4AA0A 1F5QA 3KEXA 2QONA 3SRVB 4A07A 3FI3A 3KK9A 4CFVA 3GI3A 3ODYX 3KCKA 4X2NA 4EQMA 3KMUA 4HGTA 5CI7A 1LEZA 1PXKA 4KIKA 4V0GB 5AP5A 5HEZA 4D2PA 3VHKA 5J1VA 3COKA 1B39A 1W84A 4WG3A 4U41A 3Q4UA 3TUCA 4BKZA 2W1GA 4JDJA 2WTKB 4OTWA 3ZO1A 3BYSA 1JLUE 4FGRA 2X7GA 4LYNA 1NVRA 4FIEA 5C9CA 3R9HA 3WARA 2C6OA 1XJDA 4X2JA 2OWBA 2XA4A 4GIHA 1PYEA 2BFYA 4MHAA 5HBHA 3EHAA 5HG9A 3W2SA 4D0WA 2PE1A 1GIJA 3S1HA 3Q96A 4W4WA 3CEKA 4TYEA 3E3BX 4EH6A 2P55A 2OU7A 4AZWA 5DVRA 1Q97A 4ERWA 4RX5A 3DJ6A 3D5VA 2REIA 3WF5A 1YDSE 3HV4A 3V01A 5HE3A 3VN9A 1V0BA 2C6EA 3PFQA 4FKLA 3WZUA 4K9YA 4XP2A 4D0XA 1SNXA 5IQCA 4NUSA 4FV7A 4I24A 4QQJA 2X39A 3TUDA 5DHJA 1BLXA 3VBVA 2JGZA 1ZARA 1Y6BA 2Z7QA 2WMWA 5EKNA 3B2WA 2QOIA 5HIEA 3NVMB 3F3VA 2PVYA 5F4NA 5F1ZA 3OUKA 4YNOA 2YIRA 1TQIA 3FQEA 1OM1A 5J9ZA 3RNIA 4G6OA 3RAKA 5IA3A 2OZAA 3GCUA 2W06A 2BCJA 1OL5A 3ORLA 3RZFA 4DH8A 3R83A 3Q32A 3MY5A 2G01A 3IS5A 4FZFB 4FA2A 4K8AA 4EHGA 3RNYA 2BUJA 2GQRA 5M07A 4ZXTA 1OGUA 2ZAZA 1ZYDA 4L67A 2C5NA 3R7GA 4JT3A 4WO5A 5BYYA 4RIYA 1U59A 1FOTA 2RFEA 4MD7E 3L8XA 3FEGA 4HJOA 4G3DA 5TO8A 1CKIA 2HAKA 5I9UA 2VTMA 3QRIA 1CKJA 3C4CA 3E62A 5IEYA 4BC6A 4PQNA 4ZLOA 2NRUA 4YHTA 3DAEA 1NVSA 4AQCA 3EYHA 3PG1A 4TN6A 2JKOA 4M0ZA 5IA2A 3PZHA 3FKOA 4TYJA 4E4NA 5K4JA 3TV7A 3DDQA 4YP8A 1ZMVA 5CANA 4OAUC 4WRSA 2I0YA 5IH6A 5CAVA 5E8TA 5CT7A 4NW6A 5AAEA 3UQFA 4R7BA 4DT9A 1PXIA 2VNYA 2R7IA 3DCVA 3FMKA 4IH8A 4GW8A 1H1WA 2BR1A 1R0EA 2CPKE 3DLZA 3FSFA 2ACXA 3VF8A 3UPXA 4NYEA 1WFCA 5BX0A 1H08A 4FSTA 4ASDA 1O9UA 1ATPE 5LMAA 4PV0A 5EYMA 4EOLA 2QO2A 3UZTA 2G2IA 3TXOA 2PZYA 1IA8A 1Y91A 2QHMA 3EFLA 1OB3A 3JY9A 1PMNA 2AC5A 4FK6A 3LCTA 4H3BA 2Z60A 2KULA 3FXWA 4J1RA 5HVKA 2Y6OA 5CZHA 2UW7A 4CZTA 3BU6A 1I44A 4EQUA 3L8PA 1G8AA 2W17A 4E5AX 2YM5A 3QUPA 1UU3A 3KN5A 2E9PA 4YJUA 2ZV2A 4LGGA 4KRDA 1FMOE 4C2VA 4KUJA 4L9IA 4RX9A 3R63A 1JKTA 4HPUE 4DG2E 3MB6A 4FTNA 4QYHA 3ORXA 4UB7A 3RK5A 3SW4A 5JGDA 2OIDA 5M53A 4AWIA 1H1SA 4E93A 1URWA 2VTQA 3HMIA 3ETAA 1CDKA 4U44A 3PE2A 4LFIA 4OR5A 4ZTNA 4C59A 2J4ZA 2VTSA 2R4BA 4GFOA 5M4IA 1BL7A 4ITHA 4CG8A 1UNGA 3R9RA 2RL5A 4O2PA 1YXXA 2JIIA 4KB8A 3I1AA 3FKNA 3VS3A 4X3FB 5DPVA 3ZS5A 4JRNA 4F08A 4AZTA 2QQ7A 4AE9A 4FIIA 4R7HA 4EYMA 3GQLA 4XBRA 4WG4A 5CF4A 2VWBA 5I4NA 3MTLA 1W7HA 2VWWA 2X81A 3MA3A 3UYSA 4WHZA 3IOPA 4L7FA 4HZSA 2PZPA 5AUYA 3E93A 4YC6A 5KMOA 4BGGA 3C1XA 4IX3A 5CSPA 4ACCA 2YWPA 2PULA 3LMIA 1WVWA 3T3VA 2VX0A 2X0GA 3K54A 3EZVA 5GZAA 1XH9A 4KIOA 2QOLA 5E8UA 3PTGA 4JS8A 5LVNA 4TRLA 4FE2A 2CGVA 3ENMA 2W05A 4J52A 4FKWA 3DAKA 4HYHA 5FP6A 4E6CA 2Z7LA 3BGPA 3LFEA 4IAKA 4PL4A 4G9RA 4P5QA 4H1MA 4XEYA 5M4UA 4A4XA 4DE4A 4FV3A 2YM7A 4GK2A 3AC2A 3BEAA 3DKFA 4L3LA 3S95A 4ZZNA 3EL7A 3MFSA 3FLZA 3QTQA 5HLNA 4UMQA 2B4SB 4LUDA 3SW7A 2XIKA 5HU3A 5LARA 3SGCA 4UXQA 5KMLA 2VTTA 3BPRA 3KA0A 5AP2A 2Y9QA 4XP0A 4FTMA 4PMPA 1WAKA 5HKMA 2IW8A 5E91A 5DRBA 5LMKC 3MY0A 4IW0A 4I1ZA 3OCTA 2O0UA 4FSWA 3N4VA 3A99A 3KC3A 4IB3A 4CEGA 3KULA 2WOUA 3FMNA 2XM9A 4FUYA 2XK8A 4TKSA 4G5PA 4YHFA 4YTCA 3MIYA 3ZO3A 2W1IA 4CKRA 2JDVA 3R7OA 3SKCA 3QTIA 4AP7A 3IO7A 5LJJA 1UU9A 1LR4A 1NXKA 2X6DA 3EYGA 5IUIA 4FF8A 3G51A 4PDSA 3CE3A 4LGDA 4W8DA 1ZZ2A 1VYZA 2RG5A 3AT3A 3PXFA 1XO2B 1Q8ZA 3UBDA 1GNGA 2W5AA 4FSYA 4QMPA 3SG9A 4M67A 5ACBC 1JNKA 4ZTRA 2QU6A 4AF3A 2XNNA 4F1MA 5AX3A 2XK4A 5J1WA 3PY1A 3V8WA 4J95A 1OL2A 4G2FA 4XBUA 3SRVA 3VS2A 1SZMA 4CFXA 4Q9ZA 