3MSSA

Abl kinase in complex with imatinib and fragment (frag2) in the myristate site
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
264
Chain Sequence
MDPSYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title Binding or bending: distinction of allosteric Abl kinase agonists from antagonists by an NMR-based conformational assay.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 264
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mssA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mssA01
4D4YA 3PXKA 3R7OA 1XBBA 4M97A 4FK6A 5EW9A 2UW3A 3W55A 3L8VA 3KC3A 3C13A 3IW5A 3LCDA 5BVNA 3ULIA 5JFVA 2XKCA 4D2SA 5LVMA 5L6OA 3UVPA 2PZ5A 4J53A 5CEQA 4C4FA 3F82A 5HCYA 4OT5A 5HCZA 4ZSAA 5EM8A 3FLZA 3W2OA 5IH4A 1GZNA 2B9IA 4QMYA 1PW2A 4EH3A 4QMMA 4BDFA 3SQQA 4OTDA 4BWXA 4PV0A 2B55A 3QU0A 2CNQA 4MAOA 2W7XA 4PL4A 4LG4A 3CBLA 3R02A 3KN6A 4XP3A 3SOCA 3GC9A 4ANQA 5KHXA 5FUTA 4FUYA 4EL9A 1OITA 4JDIA 3O96A 4FZDB 4RSSA 2PMIA 4CRSA 3C4XA 3I4BA 2BKZA 4XLVA 4XRLA 1ZARA 2G9XA 3R00A 4KKHA 4ZSGA 3WZEA 4CFVA 3TDVA 3TG1A 1BUHA 2OSCA 4HYIA 4R77A 4UZHA 2F7ZE 3FZPA 2C6KA 3UE4A 2XKFA 4J97A 4ZEGA 4L53A 3KN5A 4XG3A 5FBOA 4QPAA 3EQGA 4AOIA 4ZLZA 4X2FA 4O84A 5CXZA 4KRCA 4RC4A 5A4EA 4O0YA 4E73A 2H96A 3ZC6A 1GZ8A 3F2RA 4AF3A 1SZMA 1YI3A 2WOTA 2IZTA 4R8QA 1H25A 1Q8UA 2X8IA 4L3PA 1Y8YA 4O0TA 3VW8A 2CPKE 3RNIA 3DZQA 5DR9A 5HG7A 3NUXA 2JFLA 3TNWA 2XP2A 1U4DA 5DR6A 4LRKA 4EOPA 1YWNA 4L45A 2OJ9A 4UMQA 3RVGA 2R64A 2W05A 3WARA 3MVHA 1WBNA 4RX9A 5DR2A 4D9TA 2W96B 2PVKA 2E9PA 2IVTA 2IZSA 3GOKA 4KNBA 4WNOA 3P7AA 5BYZA 5C8NA 4JG8A 4GL9A 3SDJA 3ZZEA 4IB1A 3KRJA 2W99B 4X6QC 4CFMA 3TTIA 2BVAA 4PP9A 4IACA 4DC2A 4K6ZA 5HI2A 1CTPE 3R8ZA 4H3BA 2WGJA 3DKFA 4ASXA 4P7EA 5LCJA 3PG3A 1OI9A 1PXNA 3MFUA 4RQKA 3SW7A 3Q4CA 5KMJA 3K3IA 3F5XA 5HCXA 3MH2A 3PY0A 4EORA 2PPQA 2VU3A 5AADA 3KRWA 4IQ6A 1S9IA 5F9EA 3W2QA 3KMMA 4R6VA 4AS0A 2BROA 4AU8A 1IA8A 4XYFA 2VTSA 2C5VA 1LEWA 3FMJA 1H08A 4HVHA 4R7HA 2OLCA 4EOLA 5DBXA 1PYXA 3EYGA 3KRXA 4O7VA 2WKMA 5KE0A 2YWPA 4YO4A 1ZMVA 1SVEA 5J7HA 3LFDA 3V8WA 1NXKA 2PMOX 3ACKA 5A46A 3EHAA 3BHHA 3F69A 4GG7A 4IX4A 4J99A 5GNKA 3I1AA 2BAQA 5CU0A 3BIZA 1CMKE 4FIJA 4EH2A 4BKJA 2X4ZA 2WMXA 4LOPA 5HO6A 3PG1A 1XQZA 3FL4A 5K0KA 3ZONA 4BFMA 1ERKA 3NYNA 4GK4A 4XG6A 5LCKA 4GT3A 4AOTA 2RSVA 4TXCA 3UZPA 1XR1A 4YLJA 4EH6A 1M14A 2XNOA 4FK3A 4GT4A 4EH4A 5H2UA 2V7OA 3ZO1A 2XH5A 3IONA 2CGWA 3BGZA 2ETMA 2B52A 4ACDA 5J5TA 3ZBFA 3ATTA 2VWUA 4HGSA 2QOFA 3WOWA 4C2WA 5HO7A 1Q24A 4IAZA 4JDKA 4CV8A 3FMLA 4I6QA 1UU9A 4BL1A 5CT0A 3MBLA 3PP0A 4BCKA 5DYJA 3OUKA 1EH4A 2XNGA 4PMMA 3O8PA 2HK5A 1M52A 3G0FA 3TKUA 4JT3A 2JDSA 5L2IA 2X4FA 2X39A 4BCNA 3GU6A 5EKOA 2YITA 4XMOA 2F2CB 4XRJA 3NNWA 4U9AA 2ITVA 3L9LA 5LMAA 4EK6A 2FSTX 2P33A 3QQUA 5BQ0A 4DT9A 2GPHA 5HIDA 5A9UA 5HG5A 5EHYA 1ZWSA 4P5ZA 4PF4A 3QTZA 4BDDA 4I4FA 3TEIA 1UKHA 4D2WA 2V22A 5JT2A 4O0WA 4YJNA 2BDJA 3DFCB 4BGGA 4BRXA 2A4LA 2ITUA 4H3QA 3CTQA 1F3MC 2ZB1A 3PXZA 3E62A 4IC7A 2IO6A 1UU3A 4GVJA 5IQAA 4L42A 4G34A 1FPUA 4OTWA 1IR3A 3C4EA 3MA6A 5BMSA 4IZ5A 4O7WA 3UQFA 3KXHA 5M4IA 1OPKA 2J2IB 4BWPA 5EI2A 4K33A 5G6VA 3V5LA 4F1TA 4FEVA 3DKGA 2O8YA 3FZRA 4IANA 4ANNA 4E6AA 5GZAA 5AP5A 3IS5A 2JITA 1AQ1A 3DBDA 3E3PA 4TZRA 1A9UA 4HVDA 4QP3A 1W0XC 3NCZA 3SX9A 3LJ1A 4RWKA 4W4XA 4EEVA 3RALA 2HAKA 5J9LA 2UW4A 2VX1A 1R0PA 4BZNA 4MCVA 5CSPA 4C58A 4BY9E 1Q8ZA 4R3PA 2BZHB 2W1CA 4PQNA 4HPTE 2QHMA 2QOHA 3IW8A 3IW6A 1UA2A 5T68A 4E26A 3IKAA 3QD2B 1DS5A 3DZOA 1XH4A 3NIZA 4O0RA 3BYVA 1W82A 5AJQA 4EC9A 1Q8YA 4EKKA 2JGZA 3D0EA 3MVLA 1IRKA 4FSYA 3NWWA 2R3NA 4RC2A 4PMPA 1I09A 3N9XA 5CVGA 3ID6C 3SC1A 4WUNA 3V5TA 4YBJA 3VS7A 2C0OA 3Q2JA 1IA9A 2CN5A 2VN9A 4CG9A 4EH8A 4G6NA 4X21A 1Q41A 1PF8A 2X0GA 3VS6A 3PWYA 4E7WA 4M68A 5IMEA 4AW2A 2XIRA 5L3AA 4XH6A 4ZJIA 2IW8A 2F9GA 3UO6A 3FWQA 1U46A 2QO2A 3DK3A 3DB6A 5JMSA 5CY3A 2PE2A 2PTKA 4DG3E 1XH8A 3QGWA 4B6LA 4K0YA 4DHFA 4RIYB 3UMXA 1IAHA 2HZNA 4RGJA 2QURA 3VRYA 3W8QA 3A62A 5H8EA 1XH5A 4FTOA 2X7FA 3UOKA 2X81A 4BKZA 3LQ5A 3ITZA 4QMLA 5J79A 5AR2A 3COHA 4WNMA 2LAVA 1QL6A 2JAVA 1LEZA 4L46A 2GQRA 3T9TA 4RWLA 4ZIMA 4O6EA 2XS0A 4UXLA 3MW1A 1J91A 3ODYX 4ENXA 2JBOA 3DGKA 4I41A 5DG5A 4AN2A 2VNYA 4EK5A 5JK3A 4ITHA 1GJOA 4FKSA 4APCA 4P4CA 5ANJA 4FTJA 2QOIA 5LMKA 4CTCA 5FM3A 3SXFA 1Q62A 2FO0A 3UGCA 2JKQA 5ACKA 2XNMA 4UYAA 1YHSA 4CT2A 4BHZA 3OMVA 4TNBA 5D12A 5GJGA 3G9LX 4FV5A 4CZTA 4NTSA 4OBPA 2ITXA 4YHJA 5CXHA 4BDEA 5IU2A 3A2CA 3QC9A 1OIYA 2HZ0A 3MJ1A 5JN2A 3U54A 5IH6A 4QYGA 4UWYA 3TKHA 2YM4A 3CPBA 3ORZA 1WVXA 3NNUA 5I3OA 3ULZA 4IX5A 2WMUA 3BU6A 1ZRZA 3BI6A 1ZZ2A 2R9SA 5IEXA 3LIJA 4UZDA 3VQHA 3NMUF 5AP3A 3BHTA 2XZSA 4I21A 4OR5A 4RZVA 5CQUA 3OT3A 3IK3A 3NPCA 5ANGA 3TM0A 3I0OA 4IM3A 3W18A 3VS1A 5E4HA 2YIXA 3CY3A 4QMVA 1IASA 3TUDA 1E1VA 3DLSA 2UZBA 2XBAA 3PXFA 4FKJA 2PUNA 3A7HA 3ODZX 2QQ7A 4MF0A 3LFFA 1G3NA 4L9IA 4X2NA 3CR0A 5IQCA 3FAAA 5HTBA 2RG6A 2NP8A 2X2KA 4KRDA 4S2ZA 1KE5A 3EZRA 5L8LA 4E5WA 4BGHA 2VTJA 3A8XA 1QPEA 3Q6WA 3TCPA 4YZBA 4BI0A 5HLPA 3PIYA 3PP1A 4AGWA 3KK8A 4KINA 3OZ6A 3KRLA 3O0GA 3DJ7A 2W1GA 5K5NA 5LJJA 2JEDA 