4YJRA

Syk kinase domain in complex with inhibitor gtc000225
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
270
structure length
263
Chain Sequence
YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 263
sequence length 270
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjrA01
4ZY6A 2NP8A 4XBUA 4C4IA 4L7SA 3ANQA 3EQBA 3PJ8A 3F2RA 2F49A 2IVVA 4MQ2A 4A9TA 4XEYA 4XV2A 5KMOA 4FIJA 5LVOA 4B7TA 4QPMA 5IDNA 4HNIA 3CQWA 4J8NA 4U0IA 2C1BA 4TYEA 4FIFA 3R21A 2Z2WA 5FM3A 1H07A 3R2YA 4P5ZA 3II5A 4AGWA 3OWPA 4D4RA 4FNWA 3TXOA 3NNWA 4FICA 2J4ZA 2QOKA 5ACBC 4U5JA 3VUKA 3AXWA 3LOKA 3R73A 4IB0A 2BKZA 4M0YA 4D2RA 2CKQA 3MH1A 4JDJA 5HG7A 5DT4A 2Y6OA 1QMZA 3DGKA 3DK6A 3F5GA 3LFFA 3PXKA 2PZPA 4ZZMA 4AU8A 2YIXA 2OJ9A 2QHNA 1OVEA 2QR7A 3MN3A 4LQMA 4P5QA 3KULA 5M09A 3EWHA 4ZLYA 1WVWA 4H3BA 2BAJA 4XYFA 4EZ3A 1YXSA 4WD5A 2QKWB 1HCKA 4QOXA 2UVZA 2XK9A 2UZLA 4CZUA 4QMTA 3G33A 2XMYA 3LXPA 1KE5A 3SOAA 4CSVA 2VTNA 3IW7A 4BCMA 2VO0A 3QALE 4G3DA 3RHKA 5CI6A 2OXYA 1SMHA 1G3NA 3CGFA 4KRDA 1YWRA 4WKQA 4FT9A 2PHKA 3V8SA 3QD0A 4KRCA 3E3PA 1JKKA 1YI4A 4W8DA 3GOKA 3I7CA 3SAYA 5IF1A 2PUNA 2WAJA 4GL9A 3D5WA 5D10A 4AZWA 4XG9A 2XEYA 4L42A 5HICA 3V01A 4H1MA 4J96A 4XV1A 3T9IA 3ZH8A 4ZMFA 3RZBA 3NUUA 4AXAA 2J0KA 2B54A 2BDFA 5E92A 2ZYBA 4HVGA 5A54A 4D1ZA 4KKGA 2LAVA 3D2IA 5KMMA 4OT6A 4Z16A 4RWJA 3AC3A 4GH2A 2C6DA 3KCFA 4AZFA 2XK8A 3UIMA 3WF9A 3E5AA 3DTCA 3KULB 5KMNA 3FY2A 3MWUA 2X2LA 3FLWA 3IKAA 2VWUA 4TZRA 4R7BA 1E1VA 3LCDA 4YHTA 3MGYA 3V5WA 3IGGA 4PNIA 4CT2A 5KHWA 2WPAA 1MUOA 4FL3A 2YIRA 4FSUA 4PPAA 2R64A 3U51A 2XBJA 4M66A 1YHVA 2X4FA 4JXFA 4BZOA 3FMEA 1J7IA 2YN8A 2QG7A 1O9UA 2DS1A 3PA3A 4QTAA 4RJ8A 4U40A 4AW1A 1ZMVA 2JAMA 2W5AA 5CAPA 3R9HA 2HWPA 5E8YA 3EFKA 5EHLA 2PSQA 4G6LA 1UV5A 4RJ6A 4AN2A 4CFNA 2R9SA 4NJ3A 4BZDA 3LFBA 3NSZA 3QAME 3HMIA 3QTUA 4QP3A 4AW2A 2ESMA 3DZQA 4PTGA 5E8XA 1IRKA 3V5LA 3ID6C 3BYVA 3DFCB 3DTWA 3HA8A 1UU3A 2Y7JA 4I0RA 2WU6A 3QC4A 5IQAA 3FY0A 5H8GA 1WBTA 4QMSA 5HHWA 3TT0A 4RVKA 5I9YA 3NCZA 4G34A 4DE4A 4MH7A 4MCVA 1YOMA 3UZPA 5HD7A 4ZK5A 4ZSGA 3ZDUA 2BRMA 4ALWA 4NH1A 4YLJA 4RIYB 4A9RA 2C6TA 4CYIA 5LXMA 4JRNA 4PMMA 4EOPA 1PXPA 3EQFA 5IEXA 5DIAA 4AGUA 4EHEA 3H9OA 5FRIA 1Y91A 2HY0A 4GVAA 3RINA 4FSRA 4YZ9A 3ZCLA 4WRGA 2B9IA 5E7RA 4C3RA 3VUHA 4BCOA 4R3CA 3E3BX 5K9IA 2XKFA 2HK5A 3E92A 2IVTA 2YM4A 4ACDA 3OS3A 1SNXA 4MXXA 2CMWA 4XG6A 3LJ1A 3V51A 2EXEA 2YAAA 4GYGA 4WRSA 5DLSA 1Q8UA 4C8BA 4EBVA 4O86A 2QONA 3P4KA 4FUYA 4FEVA 4FKTA 4P90A 1XH6A 2BTRA 1XKKA 3NUPA 3OW4A 5CSWA 4AF3A 1GAGA 2OU7A 3A7FA 1DAWA 5JFXA 4DT9A 3LQ8A 4DEBA 2RSVA 2P33A 4QMQA 3SVVA 3LAUA 3JR1A 4WOVA 5B0XA 4FV8A 2BHHA 1Q8WA 1SZMA 2YM8A 3LE6A 2ZOQA 1IR3A 3OBJA 4LUEA 5CI7A 2BDWA 5DG5A 3RAIA 3K3JA 4N57A 5H2UA 3C51A 1MQ4A 3LMGA 2BIKB 2P0CA 3ZMMA 5KMKA 2G2FA 4KS7A 5TOZA 2E2BA 5CU0A 2CPKE 4E1ZA 3D7TB 3FZ1A 3Q4CA 3R7GA 4FTNA 5BVFA 4UX9A 3ZUTA 5CQUA 3COIA 3TZ8A 2F7ZE 5HZNA 2ITYA 1REJA 2XCHA 1Q3DA 4EQUA 2FGIA 4NIFB 4DFBA 5K0XA 4K77A 