2ONLA 3NUAA 4EZ7A 4RC4A 4CRSA 3VW6A 3OF0A 3PWYA 2VX3A 4V0GA 4DFZE 4OBPA 2LGCA 2C6KA 4E26A 3RAIA 3C4EA 3E8CA 3TZ9A 3LFDA 4PNKA 3GXLA 4ZTQA 3IQ7A 2XIXA 3OW3A 1AD5A 4MD8E 2WMAA 2ZM1A 3EMGA 4ZY6A 1VJYA 3WOWA 3QD0A 5FBOA 4A9UA 5J8IA 3QTWA 3R04A 4KABA 4EQCA 2A27A 3UG2A 2OO8X 3CPCA 5JZNA 3JVSA 1EH4A 2F4JA 4ANSA 4JBVA 4IDTA 4JBPA 4L68A 3KXMA 4LRMA 4L45A 2QOCA 3DB6A 5DEWA 4AT3A 4FEVA 4MCVA 3GGFA 3EN6A 5J9YA 5HX6A 4HVGA 4JLCA 4KAOA 2HWOA 1Q99A 1ZYSA 2C6IA 2H96A 3VRYA 3V51A 1NW1A 2WQMA 4V05A 4AG8A 3R9DA 4OTQA 2IWIA 3D2KA 3F5GA 3PSBA 2DYLA 4QT1A 4ZSEA 3EKNA 3UYTA 3FE3A 2R3MA 4QTAA 2OZOA 3QWJA 4A9RA 5HORA 5K9IA 4YNEA 1GIHA 2OK1A 3ACKA 4BZOA 5CF8A 4R5SA 2F7XE 4I21A 4HVDA 2R3PA 3A62A 3BHHA 4BCJA 1BUHA 4IB5A 3NEWA 3I6WA 2QOOA 5CLPA 2GS2A 5FXQA 3ZUTA 2BZHB 3LFNA 4LOPA 3KXGA 5AADA 4XLVA 1M2RA 2QOKA 3HUCA 4DAWA 3POZA 1OZ1A 1DAWA 3PA4A 5ANEA 3TL8A 3DOGA 4C62A 2XF0A 3DK3A 2QURA 2UZVA 1OKYA 2GDOA 2XNPA 4YURA 5BVOA 2FSOX 3EWHA 4A9YA 2XP2A 4R5YA 4EUUA 3BIZA 4WNOA 3II5A 1OKZA 4AGCA 2R0IA 2UW8A 3MYGA 2P2HA 3LJ2A 1PJKA 4S30A 5CY3A 5GJGA 4EZ3A 1FBNA 4QYFA 4RJ5A 3L1SA 5AIRA 2DS1A 4BCOA 4RA5A 3VUKA 1GY3A 5CVGA 3G6HA 1DS5A 1GZOA 1ZYLA 4QMUA 4RVMA 3TNIA 4RFZA 4X3JA 4FV5A 3Q5ZA 4FZDB 3ROYA 3C4ZA 3MA6A 4BDFA 4CNHA 4F63A 2EB2A 4FEUA 3LQ5A 3LQ8A 4H3QA 4BKJA 2W1HA 3ZONA 2UVZA 4MXCA 4DCAA 3QA0A 3NSZA 3A4OX 4ZSLA 1B6CB 3H10A 2HIWA 2W5HA 4IWPA 1UWHA 3A7FA 4PMMA 4EOQA 1M7NA 4FVRA 4QMZA 3ZSIA 4DC2A 3LXPA 1M17A 4BCGA 4DGLC 4H58A 4TNDA 3R8ZA 4YO4A 2CNQA 3PXZA 2H9VA 2YM8A 5DRDA 3OP5A 2QLQA 4FZAB 4CFUA 2UVYA 4E5BA 2XRUA 4FG9A 3RPVA 3FLQA 5HGIA 3AC3A 4DH1A 4GH2A 5LXMA 1SVGA 3KGAA 5JSMA 3EQBA 3ATTA 5HO8A 4RFMA 3MH1A 2XM8A 2XNBA 4UV0A 5FD2A 5J7HA 5KCVA 3GB2A 1S9IA 2RGPA 3A8WA 3GQIA 1OL6A 3LE6A 2R3IA 3FMHA 4BRXA 4YGAA 4BYIA 1FQ1B 4F6WA 3OS3A 5AM7A 3O7LD 2QU5A 5A4EA 4NU1A 4IZAA 4EH7A 2UW4A 3B8QA 4X3FA 2BZKB 4TWCA 4FV1A 3TZ8A 2VRXA 4F99A 5J7BA 3UIXA 3R1NA 4NM3A 4UMRA 1OIYA 2ITOA 4JX7A 4QPMA 3R7UA 3ZYAA 4AW2A 3N9XA 5CAOA 4DFUA 4AGUA 2A4LA 4FX3A 2B53A 3COIA 4IX4A 5A6NA 2WU7A 3R7EA 3R71A 4RWJA 3Q2JA 3C50A 2BDJA 4F0IA 4LM5A 3VS7A 5ANOA 4EK4A 3QBNA 4NKAA 4FOCA 3UOHA 3G5DA 5BVFA 3FYJX 3UDBA 3ATSA 4RG0A 4BDDA 2CKEA 4U97A 4O91A 3TZMA 5DR2A 4EOIA 4YZCA 4QRCA 3DNDA 3RCJA 3PXRA 4DLIA 3AGMA 1VZOA 2ITVA 3PVBA 2VUWA 1ZYCA 3IKAA 3PXKA 3ANQA 3U9NA 3VBXA 1H8FA 4MH7A 1Q3DA 4FODA 5AP4A 3GCVA 3VVHA 1Q5KA 5FG8A 2UZOA 1X8BA 4JBOA 1WCCA 4ANBA 4CQGA 2WIPA 2J0LA 4RIWA 2EUFB 3IW4A 4WNMA 4TW9A 1ZMWA 5IQAA 3VBYA 4OUCA 4IC7A 4QMOA 1AGWA 2EVAA 4WUNA 1IEPA 5L6PA 3DKCA 3VS5A 1WBWA 2PMOX 4IWOA 4CKIA 4FTJA 2BHHA 5JT2A 5B2KA 3C51A 4JDIA 4MK0A 4FT3A 5GHVA 4I0SA 4FGBA 5L6OA 2AC3A 3PPZA 4C38A 4BF2A 3NAYA 3OCBA 3QWKA 2C68A 4QOXA 2YM3A 1QPJA 3IW6A 4TWPA 1FVTA 3TTIA 4F0FA 3DBCA 3R8MA 3TNHA 5AEPA 2CJMA 1DI8A 2W4OA 4O96A 4O0VA 2XIYA 4ZJIA 4EOMA 3FI2A 4BCKA 4LV5A 2XEZA 4FUXA 3DV3A 4RJ3A 4FIFA 5BUIA 2I7QA 4IAIA 4RC3A 3OW4A 2PPQA 5A14A 4QP1A 4JI9A 3VJNA 3PJ2A 1W82A 4FT0A 2B54A 2UW0A 3FY2A 1Q8WA 2CCHA 4MAOA 2HCKA 2QC6A 5E90A 4S33A 1F3MC 4GS6A 3W10A 3VRZA 4C4FA 1P4OA 2R3RA 2VTRA 5AP7A 4ANNA 4E6DA 3ZRLA 4EORA 1YHWA 2Y4IC 3COMA 3QZIA 2UVXA 3ULIA 2WQOA 5HE2A 4RLLA 3EH9A 2J0JA 3RGFA 3UP2A 4CLIA 4JAJA 4FL2A 4HPTE 3C0IA 3FY0A 4U80A 3V6RA 3QYWA 3FI8A 4RQKA 4HZRA 4I5PA 3HV3A 4I5MA 1IASA 3IGGA 2J50A 2QKWB 1S9JA 3HZTA 4IXPA 5E8XA 5FXRA 1TQPA 