2ITZA 5KBRA 5JQ5A 2FYSA 4B7TA 3EFKA 1SNXA 4L7SA 4OUCA 3VHKA 5EHOA 5LMKC 4KIKB 2XCHA 3NUNA 1J7LA 2C3LA 5IQIA 4ZSJA 4F09A 3U9CA 2R7IA 4LFIA 4U41A 5HOAA 3K3JA 5HORA 5LMBA 1OKZA 3BQCA 1MRVA 4FKWA 5F4NA 2BRBA 3CJFA 4O1PA 3O50A 3DTCA 2G01A 5HVJA 2HZIA 3ZFMA 4EH7A 5BVEA 3ZUTA 4JJRA 3ACJA 4NJDA 3LKMA 2W4OA 5DE2A 3CEKA 4RWJA 2PE0A 5L4QA 4O7RA 3Q9WA 3HNGA 3HUBA 1WZYA 4AN9A 4UB7A 4YR8A 1NVRA 4P2KA 1Z5MA 3VS5A 4FTRA 3CD8A 5JFSA 4DEDA 2YDIA 4F7LA 5EH0A 3UOLA 4QMSA 4EJ7A 5AR8A 2IPXA 4DH7A 4QTBA 4QTAA 3TV4A 3RI1A 3QQJA 5CASA 3SKCA 1E1XA 4JVGA 3E8NA 1MRUA 3BEAA 2W9ZB 3WE8A 4D1ZA 2IVSA 3CP9A 3LMGA 4R1VA 2C0IA 3VUDA 3GT8A 3Q4UA 2OZAA 3MH3A 4XP0A 1WBSA 4GG5A 2WNTA 5ETFA 3V5WA 3R8PA 5HTIA 4FEWA 1R3CA 3QQGA 1Z57A 3JXWA 5F95A 4J71A 4FKRA 4O91A 1PMEA 1ZY4A 3V5QA 3H9RA 5EFQA 2WMQA 1BKXA 3AMYA 4ZTQA 3QRUA 1CKJA 3HRBA 4Z55A 4X7QA 4DA5A 4ACCA 4IJPA 1QPJA 3ZEPA 3NGAA 4ARKA 2ZYBA 3LFCA 1ZOGA 1KE7A 2XRUA 5GZ9A 4FNXA 4AA5A 3EN7A 3R7VA 5KMMA 3HMIA 2G1TA 3JPVA 4EOJA 5CF5A 4IZ7A 1P5EA 3D5VA 4WSYA 4BF2A 4F6UA 2OIQA 4I0SA 2PK9A 2YM5A 2EB2A 3QTWA 4FUXA 4EOIA 2XEZA 4FL2A 3CE3A 3IQ7A 4I94A 4TW9A 4FZAB 3GCPA 3R28A 1KSWA 2I0YA 4BBFA 4BICA 4FOBA 5C26A 4FEXA 2OG8A 2JC6A 2UV2A 3PXYA 4KA3A 4F99A 2XK9A 4N70A 2NNWB 4XG7A 4AZSA 3QD3A 4UMPA 5CAVA 5IDPA 4D5HA 2BALA 2F49A 5D9HA 4HVGA 1JSTA 3FXZA 4Z16A 2XMYA 3MVJA 3NNVA 3R1YA 2Z02A 2W1ZA 4FKOA 3ORXA 4W4YA 1DI8A 5HG8A 4I22A 1KOBA 1KOAA 4HYUA 3O71A 4LGGA 4RIWB 5AP1A 3RK7A 4AACA 5I9XA 3U6IA 1PRYA 2C30A 2YWVA 3AT4A 4YZ9A 2PZIA 5LOHA 2YDJA 3QTUA 2F4JA 4HZRA 4K9YA 3S4QA 3U6HA 3NAXA 1AGWA 1YWVA 3FMNA 4C3PA 4DH5A 4QP1A 2JFMA 2R3HA 3OCGA 4YJUA 1P4OA 4BCPA 5B2MA 4FKUA 3E7VA 4GMYA 3VVHA 5J1VA 5J1WA 3H4JA 3DNDA 3R1NA 4FIFA 2UVXA 4NKSA 4TNDA 4ASZA 4CYIA 3HV5A 3NYVA 3KK9A 4WSQA 3I0QA 1OUKA 2EVAA 2QD9A 3PSDA 4PPBA 4FF8A 4RJ6A 3ZU7A 3ZYAA 4BDIA 4C61A 4CMOA 3RGFA 3Q9YA 3DAKA 4KBCA 5HBEA 5BNJA 2DQ7X 1T46A 4E6QA 1W84A 3LFAA 5BMMA 4UALA 3ORTA 4O2ZA 3QRKA 3R9HA 4M12A 5BUJA 5FD2A 5HX8A 4II5A 2YJRA 3DDQA 3PLSA 4E1ZA 4QO9A 5M4UA 3PPZA 2PMLX 2XIYA 3EN4A 3D5XA 3FLNC 4I93A 4PDYA 5E8SA 3A4OX 2W17A 2XYNA 3UOHA 3GU8A 3UC4A 2QLUA 5HLNA 4GSBA 2CKQA 2IVUA 4MD9E 2BTSA 5H3QA 2BRMA 2VZ6A 3F3TA 4CMTA 2JAMA 5AUWA 4KS8A 3VUHA 2YCFA 2R3QA 3E93A 3E8EA 3HDMA 4JRVA 2VWXA 4YO6A 4I0TA 1W8CA 3NSZA 3N4UA 4RJ3A 4N6ZA 5TO8A 3FUPA 3FI2A 4EOOA 5I3RA 3FSKA 3QTIA 4EWHA 3LCOA 5GJDA 3OW3A 3MH0A 4HOKA 2WMTA 3ENMA 5HICA 4EYMA 4YJOA 4H39A 3OBGA 1KWPA 2B9JA 2YZAA 1O6LA 1SM2A 4EK8A 3VAPA 5AUTA 3QQFA 3RAKA 1SYKA 2JKMA 4FTIA 5L6WL 3TNQB 3BYSA 3D15A 4L67A 3VULA 4BWKA 4CD0A 1JAMA 4O7NA 1GIIA 3OXTA 3DKOA 2PVFA 3V51A 3RP9A 5KMLA 3FLQA 5AV3A 3BHVA 4XG8A 3RAWA 5L2WA 1BYGA 5JGDA 3FKOA 5BVKA 2QODA 3IW7A 3LFBA 1Y6AA 3BU3A 1GAGA 3ZBXA 1FQ1B 4FKVA 3NDMA 4RJ8A 3EYHA 4YJQA 2JDTA 4JQEA 3TL8A 4BIEA 5M55A 3ANRA 3P4KA 3UNZA 5F1ZA 3C4FA 3AC1A 3EL7A 4G6OA 5KZIA 5A14A 4OBOA 4DH8A 3OUNB 2W1FA 3Q2MA 3AC5A 5HX6A 1OECA 1BL6A 3QTRA 4FV6A 3TV6A 3WILA 4Y72A 2PWLA 3HP2A 3CQWA 3Q96A 3VBQA 4TTHB 4DCEA 3GENA 4M3QA 5DLSA 2RF9A 3D7TA 2GS2A 3C0GA 5K0XA 1G8AA 5IQHA 2B54A 3Q9XA 2CKOA 4TYEA 3Q6UA 2A2AA 4FKQA 4FZ7A 3NUPA 5L2SA 2GHMA 3Q4ZA 1JNKA 1YOJA 2FSMX 3CQEA 4FTKA 1YXSA 1H28A 1TQMA 2QC6A 4RX7A 3CIKA 3RHKA 1FMKA 4U40A 4OAVB 4ACHA 1MUOA 2C3KA 4DH3A 4MNFA 3R2YA 2ZV9A 5M44A 4C02A 5CEIA 5EQYA 3TV7A 2YA9A 1CM8A 3BBWA 4AFJA 4N4SA 3CS9A 4PTCA 4RRVA 1ZYSA 3P23A 3KVWA 3V6SA 3C51A 2OF2A 1YRPA 3RK9A 4IAAA 4WBBB 4GV1A 2VNWA 4MD7E 5ETIA 2OZAB 2QNJA 2WTCA 1H8FA 2O0UA 4RT7A 3O8TA 4QP6A 1LP4A 4E20A 3OT8A 2Y6OA 3C4CA 2HCKA 3QBNA 4IB0A 3H30A 4Q2AA 3ZFXA 4DTKA 4CRLA 1OB3A 3MPTA 5EYCA 4ENYA 1YXTA 2OW3A 4XNEA 2A19B 1J3HA 3PTGA 1GZOA 2XNEA 2EB3A 4R7IA 5C01A 3JS2A 4USEA 1W83A 3MY0A 5I9VA 5DNRA 1ZYCA 4WT6A 4F0IA 2IVVA 3KU2A 4IIRA 1A06A 1YOMA 5EI6A 2OXYA 1O6KA 5EDQA 4IC8A 2FSOX 3FPMA 4IZAA 1DAWA 5AV0A 3DA6A 4H58A 3REPA 3C50A 3MPMA 4MK0A 5DT3A 3VJOA 2V5QA 3CCNA 4YTCA 3EFWA 4QMUA 4QQCA 2C3JA 3RTPA 2UZOA 1URWA 3FDNA 2OXXA 4I1ZA 2FH9A 3DBFA 4IH8A 5A6OA 1NW1A 3LLAA 4EUTA 3OHTA 4G31A 4NFMA 4S32A 3SLSA 2WU6A 2I0HA 3R22A 2CLQA 3ENHA 4FR4A 2C1BA 4X3FC 5CSXA 4W9WA 4N57A 3FC1X 4Q9SA 3C0IA 1OIQA 1MP8A 4L8MA 5M53A 3HMOA 5EDPA 1KUTA 3TTJA 2Z7LA 1IAJA 1RJBA 2C4GA 2VTTA 3QUDA 2J4ZA 3BLHA 3KF4A 3T8OA 1OKYA 4WRGA 3VC4A 2J7TA 2WMRA 1CSNA 2EWAA 3R73A 5E8YA 3R9DA 3AMAA 2A27A 4HGEA 4JBPA 3IGGA 2R7BA 2P55A 1IEPA 4ITJA 3KY2A 4TL0A 5CAPA 4LUEA 5AX3A 4QRCA 4XBUA 3PVWA 1OL7A 3QCQA 5DRBA 3V3VA 3ZXTA 4DITA 1FINA 2R3GA 4O0XA 4QMQA 5IISA 3MY1A 4CKRA 3QF9A 4CFXA 4FZ6A 4JR3A 1ZMWA 5CZHA 4PWNA 4ZZNA 3MV5A 3C4WA 3CGOA 3MY5A 3DS6A 3ZC5A 5A4TA 3C7QA 3TXOA 5CX9A 3UJGA 2HIWA 1J1CA 4IX6A 3DBEA 4YTHA 5IA4A 3QGYA 4EBVA 3LPBA 4ZTSA 4K1BA 3W2RA 2WQMA 2FA2A 4EHGA 5AFVA 3AC8A 3OWPA 4NW6A 2VTOA 3QWJA 4N6YA 4QTDA 3CQUA 3EIDA 4ZZMA 3VO3A 3R9OA 4XV3A 2PUIA 2BZJA 3QKKA 3UBDA 4FSMA 2XEYA 3WZUA 4JR7A 3WYYA 1OPJA 5B7VA 2BHEA 4AT4A 5L2TA 1XKKA 1MRYA 2YIYA 3GEQA 2HWOA 4EZ7A 5DMZA 4FSRA 3GQIA 5I9UA 5CQWA 3DT1A 4OBQA 4YP8A 4FNZA 5L8KA 2I6LA 2XKEA 2UW7A 3A60A 2XNPA 3COIA 3D5WA 4FIGA 3BLQA 5IQGA 4H05A 