2PVFA 1G5SA 3QRTA 1IAJA 3BKBA 4IADA 3UGCA 4BFMA 2QLUA 4PF4A 3QYZA 3VBQA 3EFJA 4C37A 2XM8A 3PSBA 5EH0A 1FQ1B 1W0XC 4JLCA 3EMGA 4QPSA 3VBWA 2CCHA 2YCRA 4IAIA 2ZMDA 2H8HA 4EI4A 3SDJA 2YEXA 2QU5A 4Q5EA 4BDHA 3KXZA 3AMYA 4KB8A 5C1QB 4OTHA 4E3CA 3NUAA 5C01A 4IMYA 3P79A 4I5MA 3LKMA 3QZFA 4TWOA 5HIEA 4DEGA 1YXTA 5A6NA 3PYYA 2XK7A 3AD5A 3OCBA 3PA5A 3PFQA 3IDCA 1FMKA 2R3JA 4L53A 5EHOA 4F9CA 2G01A 4IZ7A 2Y6MA 2OIBA 2Z8CA 4FKSA 3TUDA 4WA9A 4DFZE 2V7AA 3W16A 4EORA 4AOIA 4PL3A 5TO8A 3C9WA 5BUJA 4DAWA 2VZ6A 3ORNA 4GFMA 4PL5A 3HV4A 2QOBA 1YOJA 4NW5A 4BL1A 4N4SA 3DLSA 1TQIA 1ZOEA 3UQCA 4O2PA 4FTJA 3EN6A 3IECA 3MW1A 3DBCA 3TV7A 4DTKA 2CNQA 2W1EA 2XNGA 3FI4A 3ZM9A 4QRCA 1V0BA 2VO7A 2W1FA 3R8VA 4C36A 2PMNX 3ZEWA 1KOBA 4F6SA 2W7XA 3EFWA 3TV4A 3DAKA 1PXIA 2FH9A 3R30A 3EQHA 3NGAA 3QRJA 2W4JA 3F3UA 3TNHA 5K5NA 3C0GA 4RX9A 3FZOA 3BGZA 4RX7A 3PE1A 4WSQA 3Q9ZA 5BUIA 5LMKA 2ACXA 4XBRA 4LUDA 4J7BA 2WIHA 1RE8A 3L1SA 4UZDA 3KF4A 4YPDA 3Q2JA 1PJKA 3EL8A 1WMKA 4I92A 5IMXA 5JRQA 3D0EA 5AUZA 3QRUA 3UG2A 3P9JA 5G6VA 4BDDA 5L3AA 4XRJA 4JBQA 5AFVA 3HZTA 3OXIA 4OTGA 2VTLA 2UW4A 5AR5A 2QVSE 3FLYA 2ETMA 3ULIA 4XP3A 4F7SA 1IG1A 4FT0A 2JITA 4FA2A 2VGOA 3DAEA 3QUDA 4U44A 5C26A 3EN7A 1OBGA 4GT3A 4MXCA 4O0SA 4M84A 2YWVA 3FV8A 4G5JA 2C6OA 5EI8A 5HE0A 3ZC6A 4FIGA 3NUSA 3M2WA 4JR3A 3TTJA 4B0GA 4D5HA 1OZ1A 4DEHA 1YQJA 5D12A 2OJIA 3G0FA 4KBAA 3GB2A 4JQ8A 4C38A 2A0CX 2WELA 3WZKA 4JR7A 3JS2A 4BF2A 4QPAA 2VTQA 2I6LA 2W17A 3TDWA 3JY0A 4UWYA 5EW8A 4RGJA 4IACA 4AOJA 2PVNA 5ANJA 2H96A 4OTWA 5AP4A 3GUBA 4YTCA 5KMLA 3PJ2A 1M52A 2WQOA 3FZTA 2CN5A 3EOCA 3TWJA 4BDEA 1YHWA 2FSMX 4MNEB 1BYGA 3MB7A 3P0MA 4ZSJA 3UMWA 1NVSA 3R7YA 4CFXA 2GMXA 3UC4A 4CEGA 4DFXE 4F0IA 5A14A 3QKMA 3EYGA 3V5QA 3VBTA 2OWBA 2F57A 3NNXA 3PDTA 2BRNA 4AACA 2XNBA 3QUEA 2AYPA 2J6MA 4P4CA 3S4QA 2YCFA 5AM6A 5IQBA 3LJ2A 1U5RA 4O27B 2OICA 3EQDA 1ZYCA 4XMOA 4HJOA 4K9YA 1RQQA 2X6DA 4Z9LA 3GT8A 2UVYA 1WBPA 4H1JA 5EOBA 5HCYA 4J71A 3V8WA 1AD5A 4F64A 1IA9A 3EHAA 4JAJA 3ZU7A 4G3CA 1KUTA 3QQUA 3EQPA 3SLSA 3HVCA 4NYEA 2QQ7A 3P23A 4M12A 1WCCA 3MJ1A 2GS7A 4GFOA 1H1WA 4CRSA 2PZYA 5BVKA 4DT8A 4FEQA 4KD1A 4OBPA 1OPKA 1ZYDA 4FV6A 3O7LD 1BI8A 4QMWA 2OGVA 2VTPA 4FOCA 3CXWA 3CSVA 4O81A 2WMQA 4U97A 4YNEA 3UO4A 4U41A 3HDMA 4Y85A 5IA5A 5B2MA 2X4ZA 2Z60A 3NUNA 3GVUA 3DQWA 5KZ0A 5CX9A 3ZBFA 4EC8A 4ZJJA 4MK0A 3PZHA 5I9WA 3VUDA 2PPQA 4C57A 2X39A 1VZOA 2KTYA 3NEWA 5CENA 5I4NA 4FTQA 4CZYB 2CLXA 3WOWA 2CJMA 2X81A 3VF8A 3DA6A 3UJGA 3PXFA 4UMPA 5L2TA 2W1IA 5LVNA 2BZKB 4YC6A 3HUBA 4MNFA 4RWKA 1R39A 4WUAA 3A61A 1E9HA 2XIKA 3CJFA 3O8TA 5EG3A 5HKMA 4C62A 4E5WA 5CY3A 1W8CA 3S0OA 2QG5A 5LVMA 2O5KA 4JG7A 3ZSIA 4PV0A 4II5A 4HCUA 2UW7A 2OO8X 4YC8A 3A7HA 5GZAA 5I3RA 2F7EE 2W5BA 4JX3A 5L8LA 4A9UA 3OUNB 5E8SA 4F08A 1O6KA 3MFSA 3QX4A 2X0GA 3U8WA 2ZB1A 3ZLWA 3WIGA 2Z7LA 3JY9A 3W55A 4NKSA 1DAYA 2YJSA 4EEVA 5TT7A 4NCTA 5CAQA 4KKHA 1FVVA 2JDOA 3R22A 4OTFA 3SC1A 3QFVA 3SXRA 3U9NA 2IZSA 5EKNA 5DA3A 2HW6A 3LXLA 