5HCZA 3V5WA 4EL9A 4F09A 4CZUA 2JAVA 3BV2A 2BDFA 2O3PA 4C36A 3E87A 4C8BA 2OI4X 5IQEA 3VJOA 5CU3A 4L6QA 4CVAA 2OSCA 5AV1A 4H39A 1ZMUA 1MRVA 5CNOA 4ANQA 5KUPA 5HG8A 4AAAA 4CXAA 4O0TA 3WZEA 2YIWA 3POOA 4CD0A 4ZS4A 5DG5A 4ZLZA 4PUZA 2WOTA 3VF9A 3AQVA 2G1TA 4G3FA 4EONA 2WAJA 5ETIA 1WBTA 5ANKA 3QC4A 5CZIA 5DLSA 3LLAA 5ETAA 3HGKA 4AZFA 3BGZA 2BRGA 3P7AA 3FZTA 2PMLX 2XK6A 3KMMA 3QHWA 3VS0A 3GU7A 1YWRA 3Q4TA 3LW0A 3R73A 1YOLA 4LQMA 3NNUA 3QQGA 2GHGA 2QNJA 2GNGA 4H1JA 4AW1A 5LMBA 2PE0A 3ERKA 4ALUA 2C47A 5IF1A 4QTBA 4DYMA 4XP3A 4C02A 2B0QA 4UMPA 2XJ1A 3Q9XA 2XK9A 3QTUA 3DJ7A 3QAME 3EB0A 1YQJA 4FKSA 4LOQA 5EG3A 4AGWA 4BCMA 4CMOA 4W9WA 1YDRE 3EQIA 4Z7HA 4MXOA 4E73A 3UVPA 2PHKA 3KRRA 3OT3A 4CV9A 3W16A 3FLSA 5CAUA 3HKOA 4LMNA 4F65A 4EH4A 1YWNA 4XRJA 3UNKA 5C4KA 4C61A 2ERZE 3H9RA 3NYNA 4NCTC 3NAXA 2CLQA 2C6MA 3DU8A 4M12A 3DZQA 4K11A 4PMSA 4PPAA 4QYGA 3R9OA 3JVRA 2BALA 3KK8A 2HENA 4R3RA 4O6LA 3K2LA 3KQ7A 4DEGA 3DK6A 5HNBA 4APCA 1PXNA 4KBCA 3RM7A 2BRHA 3NS9A 4CMUA 1J7UA 3KF4A 1FVVA 1R78A 2ZDUA 3IDCA 2JDSA 3C4WA 4FNYA 5HTCA 3QQHA 1H4LA 3WZKA 2WGJA 2R3FA 3NRMA 4JL9A 3IW8A 4AZVA 3IDPA 4C4GA 5IQGA 2EXCX 3PJ8A 4TYGA 3QXOA 4XHKB 3FXZA 3WI6A 2V7AA 3LCSA 3RAWA 4I5CA 4X6RA 5JZJA 3TDVA 2C3IB 2VTOA 3DTWA 4E1ZA 4D58A 3D15A 2R3NA 3QRJA 4O6EA 4U9AA 5FGKA 1A9UA 4EH8A 3DXPA 3OMVA 4EBWA 2CMWA 2QO9A 2J5EA 2R64A 3BBWA 3PP0A 5HBJA 1R0PA 4MXYA 5AUXA 3JY0A 5I9XA 5KMIA 5KZ0A 4O0WA 2VGOA 3HECA 2JEDA 3QUEA 4ITJA 4HGSA 3W33A 3R22A 4E3CA 4BFMA 4F70A 3R6XA 1YDTE 2WMUA 2X8IA 3GU6A 4FEWA 1J1CA 1NVQA 2R3LA 3KVXA 5DT4A 4DT8A 5AUZA 4GJ2A 2ITXA 3KU2A 5LCJA 5E8WA 5H9BA 2UZBA 4Z9LA 4ANLA 3U54A 5J5TA 3ELJA 1J1BA 4N6ZA 5HCXA 4D2RA 4B8MA 4DGMA 5JRQA 1K2PA 3QUDA 5IEVA 2R3JA 2OJ9A 3KREA 1JKKA 3NLBA 4ASEA 1ZAOA 2ZM4A 1GIIA 2VWUA 4RVLA 2OBJA 3PDTA 3MS9A 1WBNA 4TZRA 3DAJA 4UBAA 3DZOA 3LFFA 3O96A 4YJPA 2ETRA 3OXZA 3H0ZA 3C9WA 3GFEA 1UNLA 4ACGA 3E64A 3Q4CA 4YJRA 2XJ0A 2PL0A 2ZOQA 4HCVA 3PLSA 1TQMA 4TWNA 4OTRA 4X2FA 4BI1A 5DMZA 4FG8A 4J7BA 4RX8A 1KE6A 2J51A 2Z7SA 4XYFA 4EOSA 3ID6C 1RJBA 2ETKA 4BBEA 1RQQA 4I23A 4FVQA 2XNGA 4XS2A 3T9IA 1Z9XA 4FSNA 3EQHA 3C7QA 5AP1A 4G34A 3QD2B 2HY0A 4U6RA 3ORZA 5FUTA 4BZNA 3IONA 3KRJA 3RPYA 4AZSA 4TPTA 3VUDA 2QR7A 3QLGA 3ZFYA 2YIQA 5HO6A 4UALA 4B8LA 3RWQA 5EHYA 5BYZA 5TE0A 3TJDA 4EWQA 3BCEA 2I0EA 5CQWA 4B7TA 4OTPA 4FZ7A 4X6QC 3RALA 2R0UA 3BI6A 2GQGA 2RF9A 5ITAA 3COHA 5DH3A 3NW5A 1WMKA 2WTCA 2PVFA 3VS6A 4CV8A 3IW7A 2PVJA 3MI9A 3PJ3A 4Y5HA 4AW0A 3ORIA 2ZB1A 5KKRC 2SRCA 3MDYA 4MBJA 1DAYA 3QRUA 2PSQA 3OROA 1A48A 4C0TA 3EN4A 2EXEA 3KL8A 4QMWA 3TACA 2PMNX 4XV2A 5I5ZA 4AOIA 3CD3A 5IUHA 3AMYA 4FTQA 1W83A 4ONAA 2DQ7X 4PTEA 3EN7A 4O0UA 3BWJA 4PDYA 3LCDA 4DBNA 1WVYA 1I09A 4X0MA 5IU2A 1IAJA 2Y7JA 2BFXA 2FSLX 3ZUVA 4OTFA 2IZUA 3PE1A 4C34A 1OBDA 2VTPA 3V5PA 3AMBA 4H05A 5IH5A 5IA5A 1MUOA 2OFUA 3GOKA 3VUMA 3FXXA 3AD6A 3OBJA 5D12A 3F3TA 4YLJA 5EOBA 4FSZA 5JFVA 5C4LA 3BGQA 3MVHA 3CKWA 1Q62A 4K6ZA 4ALWA 5CU2A 5IQIA 2Z7RA 4Z3VA 2UZTA 5AV2A 4HGEA 3MPTA 4D4SA 1PF8A 5FEEA 3QRKA 2Y4PA 3JUHA 4MNEA 5TT7A 2F2CB 2CN8A 2J0KA 3BBTB 5IA4A 3CLYA 3ZH8A 5AM6A 2VTJA 4ZTSA 3DBEA 3UO6A 2FYSA 4GMYA 3G0EA 3OEFX 4FNZA 2Q0BA 4GYGA 2YM4A 4BZDA 5CU0A 3TM0A 4BCHA 2YCFA 3I79A 2V0DA 5L8KA 1XH7A 1YHVA 3BYOA 3BYMA 3A2CA 3G0FA 4II5A 2YWVA 3P7CA 2BAQA 3ANRA 3DT1A 3P86A 5JQ8A 3RPSA 1FMKA 4HCUA 5CXZA 4EH2A 4BDGA 