2PVRA 5K4IA 3JYAA 2C47A 2WZJA 3AMBA 4F4PA 4C2VA 1PKGA 3FKLA 4BBEA 2OJFE 4UY9A 5I9WA 4D0WA 2HXQA 1FBNA 2YABA 3HMMA 5I5ZA 2VV9A 2WEIA 3UODA 4I5PA 1M2PA 2C5OA 3A61A 3EKKA 3EL8A 1OBGA 1Y8GA 3LW0A 4HVSA 2BHHA 3H9OA 5LWNA 1UWJA 3A7FA 3MN3A 4FT5A 3TNPC 3LJ2A 4GKIA 2HOGA 4BC6A 4FTAA 3R7EA 4ORKA 5EQEA 3HVCA 3VF8A 5EG3A 3HMNA 2IW6A 3PSBA 2CHLA 4Y73A 4NM5A 3QTQA 4QMPA 4OTGA 2VWWA 4BGQA 3ZRKA 4AT5A 4KUJA 2PU8A 4Y8DA 4BYJA 3TNHA 4GJ3A 3R04A 4CGAA 4CXAA 4FBXA 4LOOA 3Q32A 1PJKA 4L01A 3QFVA 3MS9A 2XB7A 4XBRA 5HE2A 4U5JA 5TF9A 4CTBA 3QALE 5JEBA 4M0ZA 3PA3A 2BPMA 5E8TA 4I24A 2VTAA 3BYUA 5DOSA 3U6JA 2GNGA 3GC0A 2EXCX 3E5AA 4JDHA 2W1EA 3U55A 2XUUA 2YCSA 3M42A 2EXEA 5LWMA 4IVAA 4LGHA 3GC7A 2W0JA 4FTLA 4NT4A 5FGKA 4I6BA 4PNIA 3VUIA 3OTUA 2EUFB 4EOMA 5CSHA 2C68A 1ZAOA 4C4IA 1VR2A 4TT7A 4FE2A 3D7TB 3F9NA 2C5NA 2OJJA 3G2FA 3Q53A 4QMNA 4KAOA 4TRLA 3OP5A 4I3ZA 2X6DA 3GI3A 1YDTE 3MSSA 5FDXA 4ALWA 1ZY5A 2KULA 2PE1A 4FEQA 3SRVA 2GSFA 4NUSA 4DFXE 4YNEA 5AUVA 2XK8A 3HA8A 5GIPE 4XP2A 5LARA 2YCRA 3G33A 4S33A 3ORIA 1ZLTA 4RVLA 3F7WA 3V8SA 4X3FB 2C6MA 3G0EA 4Y5HA 5CF8A 1F0QA 1PXOA 3CY2A 4TWPA 3PJCA 3F88A 1S9JA 3ORMA 3UG1A 3EFLA 5AIRA 4DTAA 3G9NA 3PY1A 3OVVA 4IVBA 1UNLA 2OICA 5L6PA 3SOAA 3MA3A 3PZEA 1JKTA 5HO8A 5I4NA 1RDQE 1FVRA 2WMSA 3QQKA 4C36A 2C5YA 2C1AA 3D7ZA 3F5PA 3HRCA 4XV1A 4B99A 1OBDA 2ZMCA 2Z8CA 4KD1A 4Q9ZA 3VBYA 2XRWA 3V01A 2IN6A 3RPSA 3ZOSA 2Y8OA 3O23A 3KFAA 4YUQA 3R21A 5CEOA 5D41A 3U9NA 2PMNX 4YZNA 1NVSA 5AAEA 5EM5A 3ZHPC 5AAGA 4E4NA 2GTMA 3F2NA 2AYPA 3HA6A 2OO8X 3QA8A 2ZMDA 1R1WA 4LGDA 3MTLA 3IOPA 4O0SA 3KCKA 4MTAA 3RKBA 1YHVA 3NUYA 5E8UA 3PJ1A 4MF1A 4MEDA 5FTQA 4EK4A 4UWBA 5KZ0A 4CG8A 2ZOQA 4HZSA 2WO6A 4KSPA 2VWIA 4IEBA 5A54A 3QL8A 1UU7A 2WPAA 2QLQA 4ALVA 4O7SA 3PA4A 4JG6A 4GYIA 4M69A 4FIIA 2DUVA 2GDOA 4RVTA 3I6UA 2FGIA 3TZ7A 4Z3VA 3SW4A 5HQ0A 3IDPA 4LMUA 5C4LA 4UMTA 5CU6A 5FEEA 3RM7A 3PRFA 3LOKA 1JKSA 4AZWA 3F6XA 2Y4IC 4F70A 2B53A 2GQSA 1HCKA 1BL7A 1WVWA 2R0UA 4ZTLA 4F1OA 1K3AA 2BCJA 4NIFA 4WBOA 2RIOA 2J0JA 3WZJA 4UYNA 3FI8A 1H01A 3ORKA 3SG9A 3U51A 2IZRA 3A99A 1J1BA 2XK4A 2VWYA 4U8ZA 2PY3A 4O0UA 5TR6A 3ZTXA 3V5JA 4BCGA 4R5YA 4EOQA 5IQBA 2WAJA 4XCUA 4J1RA 3BEGA 2C6TA 2BIKB 4IDTA 3VUKA 4BCFA 2XYUA 3F7ZA 1OL1A 2X7OA 1DI9A 1GOLA 2OJIA 3OCBA 4FOCA 4LQMA 5FTGA 4IAFA 5E1EA 5DPVA 5FDPA 4A9UA 1M7NA 3HAVA 1ZOEA 4WUAA 4F08A 4AX8A 1B38A 3K2LA 3PA5A 4FYOA 3R2BA 4ZMEA 1V0PA 2J0LA 1BI7A 1W7HA 4XS2A 5FXQA 4LL0A 4DGOA 1R0EA 4IWDA 5CU4A 3EQFA 5AV4A 2RL5A 5CAOA 5BUEA 4IZYA 4ERWA 3ALOA 5JGBA 1XHAA 5CYIA 2ETKA 3EZVA 4RMZA 5HEZA 4MXAA 3Q52A 1XH7A 3EWHA 2B1PA 3FJQE 4QP2A 5EOLA 5FBNC 2YACA 5D7AA 3R71A 3SVVA 2YN8A 2Y7JA 4FV2A 4DE4A 2PVMA 2SRCA 2JLDA 3EKNA 3V5PA 4KIOA 5M09A 3F3UA 1VYWA 3D5UA 3MIAA 3KULA 4QQ5A 4YJVA 5E8VA 3O7LB 4KABA 4NW5A 3NVMB 4EOKA 2E9VA 1YKRA 4AZVA 3UOJA 3UG2A 3GU7A 2JBPA 3GB2A 5HIBA 2PL0A 3ZSIA 2CGUA 4F9YA 5CI7A 4CLJA 3MESA 4TN6A 4C7TA 2VTPA 2VTNA 3CKWA 4ANOA 4ZXTA 2PZRA 3R8VA 4CFUA 4D2PA 3MFSA 3SV0A 3EQHA 4O96A 4TYHA 4E8AA 5ANEA 3LXKA 4YPSA 5T3QA 2HW7A 3QUEA 2WIHA 3D2IA 2ZM1A 2ITOA 4C8BA 4DEEA 4ZK5A 4EONA 4BZDA 2GTNA 5KO1A 3W2PA 2J0KA 1YOLA 3FI3A 3NR9A 3PZHA 5LVOA 3EQIA 3H0YA 3KVXA 1QMZA 4KIQA 4QMOA 3R9NA 5BYLA 4QP7A 5AWMA 3TZ9A 3MYGA 1OKWA 1OGUA 3GCVA 1OL6A 1H24A 2VWVA 3AC4A 4G5JA 4L68A 4CFNA 5J95A 4BI2A 1REKA 2HENA 3DQWA 3FZTA 3LE6A 5IEYA 2QO9A 2CCHA 3PJ3A 5CU3A 1FGIA 3SA0A 3FPQA 4D9UA 4EHVA 2WQEA 5ICPA 4WG5A 4O27B 4P5QA 5HVKA 4MBIA 3K5UA 2H8HA 3THBA 2R4BA 1Z9XA 3R8MA 2R3JA 4IHPA 4U3YA 4FICA 5CU2A 5JGAA 5M57A 4EUUA 1GIJA 4ZY4A 3PIXA 3DCVA 3VWAA 1OL5A 3F5UA 4FV7A 5K3YA 1Q5KA 1YI4A 1MQ4A 5CVFA 3O7LD 3U87A 1FGKA 4AN3A 3LM0A 2VX0A 5HTCA 1V1KA 2OK1A 4L6QA 4U42A 3VS2A 4DGGA 1JVPP 5IKWA 2A0CX 4FKLA 1TQPA 3R83A 3F3WA 3C1XA 3LJ0A 4JDJA 4JQ8A 2QCSA 3FE3A 4RA5A 2I0EA 4R1YA 3SRVB 4EZ3A 3D94A 4RQVA 5C9CA 5K5XA 2J51A 5I9YA 3QD0A 3BX5A 3I81A 5E8XA 3EOCA 3RMFA 5KHWA 1YW2A 1ZXEA 3MB7A 3RBWA 4MKCA 3QXOA 1PYEA 2Z60A 3CSVA 2Y4IB 3PFQA 2XA4A 3TZMA 1H1WA 3H10A 5GJFA 2ITYA 4RC3A 3RK5A 4B8MA 4K2RA 3OY1A 4NK9A 4EI4A 4PP7A 2BKKA 3E8CA 3QAME 4FV0A 4WKQA 4IX3A 4C33A 5I0BA 4D1XA 3W10A 1WCCA 3AGMA 3FLSA 2JDOA 5IA1A 4AA4A 4M15A 4ZY5A 2WQOA 4O7TA 3M2WA 2QHNA 4WNKA 2WEVA 3WF5A 4DGLC 3DXQA 2V55A 5JRQA 1BX6A 4ONAA 2UW8A 2DS1A 4FSWA 2J5EA 4IM2A 3TIZA 4ZTRA 4YTFA 2ITNA 3AT3A 2PZYA 3R30A 2B9HA 4K11A 4MH7A 3T3VA 3LAUA 4X2JA 3UQGA 4A7CA 5EKNA 1H27A 1FMOE 3NRMA 5CT7A 3UP7A 4V04A 3CGFA 4ZMFA 4PPCA 3ZSHA 3R7UA 4G1WA 5EYMA 3FC2A 3EQCA 2XNBA 5J87A 3VBXA 3UPXA 4I0RA 3UYTA 5CANA 2JIIA 5AP4A 3OEZA 3HDNA 4ALUA 4FV8A 4GFGA 4F7NA 2QOQA 4HW7A 3ZRLA 4AW0A 5TT7A 1CDKA 2JKOA 3A8WA 3P0MA 2ZB0A 3QUPA 4LUDA 1JPAA 3VBWA 1U5RA 2WTKC 3PY3A 1JLUE 4F9BA 4YLKA 2OJGA 3UTOA 4BCOA 3SXSA 2VUWA 2X7GA 1HOWA 4JI9A 5ETCA 4HPUE 4ID7A 4N0SA 4BDCA 4NH1A 4QPMA 2CLXA 3EN5A 3RPVA 3JY0A 3TJDA 5JSMA 4BDJA 4BCHA 3R1SA 4OW8A 1YXVA 1FVVA 2X2MA 3D9VA 4JOAA 4XOYA 5D11A 2YJSA 4C35A 5AUYA 4IMYA 1YHWA 4G2FA 4OTQA 5E9EA 3TKIA 4YMJA 3BPRA 2V62A 2YCQA 2VTHA 4NIFB 2VTIA 3RJCA 4ZTNA 4UV0A 4FT9A 4NEUA 4BR3A 2ITTA 5FLFA 5CS6A 5ETAA 2GNLA 