2CGVA 1PHKA 2I0YA 4I5PA 4IC8A 4UBAA 2R3LA 2GNHA 3QD3A 2YZAA 4JBPA 4ITJA 3COMA 1URWA 3PVBA 1ND4A 1XO2B 2JDTA 2YM5A 4W4VA 4EHZA 1BUHA 5HBJA 1VYWA 3FQSA 3OXZA 3VIDA 3F2AA 3VO3A 2YM7A 4ONAA 3ZHPC 5CT7A 3R8LA 5DBXA 1PYEA 1JSUA 4NJDA 3QD4A 3R1NA 3ZC5A 2ITPA 2OH4A 2BAQA 3SG9A 4BTMA 3TEIA 3OVVA 3E7VA 3I6WA 4QMLA 4EL9A 3AMBA 1OKWA 3O2MA 3ORIA 3UOKA 4MKCA 4RLKA 4CYJA 4BKZA 4F9YA 2RL5A 3FMLA 3TI1A 3VQHA 4G9RA 5ETAA 4EH7A 3H30A 5L6PA 5LWMA 4CMTA 5J7BA 5AA9A 4BTKA 3PWYA 3R6XA 3B2WA 3UYSA 3UBDA 1W84A 3FC2A 4RIWA 3W2CA 3O96A 5JT2A 4R1VA 3SRVB 3ACJA 1EH4A 3AT2A 4NTSA 3MH2A 4AX8A 4A07A 5HLWA 3MS9A 2GHLA 4GIHA 1IA8A 1KWPA 2WD1A 3M1SA 4G2FA 3KU2A 3QCQA 4I6HA 4NUSA 4O0WA 3CJGA 3KXXA 3L8XA 5EQYA 3SKCA 3AD6A 5A4EA 1PXNA 3BEAA 3I4BA 2OSCA 4NKAA 4TYGA 5HX6A 4N70A 5CNNA 3VUGA 5BYYA 4W4YA 1XWSA 2WKMA 3T9TA 4FKJA 2BCJA 4JG6A 4F1MA 2ITXA 3LFEA 5AR3A 3JVRA 4EJ7A 4BY9E 2B52A 4IAZA 5EM5A 1KE7A 3DFAA 3VWAA 3KRJA 5FTGA 3AC5A 4YP8A 3QYWA 5HTCA 3F3VA 3WE4A 4AAAA 5D1JA 4D2WA 4YNOA 5AUYA 4O96A 3PPKA 2VO6A 2ZB0A 3G90X 5IUGA 4KIQA 4YBJA 2X7GA 4P7EA 5J95A 3SQQA 5KX8A 4AUAA 4MWHA 5J8IA 2CN8A 2JKOA 5FTQA 2R7IA 5AP5A 3WYXA 5JFWA 3W8QA 4R5YA 4YJTA 5FP6A 1JAMA 3K2LA 4TW9A 3HA6A 3GCUA 5IDPA 3VS1A 5HCZA 2B9JA 2JFLA 3MVLA 4RJ5A 1H0VA 2OIQA 3DXQA 5AA8A 4GT4A 5AIKA 5AIRA 3TIYA 1OMWA 4C2WA 4WG5A 4PDOA 5IQDA 3VS5A 4ID7A 5M57A 3O17A 4RIOA 1M2QA 3D14A 4AN9A 5GIPE 5AUVA 4K6ZA 3CY3A 3DAJA 2XIYA 4JX7A 3BE9A 2C68A 2ETRA 4PMTA 4WNMA 1Q8YA 4ZSEA 4C2VA 4C58A 4L3JA 4EOMA 4ZAUA 3FEGA 1PMNA 1Z9XA 3DLZA 2W1GA 4DFYA 4F1TA 3QRIA 4F7LA 3PLAE 2ZAZA 4Y95A 3R8ZA 3QQGA 2OK1A 3O71A 4RFYA 4YJPA 3RGFA 5AP7A 2R5TA 3HECA 4YHJA 3IOPA 4HGSA 1UKIA 4ITIA 4QMMA 1OI9A 4ACMA 1JNKA 3R9RA 2PZ5A 2P4IA 3Q04A 5FDPA 3GI3A 1F0QA 4UWCA 2WMXA 3THBA 3R0TA 3WZEA 3KB7A 2GS6A 3GC0A 2ONLA 2W4KA 2UZEA 2H6DA 4FK6A 2B9HA 2BROA 1BX6A 4Z55A 4BCJA 4IW0A 3MTFA 3MA3A 5D7VA 3ENMA 4APCA 5CEPA 2V22A 3TDVA 2PTKA 5E1EA 2QO7A 3H10A 3UIXA 4EH9A 3LCSA 3QKLA 3QTQA 2BRGA 1UA2A 5IA3A 4QP9A 4DBNA 3Q4ZA 4JVGA 1PXMA 2WXVA 3TUCA 3H3CA 3BCEA 2OFUA 4F9BA 4M3QA 4EUTA 2RIOA 3PUPA 4GK4A 4RWLA 2PVYA 2JEDA 3DK7A 4FT5A 4YSMA 5EOLA 3QRKA 3U54A 4K2RA 1ZMWA 2P2IA 3BQRA 5ANIA 3KCKA 4UWBA 5CEQA 4O0UA 3GFEA 2JIIA 3CBLA 5AP1A 3FSKA 2BVAA 3PY0A 5IH6A 1ATPE 3FWQA 4M68A 3CKWA 1G8AA 4FC0A 1OM1A 3FMDA 4FZFB 1KV2A 5C8NA 4DEDA 3A4PA 1XJDA 4I41A 4WNKA 4I93A 3TZMA 2FUMA 4C35A 2Q0BA 4IX4A 1NXKA 3UODA 2A27A 2J0LA 4QQCA 4D55A 4G6OA 5JGDA 5DR9A 4FTTA 5FDXA 4BICA 4D0WA 3I7BA 2XP2A 2GSFA 5KE0A 3AT4A 3C4WA 1KSWA 1QL6A 5DEYA 5IQEA 2R3HA 2WZJA 3DJ5A 2XJ2A 2CCIA 4CKIA 1VR2A 3QWKA 1LR4A 3ALOA 5LVPA 3LQ5A 2XK4A 5KUPA 3UNZA 5K4JA 5F95A 5ACKA 3CTQA 1TQPA 1ZY4A 4M15A 4O21A 5HX8A 4HCVA 3E8NA 2B53A 3N9XA 4L44A 4UN0C 3PY3A 5D41A 3COHA 5ETCA 4V0GB 5BX0A 2BALA 2CGWA 3POOA 2PMIA 4FKLA 4KA3A 3UP2A 4PPBA 5I9VA 3L8PA 4EH5A 3VS2A 4QP1A 5CAOA 2YA9A 1GOLA 5CU4A 4X6RA 1P4FA 4RRVA 5EDPA 4IC7A 3ENHA 4JQEA 4Y46A 5AAGA 1XQZA 2IO6A 3RPRA 3R7EA 