4KD1A 4I22A 4K0YA 5AR3A 4BIDA 4RJ7A 3FQHA 4R6VA 5C27A 4QNYA 2CKPA 4IB0A 5LOHA 4R8QA 4FT9A 4RJ6A 4DF3A 4O7LA 5HG7A 2JD5A 3VWAA 3PJCA 1ZY5A 4IVAA 2RG6A 5EQEA 4FEXA 4O7RA 4A9TA 4WKQA 4QMMA 5TKDA 3NX8A 4HNFA 2X9EA 4G6NA 2QG5A 2HZ0A 2PVLA 4MVFA 4D2VA 5BUJA 5FRIA 3KVWA 3TJCA 2X7FA 5D41A 4FTLA 2B7AA 2E9VA 3QD4A 3OWPA 2C6TA 3BLHA 4UZDA 5L8JA 3ZLYA 3ZU7A 4KINA 4FC0A 3IW5A 5CU4A 5KX8A 3BHUA 1G3NA 1Q8YA 2R3QA 3EQRA 4KA3A 3HRBA 4RQVA 4C3RA 2VNWA 1OIRA 1YVJA 3BLRA 3PIZA 2BHEA 4IVBA 4G3EA 3NUYA 2C1BA 4ZY4A 3ODZX 5EHOA 3D0EA 4C58A 1VEBA 4QTCA 3QQJA 4U79A 5FM3A 4RZWA 3E92A 4GK4A 2ZV7A 3BLQA 5IQHA 4BTMA 1Y8GA 3I7BA 3MGYA 3MPMA 4L8MA 2HK5A 3ZO2A 1W0XC 3EKKA 5FTOA 3UPZA 2XZSA 4FSMA 5BNJA 1OI9A 3HMPA 4RRVA 4XV3A 1GAGA 2B9IA 3CP9A 4DHFA 4HW7A 3NGAA 3DXNA 1GJOA 3NW7A 4DEBA 3E8EA 1OIQA 4YZNA 2E9UA 5AUVA 4OTDA 3U51A 5E8YA 1J7IA 1SMHA 4YJVA 2X7OA 2YCQA 3H3CA 4WNKA 5DA3A 3VULA 2W0JA 4OAVB 1U46A 2W5BA 1YRPA 4YBJA 2JBOA 4FTIA 4IWQA 3QYZA 4L01A 3PZEA 5HHWA 3O23A 1HOWA 3A7IA 5G1XA 3P78A 4D1SA 5EFQA 2C30A 1P14A 3NIEA 2H6DA 3BE2A 4AXAA 4HYIA 3QTXA 3I0OA 3MV5A 5LVLA 5F9EA 3PA5A 2BMCA 2V7OA 3HRCA 4XV9A 1LPUA 4HVHA 4I4EA 3BEGA 3O51A 4QMNA 5CEMA 3WF8A 3PG3A 3HAVA 3ZMMA 3L9NA 5C8NA 5JFXA 2VV9A 4FG7A 5IQFA 3OY3A 3FZ1A 5M56A 3TI1A 3GOPA 3FC2A 4DG3E 2CGWA 4MXXA 5HBEA 4X2GA 3CC6A 2XKEA 3Q2MA 4IX6A 3RP9A 1CKPA 5L3AA 1KUTA 2UV2A 1MRYA 4L00A 4AN2A 4F9YA 5AUTA 2OF4A 5FLFA 4O38A 4MXAA 4E20A 5A6OA 2X6EA 4QMYA 5ICPA 2QOQA 5AMNA 1V0PA 1ZY4A 5C8MA 4E6AA 3GEQA 3HDMA 3QQLA 5BMMA 3MFUA 1REJA 4L42A 4C4JA 2ZB0A 1MQ4A 3EFWA 4XG9A 3U87A 4YR8A 1WBOA 5A9UA 3FZSA 2VTLA 4LG4A 4NTTA 2W99B 2RFNA 4JDHA 4DINA 5KE0A 3KRWA 3L9LA 3FZPA 4EH9A 2E9OA 5KMKA 2R5TA 3HDNA 3K3JA 3RI1A 3ZRKA 3UO5A 2QHNA 3WIKA 2P2IA 5AP0A 4MEDA 4FSQA 3A7JA 2WZJA 5ACKA 4D4RA 3DS6A 2UZWE 5A4QA 5L4QA 4OBQA 4O82A 4GKHA 3RMFA 2QVSE 5ETFA 5DFPA 3VNTA 2IVUA 4XH6A 2WTWA 3UQCA 5CASA 3MIAA 5HESA 4FKGA 5HO7A 3RK9A 2J7TA 4NWMA 5JN2A 2YERA 3TNQB 2Y6MA 4I4FA 1H28A 5GJFA 4ZK5A 4BHNA 2BVAA 2PUUA 4NT4A 1GZKA 2H8HA 3OHTA 3P08A 4DEHA 3QX4A 5H8BA 1SM2A 3CXWA 5EQYA 2UZDA 4F0GA 4R3CA 3EZRA 4FV0A 1H25A 3V04A 5JKGA 4USEA 2YCSA 2C0TA 3OBGA 2VWZA 2GQSA 4U40A 2NO3A 2E2BA 4Q5HA 3FMEA 3IECA 5IPJA 3TG1A 4G16A 4IADA 3LXNA 3HRFA 4EZ5A 3MESA 1QL6A 1E1VA 3QALE 3W2RA 4ACHA 4ASXA 3CKXA 2I0VA 3EFKA 4EC8A 1TKIA 2HXQA 3SXRA 2B52A 2GFCA 2XH5A 2Y0AA 4HOKA 5AR7A 5M51A 3HMOA 4L52A 1CMKE 1ZOEA 2GPHA 2FSTX 4I94A 4MXZA 4QMSA 3TN8A 4U81A 3ZCLA 5IDPA 3KCFA 3MH2A 1XHAA 3BKBA 4FV2A 2WMQA 5EDPA 3F2RA 3DBFA 5HX8A 3HP5A 5EDQA 4ZS0A 3V5JA 4EOOA 2YACA 2WU6A 3SQQA 4R1YA 1QCFA 3E88A 2RKUA 2VWXA 4DH5A 4UYAA 2PYWA 3IOKA 2C0OA 2XK3A 4QP6A 5FWKK 5B0XA 3S00A 4UX9A 3HX4A 3PA3A 2OJGA 3R7YA 1PXPA 2GCDA 4HYUA 4AE6A 4DTAA 5AAFA 4TTHB 4U3YA 5DNRA 5I3OA 3Q04A 4NM7A 3L9PA 1UKHA 4ZSJA 3ZDUA 4BDKA 4EHVA 4L43A 2JIVA 5E1SA 5E8SA 2O63A 2ITNA 3A61A 3EQCA 4F9BA 4ORKA 2WMTA 4J97A 3LFCA 4RC2A 2A1AB 4BICA 2WXVA 3JPVA 4XUFA 5I9VA 3R2YA 4R7IA 4EWHA 5K0XA 4I0TA 3R02A 2XKCA 5CALA 3F6XA
chains in the Genus database with same CATH superfamily