2WTDA 4FSQA 4I5CA 5D1JA 3VF9A 4E4MA 5EOBA 2CNVA 5M51A 2NPQA 4BZOA 2I0VA 5AR7A 3ORPA 1U54A 3LVPA 2X2LA 4FMQA 4YNOA 5IPJA 3WBLA 2F57A 4CZYB 3R7GA 4C59A 5M4FA 4MXYA 4K77A 5AV1A 5C8MA 5KNJA 2QR8A 3ZO3A 1O9UA 4IBMA 3ZH8A 2X9FA 4WRSA 3WIGA 3GU5A 5FXRA 2ZDUA 4PNKA 2QO7A 3HV3A 2YM7A 1MQBA 4IAKA 2O63A 4JX3A 3KA0A 4NM7A 4RG0A 1M2RA 2XM9A 2JDVA 4D55A 4JAIA 2IJMA 3DK7A 4KKEA 4XEYA 1PKDA 3E88A 4CT1A 4BCMA 1XJDA 4ZZOA 2H9VA 2HY81 3POZA 3C4ZA 2HZ4A 4HNFA 2R3RA 4L44A 3ZDUA 2C6DA 4DFZE 4QMTA 4LI5A 5H9BA 3CLYA 2OH4A 2CN8A 1W98A 4ZTMA 4G3GA 3RNYA 2PVHA 5A4CA 4MX9A 3I79A 3OD6X 4FTTA 2E2BA 4PMTA 3UIXA 4KWPA 2O3PA 2W06A 2WU7A 4H3PA 4B0GA 1H1QA 3QRIA 3PVUA 4EYJA 3D83A 3BELA 5DIAA 5BPYA 5HZNA 3OW4A 3PJ8A 3LMIA 2G15A 2J6MA 2W4KA 1J7UA 4F6SA 1L3RE 2FSLX 2WTVA 3FBVA 3KGAA 3DDPA 2IW9A 5DI1A 1YWRA 4TYHB 5H8GA 4MQ2A 4XG2A 4C4GA 2YIQA 5DT0A 2UZNA 3VW6A 5JFXA 4RPVA 3EQRA 4U3ZA 3COMA 4IFGA 2R3FA 3HV6A 2UZDA 4W4WA 4BTKA 4AE9A 3FHIA 4WHZA 5JZNA 4DFBA 2VGOA 4E5BA 2J0IA 1NY3A 4WA9A 1GZKA 4YSMA 4Y83A 2IZUA 4PTEA 3DTWA 4FGBA 4FV9A 2Q83A 3EN6A 3FHRA 4BDGA 2UZVA 3EQPA 3ZXZA 4M66A 5KX8A 1WAKA 3QZHA 4DBXA 3MJ2A 3C5IA 5M07A 4FVQA 1JWHA 4D58A 4HYHA 4ACGA 5DEWA 2P2IA 2X9EA 3F61A 2VO0A 4AE6A 4BCIA 4DG0E 5HU9A 3LQ3A 2VO6A 3QX2A 5CNNA 5FXSA 2C6LA 1B39A 1WMKA 2YISA 4LMNA 1BLXA 5AP7A 4QP9A 4O0VA 5HU3A 3JVRA 2YLFA 4CVAA 1TQIA 4FKGA 5HHWA 2XM8A 2C6EA 3UC3A 2J0MB 2BILB 4PMSA 3RHXA 3OF0A 2RFSA 3FY0A 4UXQA 4F0GA 3GQLA 3S1HA 4B4LA 5HNIX 2WTKB 4FZFB 5LVNA 2FVDA 3ZLYA 1ZMUA 3V6RA 4E5AX 4HVIA 5HD4A 4M8TA 4UWCA 3ZS5A 4R3RA 4DBNA 4YBKA 5G1XA 5HESA 5M56A 4J95A 1HCLA 2CKPA 4AWIA 3PRIA 3E92A 3EFJA 4O7ZA 2P3GX 3QCXA 4FODA 2YM3A 4IAYA 4KIPA 3D2KA 2Q0NA 3EJ1A 5E1SA 4IWOA 3AGLA 2ETRA 1VEBA 3DFAA 4X2KA 3ETAA 2QR7A 3F3ZA 3FKNA 4E3CA 4FGRA 4GK3A 1O6YA 2R3KA 3R63A 3A4PA 2ITWA 1M7QA 2WB8A 5IUIA 2VTMA 2WELA 4BHNA 4ZSEA 4WIHA 3EH9A 4G9RA 5IQEA 2BR1A 2I7QA 2R3MA 3MI9A 4A9TA 4WO5A 3N51A 5AP2A 3BBTB 4AGUA 1KE8A 2O2UA 4G16A 2VWZA 4YHFA 4FKIA 1Y57A 3DU8A 3LM5A 1QCFA 1REJA 3WYXA 1UWHA 1SVHA 4U45A 3WZKA 5K4JA 4R7BA 5AR5A 2VAGA 3GNIB 3KCFA 3LCTA 4FNYA 3RPOA 2E9NA 2ITQA 3BGPA 3DY7A 1RQQA 2PHKA 4IWQA 2BTRA 4D28A 1P2AA 1OIRA 1JSUA 3ET7A 2BZIB 3GOPA 3V04A 4BN1A 3ALNA 1M17A 1WBPA 4MXXA 3O17A 3QYZA 2HXLA 3VN9A 3LMHA 3LFEA 1APME 3AD4A 4YSJA 4FNWA 4C38A 3UVRA 3FZOA 4FT3A 3ZSGA 2QG7A 3QLFA 4NJ3A 3NYXA 3E7OA 4Y5QA 2IWIA 5B0XA 2G2FA 4IB5A 3PWDA 3VS4A 4L7FA 4BIBA 3HL7A 4ASDA 5DWRA 5HE1A 5AP0A 2R3IA 3EMGA 5IA3A 4W4VA 2B9FA 4G6LA 3FQHA 4NCTA 4C57A 2WMVA 3GGFA 3RPYA 2ZDTA 2VTLA 3SHEA 4QMZA 4RVKA 4RJ4A 5LVLA 2ZM4A 5ITAA 4YZDA 3FMKA 2PVYA 4CFWA 4DTBA 4U0IA 2C69A 2GNIA 1U54B 4DINA 4E4XA 3ZDIA 3S2PA 3NW5A 4IE9A 1G8SA 2RG5A 3LFSA 3ZLXA 1QPDA 1GIHA 4DFUA 4ITIA 1H0WA 1JSVA 4RFZA 3BYMA 4A4XA 4MBJA 5DRDA 3UYSA 4FC0A 4UBAA 4O22A 2AC3A 1NVQA 3P78A 4FTMA 4HJOA 4AZTA 4ZOGA 3KREA 4K18A 4ZAUA 5HG9A 2CGXA 2GS6A 3GCQA 2HELA 3TACA 1SMHA 4GU6A 3UO4A 3N4TA 3AC3A 4LYNA 3VHEA 3EN9A 4AOJA 4D4SA 3GBZA 5LXMA 5B2KA 4Z7HA 3Q5ZA 1Q8WA 4FIHA 4BTFA 2Q0BA 4BTMA 2Y0AA 3N4VA 3PXQA 1YXXA 4JL9A 3O51A 4CQGA 3CC6A 4FYNA 3SD0A 3HYHA 3OROA 4OT6A 4RIOA 3RAIA 4CV9A 3F2AA 2VTRA 3P08A 3L1SA 4YJPA 3W33A 3GC8A 1KE6A 2UW9A 3HKOA 4J8NA 3BYOA 3DBQA 4LV5A 1ZYDA 5L8JA 5KCVA 4OTPA 3FQSA 4OAUC 3C9WA 4CFFA 3RCJA 3BV3A 5BVOA 2EU9A 4I20A 3DNEA 1J7IA 3LHJA 4UMRA 5DEYA 5AA9A 4O86A 5DHJA 4F6WA 4NM3A 4RIYA 2GNHA 4WNPA 4NCTC 2JDRA 4DEIA 2CKEA 3HRFA 3G6GA 3QHWA 1NT2A 4GCJA 5CENA 3C5UA 4I4EA 3S00A 2OI4X 5HD7A 4F9WA 5BYYA 3UDBA 3H3CA 3DXPA 2WOUA 2W5HA 4O6LA 5IDNA 5BVFA 5IUHA 5J5SA 5HVYA 3IO7A 3UO5A 3QRJA 5GINE 3AT2A 5AX9A 4A4OA 2YFXA 1QPCA 3GP0A 4AXAA 5E90A 4GW8A 1M2QA 2ZV8A 5HNGA 4Y95A 5AR4A 4TYGA 4MBLA 5DH3A 4LOQA 2YIRA 3QRTA 2VGPA 2ONLA 2WFYA 4DT8A 3JY9A 4YPDA 3A7IA 3TWJA 3QQHA 2UUEA 3W16A 4AZEA 2J90A 3A7GA 3MGYA 4EKLA 1V0OA 3DBCA 2P2HA 4O7LA 1BI8A 3BHUA 3HECA 3M11A 4GIIA 4I6FA 3KQ7A 3B2TA 4FSTA 4Q5HA 3NW6A 5M06A 5JFWA 1H07A 4GYGA 3WF7A 3MPAA 4IFCA 5T6KA 1Y91A 4X3JA 2BIYA 3POOA 1SNUA 4RJ5A 4BDHA 4CZUA 2YAAA 3FYKX 4P90A 1UKIA 3ZUUA 4M67A 5ANIA 1P14A 4LL5A 2I1MA 3COKA 3BKBA 3Q9ZA 3DAEA 4DCAA 4CLIA 4PX6A 4ACMA 4F9AA 3FYJX 3NYOA 4AGDA 3RWPA 3R8UA 3TUCA 3GXLA 4K8AA 4QT1A 1KV1A 2WXVA 4GUEA 4IADA 2J9MA 4IAIA 5CEPA 2QOBA 3HP5A 1DAYA 5CWZA 5HIEA 3ZRMA 3ELJA 4AG8A 3KB7A 4ANMA 3K54A 4ANSA 3DKCA 3EQDA 4FX3A 3HAMA 5C03A 2YHVA 2PVJA 3ZM4A 3U4UA 3BV2A 4A4LA 4CKIA 5HKMA 3UZTA 3OOGA 3I7BA 5DFPA 2WQBA 4D2VA 3DLZA 4Q5EA 2WHBA 4QP8A 4GH2A 1A48A 3QCSA 4APPA 4EQMA 2XJ2A 3GCUA 2ESMA 3LFNA 4BTJA 1OM1A 4YU2A 3ZFYA 3LXNA 3H9FA 4G3EA 4IXPA 4XV2A 4TPTA 4IM0A 2ACXA 3FLWA 4HYSA 4JXFA 4KB8A 1XO2B 5CI6A 1GY3A 3A7JA 2ONLC 3OS3A 4KIKA 3HEGA 2OF4A 4OTRA 4QTCA 5FQDC 3RINA 5FEDA 5JRSA 3P5KA 2HY0A 5FWKK 3SG8A 2XBJA 3CTJA 3FV8A 5FG8A 4BCQA 5LVPA 3GFWA 4NU1A 3BU5A 4RZWA 3W8LA 4DFYA 5CF6A 1WBWA 5JZJA 3ERKA 3Q4TA 5M08A 1G5SA 1P4FA 2W1IA 5BVDA 3LLTA 2GNJA 1WBTA 3NUUA 4L00A 2GHGA 3UNJA 3FMMA 4UEUA 5BX0A 5JKGA 3UPZA 4FSUA 2PVLA 4AFEA 3EQBA 3IOKA 3U8WA 4DFLA 2XCKA 2W1HA 4LV8A 1PY5A 4FKTA 5TKDA 3W2SA 4U44A 3W32A 3FZSA 