3OMVA 3V3VA 3MH0A 3VULA 4AZTA 2UW3A 5BVDA 4AP7A 1WBSA 2ITQA 4YGAA 4AW5A 3C0IA 4IZYA 5AX3A 1LEWA 5I9XA 3GC9A 1Q62A 3EKNA 2O63A 4AS0A 1M7QA 3B8QA 2UZNA 3MTLA 3AC1A 2VNYA 1HOWA 4AN3A 2R3FA 1ZZLA 4HCTA 4PWNA 4YHFA 4O0VA 4YJRA 4R8QA 4ZMEA 4I22A 5JMSA 2GU8A 3V5PA 4FV3A 4P2KA 2Y4IC 3QLGA 3PIXA 4FKGA 2C69A 4JDHA 4FKUA 4ACGA 2CKOA 1UWHA 1ZARA 2XH5A 4FUXA 4OAUC 5AP0A 2BHEA 1J7LA 4KABA 3IO7A 3TTIA 4L52A 5HG8A 2VWBA 4PL4A 3K5VA 4IXPA 4E8AA 3NW7A 3DKFA 4U79A 4Z7GA 3CLYA 5EYMA 4MYGA 5HGIA 3U4UA 4HYUA 5HO8A 4EK8A 2FO0A 2UZTA 2OZOA 3P7AA 4O0YA 3I5NA 3MV5A 3SV0A 3NMUF 4Z3VA 5JRSA 1U54A 2G9XA 4YJVA 5IPJA 2FYSA 4CT1A 2O0UA 3KMWA 4DYMA 5JSMA 4I5CA 2BR1A 4WG4A 3Q4TA 5AR8A 4A4XA 2GFSA 4ALUA 3KXGA 3KREA 4OTQA 5EI6A 4HGEA 4I0TA 3WF6A 2WTKB 3Q4UA 5LJJA 5CSHA 4AA4A 1FMOE 4AA5A 4ZS0A 5FXQA 3GU5A 4I5HA 3CD3A 3P7CA 5IQFA 3SGCA 5BVEA 3HUCA 1APME 3LFDA 3R02A 2PMLX 2VTIA 3ZLXA 3WBLA 3ULZA 1YI3A 3PE2A 5H8BA 4FOBA 3RNYA 3G15A 3U6JA 1BL7A 3E63A 3AC4A 4D4SA 2ITNA 3IQ7A 3ZFYA 3DDPA 4YZDA 1RDQE 4E6DA 5L8KA 5HORA 5LMAA 1F3MC 4E73A 5M56A 5IMEA 1CKJA 4M14A 2Q83A 2YACA 3A4OX 3OCTA 4XLIA 2W1ZA 3F66A 4RJ3A 2X9EA 2HOGA 1SVEA 4J95A 2Y0AA 4J53A 4L01A 4YJOA 5JGBA 5F94A 4EKKA 5CANA 1A06A 4RVLA 4RA5A 1DI9A 4BI2A 1CTPE 3TJDA 4BDKA 1T45A 3HRCA 3RAWA 2GCDA 4EH3A 3HEGA 1GZKA 2NRYA 3G0EA 3P5KA 2QC6A 4AZSA 5JEBA 3E64A 3GCSA 1NT2A 1BLXA 2ZDUA 3QBNA 1WFCA 4X3FA 3FZRA 4ERWA 2HYYA 4I20A 2HAKA 2ERZE 4QYYA 5LARA 4N0SA 3VS7A 3ZBXA 3BBTB 4C4EA 4EZ5A 5M06A 5T68A 3KC3A 3QD2B 5IU2A 1Q8TA 2B55A 4IM3A 1PMVA 5A6OA 2WOUA 3ZM4A 5HU9A 3H0YA 3DKOA 5FEQA 4D1XA 5M55A 4BTFA 4NU1A 3SXSA 4BRXA 4D2VA 3RBWA 3WE8A 5DYJA 2WMUA 2UZVA 4F7NA 3ORZA 2RG5A 3WF7A 2W06A 3CPBA 2GQGA 3HV5A 3P7BA 2PVLA 5AV4A 4RIXA 2WMTA 3KRRA 4NM3A 4X3JA 4IB1A 4G3EA 4R3PA 3DBEA 1P14A 2YLEA 5E9EA 4UMUA 2QR8A 3OEZA 4AFJA 2XCKA 3AD4A 3FI2A 3F88A 2C47A 4ITHA 3K5UA 4A4LA 4F9WA 3NS9A 3PVGA 5AV2A 5LCJA 5FQDC 2O2UA 3IGOA 3NWWA 4H58A 1R0EA 4DG2E 3ITZA 3R28A 3TJCA 2E9NA 3A62A 4DFNA 3G9LX 4R7HA 3F5PA 2I0HA 3W2SA 2UZBA 3QCYA 4O22A 5EHYA 4U6RA 2F2UA 4LRKA 4BCGA 4HVSA 2UW5A 3LZBA 2BRHA 3MPMA 4FKRA 1W7HA 1XH4A 3D2KA 3OHTA 4USDA 2WTJA 4V01A 4J8MA 3PSDA 4YTIA 5C8MA 1MQBA 5CTPA 3ORTA 1FOTA 2UV2A 5KCVA 4MXZA 4BDBA 2HELA 4YLLA 4ZSLA 4GRBA 3MPAA 4FV0A 4O2ZA 4UB7A 4C3PA 3OWLA 4LM5A 3QTZA 2WMRA 3BWFA 2VTTA 5IEVA 2QCSA 1PRYA 2PULA 2AUHA 5DHJA 3L9MA 4PDPA 5FXRA 3BHTA 2YZLA 2WB8A 1GY3A 4WBOA 1U5QA 1ZOHA 5L2SA 3HV3A 1SNUA 4F99A 1QCFA 5DVRA 5CQWA 3HDNA 4BYJA 3PVWA 2WQEA 3PRFA 2YHVA 3KEXA 4UY9A 4V05A 4AE6A 4D2PA 2YAKA 3POZA 3CE3A 1Q8ZA 3NYNA 4B8MA 1S9IA 4FTKA 2XYUA 3PXQA 4M13A 1KE8A 4CLJA 3W1FA 3LVPA 4TRLA 2CDZA 5HE1A 4ZEGA 3CTHA 1LUFA 2EVAA 5IA0A 3QL8A 4U81A 4FTAA 5BYZA 1ZLTA 4W9WA 3SW7A 2F4JA 3QA0A 1LEZA 2JIUA 2EB2A 5HESA 3VQUA 1PYXA 3HP5A 2BRBA 3TKHA 1PXOA 1Q4LA 3IW8A 4R78A 4LFIA 4OLIA 1ZYSA 4G5PA 3Q3BA 5DRBA 2PVKA 3W2PA 3WYYA 1P5EA 4AT4A 4D9UA 5M51A 4IHPA 3V04A 3W10A 3FMJA 4DH7A 2ZM3A 4ZS4A 2QU6A 2XK6A 