3R28A 2C4GA 4M69B 2J0IA 3QKMA 5H3QA 2UW3A 4M84A 5ANDA 4YMJA 5M55A 4ZTMA 3Q6UA 5KNJA 3M2WA 3F3WA 4J53A 3W2CA 5E92A 4UY9A 5EK7A 3QD3A 2HZ4A 3ZM4A 5EQPA 2WMRA 1OPJA 3QCYA 2PVHA 3O5AA 3WF7A 2YZAA 3HA8A 4S2ZA 5FP5A 4FTTA 1PMEA 4X2KA 4XLIA 3UOLA 4O7SA 4GEOA 4AOJA 3ZOSA 1Q24A 2HOGA 4U43A 2AQXA 3ACJA 3FAAA 4QMTA 5M06A 5CEPA 3TTJA 4RJ4A 1ZLTA 3O8TA 3KY2A 3K5UA 1OL7A 3NCGA 3D9VA 4DFXE 4RLKA 4FZ6A 3UG1A 3ZXZA 4FKUA 5TR6A 1B38A 3WZDA 4ARKA 4NSTA 4WOVA 2GFSA 3QQFA 4WBOA 3TT0A 4GFGA 2X2LA 2JDTA 3CD8A 4XMOA 3V5QA 3G2FA 2IEWA 2VU3A 3DK7A 3GBZA 4D9TA 1Q61A 2PK9A 3IG7A 3V8SA 3CQUA 4QQ5A 3MH0A 3OVVA 1PW2A 4BBMA 4YZDA 4XG3A 2VD5A 2FA2A 1BKXA 3P4KA 4Z7GA 4ZZOA 1V1KA 3Q9WA 3D4QA 4AT4A 5EYDA 1XBBA 3PIYA 2VN9A 1M14A 4JVGA 4D28A 3D2IA 3IK3A 3QLFA 3BL7A 3TYKA 3DBDA 5CF6A 5JGBA 4U5JA 3SLSA 4IVCA 4C33A 5CSWA 4DGGA 2DUVA 5DYJA 3EQDA 4GJ3A 4S32A 2BDWA 4F6SA 4RX7A 4GU9A 3BHVA 1U4DA 1XH8A 4BTKA 4WT6A 2XYUA 4FOBA 1XR1A 3RBWA 4DGOA 5J9LA 3W0PA 3SDJA 1J91A 2EWAA 3H0YA 3FQSA 2XBAA 3UGCA 3OXTA 1LEWA 3PVGA 4D4YA 3UNZA 3PPKA 2HXLA 2YFXA 4NFNA 5CYIA 5AV4A 4WBBB 1XMMA 4RVKA 4KIPA 3WBLA 5HD7A 5AR5A 5CNNA 3JR1A 1Y6AA 2PTKA 1Z57A 4O1PA 4CFWA 4GIIA 4O84A 1RDQE 3NIZA 4IHPA 4OGRA 4Q9SA 3W18A 3DXQA 1MQBA 3BHYA 2JFMA 3OCGA 3TKUA 4GCJA 3NNWA 5BVDA 4IAAA 5CWZA 4QP3A 4AW5A 4FTKA 3P5KA 4OTIA 5CSHA 5H2UA 4TYHB 2P0CA 2PE2A 3QGYA 3ALOA 4BDCA 4NFMA 5HD4A 3P0MA 3RTPA 5EHLA 3LKMA 3CY3A 2V22A 4JQEA 4IANA 4O4EA 4FKIA 3T9TA 1O6LA 3UIMA 4BDAA 3VS1A 4AU8A 4L44A 4FMQA 5LQFA 2A98A 3G15A 2W1DA 3GC9A 3W55A 4EEVA 1H1RA 1XH6A 4DLJA 3G9NA 3O0GA 2YDKA 2PUNA 4IAYA 1R39A 4FEQA 2JKMA 4I6BA 3R8LA 3QQKA 4DG0E 2C5XA 5C1QB 3F66A 4LUEA 2W7XA 1KE5A 3H30A 4IEBA 1SVEA 4K33A 3UODA 2UW6A 3CR0A 5IISA 3QU0A 2ONLC 4O0XA 3AGLA 2W1EA 3GFWA 3MJ2A 3DB8A 3OWKA 3P23A 5CVFA 4AN3A 1ERKA 2V62A 1JVPP 3ZC6A 1G8SA 3KXZA 5EM7A 5D1JA 2OJIA 2VO7A 3MH3A 4KWPA 4OTHA 1MRUA 5M57A 3U6HA 2IPXA 3ORMA 1KE9A 4EHZA 3G33A 5EM5A 3E8DA 2WTKC 4P4CA 3FJQE 2IVTA 4PNIA 1OPLA 2BRMA 3G9LX 1R3CA 3I81A 3PIXA 2O2UA 3NUPA 1HCLA 4DEDA 5K5NA 5A3XA 4CYJA 2OXDA 3FMJA 3LHJA 4IE9A 4IM3A 1BL6A 4WG5A 2P3GX 4M68A 5JMSA 4K2RA 3VC4A 4I3ZA 4ZMFA 2OZAB 1JAMA 3QCQA 4BDJA 2XK7A 2GNHA 2WMXA 3W2PA 4KRCA 3NWWA 3ORNA 2GNFA 4A06A 3ZTXA 5EM6A 4DHZA 3VBWA 5F94A 4JIKA 3DKOA 4OBOA 1JBPE 1BI7A 3PXQA 4GU6A 4MD9E 4A9SA 3PWDA 4J8NA 4R3PA 5CTPA 3PUPA 3TKIA 4N4SA 3DFCB 4GG7A 4NTSA 5AAGA 1ST0A 2XKDA 4CCUA 1JWHA 2YJRA 3FWQA 4EKKA 3HVCA 4JIAA 3SOCA 2YDIA 5HNIX 4FV6A 4IB1A 4BBFA 4BCNA 2IZSA 4RMZA 4AS0A 4C7TA 5CS6A 4ZJJA 4RFYA 3TV4A 2UZUE 1H07A 4AZEA 2WMBA 5IEXA 3ZBXA 5J95A 2BIYA 4IIRA 4S31A 4BGHA 1PRYA 3QF9A 4PTGA 4V04A 5HE1A 4CLJA 2B9HA 3FDNA 1W8CA 2GS7A 2R3GA 3P9JA 5AJQA 5DI1A 5EI2A 5HNGA 2HW6A 1MP8A 4EUTA 3BHTA 1Y57A 1PKGA 3GP0A 4IJPA 4KKEA 2CDZA 4CMTA 4FTUA 5M08A 3JS2A 4A7CA 4O0YA 1E1XA 4JQ8A 4FT7A 4HCTA 3ZEPA 5EI8A 4FICA 1VLRA 2XARA 3FMMA 2XIRA 4EOKA 4EOJA 4XV1A 3R01A 4OT6A 3R0TA 2WQBA 2KTYA 3AT2A 4LGHA 3DJ5A 1M2QA 3OEZA 2WNTA 4FIHA 3NW6A 1PHKA 1UWJA 1O6YA 4DFNA 4UZHA 3U6IA 1OKVA 2RIOA 4IM2A 1PXJA 5AR8A 2QO7A 4EBVA 3AT4A 4XJ0A 4FKOA 5AX9A 1U5RA 3EN5A 2PY3A 3Q9YA 2C3KA 2W4KA 3S0OA 1J3HA 4ZJVA 4NH1A 5HLWA 4LL0A 3C5IA 3ZRMA 4QEBA 5GINE 3GC8A 4QD6A 2X4FA 1KV1A 5FTGA 3RVGA 2YAAA 2BAKA 3F5PA 4RIOA 2IW9A 4F7JA 2G2FA 3AOXA 3NPCA 3G90X 5D10A 3ENHA 3NCZA 4E7WA 4M69A 3ZHPC 3NVKI 1M52A 2PVKA 4I92A 4D1ZA 5DEYA 4OT5A 5J87A 4EK5A 2CN5A 4FKJA 4O83A 2X4ZA 3LCOA 5CU6A 4Z16A 1IR3A 3BQCA 1PXOA 5IMEA 2OW3A 4IZ5A 4M3QA 4WNPA 1XKKA 4D5KA 3CTQA 2PVNA 2W9FB 5EW3A 3EIDA 1FGKA 3KF7A 2PVRA 3DBQA 3RK7A 4AN9A 3ZZWA 5C8KA 3GVUA 4DA5A 4PL5A 5HIBA 4R78A 3RHKA 2W4JA 3VBQA 4FVPA 3GU4A 3SX9A 