1DM2A 2BZKB 2YM8A 4TWNA 4ZJJA 5IA5A 4GUBA 4NSTA 2QKWB 3B8QA 4RIXA 4W9XA 3NCGA 3PUPA 4ANLA 4F63A 2YLEA 4LRJA 2V0DA 3R6XA 4QYEA 4GT5A 3DJ6A 4IDVA 4RX8A 3BE9A 3BRBA 4V01A 1OKVA 5AIKA 5CNOA 1FOTA 3VUMA 4DEHA 5K9IA 5IQFA 4WG4A 4XLIA 4JRNA 3ZLWA 2Z7QA 5AP6A 3S3IA 4TYJA 4MD8E 2R5TA 2NRUA 3MH1A 3ZM9A 4U79A 5C4KA 2BDWA 5EYKA 4FKPA 2W9FB 4AZFA 2YIWA 1KE9A 3VS3A 2PVNA 4J7BA 4MXOA 3SXRA 4PTGA 3QA0A 3LCSA 3MWUA 4QP4A 4C4JA 5A4LA 2RFNA 5CTPA 2BDFA 5FTOA 2QOKA 3BWJA 2C3IB 1Q4LA 4Y46A 2G2IA 5HBHA 4BBMA 5ACBC 3BQRA 3QCYA 4EH9A 4EOSA 2REIA 4RFYA 5HLWA 4QYHA 3DK6A 4DAWA 3G90X 4CQEA 3QXPA 4MVFA 2CJMA 2GQGA 3P9JA 2LGCA 4O21A 3R9RA 2ITPA 4YGAA 4AQCA 5AA8A 1Q3WA 3KMWA 4G3FA 3PDTA 1PXMA 3FXXA 3CJGA 2XJ1A 3UIMA 4DEAA 2PUPA 2YERA 4YC8A 4FVPA 1WFCA 1ZYJA 4IVDA 4MWIA 5IA0A 4MXCA 5IG1A 2W1DA 3WE4A 5TE0A 4U7ZA 5IA2A 1H1RA 5BVWA 3PVGA 4HCVA 3FZ1A 4FI1A 5KUPA 3OWJA 4PUZA 4F9CA 2XVDA 1T45A 5E8WA 3RZFA 3NX8A 4J8MA 3WF6A 4BVUA 3UQCA 4UMUA 4M7IA 4FTNA 3OEFX 3MB6A 4DLIA 5BUIA 3NUAA 4U6RA 4RIWA 2XKDA 3L8XA 3MIYA 5AAFA 2WQNA 4CMUA 1OIUA 4AGCA 4FIEA 3R7IA 5FEQA 2VD5A 4GEOA 4WOVA 4B9DA 3UNKA 4O82A 1LUFA 3FLYA 4GKHA 3FEGA 1Q99A 2X8EA 4YJSA 4V0GA 4MXZA 2XK7A 4TY1A 3PPKA 3MDYA 5EHLA 3UMWA 3UP2A 3TUBA 4FL3A 3OWLA 3PSCA 4R5SA 4GRBA 5IQDA 3DPKA 3WI6A 2NO3A 4AT3A 3NUSA 3VS0A 4ANBA 4QOXA 2PSQA 3IPHA 4G3DA 2GS7A 5A3XA 2XNNA 3ANQA 4D2TA 1OUYA 3ORNA 1I44A 3OXIA 3TNIA 4F64A 4ZJVA 4CKJA 4S34A 2GMXA 2KTYA 4MNEA 3F66A 5IH5A 3TN8A 2XJ0A 4PDOA 4USFA 4J98A 2XIKA 3HV4A 3R01A 4I5HA 4JLCA 4XG9A 4IWPA 4XUFA 1OL2A 5GHVA 4TYIA 1H1SA 3LCKA 4JNWA 2ZV2A 2VRXA 2BUJA 4QD6A 2GCDA 3C0HA 2VWBA 4R3CA 2X1NA 1RE8A 3L9MA 4RBLA 4RWIA 2P0CA 3E63A 3OTVA 4EQUA 3GFEA 3WIKA 4BDKA 3KF7A 4KBAA 1URCA 2X6EA 2FB8A 3OCTA 4JAJA 4D4VA 5GIOE 3LZBA 3MTFA 3QTSA 1TVOA 2OWBA 3QWKA 3R7YA 4JX7A 2PUUA 4AUAA 4QQTA 2CGVA 4O1OA 1PXIA 2OH0E 3TI1A 5J9ZA 3AOXA 4CSVA 2UZTA 1R39A 1YDRE 2OFVA 1F5QA 2QOCA 1XBCA 1TKIA 3QLGA 4FV4A 5CSVA 4DYMA 3AXWA 2F7XE 4NTTA 4UX9A 5HBJA 4ZS4A 4WG3A 3CTHA 3HZTA 2ZAZA 4NFNA 3CD3A 5J8IA 2C5XA 4FEUA 3DB8A 3P1AA 1AD5A 3CXWA 1L8TA 3L8PA 4FA2A 4AW1A 2GU8A 4RVMA 5JH6A 4R78A 2BAJA 3DOGA 1JKLA 2WMAA 4U80A 4FVRA 4GFMA 3G15A 3EB0A 4WD5A 3QX4A 4A9SA 1H4LA 2BRHA 3O8UA 3ZO2A 4FG9A 4NKAA 4YHTA 5L2QA 1KV2A 2OKRA 4HGTA 4QMWA 5AUZA 4QTEA 4IJ9A 5CF4A 2YEXA 2ZVAA 3KEXA 3RPRA 4U81A 2Z2WA 2CMWA 2J5FA 2UVYA 4PDPA 3QKMA 1SVGA 2JKKA 2XIXA 4L3JA 2HYYA 5HNBA 4YURA 4NYEA 1VJYA 3VUGA 4AA0A 1YI6A 4G17A 5J9YA 5CSWA 3TIYA 4A9RA 1VZOA 1PMNA 3D14A 2B0QA 5EYDA 3PE2A 4L43A 2QU5A 2Z7SA 4USDA 2OZOA 4OTIA 4PRJA 4JIKA 5FM2A 3BLRA 2R0IA 4EH5A 4DG2E 4BIDA 4JQ7A 4C37A 5CAUA 3O2MA 2CNUA 3S95A 4E4LA 4C34A 2UZWE 4FG8A 5CALA 2VX3A 2B4SB 3ZMMA 4F7JA 4OLIA 2GNFA 4RX5A 2H6DA 3S0OA 4F0FA 2V7AA 1YDSE 3M1SA 4I23A 3TDWA 2QVSE 2JIUA 4QYFA 2WTJA 3G51A 2E9UA 3U4WA 2VO7A 1LPUA 4FL1A 4M13A 2C6IA 4RIXB 4GU9A 3I5ZA 1PXPA 1K9AA 4QYYA 3ZO4A 1OPLA 3RWQA 4KS7A 4A06A 2ZJWA 4ZLOA 4GK2A 4H36A 5KMOA 3T9IA 1YQJA 1PXJA 4PL5A 5AV2A 3NS9A 3BZ3A 4YZCA 3BWFA 1IG1A 5I9ZA 3D4QA 4JBQA 4NZWB 4M69B 5DGZA 3E8DA 3QYWA 5CLPA 2UZLA 1ZOHA 3VUTA 2HW6A 4AW5A 4CYJA 3AG9A 5AM7A 5F20A 1ZZLA 2B7AA 4FTUA 4EC8A 1PMUA 1Q61A 5B2LA 5KMNA 5DN3A 2G2HA 4I92A 3KXZA 2R3PA 4AP7A 4M84A 4ZY6A 1WVYA 1FVTA 4C4EA 4EQCA 3I60A 2QG5A 2DWBA 4XJ0A 3OBJA 4DH1A 4C3FA 4B8LA 5CEMA 1B6CB 2UW6A 3GVUA 2O64A 3NEWA 4M0YA 4GFOA 4E6DA 1XH6A 2QI8A 2GFSA 4E93A 4YC3A 3NAYA 3PYYA 3ZCLA 4KBKA 2CCIA 1XBAA 3PVBA 1V0BA 4FG7A 3KXXA 4X2GA 1Q8TA 4I6HA 3CKXA 4GS6A 4KSQA 2Y9QA 4XG4A 1XWSA 2YDKA 3AC2A 1JOWB 3Q04A 3DV3A 3UVQA 4KKGA 4AAAA 4OTFA 3G6HA 4ZSLA 4V05A 3OOMA 3PLAE 4RA4A 3VNTA 4FV3A 1STCE 1CKPA 2I40A 3L9NA 3JR1A 2OIDA 3W2CA 2UZUE 4PY1A 3TZ8A 3NIEA 2QOLA 3P86A 3RCDA 3FY2A 5AR3A 1PXLA 2YAKA 3NZ0A 5EK7A 5FP6A 3IECA 3BE2A 1JQHA 4F7SA 3PXRA 4RLKA 2ZV7A 3IW4A 5AMNA 4ASEA 4XV9A 4EHZA 4QNAA 4JBOA 4EHEA 3P7BA 3HV7A 3OCSA 4YTIA 4C3RA 2UW0A 3QHRA 4L52A 5AM6A 4RJ7A 3AQVA 2C0TA 4L3LA 1LR4A 2PULA 2Y4PA 2BMCA 2WIPA 3B2WA 4JG7A 4DGNA 4V0GB 3FSFA 2OXDA 3KKVA 5JQ8A 5DVRA 1Q97A 4ZP5A 5E91A 3DAJA 1H1PA 5HE3A 3E64A 3KULB 3W1FA 3ZEWA 4A07A 2C6OA 4DLJA 2W5AA 4PDSA 1OMWA 4U97A 5E8ZA 3MFRA 5KKRC 3OG7A 5EDRA 4BDAA 4GJ2A 3P7CA 3DQXA 4FTCA 2IG7A 1U59A 4EWQA 3R1QA 4S30A 4X6RA 4FT0A 5EI8A 5EM7A 5AUUA 5C27A 4QQJA 3VRZA 3CPCA 3OC1A 2ZM3A 3FMDA 3G5DA 2RGPA 4F65A 4OTHA 4D2RA 2F7EE 4JS8A 2WMBA 3BHYA 4MNEB 2BRGA 1R78A 3ZLSA 2Y6MA 3WZDA 5KMKA 3ATSA 2E9OA 1OZ1A 2UW5A 3FQEA 3PE1A 5ANOA 4DFNA 5E92A 4D1SA 4LM5A 1K2PA 3II5A 4CCUA 2QONA 4DEBA 4TKSA 4UN0C 5CEKA 2OBJA 2YZLA 3LXPA 3NNXA 4FT7A 2PZPA 4MQ1A 3V8TA 4EBWA 1Q3DA 2OFUA 4MYGA 4G9CA 4XHKB 3MVMA 4M14A 3RAHA 3GU4A 1PXKA 2VTQA 2P4IA 2WTIA 5HE0A 4C0TA 3R0TA 5IZFA 3I5NA 5M4CA 5GZ8A 3I6WA 3DJ5A 3HUCA 4JIAA 4YJRA 4E6CA 4QPSA 1PHKA 3LXLA 4W8EA 4ERKA 2AUHA 4ZTHA 3BGQA 2JD5A 4D5KA 1Y6BA 4EJNA 3PIZA 3E3BX 3QZFA 4DEGA 3VBTA 2BFYA 1JKKA 5CVHA 4BCJA 5IEVA 4FSZA 1GNGA 2RFEA 4GIHA 5KBQA 3HGKA 4IW0A 1NA7A 5A4QA 2R2PA 1H0VA 3RZBA 3ORLA 4CNHA 3KXNA 1RW8A 3UIBA 3LFQA 3NW7A 5EW3A 3FMEA 5IUGA 2AC5A 3JUHA 1OVEA 3IDBA 4G3CA 3OWKA 2F2UA 