2DYLA 2XB7A 3WZDA 4ZTMA 5AAEA 1CSNA 2XNNA 3QZHA 3R01A 5E8ZA 5IKWA 4BDJA 1OKYA 4FG8A 4BGQA 4DH3A 5BVNA 5HVKA 3EB0A 4FI1A 2ITOA 5AADA 2O3PA 4U3YA 4BGGA 4HVIA 4I21A 1M7NA 4X2NA 3FXXA 2E9PA 1W98A 3A2CA 3HL7A 4CD0A 5A4CA 3CGOA 1I44A 2RG6A 1QPJA 3EL7A 2P3GX 3LFSA 4S33A 4ANOA 4EQMA 2CNVA 2GFCA 1TVOA 1Q5KA 2R3OA 3IONA 5CF6A 4EH4A 2WU7A 4U45A 5EFQA 2B9FA 3IK3A 5BQ0A 4CLIA 3DB6A 1ZWSA 4ZY4A 3VW8A 3ETAA 2P55A 3HKOA 2UW0A 4LMNA 4FV2A 4DBXA 5C4KA 3GXLA 4FKWA 3CR0A 2NO3A 4EOOA 2VTAA 4AA0A 4G6NA 3R83A 4CG9A 3E8DA 3G5DA 3MIYA 4YTHA 4F7JA 4XG3A 2F7XE 3SXFA 5HEZA 1Q24A 2P2HA 4GK2A 4FTUA 4IAYA 3FQEA 5AP2A 4WNPA 4DH5A 2E9VA 5FM2A 5DH3A 4GUEA 3VS4A 4RJ4A 4OW8A 4TY1A 1URCA 3F3TA 4L3LA 1Y6AA 3RK9A 2C0TA 3DXPA 4O7RA 3NLBA 3KL8A 3FXWA 4FSQA 4X2GA 1YHSA 3FMMA 4MXOA 5BPYA 5KKRB 1J7UA 3C4XA 1YW2A 2IZTA 3P78A 3VS0A 4AZEA 4TWPA 4I4EA 1I09A 4EOIA 4EOJA 3MJ2A 2XS0A 4YURA 4X2JA 1KE9A 3L9PA 3FL5A 4FEWA 4FV4A 3SD0A 4CVAA 2VTHA 3ZYAA 3ATTA 2VX0A 3ZO3A 4BCIA 3MY1A 1KOAA 1PF8A 4RFMA 2WTDA 4F70A 4F0FA 3SA0A 3GP0A 3ZLYA 3T3UA 2C1AA 3N51A 3EN4A 3NW5A 2BKKA 3UIBA 1M14A 1OITA 5DOSA 3KK8A 4OUCA 3TV6A 2J0MB 3BQCA 3MSSA 4IJPA 4I23A 4LOQA 3L8VA 4PTEA 4BHNA 4CQEA 4I1ZA 4Y5HA 3EZVA 4RX8A 3VBVA 5IEYA 4EOLA 3BELA 4HGLA 2Y9QA 4I6FA 4F1OA 2BTSA 4I4FA 3BLHA 2GS2A 3QQFA 3KVWA 3WZJA 5ICPA 3I5ZA 3E8CA 4FG7A 3RAKA 2PUIA 2B4SB 2QKRA 3PPJA 3KQ7A 3D5XA 4KNBA 4FEXA 4O7SA 5HNGA 1H26A 1U46A 5F1ZA 3R7VA 2OXDA 2XYNA 4YSJA 4IDTA 4DGNA 3ZRMA 3TNPC 2A4LA 2WOTA 5HVJA 5K3YA 4G9CA 4E6QA 3TN8A 1KE6A 2R3NA 4LGGA 4Y72A 3GC8A 5GIOE 2XA4A 3UDBA 1YXXA 4LGDA 3E8EA 2C6EA 2XKEA 4B4LA 2WQNA 3OG7A 3CD8A 3DZOA 2YITA 2VV9A 5DFPA 5A3XA 3RMFA 2BFXA 1BKXA 4UXQA 3RTPA 5CASA 3MPTA 1OB3A 3HLLA 4NT4A 4YJSA 1JOWB 5ANEA 4C61A 4HNFA 3EIDA 3UPXA 3FI3A 2GDOA 3BE2A 4KIKA 3VN9A 3UMXA 3NAXA 2ITVA 1Q99A 3DB8A 5J9ZA 1PXLA 4S34A 1ZAOA 4KWPA 4YZMA 5I3OA 4F6WA 5ETFA 5CXHA 3LCTA 3FLNC 3DU8A 2WTWA 3F5XA 5CU3A 3UO6A 3RJCA 5ETIA 1H1RA 3PVUA 2IZRA 4GSBA 3RPSA 3WI6A 2OF4A 4ERKA 2QD9A 3TZ9A 4CKJA 5HBHA 3TG1A 4RPVA 1STCE 3EJ1A 3IW4A 4D28A 2VO3A 1FGIA 1H25A 3BWJA 3QC9A 4KAOA 4DG3E 4QYEA 5CVFA 5HD4A 5AR4A 4CCUA 4E4NA 4BDCA 4O7LA 2W1HA 3F5UA 2XIZA 1UU8A 3QZGA 1OPJA 5DN3A 3PP0A 4ZJVA 5DT0A 2XBAA 3KRXA 4KINA 1G8SA 3K54A 3QCXA 4D4VA 2XEZA 4TNDA 2WTIA 3R04A 3NCGA 4FIEA 2QOCA 4JL9A 2XNEA 3IS5A 4L46A 4BWKA 5HU3A 5IUIA 3LM0A 2X8DA 4S32A 4YJQA 3KRWA 1FVRA 3ZUUA 4E20A 3MB6A 2QLQA 4ANSA 3AOXA 3BHUA 4CXAA 3ZLSA 3ZDIA 2IPXA 1YWNA 1JQHA 3R9NA 2J51A 4AE9A 1MRUA 3I60A 3CKXA 1K3AA 4FR4A 4WNOA 3TIZA 1JKTA 5GJFA 4ZXTA 4Y73A 1JSTA 2CKPA 4HGTA 1PKDA 3RK5A 5L4QA 4E93A 2VAGA 2X2KA 3BX5A 2JKKA 2WIPA 1YRPA 4PY1A 4UMQA 1MRYA 5F4NA 4DC2A 4PMPA 4MXAA 5K5XA 2GHGA 4LOOA 5AAFA 3ZRLA 5KNJA 4FTLA 4U7ZA 4ACCA 1FBNA 4O0TA 4O6EA 3FL4A 4YUQA 4R5SA 2JKMA 5CEKA 3CIKA 4L7FA 5TF9A 4N6ZA 4GJ2A 4FVRA 1YDRE 4O38A 5CU6A 1T46A 4M8TA 1TQMA 5B2KA 4XP0A 3UOHA 5HTIA 1OIQA 4GIIA 4GUBA 2IW6A 5DEWA 4KSPA 2R3QA 1OL2A 2CSNA 2HCKA 