4NKSA 4BKYA 4EK8A 4XG2A 2QOBA 2GMXA 4QDVA 4GSBA 2XJ2A 3N51A 2YLEA 4W8EA 4U45A 4XG8A 2BTSA 4TXCA 4X3FC 1KE8A 2IZRA 4F9AA 4MWHA 3F2NA 5B2LA 5HQ0A 2C5VA 4CCBA 2UZNA 2OJJA 3THBA 1PKDA 2ZVAA 3OG7A 2VWYA 1GZ8A 4GT3A 3ORPA 4L46A 4CQEA 4MX9A 4U8ZA 4A4OA 4DITA 3HV5A 3BE9A 4P2KA 5BVNA 3W1FA 2WHBA 3DA6A 4O4DA 4IDVA 5CI6A 2XNMA 3VAPA 3HEGA 1H0WA 3QTZA 2R3HA 3F82A 4JJRA 2XS0A 4MKCA 4W4XA 3ZDIA 4UMUA 4H3PA 2QR8A 5L2IA 3LFQA 4UEUA 3R7IA 4AACA 4B99A 4BIEA 2V5QA 4GRBA 4ID7A 3SVVA 1FVRA 1BYGA 4QO9A 3UMXA 4M14A 4Z55A 4XCUA 2IJMA 1JKSA 5L2WA 3NDMA 4AAYA 3TDWA 4Y83A 4DHJA 4KBKA 3QRTA 3PLAE 3F3UA 3QHRA 4BCIA 2CLXA 1WBVA 4Y5QA 2YM6A 3KXXA 2XNOA 3OFMA 3AC8A 2VZ6A 4FKTA 2ITYA 3HYHA 4E4MA 4O7ZA 5AR4A 2G2HA 3TV6A 3B2TA 2CNVA 4O22A 5HG5A 4FTOA 2JFLA 3VBTA 4QP7A 3CPBA 3P79A 2JDOA 1KSWA 3QGWA 5AA8A 3LMHA 1LUFA 1G5SA 3F88A 4O0SA 3ZFXA 5CF5A 2OICA 2QCSA 4YSMA 3LLTA 5LVMA 1IA9A 4CFFA 4D5HA 2OH4A 2CHLA 3M1SA 3GCSA 3LAUA 4C4IA 2ITPA 3VUHA 3D5WA 4M97A 3WZJA 4N57A 4KIQA 1L3RE 4QQCA 1ZWSA 4GYIA 3UO4A 2YITA 4TYHA 5LMKA 2WB8A 3WILA 1ZOGA 2BROA 1IRKA 2WELA 5H8GA 5L2QA 5ANIA 1OKWA 4OLIA 2H34A 3EFJA 3FLNC 3O8PA 4J99A 4WRGA 3HV7A 3QZGA 5IQBA 4XRLA 3F69A 4JNWA 5IDNA 3AD5A 4UXLA 3K3IA 3OOGA 5L8LA 4ZP5A 5FBNC 3N4UA 1WVXA 3BX5A 5FDPA 4ZEGA 2QG7A 3BU3A 4AA5A 4DCEA 1WBPA 4N70A 3F61A 3HV6A 4MTAA 2OG8A 4N0SA 4YZMA 3SC1A 4NIFB 5F95A 3JYAA 2QOHA 5EKOA 4FTAA 1VYWA 2VO0A 5DR6A 2WEVA 3SXFA 4BR3A 4B4LA 4DEIA 1H01A 1F0QA 3HMNA 2FVDA 4F9WA 3K5VA 1GOLA 1YXUA 2PU8A 3S4QA 3UZRA 3BWFA 4YJOA 4BDEA 4BCPA 2ZM3A 2ZV9A 2Y4IB 3H4JA 4MQ2A 2C5YA 3DQWA 4I5HA 4YTIA 3UC3A 4O7YA 1UVRA 2X9FA 4UYNA 4M13A 2VGPA 3NUSA 4PTCA 5CT0A 4EHEA 2PZ5A 1YI6A 5H8EA 5I9WA 2XKFA 3DY7A 3OD6X 3TUBA 3TNWA 4PX6A 4XX9A 5K0KA 1R1WA 4TL0A 5T3QA 3QKKA 1BI8A 1VR2A 1WBSA 5HVYA 2ZMCA 1W98A 3EN9A 2PVMA 4EH3A 4ERKA 3AD4A 5J5SA 3LCKA 2WTJA 3Q5IA 3WYYA 4IJ9A 3P7BA 3PY3A 1T46A 3T8OA 4QP8A 4EC9A 5M09A 3RCDA 1H27A 4YJNA 3RHXA 4NW5A 2ERKA 2ZMDA 3B8RA 4FIGA 4CKJA 4G31A 1ZXEA 4PPCA 4HVIA 3GC0A 5BQ0A 5LVPA 3CJGA 4BTFA 5DR9A 1PYXA 4O7WA 4EKLA 5D7VA 3ZXTA 1YHSA 3DQXA 2JIUA 5HU9A 1W2CA 4S34A 4J98A 3SHEA 5ETCA 4LV8A 3OC1A 3RJCA 5CSVA 2WO6A 5HI2A 4RJ8A 4Y46A 4FKVA 4JG7A 4MBLA 4PP9A 4BHZA 3WF6A 3NR9A 2YHVA 2YIYA 3CCNA 3R7VA 3WE8A 3LQ3A 3Q6WA 1H1PA 4O81A 4PF4A 3RM6A 4M15A 4DH7A 1OUYA 4PP7A 4O7NA 4PL3A 2WEIA 5EYCA 4CFMA 2R7BA 3TEIA 2W1ZA 3ALNA 5CEQA 3VQHA 3QTSA 2CGXA 2BZIB 4ZIMA 3R8PA 3TCPA 4W4VA 3FBVA 4LRKA 4YJSA 4YJTA 2J2IB 1YI4A 3CJFA 3E7VA 4CRLA 4ZTHA 2ITZA 2YABA 4UWYA 5KMMA 3FLWA 3PP1A 4PDOA 3MY1A 3PRFA 1P2AA 2JBPA 2W1FA 4TY1A 4RT7A 5JFSA 3QZHA 3NZ0A 4EH5A 3I4BA 4M66A 4C37A 3UIUA 3IGOA 4GT5A 2PUPA 2C5OA 2XCKA 3Q3BA 4I0RA 3ZO4A 5GZ8A 3WYXA 1KWPA 2YA9A 3GU5A 2ITQA 4CT2A 4QYYA 4EOPA 3AG9A 5HTBA 3UOJA 2B9JA 5ANJA 5FTQA 3ZSHA 2Q83A 3I6UA 4F6UA 4QMLA 4BI2A 3I5ZA 5AP3A 5HE0A 5EW8A 2YJSA 3HA6A 2JDRA 4JR3A 1L8TA 3PY0A 3U4UA 4RZVA 2V55A 3F2AA 3NYXA 5FM2A 4YBKA 2JLDA 3KRXA 2CGUA 4P7EA 3SOAA 3TNPC 4YLKA 3KXNA 1QMZA 4HNIA 4X21A 5DN3A 4L7SA 1Z5MA 4AOTA 2OIBA 4KS8A 4F9CA 4F7SA 3LMGA 3O71A 3PRIA 5I9ZA 2Y8OA 3RPRA 3TZ7A 4EJ7A 3ZC5A 2A2AA 3FZOA 5A4LA 1QPEA 3FI4A 4JDKA 2EB3A 3D7TB 2YN8A 3OTUA 4FL1A 3NYOA 3QCSA 4YC3A 4ANOA 4WUAA 2IN6A 2ZYBA 4FT5A 3RINA 4X7QA 3HP2A 4QP9A 1PXMA 4PMTA 3RAHA 4N6YA 4JG8A 4KBAA 4H36A 1V0OA 4ZSGA 4BDHA 1SNUA 3MWUA 4QPSA 3JXWA 3DDPA 5EI6A 