3F5GA 4HCTA 3Q3BA 5CZIA 3Q5IA 2WTWA 4QNYA 5KMIA 3Q60A 4J96A 4JBVA 1ATPE 2RFDA 2OGVA 2UZEA 1PMVA 4FV1A 2Z7RA 3IG7A 2QU6A 4MWHA 4NWMA 4Y85A 4BYIA 3SGCA 4H1MA 1UVRA 3VIDA 4YZMA 5J7BA 3H0ZA 3PPJA 5EQPA 4MHAA 3VJNA 3HLLA 3HX4A 2DYLA 2JIVA 3KRRA 4RLLA 5HGIA 4BDBA 5CAQA 4GVAA 4H1JA 5AEPA 3R8LA 3QZIA 4O2PA 3B8RA 2H34A 4A9YA 3RM6A 4J52A 4ZLYA 4G5PA 5C1QB 4YLLA 2ERZE 5E7RA 3T3UA 4D0XA 4C62A 2O65A 3AD5A 4XX9A 1VYZA 3ROYA 3OFMA 4QMXA 3IDCA 3BCEA 4HGLA 4IB3A 3VBVA 3SAYA 2YM6A 3HMPA 2W5BA 4IVCA 1E9HA 1X8BA 3QC4A 3FI4A 2RKUA 1U5QA 4OGRA 5AUXA 2HWPA 2BRNA 5IF1A 2GHLA 3DXNA 4XOZA 5DT4A 4DN5A 3K5VA 3L9PA 1UV5A 3QKLA 1WBVA 3NVKI 2NRYA 3E87A 4PL3A 3AD6A 3OXZA 4DGMA 3FXWA 3GCSA 4FTQA 4HCUA 4U43A 5D10A 5EW8A 2CSNA 1CKIA 2BFXA 3TJCA 2R3LA 1UNGA 1BMKA 4X0MA 4O81A 5ANKA 4C4HA 1UU8A 3OY3A 2UVZA 4I5MA 2VO3A 5LQFA 3VQUA 4EK3A 4ZS0A 4D4RA 4X3FA 4F1MA 3ZZWA 2FUMA 4O83A 2A1AB 2XF0A 5A6NA 4DF3A 3L8SA 3TT0A 4PPAA 4HNIA 3LQ8A 5D7VA 3FMHA 5EM6A 3WF9A 1JBPE 5FRIA 3FL5A 5ANDA 1ND4A 2OIBA 4O38A 3QTXA 4BB4A 5DA3A 1UNHA 2O5KA 3IGOA 4NL0A 4S31A 3QQLA 3P79A 5FP5A 2WMWA 3F3VA 4CEGA 4RFMA 2PYWA 4LRMA 1H00A 3ROCA 4YJTA 1WBOA 2CDZA 2OU7A 4NM0A 5H8BA 4CCBA 3UZRA 2QKRA 3KXGA 2BAKA 4Z7GA 2GFCA 5KKRB 4O7YA 3NLBA 2ERKA 4EZ5A 4W8DA 1YVJA 5C8KA 4TWOA 2R3OA 5F94A 2EXMA 1YXUA 1XH9A 1ZYLA 5TOZA 3KMUA 3QZGA 2XIZA 2XK6A 2QOOA 4Z9LA 3PJ2A 3ZUVA 2W4JA 3QD4A 3GUBA 4BKYA 4YC6A 1H26A 4BI1A 3I7CA 3UIUA 2WD1A 5IMXA 2J50A 4FSNA 4TWCA 2XK3A 3KXMA 3KL8A 3WF8A 3MFTA 3JVSA 2X8DA
chains in the Genus database with same CATH superfamily
4D4YA 3PXKA 3R7OA 1XBBA 3TMOA 4M97A 4FK6A 5EW9A 2UW3A 2A98A 3W55A 3L8VA 3KC3A 3C13A 3IW5A 3LCDA 5BVNA 3ULIA 5JFVA 2XKCA 4D2SA 5LVMA 5L6OA 3UVPA 2PZ5A 4J53A 5CEQA 4C4FA 3F82A 5HCYA 4OT5A 5HCZA 4ZSAA 5EM8A 3FLZA 3W2OA 5IH4A 1GZNA 2B9IA 4QMYA 1PW2A 4EH3A 4QMMA 4BDFA 3SQQA 4OTDA 4BWXA 4PV0A 2B55A 3QU0A 2CNQA 4MAOA 1ST4A 2W7XA 4PL4A 4LG4A 3CBLA 3R02A 3KN6A 4XP3A 3SOCA 3GC9A 4ANQA 5KHXA 5FUTA 4FUYA 4EL9A 1OITA 4JDIA 3O96A 4FZDB 4RSSA 2PMIA 4CRSA 3C4XA 3I4BA 2BKZA 4XLVA 4XRLA 1ZARA 2G9XA 3R00A 4KKHA 4ZSGA 3WZEA 4CFVA 3TDVA 3TG1A 1BUHA 2OSCA 4HYIA 4R77A 4UZHA 2F7ZE 3FZPA 2C6KA 3UE4A 2XKFA 4J97A 4ZEGA 4L53A 3KN5A 4XG3A 5FBOA 4QPAA 1TFFA 3EQGA 4AOIA 4ZLZA 4X2FA 4O84A 5CXZA 4KRCA 4RC4A 5A4EA 4O0YA 4E73A 2H96A 3ZC6A 1GZ8A 2ZFYA 3F2RA 4AF3A 1SZMA 1YI3A 2WOTA 2IZTA 4R8QA 1H25A 4AXFA 1Q8UA 2X8IA 4L3PA 1Y8YA 4O0TA 3VW8A 2CPKE 3RNIA 3DZQA 5DR9A 5HG7A 3NUXA 2JFLA 3TNWA 2XP2A 1U4DA 5DR6A 4LRKA 4EOPA 1YWNA 4L45A 2OJ9A 4UMQA 3RVGA 2R64A 2W05A 3WARA 3MVHA 1WBNA 4RX9A 5DR2A 4D9TA 2W96B 2PVKA 2E9PA 2IVTA 2IZSA 3GOKA 4KNBA 4WNOA 3P7AA 5BYZA 5C8NA 3NFGB 4JG8A 4GL9A 3SDJA 3ZZEA 4IB1A 3KRJA 2W99B 4X6QC 4CFMA 3TTIA 2BVAA 4PP9A 4IACA 4DC2A 4K6ZA 5HI2A 1CTPE 3R8ZA 4H3BA 2WGJA 3DKFA 4ASXA 4P7EA 5LCJA 3PG3A 1OI9A 1PXNA 3MFUA 4RQKA 3SW7A 3Q4CA 5KMJA 3K3IA 3F5XA 5HCXA 3MH2A 3PY0A 4EORA 2PPQA 4I6LA 2VU3A 5AADA 3KRWA 4IQ6A 1S9IA 5F9EA 3W2QA 3KMMA 4R6VA 4AS0A 2BROA 4AU8A 1IA8A 4XYFA 2VTSA 2C5VA 1LEWA 3FMJA 1H08A 4HVHA 4R7HA 2OLCA 4EOLA 5DBXA 1PYXA 3EYGA 3KRXA 4O7VA 2WKMA 5KE0A 2YWPA 4YO4A 1ZMVA 1SVEA 5J7HA 3LFDA 3V8WA 1NXKA 2PMOX 3ACKA 5A46A 3EHAA 3BHHA 3F69A 4GG7A 4IX4A 4J99A 5GNKA 3I1AA 2BAQA 5CU0A 3BIZA 1CMKE 4FIJA 4EH2A 4BKJA 2X4ZA 2WMXA 4LOPA 5HO6A 2NYAA 3PG1A 1XQZA 3FL4A 5K0KA 3ZONA 4BFMA 1ERKA 3NYNA 4GK4A 4XG6A 5LCKA 2IF8A 4GT3A 2RSVA 4AOTA 4TXCA 3UZPA 1XR1A 4YLJA 4EH6A 1M14A 2XNOA 4FK3A 4GT4A 4EH4A 5H2UA 2V7OA 3ZO1A 2XH5A 3IONA 2CGWA 3BGZA 2ETMA 2B52A 4ACDA 5J5TA 3ZBFA 3ATTA 2VWUA 4HGSA 2QOFA 3WOWA 4C2WA 4DHJA 5HO7A 1Q24A 4IAZA 4JDKA 4CV8A 3FMLA 4I6QA 1UU9A 4BL1A 5CT0A 3MBLA 4F78A 3PP0A 4BCKA 5DYJA 3OUKA 1EH4A 2XNGA 4PMMA 3O8PA 2HK5A 1M52A 3G0FA 3TKUA 4JT3A 2JDSA 5L2IA 2X4FA 2X39A 4BCNA 3GU6A 5EKOA 2YITA 4XMOA 2F2CB 4XRJA 3NNWA 4U9AA 2ITVA 3L9LA 5LMAA 4EK6A 2FSTX 2P33A 3QQUA 5BQ0A 4DT9A 2GPHA 5HIDA 5A9UA 5HG5A 5EHYA 1ZWSA 4P5ZA 4PF4A 3QTZA 4BDDA 4I4FA 3TEIA 1UKHA 4D2WA 2V22A 5JT2A 4O0WA 4YJNA 2BDJA 3DFCB 4BGGA 4BRXA 2A4LA 2ITUA 4H3QA 3CTQA 1F3MC 2ZB1A 3PXZA 3E62A 4IC7A 2IO6A 1UU3A 4GVJA 5IQAA 4L42A 4G34A 1FPUA 4OTWA 1IR3A 3C4EA 3MA6A 5BMSA 4IZ5A 4O7WA 3UQFA 3KXHA 5M4IA 1OPKA 2J2IB 4BWPA 5EI2A 4K33A 5G6VA 3V5LA 4F1TA 4FEVA 3DKGA 2O8YA 3FZRA 4IANA 4ANNA 4E6AA 5GZAA 5AP5A 3IS5A 2JITA 1AQ1A 3DBDA 4FRFA 3E3PA 4TZRA 1A9UA 4HVDA 4QP3A 1W0XC 3NCZA 3SX9A 3LJ1A 4RWKA 4W4XA 4EEVA 3RALA 2HAKA 5J9LA 2UW4A 2VX1A 1R0PA 4QEBA 4BZNA 4MCVA 5CSPA 4C58A 4BY9E 1Q8ZA 4R3PA 2BZHB 2W1CA 4PQNA 4HPTE 2QHMA 2QOHA 3IW8A 3IW6A 1UA2A 5T68A 4E26A 3IKAA 3QD2B 1DS5A 3DZOA 1XH4A 3NIZA 4O0RA 3BYVA 1W82A 5AJQA 4EC9A 1Q8YA 4EKKA 2JGZA 3D0EA 3MVLA 1IRKA 4FSYA 3NWWA 2R3NA 4RC2A 4PMPA 1I09A 3N9XA 5CVGA 3ID6C 1XMLA 3SC1A 4WUNA 3V5TA 4YBJA 3VS7A 2C0OA 3Q2JA 1IA9A 2CN5A 2VN9A 4CG9A 4EH8A 4G6NA 4X21A 1Q41A 1PF8A 2X0GA 3VS6A 3PWYA 4E7WA 4M68A 5IMEA 4AW2A 2XIRA 5L3AA 4XH6A 4ZJIA 2IW8A 2F9GA 3UO6A 3FWQA 1U46A 2QO2A 3DK3A 3DB6A 5JMSA 5CY3A 2PE2A 2PTKA 4DG3E 1XH8A 3QGWA 4B6LA 4K0YA 4DHFA 4RIYB 3UMXA 1IAHA 2HZNA 4RGJA 2QURA 3VRYA 3W8QA 