4FKPA 4YO6A 3HMPA 2Z7SA 4X0MA 4LI5A 2I0EA 3KMUA 4CFFA 3LMHA 1WAKA 3EQGA 5CVGA 3E88A 3QQKA 4UYAA 3D15A 5JZJA 1XH8A 1SYKA 4K8AA 4JJRA 4YBKA 4FSTA 3NUYA 3PRIA 4UV0A 3SHEA 1YDSE 1H24A 2V0DA 3KFAA 3W33A 4A06A 4XUFA 2VWWA 5IA2A 4IVCA 4RWIA 5D7AA 4PTCA 4JRVA 2R2PA 5DGZA 4YZNA 3FYJX 4IWQA 3VBYA 3Q9WA 4X21A 5BVWA 5GJDA 4XJ0A 4YMJA 2R3KA 3MVMA 4E4MA 3HGKA 2DUVA 4MBJA 2PK9A 5FWKK 5EQPA 3CY2A 1OUKA 2UZWE 2A1AB 1JKLA 2BMCA 4OTDA 5DR2A 5CEMA 4GKHA 3COKA 3IW5A 4ZTQA 4FTRA 3LJ0A 3ROCA 4ASXA 1JBPE 4D4YA 3VRZA 2CGUA 2PUPA 3RZFA 4GV1A 3HP2A 4DEIA 3IOKA 4XX9A 1Y57A 4W4XA 1NVQA 1OIRA 3TKUA 1ERKA 3FZSA 4FEUA 3OTVA 4IB5A 2C3JA 1UNGA 3AMAA 3DKCA 5J87A 4ASEA 3QCSA 1W83A 5T3QA 4BIBA 3LXKA 3UNKA 3QQLA 4IH8A 4EOQA 5EM8A 3TACA 4B99A 1SVHA 5CNOA 4BDGA 4BI0A 2VTSA 2PZIA 1FPUA 5CSVA 3WILA 4QTCA 5LOHA 3BU5A 5JFVA 4GFGA 2C5OA 4PP7A 3UQFA 3ZUVA 3C7QA 3FPMA 4XHKB 4DITA 4NL0A 4UZHA 3WIKA 5EW9A 4KSQA 3PIYA 2VTJA 4XG7A 4ASZA 2X8EA 5EM7A 3BLRA 4FX3A 2RFNA 3NW6A 4RIWB 3IDPA 5HE3A 3BYUA 3KF7A 5CU2A 1GIJA 4FZ7A 3REPA 3R7UA 4BCKA 4MVFA 3LLAA 4JAIA 4MXYA 4O7YA 2A2AA 4IEBA 4ZTNA 4D0XA 3F6XA 2UW8A 3WF5A 4R77A 1ZYLA 4QNYA 5HOAA 5FBNC 4OBOA 3KXMA 4IVBA 2VWYA 2GNFA 4Q9SA 5AP6A 3ZXTA 3E87A 3EFLA 3OFMA 5AUXA 3RK7A 1L8TA 3MI9A 2V62A 4EZ7A 5KMIA 5HLPA 4F63A 3ATSA 4F0GA 4FODA 5F20A 5CEOA 4OTRA 5I9ZA 2NNWB 3WZUA 4PUZA 3MVHA 5T6KA 2PE0A 3ZTXA 2BZIB 1ZOGA 4IZAA 3RWQA 4O84A 1GIHA 3BYSA 1CKPA 4W9XA 2NRUA 3DKGA 3UVQA 3RI1A 3SOCA 4EWHA 4FSMA 3UZTA 1HCLA 1OKVA 3ORXA 5AV0A 4A7CA 4EJNA 3UPZA 4YR8A 1X8BA 5L6WL 2XKDA 4E4XA 4O7ZA 4D58A 1YI6A 3W8LA 3BHHA 5FXSA 5CXZA 3DJ7A 2GNJA 2VWZA 2J50A 4ALVA 2EXCX 3AGLA 1H8FA 4L3PA 2XM9A 3QTSA 1QPCA 4EH6A 5BMSA 2YFXA 5CAVA 4C4JA 3TUBA 2QO9A 5H8EA 3DDQA 4LOPA 1OIUA 2J5FA 4TXCA 5EDRA 3U87A 4NSTA 2UZDA 3O51A 5BNJA 4DINA 3LFQA 4MHAA 4AT3A 4HVHA 4GU6A 4GU9A 5EDQA 5EW3A 2CKEA 5FGKA 3MVJA 3PXZA 2C5NA 3PJ1A 3ZEPA 3I1AA 3OOGA 5IUHA 4LV5A 5JGAA 4RZWA 3PY1A 1R1WA 4JT3A 1FVTA 3NYXA 3C4ZA 2RF9A 5M4IA 3QTRA 4KKEA 2VX1A 3JVSA 4XV3A 4CCBA 2J0JA 3BGQA 2XJ0A 2O65A 3PJCA 2YDKA 5CZHA 2ZV2A 4EWQA 4E26A 2NPQA 4JG8A 3WARA 2C6KA 5LCKA 4MQ1A 4EKLA 5KO1A 2UW6A 3F7WA 4USFA 5TR6A 4FVPA 3NIEA 4U3ZA 4CQGA 2YLFA 3OOMA 3OROA 4ENXA 3LHJA 5M07A 1R3CA 3LCKA 4IIRA 5ANKA 2B0QA 4J98A 4L6QA 4RQVA 1XBBA 1OBDA 3R1SA 4KS8A 5M4FA 1M17A 2LGCA 3R9OA 5CF8A 4IZ5A 3FXZA 2Z02A 4YO4A 1UWJA 3BV3A 3FUPA 2ZDTA 3LIJA 3VHKA 2J0IA 1XH7A 2HXLA 3FLQA 4TTHB 3JYAA 2GNLA 4ZJIA 3NRMA 5A4TA 4S30A 3GU6A 2JBPA 2PWLA 2W0JA 2V5QA 1UNLA 3LXNA 4MD7E 4TKSA 5FG8A 5CALA 3UOJA 5EQEA 2BUJA 4A9YA 2VGPA 2VTOA 2X9FA 3GCVA 5CEIA 4RLLA 3AC2A 3T8OA 2XNPA 3S00A 4JQ7A 3OT8A 3BYMA 2W9ZB 4AG8A 4TYHA 1ZXEA 4IAAA 4TPTA 5JN2A 1R0PA 5HG9A 2VWXA 2IW8A 1VJYA 2X6EA 2BAKA 2J7TA 3BI6A 4EK3A 4K33A 2AC5A 2QOQA 3QTIA 5E91A 4IAKA 4J97A 4E6CA 3OW3A 4L68A 4LRJA 2VTRA 4S31A 4S2ZA 5IH4A 3QX2A 1U59A 4MBIA 5HBEA 4BCHA 3ZOSA 2I0VA 4OTIA 1GZOA 3FZPA 3OY1A 4FTMA 5J9LA 1ZRZA 2GNGA 2HY81 5K0KA 1WZYA 1JSVA 