2XAMA 2GHLA 2UZEA 2B1PA 2GU8A 3F7ZA 4L3PA 4ZLYA 4IZYA 4Y73A 2IVSA 4K77A 3DLSA 4EK6A 4RVTA 2VX1A 4RWLA 5AUUA 4NJDA 5BPYA 4FSUA 4FR4A 4I6HA 1YWVA 4YZBA 1DI9A 4IWDA 5IKWA 2GNJA 2VTAA 3FLYA 5AA9A 5CEKA 2HELA 2XALA 3OTVA 1JKLA 1H00A 4IZ7A 3D83A 4JAIA 1OGYA 3UQGA 3U9CA 3MSSA 1ZZLA 2QI8A 4U7ZA 3MPAA 4YZ9A 4BI0A 5KHXA 4BWKA 3FUPA 3NYVA 1YKRA 3BRBA 4DN5A 5HICA 1LP4A 5T68A 4CGAA 3KB7A 3DNEA 3GC7A 4RIWB 2I1MA 3U8WA 4QPAA 4CZYB 4BTJA 4RWKA 4YU2A 3VHEA 4Y8DA 5JEBA 3DFAA 5JRSA 4BDBA 2RSVA 4IC8A 1YI3A 4KS7A 4JBQA 4MBIA 3MN3A 4FNWA 4YJQA 3UP7A 5EH0A 4ZOGA 5BVEA 3I5NA 4O1OA 3AXWA 4LRJA 5TF9A 1PXLA 3AC1A 3LFBA 3NNXA 3R1SA 4J71A 3ZSGA 4BY9E 1UU8A 3A7GA 4ALVA 2ITWA 3W8LA 5DOSA 4P5ZA 2QD9A 4GUEA 2GS6A 2VTHA 3C4FA 3OWJA 2C6DA 4NK9A 4AX8A 4DTBA 4KNBA 4E6QA 2OF2A 3H9FA 2X8EA 3BYUA 3D94A 2VO3A 5E8ZA 3W2OA 1OBGA 2CKOA 2HZIA 3EQGA 2JC6A 4DH3A 5CAQA 2NNWB 1A06A 2BZJA 3PSDA 3R1QA 4MF1A 2C6LA 3O2MA 4Y72A 3V5TA 4D4VA 5JK3A 3F5XA 2JITA 3KXHA 4FYOA 1JPAA 3R2BA 4KSPA 4IMYA 4C2WA 4QMQA 4JQ7A 5CVHA 3DPKA 3G6GA 2AYPA 3MVJA 3E5AA 4FL3A 4BWPA 3NNVA 2OLCA 4IQ6A 3LPBA 5T6KA 5CX9A 1OECA 3Q53A 5B2MA 5KHWA 3F3ZA 1YXTA 5KKRB 4NM0A 5E8VA 3ZUUA 2BTRA 3D7ZA 3OT8A 1URCA 3UZPA 1OL1A 4EK3A 5GIOE 3AC4A 1OITA 1FINA 2ZV8A 4D2TA 2IVVA 3LFSA 4FSRA 4F64A 4ZY5A 4GL9A 5M4FA 4JR7A 3EL8A 3LJ0A 5CEIA 4ACMA 4YTFA 3F5UA 4YC8A 1NT2A 4YTHA 4FV8A 3TIZA 1JSUA 3FKLA 4LOOA 4G6LA 4MWIA 4WD5A 3BV3A 2WTDA 3UE4A 1E9HA 2XEYA 3M11A 2JAMA 3H9OA 4NIFA 5AWMA 4E4LA 3CS9A 3MVMA 2UW5A 4W9XA 2IG7A 3C0GA 4L53A 4OTGA 3MJ1A 2XCHA 3E7OA 5AR2A 1OIUA 4WA9A 4Q2AA 2C69A 4J96A 2P33A 2UZLA 3U6JA 1U5QA 3GCPA 4NZWB 4O2ZA 4KKHA 2XMYA 5L2TA 4W4YA 2BKZA 4R1VA 4BCFA 3R21A 1YXSA 3F7WA 4NJ3A 3EJ1A 4BGQA 4CFNA 3HL7A 3L8SA 4EYJA 1H1QA 3PJ1A 3R1YA 4RGJA 3QFVA 4ZTLA 4C3FA 4FI1A 3Q4ZA 3VUGA 5E9EA 5A46A 5AP6A 5DIAA 3ORKA 3OY1A 3EQPA 1HCKA 1UNHA 3GENA 3NUNA 4J8MA 3LXLA 5GZ9A 5BYLA 4U3ZA 2HWPA 5D7AA 4ZMEA 2YDJA 2ITTA 3LM0A 4EJNA 4ITIA 1IG1A 3I60A 5IA0A 1Q8UA 3LXKA 4AUAA 3OOMA 4HGLA 2G15A 2J5FA 3RZBA 2JKKA 4DGNA 4XOZA 4GFMA 4RBLA 1FPUA 5M44A 1RE8A 3KRLA 4CSVA 3Q60A 4BL1A 3FZRA 2YZLA 2QLUA 4WSQA 4MYGA 2RFSA 4LL5A 3KKVA 4JRVA 2OXYA 4FYNA 4G3CA 3ZLWA 4IFGA 5DT3A 3P5JC 2OKRA 3E8NA 2WQEA 2ETMA 3D5XA 4IACA 4XG7A 5KO1A 4WSYA 1H26A 4G5JA 5K3YA 3SA0A 4QP4A 3HAMA 2F57A 4RA4A 4AXCA 4M8TA 5DWRA 4ENXA 4NL0A 5I9YA 3V8TA 3FYKX 2I6LA 3SG8A 1XWSA 2GSFA 4GT4A 4I20A 3CGOA 4OW8A 5C03A 5JGAA 3O7LB 3PPJA 4RIXB 3ZM9A 5GJDA 4R77A 2XIZA 4K1BA 4ENYA 1JSTA 3I0QA 3SXSA 3VONA 5IMXA 2X1NA 2C3JA 3BZ3A 3OWLA 3MFRA 3A7HA 4MF0A 4D55A 1Q41A 3L8VA 1P4FA 3UTOA 3O8UA 4ANMA 3C4XA 3GU8A 1J7LA 2BKKA 2WD1A 2GNLA 1CM8A 5CENA 4YPSA 5KBRA 1UA2A 3MTFA 2LAVA 4QTEA 1XH4A 1KE7A 5D11A 2NRYA 2C3LA 3VS4A 3PVUA 5EDRA 3QXPA 2GNIA 2FH9A 4D2SA 1YXVA 4ZSAA 1IAHA 3FMLA 4IFCA 3ZFMA 1P5EA 5CXHA 2HW7A 4C57A 5LWNA 4GV1A 3I7CA 4XNEA 4NCTA 2HY81 3QKLA 4TNBA 5E1EA 4BJJB 1JSVA 2EXMA 2GTNA 4DEEA 2HYYA 5CSXA 2I0HA 4BCQA 3ET7A 4JX3A 2XNEA 5IQDA 4XOYA 2F49A 3R30A 3R8UA 2E9NA 5LWMA 4JG6A 4P90A 1NA7A 1ZRZA 2DWBA 4PRJA 4F7LA 4MQ1A 2PWLA 4JOAA 2W9ZB 2OIQA 4RWIA 1UU7A 4A4LA 1KV2A 2R2PA 2VTNA 2XVDA 3CTJA 3VO3A 4F1TA 3OCSA 3S3IA 5F20A 4FTRA 3E63A 3NUXA 3GUBA 4TWOA 4XG4A 4G9CA 4B0GA 1U54B 2YLFA 5C01A 4U0IA 3UJGA 3ULZA 4O0RA 3S2PA 1UKIA 5AIKA 3UVRA 3ORTA 2W1CA 3QC9A 3UNJA 5A54A 3FC1X 3NMUF 3D7TA 3PSCA 5HTIA 4TT7A 5LVOA 