3A62A 5H8EA 1XH5A 4FTOA 2X7FA 3UOKA 2X81A 4BKZA 3LQ5A 3ITZA 4QMLA 5J79A 5AR2A 3COHA 4WNMA 2LAVA 1QL6A 2JAVA 1LEZA 4L46A 2GQRA 3T9TA 4RWLA 4ZIMA 4O6EA 2XS0A 4UXLA 3MW1A 1J91A 1W2FA 3ODYX 4ENXA 2JBOA 3DGKA 4I41A 5DG5A 4AN2A 2VNYA 4EK5A 5JK3A 4ITHA 1GJOA 4FKSA 4APCA 4P4CA 5ANJA 4FTJA 2QOIA 5LMKA 4CTCA 5FM3A 3SXFA 1Q62A 2FO0A 3UGCA 2JKQA 5ACKA 2XNMA 4UYAA 1YHSA 4CT2A 4BHZA 3OMVA 4TNBA 5D12A 5GJGA 3G9LX 4FV5A 4CZTA 4NTSA 4OBPA 2ITXA 4YHJA 5CXHA 4BDEA 5IU2A 3A2CA 3QC9A 1OIYA 2HZ0A 3MJ1A 5JN2A 3U54A 5IH6A 4QYGA 4UWYA 3TKHA 2YM4A 3CPBA 3ORZA 1WVXA 3NNUA 5I3OA 3ULZA 4IX5A 2WMUA 3BU6A 1ZRZA 3BI6A 1ZZ2A 2R9SA 5IEXA 3LIJA 4UZDA 3VQHA 3NMUF 5AP3A 3BHTA 2XZSA 4I21A 4OR5A 4RZVA 5CQUA 3OT3A 3IK3A 3NPCA 5ANGA 3TM0A 3I0OA 4IM3A 3W18A 3VS1A 5E4HA 2YIXA 3CY3A 4QMVA 1IASA 3TUDA 1E1VA 3DLSA 2UZBA 2XBAA 3PXFA 4FKJA 2PUNA 3A7HA 3ODZX 2QQ7A 4MF0A 3LFFA 1G3NA 4L9IA 4X2NA 3CR0A 5IQCA 3FAAA 5HTBA 2RG6A 2NP8A 2X2KA 4KRDA 4S2ZA 1KE5A 3EZRA 5L8LA 4E5WA 4BGHA 2VTJA 3A8XA 1QPEA 3Q6WA 3TCPA 4YZBA 4BI0A 5HLPA 3PIYA 3PP1A 4AGWA 4BJJA 3KK8A 4KINA 3OZ6A 3KRLA 3O0GA 3DJ7A 2W1GA 5K5NA 5LJJA 2JEDA 2ITZA 5KBRA 5JQ5A 2FYSA 4B7TA 3EFKA 1SNXA 4L7SA 4OUCA 3VHKA 5EHOA 5LMKC 4KIKB 2XCHA 3NUNA 1J7LA 2C3LA 5IQIA 4ZSJA 4F09A 3U9CA 2R7IA 4LFIA 4U41A 5HOAA 3K3JA 5HORA 5LMBA 1OKZA 3BQCA 1MRVA 4FKWA 5F4NA 2BRBA 3CJFA 4O1PA 3O50A 3DTCA 2G01A 5HVJA 2HZIA 3ZFMA 3P5JC 4EH7A 5BVEA 3ZUTA 4JJRA 3ACJA 4NJDA 3LKMA 2W4OA 5DE2A 3CEKA 4RWJA 2PE0A 5L4QA 4O7RA 3Q9WA 3HNGA 3HUBA 1WZYA 4AN9A 4UB7A 4YR8A 1NVRA 4P2KA 1Z5MA 3VS5A 4FTRA 3CD8A 5JFSA 4DEDA 2YDIA 4F7LA 5EH0A 3UOLA 4QMSA 4EJ7A 5AR8A 2IPXA 4DH7A 4QTBA 4QTAA 3TV4A 3RI1A 3QQJA 5CASA 3SKCA 1E1XA 4JVGA 3E8NA 1MRUA 3BEAA 2W9ZB 3WE8A 4D1ZA 2IVSA 3CP9A 3LMGA 4R1VA 2C0IA 3VUDA 3GT8A 3Q4UA 2OZAA 3MH3A 4XP0A 1WBSA 4GG5A 2WNTA 5ETFA 3V5WA 3R8PA 5HTIA 4FEWA 1R3CA 3QQGA 1Z57A 3JXWA 5F95A 4J71A 4FKRA 4O91A 1PMEA 1ZY4A 3V5QA 3H9RA 5EFQA 2WMQA 1BKXA 3AMYA 4ZTQA 3QRUA 1CKJA 3HRBA 4Z55A 4X7QA 4DA5A 4ACCA 4IJPA 1QPJA 3ZEPA 3NGAA 4ARKA 2ZYBA 3LFCA 1ZOGA 1KE7A 2XRUA 5GZ9A 4FNXA 4AA5A 3EN7A 3R7VA 5KMMA 3HMIA 2G1TA 3JPVA 4EOJA 5CF5A 4IZ7A 4LV7A 1P5EA 3D5VA 4WSYA 4BF2A 4F6UA 2OIQA 4I0SA 4AXEA 2PK9A 2YM5A 2EB2A 3QTWA 4FUXA 4EOIA 2XEZA 4FL2A 3CE3A 3IQ7A 4I94A 4TW9A 4FZAB 3GCPA 3R28A 1KSWA 2I0YA 4BBFA 4BICA 4FOBA 5C26A 4FEXA 2OG8A 2JC6A 2UV2A 3PXYA 4KA3A 4F99A 2XK9A 4N70A 2NNWB 4XG7A 4AZSA 3QD3A 4UMPA 5CAVA 5IDPA 4D5HA 2BALA 2F49A 5D9HA 4HVGA 1JSTA 3FXZA 4Z16A 2XMYA 3MVJA 3NNVA 3R1YA 2Z02A 2W1ZA 4FKOA 3ORXA 4W4YA 1DI8A 5HG8A 4I22A 1KOBA 1KOAA 4HYUA 3O71A 4LGGA 4RIWB 5AP1A 3RK7A 4AACA 5I9XA 3U6IA 1PRYA 2C30A 2YWVA 3AT4A 4YZ9A 2PZIA 5LOHA 2YDJA 3QTUA 2F4JA 4HZRA 4K9YA 3S4QA 3U6HA 3NAXA 1AGWA 1YWVA 3FMNA 4C3PA 4DH5A 4QP1A 2JFMA 2R3HA 3OCGA 4YJUA 1P4OA 4BCPA 5B2MA 4FKUA 3E7VA 4GMYA 3VVHA 5J1VA 5J1WA 3H4JA 3DNDA 3R1NA 4FIFA 2UVXA 4NKSA 4TNDA 4ASZA 4CYIA 3HV5A 3NYVA 3W0QA 3KK9A 4WSQA 3I0QA 1OUKA 2EVAA 2QD9A 4DDIA 3PSDA 4PPBA 4FF8A 4RJ6A 3ZU7A 3ZYAA 4BDIA 4C61A 4CMOA 3RGFA 3Q9YA 3DAKA 4KBCA 5HBEA 5BNJA 2DQ7X 1T46A 4E6QA 1W84A 3LFAA 5BMMA 4UALA 3ORTA 4O2ZA 3QRKA 3R9HA 4M12A 5BUJA 5FD2A 5HX8A 4II5A 2YJRA 3DDQA 3PLSA 4E1ZA 4QO9A 5M4UA 3PPZA 2PMLX 2XIYA 3EN4A 3D5XA 3FLNC 4I93A 4PDYA 5E8SA 3A4OX 2W17A 2XYNA 3UOHA 3GU8A 3UC4A 2QLUA 5HLNA 4GSBA 2CKQA 2IVUA 4MD9E 2BTSA 5H3QA 2BRMA 2VZ6A 3F3TA 4CMTA 2JAMA 5AUWA 4KS8A 3VUHA 2YCFA 2R3QA 3E93A 3E8EA 3HDMA 4JRVA 2VWXA 4YO6A 4I0TA 1W8CA 3NSZA 3N4UA 4RJ3A 4N6ZA 5TO8A 3FUPA 3FI2A 4EOOA 5I3RA 3FSKA 3QTIA 4EWHA 3LCOA 5GJDA 3OW3A 3MH0A 4HOKA 2WMTA 3ENMA 5HICA 4EYMA 4YJOA 4H39A 3OBGA 1KWPA 2B9JA 2YZAA 1O6LA 1SM2A 4EK8A 3VAPA 5AUTA 3QQFA 3RAKA 1SYKA 2JKMA 4FTIA 5L6WL 3TNQB 3BYSA 3D15A 4L67A 3VULA 4BWKA 4CD0A 1JAMA 4O7NA 1GIIA 3OXTA 3DKOA 2PVFA 3V51A 3RP9A 5KMLA 3FLQA 5AV3A 3BHVA 4XG8A 3RAWA 5L2WA 1BYGA 5JGDA 3FKOA 5BVKA 3PFYA 2QODA 3IW7A 3LFBA 1Y6AA 3BU3A 1GAGA 3ZBXA 1FQ1B 4FKVA 3NDMA 4RJ8A 3EYHA 4YJQA 2JDTA 4JQEA 3TL8A 4BIEA 5M55A 3ANRA 3P4KA 3UNZA 5F1ZA 3C4FA 3AC1A 3EL7A 4G6OA 5KZIA 5A14A 3W0NA 4OBOA 4DH8A 3OUNB 2W1FA 3Q2MA 3AC5A 5HX6A 1OECA 1BL6A 3QTRA 4FV6A 3TV6A 3WILA 4Y72A 2PWLA 3HP2A 3CQWA 3Q96A 3VBQA 4TTHB 4DCEA 3GENA 4M3QA 5DLSA 2RF9A 3D7TA 2GS2A 3C0GA 5K0XA 1G8AA 5IQHA 2B54A 3Q9XA 2CKOA 4TYEA 3Q6UA 2A2AA 4FKQA 4FZ7A 3NUPA 5L2SA 2GHMA 3Q4ZA 1JNKA 1YOJA 2FSMX 3CQEA 4FTKA 1YXSA 1H28A 1TQMA 2QC6A 4RX7A 3CIKA 3RHKA 1FMKA 4U40A 4OAVB 4ACHA 1MUOA 2C3KA 4DH3A 4MNFA 3R2YA 2ZV9A 5M44A 4C02A 5CEIA 5EQYA 3TV7A 2YA9A 1CM8A 3BBWA 4AFJA 4N4SA 3CS9A 4PTCA 4RRVA 1ZYSA 3P23A 3KVWA 3V6SA 3C51A 2OF2A 1YRPA 3RK9A 4IAAA 4WBBB 4GV1A 2VNWA 4MD7E 5ETIA 2OZAB 2QNJA 2WTCA 1H8FA 2O0UA 4RT7A 3O8TA 4O4DA 4LDTA 4QP6A 1LP4A 4E20A 3OT8A 2Y6OA 3C4CA 2HCKA 3QBNA 4IB0A 3H30A 4Q2AA 3ZFXA 4DTKA 4CRLA 1OB3A 3MPTA 5EYCA 4ENYA 1YXTA 2OW3A 4XNEA 2A19B 1J3HA 3PTGA 1GZOA 2XNEA 2EB3A 4R7IA 5C01A 3JS2A 4USEA 1W83A 3MY0A 5I9VA 5DNRA 1ZYCA 4WT6A 1OGYA 4F0IA 2IVVA 3KU2A 4IIRA 1A06A 1YOMA 5EI6A 2OXYA 1O6KA 5EDQA 4IC8A 2FSOX 3FPMA 4IZAA 1DAWA 5AV0A 3DA6A 4H58A 3REPA 3C50A 3MPMA 