3DT1A 3F2NA 3BHYA 4XG2A 1PXJA 3UYTA 5C9CA 4DGMA 3VHEA 2QHMA 3E93A 5HVYA 1NW1A 2YJRA 3C5IA 2YIWA 3F3ZA 4CZTA 1Y8YA 3OXTA 3ELJA 4JI9A 2OW3A 3Q6UA 3W2RA 5L2IA 1Z5MA 2R3MA 5JQ8A 4HOKA 2W05A 5FTOA 1A9UA 1IASA 2PL0A 3BLQA 3HV6A 4IAFA 3QA8A 3I79A 4PNKA 1BL6A 4CTCA 3R7OA 5BUEA 3ODYX 2C0OA 2XRUA 3HYHA 3S95A 5LMKC 3L8SA 1XHAA 2QODA 2VRXA 2YWPA 3L9LA 4UMRA 4C02A 3QF9A 3ALNA 2OXXA 2C0IA 5LMBA 3ORLA 2YCSA 3CTJA 4TN6A 5IA1A 3D5UA 2OKRA 2W96B 3RPYA 3A99A 1H1PA 3OUKA 3FKLA 5HNIX 2IWIA 5DNRA 1YXVA 3N4VA 4U9AA 3RPVA 3P1AA 4MD8E 3K3IA 4FV9A 4R6VA 4RVMA 1VEBA 3U9CA 4F09A 4CGAA 3VF9A 1LPUA 3RVGA 4CRLA 2HENA 2JDRA 4YLKA 2Z7QA 4J99A 4TL0A 1B38A 2C30A 4BR3A 4M7IA 4W4WA 4DHFA 2W99B 5IA4A 3HNGA 3QZIA 5DE2A 5L8JA 2IVUA 1H00A 3F82A 4QP8A 5AWMA 3FSFA 4GK3A 2WEVA 3FKOA 4EOKA 5AUUA 2PZRA 5J5SA 2WNTA 4QMZA 3UE4A 3OY3A 2PU8A 4ZZOA 2YERA 3UTOA 3KA0A 5CZIA 5EM6A 3DS6A 3G51A 2C3IB 5EI2A 4PDSA 2UZOA 3H9RA 2C5YA 2OFVA 2UW9A 3IPHA 3Q32A 3PWDA 1GNGA 3QLFA 4LL5A 4NTTA 4OT5A 2VWIA 2BZJA 5AUTA 1U54B 3KVXA 3F7ZA 1WVXA 3QGYA 4FL2A 4I6QA 4KIOA 4A4OA 3OCGA 4FSYA 3RCJA 3TCPA 4QP4A 5CYIA 2HZ0A 3PG3A 3FC1X 3GBZA 4LYNA 4FT7A 4B8LA 2BFYA 4C34A 3GOPA 4AW0A 3Q53A 2QOIA 3MFTA 2O8YA 4K11A 5HLNA 4NM5A 4QMVA 4CKRA 1WBWA 2ITZA 3LLTA 2RGPA 3KMMA 3ERKA 2OJGA 1TKIA 4RIYA 4V04A 3CP9A 1OL5A 4FF8A 4I3ZA 5A4QA 2QOOA 5M4CA 4BHZA 2CHLA 5J7HA 1BMKA 2PVJA 2V7OA 3R8MA 4DCEA 5CAUA 4OTPA 3O8PA 4HZRA 5E1SA 3FMNA 4M0ZA 3TNWA 1H01A 2XNMA 5GJGA 5A46A 1PXKA 3S3IA 4QP7A 3A7IA 3AGMA 3KXHA 2VNWA 2XRWA 2HZ4A 4DGOA 3CQEA 3RPOA 5A9UA 4WHZA 2PVMA 2O64A 4BI1A 2EU9A 1H0WA 1RW8A 3MIAA 5JQ5A 2XUUA 3F69A 3KN6A 4BGHA 4E6AA 4FK3A 2VTMA 4YJUA 3VVHA 3RM7A 4MAOA 4ZTSA 4BWXA 5E8WA 3HRFA 4WSYA 4O82A 3NX8A 2YABA 4NW6A 4QO9A 4D2TA 5KMJA 4EYMA 4K18A 3SX9A 2Y8OA 3OC1A 5AMNA 4Q9ZA 4FG9A 2BILB 1ZY5A 4X3FB 1BI7A 4R1YA 4W8EA 4WO5A 3C1XA 3Q52A 2R3GA 4GYIA 3P08A 4DLIA 1DS5A 4GT5A 1GZNA 4CFUA 1ZMUA 4O7NA 4RQKA 4QTEA 1JPAA 3N4UA 2QOFA 3OWJA 4UMTA 4QYGA 3D7TA 3AG9A 3ZO4A 2YM3A 1JWHA 5IG1A 4J1RA 4BCFA 2EUFB 4FKVA 5CLPA 2GQSA 1LP4A 4L45A 4RIXB 4L67A 5GINE 3H4JA 4FKOA 4NIFA 2VUWA 3CPCA 4IFGA 4J52A 4ANMA 4I0SA 3CS9A 2HZNA 4EOSA 4NCTC 4RX5A 4BKYA 3OP5A 4BWPA 4ZLOA 1K2PA 3U6IA 5L2QA 4K1BA 4PPCA 3OT3A 4O6LA 3ANRA 1IEPA 1Q41A 2OI4X 2WTVA 5EYDA 5FEDA 4EQCA 1F5QA 3CC6A 1WBOA 4PRJA 4RBLA 5I5ZA 1GJOA 1J91A 3JXWA 2WMBA 5KZIA 2QURA 4TYJA 3NVMB 3A7GA 2BDJA 4DFUA 3BZ3A 3A7JA 2X7OA 3OTUA 4BCNA 1AGWA 2ZVAA 4QTBA 5HO6A 2VD5A 4CFMA 5CSPA 3O0GA 4DG0E 4QD6A 3OEFX 4QYHA 4WUNA 3VJNA 3ZS5A 4RG0A 5HQ0A 3UOLA 4Q2AA 2I1MA 3HX4A 2RKUA 5ANOA 4PQNA 1H27A 2JDSA 4NWMA 4DEEA 4RZVA 2VWVA 4BDFA 2WMSA 3NDMA 3VBXA 4RMZA 4UXLA 3IW6A 2XIRA 1UU7A 3GEQA 2DWBA 4YPSA 1CKIA 5HNBA 4NFMA 3VNTA 4C0TA 5BVOA 5CVHA 3Q9YA 4MEDA 4JNWA 1REKA 5FUTA 4O7VA 4FYNA 3KKVA 3B2TA 3Q60A 3R1YA 4YU2A 1OL7A 3GENA 5GHVA 3DNEA 3DCVA 3MYGA 5DT3A 4BKJA 4BTJA 1JLUE 4KIPA 5E8TA 3ZRKA 1OPLA 1V0OA 4AZVA 1S9JA 2ITWA 4DGLC 5IZFA 4PP9A 5M4UA 4WG3A 