2J6MA 3D5UA 3HMMA 1K3AA 2J9MA 2BAJA 2BPMA 4KIKB 5HLPA 3QCXA 2O64A 3CQEA 4XG6A 4BB4A 4BIBA 4RSSA 3SAYA 3F9NA 4I6FA 2AUHA 1XBCA 2FSMX 3FMDA 3LFAA 4QTDA 3CY2A 3ZLSA 3LVPA 3ROCA 3RPOA 1PMVA 2PZIA 3GNIB 4PDPA 3BQRA 5G6VA 3O50A 3OZ6A 4UMTA 3FSKA 4GG5A 4O4BB 3A60A 5AV3A 1OUKA 4PWNA 4G17A 3UIBA 4LMUA 1DM2A 2QKRA 2ESMA 2Z8CA 5AUWA 4O7VA 5I3RA 3FL4A 4FKQA 2YIXA 2PMIA 5KBQA 3UVQA 4F7NA 3AC5A 4PY1A 5AV0A 4DBXA 2B9FA 3LOKA 4QNAA 4O7TA 4I41A 4USFA 1Q8TA 1SYKA 3C13A 3R00A 4UWCA 3W0OA 4KSQA 4GK3A 4AGDA 2FO0A 1YOJA 5DGZA 4C3PA 1TVOA 5CEOA 2A19B 4QYEA 4CG9A 2NPQA 2WFYA 2ITUA 3OUNB 2XB7A 4FV9A 4M7IA 3REPA 1APME 1XQZA 4DTKA 4ZAUA 4O86A 1QPDA 4L3JA 3VW8A 5A4TA 5JQ5A 1KOBA 3ITZA 1M7QA 4BWXA 4FIJA 4G1WA 4V01A 2CCIA 1JQHA 4NEUA 1XH5A 3QQUA 4FNXA 4TYIA 5GIPE 1ND4A 2WMVA 2R3OA 2YCRA 4B9DA 1YOMA 3BYVA 3U55A 2OJFE 4BDIA 3W32A 1Y8YA 3PYYA 3LM5A 3FPQA 1W2FA 4CYIA 3HUBA 2R9SA 4DEAA 3TWJA 4RIYB 2OXXA 5AFVA 2QOFA 3V3VA 3MBLA 4ZZMA 1TZDA 3LIJA 3CTHA 2VTIA 3W0RA 3EOCA 5IZFA 1RW8A 3CQWA 2I40A 2UUEA 2YEXA 2J90A 3PVWA 5CAPA 3FV8A 4FKPA 4C4EA 2F7ZE 2YAKA 3CIKA 2GTMA 4FV4A 3ZZEA 2NP8A 4C4HA 4FBXA 5BVKA 2QODA 4FKRA 1XBAA 2XBJA 4GKIA 3MVLA 5KZIA 4PPBA 3WF9A 1ZOHA 4MNEB 4AT5A 1SVHA 3A4PA 2RFDA 5K5XA 1ZYJA 3VUTA 4JXFA 2XUUA 4WIHA 4YUQA 2GHMA 3FHRA 3WIGA 3MB7A 4C35A 1GZNA 3DTCA 1UV5A 2X8DA 3C0HA 4IBMA 1JOWB 2WKMA 4YO6A 3V6SA 1BMKA 5JH6A 4BYJA 3VQUA 4QQTA 4EI4A 3LZBA 3P1AA 4DFLA 3QZFA 5IA1A 2FB8A 3WE4A 2WMSA 3BELA 3HLLA 4Q5EA 4I93A 5E7RA 2F7EE 4E5WA 5HOAA 4LI5A 4RPVA 3VUIA 3ZLXA 2R3KA 2WPAA 4CTBA 4CT1A 2G9XA 2VWVA 3QA8A 3U4WA 2F9GA 3L9MA 3ZBFA 4ACDA 5LCKA 5DT0A 4YHJA 1PMUA 2JKQA 5JFWA 2CKQA 4HVSA 2C1AA 2F2UA 3FHIA 3QL8A 4IAFA 5C26A 2X2KA 4I6QA 4Y85A 2WTIA 4CTCA 3IDBA 4FK3A 5M4CA 4QMXA 3V5LA 5HCYA 3W0SA 4ASZA 2J0MB 3N4TA 2FUMA 3QTRA 4AA4A 3AKJA 3MFTA 3OXIA 3KFAA 3Q9ZA 1STCE 4DHIB 4MUQA 2A0CX 2UW9A 3FPMA 1H24A 3KMWA 1REKA 5FEDA 3IPHA 3RWPA 3SV0A 3T3UA 1OMWA 3BU5A 4DFYA 1AQ1A 5CQUA 2VWIA 5FDXA 1OVEA 4USDA 3UOKA 5B7VA 2HZNA 2B55A 2BILB 4FTCA 1CTPE 4G3GA 5BVWA 5FQDC 3QX2A 1WZYA 1T45A 3MW1A 2O65A 3E3PA 4D1XA 5J79A 2OH0E 4BN1A 2PZRA 3ZEWA 5I0BA 2XYNA 3AMAA 4D2WA 4DFBA 5EYKA 5K4IA 1Q4LA 3CSVA 5TOZA 2VO6A 1NY3A 3FL5A 3Q52A 2BRBA 3W2QA 4MNFA 3A8XA 2O5KA 5FEQA 3EQFA 4RIXA 4QP2A 4KKGA 4M0YA 5EM8A 5ANGA 5IH4A 2XRWA 2BRNA 4IAZA 1CSNA 4APPA 4F1OA 2OGVA 4UWBA 5IUGA 1YW2A 4QMVA 1FGIA 5BMSA 3CBLA 2EU9A 2WIHA 2Z02A 3UDTA 4GVAA 2PUIA 2IZTA 2YISA 3UMWA 4AFEA 2AEGA 4O27B 3O17A 5L6WL 3AKKA 4Y95A 2OFVA 5E4HA 3M42A 4BVUA 5L2SA 1O6KA 3RKBA 1PY5A 4IX5A 3LJ1A 4NM5A 3TKHA 5BV3A 3SD0A 4YLLA 4E8AA 2C0IA 5D9HA 2IO6A 4K18A 5FXSA 3UC4A 2IW6A 4B6LA 2Z2WA 4IM0A 2ZJWA 2WQNA 2CSNA 4IVDA 4BJJA 5A4CA 1Q3WA 4GVJA 1BX6A 5EOLA 3KN6A 1H0VA 1KOAA 3C5UA 3KULB 3PXYA 4AFJA 3GCQA 5EW9A 1QPCA 2Q0NA 3VIDA 2VAGA 5KMNA 3DKGA 3NUUA 3HNGA 4D9UA 1OPKA 3TIYA 5HZNA 2O8YA 4YPDA 3BLAA 5DBXA 3DGKA 3D14A 3R8VA 2P4IA 2BIKB 5HIDA 4UN0C 2ZDTA 3R9NA 4E4XA 5IG1A 1M2PA 5GNKA 1K9AA 2W96B 4O21A 4F4PA 5BUEA 5DE2A 1U54A 4HYSA 3CGFA 4GUBA 2WTVA 4U42A 4YSJA 2FGIA 5KMJA 2CNUA 3GT8A 5HVJA 2X2MA 3W8QA 4AA0A 1F5QA 3KEXA 2QONA 3SRVB 4A07A 3FI3A 3KK9A 4CFVA 3GI3A 3ODYX 3KCKA 4X2NA 4EQMA 3KMUA 4HGTA 5CI7A 1LEZA 1PXKA 4KIKA 4V0GB 5AP5A 5HEZA 4D2PA 3VHKA 5J1VA 3COKA 1B39A 1W84A 4WG3A 4U41A 3Q4UA 3TUCA 4BKZA 2W1GA 4JDJA 2WTKB 4OTWA 3ZO1A 3NFFB 3BYSA 1JLUE 4FGRA