4MK0A 5DT3A 3VJOA 2V5QA 3CCNA 4FJVA 4YTCA 3EFWA 4QMUA 4QQCA 2C3JA 3RTPA 2UZOA 1URWA 3FDNA 2OXXA 4I1ZA 2FH9A 3DBFA 4IH8A 5A6OA 1NW1A 3LLAA 4EUTA 3OHTA 4G31A 4NFMA 4S32A 3SLSA 2WU6A 2I0HA 3R22A 2CLQA 3ENHA 4FR4A 2C1BA 4X3FC 5CSXA 4W9WA 4N57A 3FC1X 4Q9SA 3C0IA 1OIQA 1MP8A 4L8MA 5M53A 3HMOA 5EDPA 1KUTA 3TTJA 2Z7LA 2X0PA 1IAJA 1RJBA 2C4GA 2VTTA 3QUDA 2J4ZA 3BLHA 3KF4A 3T8OA 1OKYA 4WRGA 3VC4A 2J7TA 2WMRA 1CSNA 2EWAA 3R73A 5E8YA 3R9DA 3AMAA 1G8JA 2A27A 4HGEA 4JBPA 3IGGA 2R7BA 2P55A 1IEPA 4ITJA 3KY2A 4TL0A 5CAPA 4LUEA 5AX3A 4QRCA 4XBUA 3PVWA 1OL7A 3QCQA 5DRBA 3V3VA 3ZXTA 4DITA 1FINA 2R3GA 4O0XA 4QMQA 5IISA 3MY1A 4CKRA 3QF9A 4CFXA 4FZ6A 4JR3A 1ZMWA 5CZHA 4PWNA 4ZZNA 3MV5A 3C4WA 3CGOA 3MY5A 3DS6A 3ZC5A 5A4TA 3C7QA 3TXOA 5CX9A 3UJGA 2HIWA 1J1CA 4IX6A 3DBEA 4YTHA 5IA4A 3QGYA 4EBVA 3LPBA 4ZTSA 4K1BA 3W2RA 2WQMA 2FA2A 4EHGA 5AFVA 3AC8A 3OWPA 4NW6A 2VTOA 3QWJA 4N6YA 4QTDA 3CQUA 3EIDA 4ZZMA 3VO3A 3R9OA 4XV3A 2PUIA 2BZJA 3QKKA 3UBDA 4FSMA 2XEYA 3WZUA 4JR7A 3WYYA 1OPJA 5B7VA 2BHEA 4AT4A 5L2TA 1XKKA 1MRYA 2YIYA 3GEQA 2HWOA 4QDEA 4EZ7A 5DMZA 4FSRA 3GQIA 5I9UA 5CQWA 3DT1A 4OBQA 4YP8A 2XAOA 4FNZA 5L8KA 2I6LA 2XKEA 2UW7A 3A60A 2XNPA 3COIA 3D5WA 4FIGA 3BLQA 5IQGA 4H05A 2PVRA 5K4IA 3JYAA 2C47A 2WZJA 3AMBA 4F4PA 4C2VA 1PKGA 3FKLA 4BBEA 2OJFE 4UY9A 5I9WA 4D0WA 2HXQA 1FBNA 2YABA 3HMMA 5I5ZA 2VV9A 2WEIA 3UODA 4I5PA 1M2PA 2C5OA 3A61A 3EKKA 3EL8A 1OBGA 1Y8GA 3LW0A 4HVSA 2BHHA 3H9OA 5LWNA 1UWJA 3A7FA 3MN3A 4FT5A 3TNPC 3LJ2A 4GKIA 2HOGA 4BC6A 4FTAA 3R7EA 4ORKA 5EQEA 3HVCA 3VF8A 5EG3A 3HMNA 2IW6A 3PSBA 2CHLA 4Y73A 4NM5A 3QTQA 4QMPA 4OTGA 2VWWA 4BGQA 3ZRKA 4AT5A 4KUJA 2PU8A 4Y8DA 4BYJA 3TNHA 4GJ3A 3R04A 4CGAA 4CXAA 4FBXA 4LOOA 3Q32A 1PJKA 4L01A 3QFVA 3MS9A 2XB7A 4XBRA 5HE2A 4U5JA 5TF9A 4CTBA 3QALE 5JEBA 4M0ZA 3PA3A 2BPMA 5E8TA 4I24A 2VTAA 3BYUA 5DOSA 3U6JA 2GNGA 3GC0A 2EXCX 3E5AA 4JDHA 2W1EA 3U55A 2XUUA 2YCSA 3M42A 2EXEA 5LWMA 4IVAA 4LGHA 3GC7A 2W0JA 4FTLA 4NT4A 5FGKA 4I6BA 4PNIA 3VUIA 3W0PA 3OTUA 2EUFB 4EOMA 5CSHA 2C68A 1ZAOA 4C4IA 1VR2A 4TT7A 4FE2A 3D7TB 3F9NA 2C5NA 2OJJA 3G2FA 3Q53A 4QMNA 4KAOA 4TRLA 3OP5A 4I3ZA 2X6DA 3GI3A 1YDTE 3MSSA 5FDXA 4ALWA 1ZY5A 2KULA 2PE1A 4FEQA 3SRVA 2GSFA 4NUSA 4DFXE 4YNEA 5AUVA 2XK8A 3HA8A 3AKJA 5GIPE 4XP2A 5LARA 2YCRA 3G33A 4S33A 3ORIA 1ZLTA 4RVLA 3F7WA 3V8SA 4X3FB 2C6MA 3G0EA 4Y5HA 5CF8A 1F0QA 1PXOA 3CY2A 4TWPA 3PJCA 3F88A 1S9JA 3ORMA 3UG1A 3EFLA 5AIRA 4DTAA 3G9NA 3PY1A 3OVVA 4IVBA 1UNLA 2OICA 5L6PA 3SOAA 3MA3A 3PZEA 1JKTA 5HO8A 5I4NA 1RDQE 1FVRA 2WMSA 3QQKA 4C36A 2C5YA 2C1AA 3D7ZA 3F5PA 3HRCA 4XV1A 4B99A 1OBDA 2ZMCA 2Z8CA 4KD1A 4Q9ZA 3VBYA 2XRWA 3V01A 2IN6A 3RPSA 3ZOSA 2Y8OA 2X0QA 3O23A 3KFAA 4YUQA 3R21A 5CEOA 3BL9A 5D41A 3U9NA 2PMNX 4YZNA 1NVSA 5AAEA 5EM5A 3ZHPC 5AAGA 4E4NA 2GTMA 3F2NA 2AYPA 3HA6A 2OO8X 3QA8A 2ZMDA 1R1WA 4LGDA 3MTLA 3IOPA 4O0SA 3KCKA 4MTAA 3RKBA 1YHVA 3NUYA 5E8UA 3PJ1A 4MF1A 4MEDA 5FTQA 4EK4A 4UWBA 5KZ0A 4CG8A 2ZOQA 4HZSA 2WO6A 4KSPA 2VWIA 4IEBA 5A54A 3QL8A 1UU7A 2WPAA 2QLQA 4ALVA 4O7SA 3PA4A 4JG6A 4GYIA 4M69A 4FIIA 2DUVA 2GDOA 4RVTA 3I6UA 2FGIA 3TZ7A 4Z3VA 3SW4A 5HQ0A 3IDPA 4LMUA 5C4LA 4UMTA 5CU6A 5FEEA 3RM7A 3PRFA 3LOKA 1JKSA 4AZWA 3F6XA 2Y4IC 4F70A 2B53A 2GQSA 1HCKA 1BL7A 1WVWA 2R0UA 4ZTLA 4F1OA 1K3AA 2BCJA 4NIFA 4WBOA 2RIOA 2J0JA 3WZJA 4UYNA 3FI8A 3UDSA 1H01A 3ORKA 3SG9A 3U51A 2IZRA 3A99A 1J1BA 2XK4A 2VWYA 4U8ZA 2PY3A 4O0UA 5TR6A 3ZTXA 3V5JA 4BCGA 4R5YA 4EOQA 5IQBA 2WAJA 4XCUA 4J1RA 3BEGA 2C6TA 2BIKB 4IDTA 3VUKA 4BCFA 2XYUA 3F7ZA 1OL1A 2X7OA 1DI9A 1GOLA 2OJIA 3OCBA 4FOCA 4LQMA 5FTGA 4IAFA 5E1EA 5DPVA 5FDPA 4A9UA 1M7NA 3HAVA 1ZOEA 4WUAA 4F08A 4AX8A 1B38A 3K2LA 3PA5A 4FYOA 3R2BA 4ZMEA 1V0PA 2J0LA 1BI7A 1W7HA 4XS2A 5FXQA 4LL0A 4DGOA 1R0EA 4IWDA 5CU4A 3EQFA 5AV4A 2RL5A 5CAOA 5BUEA 4IZYA 4ERWA 3ALOA 5JGBA 1XHAA 5CYIA 2ETKA 3EZVA 4RMZA 5HEZA 4MXAA 3Q52A 1XH7A 3EWHA 2B1PA 3FJQE 4QP2A 5EOLA 5FBNC 2YACA 5D7AA 3R71A 3SVVA 2YN8A 2Y7JA 4FV2A 4DE4A 2PVMA 2SRCA 2JLDA 3EKNA 3V5PA 4KIOA 5M09A 3F3UA 1VYWA 3D5UA 3MIAA 3KULA 4QQ5A 4YJVA 5E8VA 3O7LB 4KABA 4NW5A 3NVMB 4EOKA 2E9VA 1YKRA 4AZVA 3UOJA 3UG2A 3GU7A 2JBPA 3GB2A 5HIBA 2PL0A 3ZSIA 2CGUA 4F9YA 5CI7A 4CLJA 3MESA 4TN6A 4C7TA 2VTPA 2VTNA 3CKWA 4ANOA 4ZXTA 2PZRA 3R8VA 4CFUA 4D2PA 3MFSA 3SV0A 3EQHA 4O96A 4TYHA 4E8AA 5ANEA 3LXKA 4YPSA 5T3QA 2HW7A 3QUEA 2WIHA 3D2IA 2ZM1A 2ITOA 4C8BA 4DEEA 4ZK5A 4EONA 4BZDA 2GTNA 5KO1A 3W2PA 2J0KA 1YOLA 3FI3A 3NR9A 3PZHA 5LVOA 3EQIA 3H0YA 3KVXA 1QMZA 4KIQA 4QMOA 3R9NA 5BYLA 4QP7A 5AWMA 3TZ9A 3MYGA 1OKWA 1OGUA 3GCVA 1OL6A 1H24A 2VWVA 3AC4A 4G5JA 4L68A 4CFNA 5J95A 4BI2A 1REKA 2HENA 3DQWA 3FZTA 3LE6A 5IEYA 2QO9A 2CCHA 3PJ3A 5CU3A 1FGIA 3SA0A 3FPQA 4D9UA 4EHVA 2WQEA 5ICPA 4WG5A 4O27B 4P5QA 5HVKA 4MBIA 3K5UA 2H8HA 3THBA 2R4BA 1Z9XA 3R8MA 2R3JA 4IHPA 4U3YA 4FICA 5CU2A 5JGAA 5M57A 4EUUA 1GIJA 4ZY4A 3PIXA 3DCVA 3VWAA 1OL5A 3F5UA 4FV7A 5K3YA 1Q5KA 1YI4A 1MQ4A 5CVFA 3O7LD 3U87A 1FGKA 4AN3A 3LM0A 2VX0A 5HTCA 1V1KA 2OK1A 4L6QA 4U42A 3VS2A 4DGGA 1JVPP 5IKWA 2A0CX 4FKLA 1TQPA 3R83A 3F3WA 3C1XA 3LJ0A 4JDJA 4JQ8A 1VLRA 2QCSA 3FE3A 4RA5A 2I0EA 4R1YA 3SRV