3TM0A 2WEIA 2FSOX 4DFLA 2OH0E 3IG7A 2X1NA 2HWOA 4HZSA 4IQ6A 2GTNA 3LPBA 4LG4A 4XH6A 2JLDA 4XOZA 2QI8A 4IB3A 3LFAA 3FJQE 4Y8DA 4IWDA 4QQ5A 4IE9A 4Y83A 3D9VA 5HG5A 1PKGA 3VUTA 2XZSA 4CV8A 2I40A 4KBKA 2R4BA 3PA4A 4F6UA 3EQCA 3DK3A 5E8UA 4IM0A 1PW2A 1W82A 5IH5A 3C4FA 2CNUA 2Q0NA 4HW7A 3CQUA 3DBQA 3TZ7A 4IFCA 4B6LA 4TNBA 2JKQA 4FKQA 4BC6A 4F9AA 4IX3A 3ZFMA 5IQIA 3QXPA 2JAVA 5IISA 4BYIA 3OF0A 3C50A 1ZYJA 4ZZNA 4ZTHA 5AP3A 3EN5A 1YWVA 4FIIA 5LWNA 1P4OA 2VN9A 4M67A 2C4GA 2WMVA 3MBLA 5GNKA 1Q61A 5JZNA 2WTCA 3QQJA 3VS3A 4CMOA 3O23A 5ANGA 4O7WA 3NUXA 2IN6A 2UVXA 3FPQA 2CLQA 3R1QA 4MWIA 4YC3A 5BMMA 4FSWA 4EC9A 1PMEA 2EB3A 3NYOA 5GZ8A 5K4IA 1AQ1A 2OZAA 4MBLA 5AR7A 5L6OA 1MRVA 1OECA 2UZUE 3H0ZA 2ZM1A 5D9HA 5DWRA 2WMAA 1B6CB 3F9NA 4GKIA 3VW6A 2RFSA 2ZV9A 1V1KA 3PSCA 3PP1A 3BV2A 1PMUA 5CWZA 4MNEA 3PLSA 3EYHA 3R7IA 3DBFA 2RFDA 4H3QA 4XV9A 4LV8A 3F61A 3GCPA 4FBXA 2JDVA 3B8RA 5AV3A 4JBVA 4C4GA 2ZJWA 3BBWA 3RALA 2OLCA 2C5XA 2JC6A 3QXOA 3I0OA 5AX9A 2F9GA 1OGUA 1CDKA 1JKSA 2QOLA 3TNIA 2IG7A 4G31A 3O8UA 3VUIA 2PE1A 4QP2A 5JFSA 3KY2A 4U43A 1GIIA 2R3RA 2EWAA 5EYCA 2J2IB 3O7LB 4ZTRA 4BIDA 1O6LA 3DJ6A 5A4LA 3HAMA 1OL6A 2W9FB 4D5KA 4DCAA 3NPCA 4NZWB 4CFVA 4L00A 2HZIA 3Q9XA 4G3FA 4UYNA 2ONLC 4GMYA 5IQGA 2Y4IB 4JDKA 3HV7A 3PIZA 1SM2A 3O50A 5J5TA 4TWNA 3VS6A 2G2HA 3DBDA 3PG1A 3DPKA 3QTWA 3QWJA 2X8IA 4QYFA 5TKDA 4A9SA 2OZAB 5HI2A 3MESA 5G1XA 3FLZA 3OCSA 4CFWA 4QMNA 3EH9A 5JKGA 3D5VA 2PYWA 4AWIA 4C4HA 3KN5A 2W4OA 3BYOA 4GEOA 3A60A 4ZLZA 5IQCA 3HMOA 4F4PA 2OG8A 4EYJA 4FZDB 4ZIMA 4WBBB 4QMXA 5C03A 3CEKA 4AOTA 1UKHA 1Q97A 3MA6A 4YZBA 5I0BA 3E7OA 3ZO2A 4FTOA 5E8VA 5DPVA 3AC8A 4ACHA 4QMPA 3R63A 3I0QA 3PXRA 2ZMCA 3W18A 4FGRA 4KBCA 3W32A 5ITAA 4HYSA 4GG7A 4Z7HA 4GJ3A 4IVAA 1NY3A 3R2BA 1H4LA 5AM7A 3C5UA 2FB8A 3D4QA 4MF1A 3ZSHA 2R0IA 3LFNA 4C59A 4Q5HA 3V5TA 4EK4A 4OAVB 2PUUA 3ORPA 4NEUA 5FP5A 5LQFA 4TYIA 4ZTLA 1XBCA 3RNIA 2JFMA 4XLVA 3C0HA 4FNXA 1KV1A 3BHVA 4DA5A 4XS2A 1VYZA 4RFZA 3R9DA 1OUYA 3C13A 1WVYA 4H39A 4GCJA 5CF5A 2YDJA 5AUWA 5DRDA 2CGXA 5H3QA 2YDIA 4KIKB 4E7WA 3ZZWA 4G16A 4F65A 2C6LA 2XK3A 2IW9A 2J5EA 2XKCA 1DM2A 4GG5A 4D1SA 5C8KA 2OJJA 2HW7A 2XF0A 3EZRA 1J1BA 3PXYA 3Q5IA 2IVSA 3ZXZA 1H08A 3C4CA 4U80A 3GQLA 4FIHA 5I9UA 1J3HA 3R8PA 4I94A 5CF4A 5HCXA 4FV5A 1WBNA 2C3LA 3GQIA 2WHBA 5HTBA 4G1WA 2PE2A 4FNYA 5M53A 4DN5A 5AJQA 5F9EA 3G6GA 3UG1A 3JPVA 1YVJA 4RT7A 2ITUA 5CSXA 4BBFA 3EKKA 2OJFE 3G6HA 4FSNA 2J9MA 4GS6A 3GFWA 4R3RA 3RWPA 4HVDA 4XG4A 4CTBA 4E5BA 1L3RE 3AT3A 4DH1A 3KRLA 2ITTA 3MFUA 3H9FA 5LVLA 3V5JA 4K0YA 3FDNA 1K9AA 4FL1A 2WTKC 5B7VA 2XJ1A 3ACKA 3LW0A 2SRCA 4AFEA 2YIYA 3GCQA 2Y4PA 4IX5A 3FMKA 4JIAA 1FINA 1OL1A 2YM6A 1ZZ2A 3BIZA 2G1TA 3D94A 3GU8A 4RC2A 4ORKA 2PMOX 4CNHA 1WBVA 2JIVA 4Y5QA 3FE3A 1OIYA 4USEA 3ZFXA 2C3KA 4EK6A 1E1XA 4EH8A 3NVKI 4MTAA 4QTDA 3UNJA 2R3IA 3SRVA 2H9VA 4QQJA 3UZRA 3NAYA 1B39A 4IWOA 3OZ6A 3MY0A 4QNAA 3FBVA 1YKRA 4O0RA 1UU9A 4LRMA 4RJ7A 3QHWA 3FHIA 4DTAA 2E9UA 2WO6A 3FQHA 3BGPA 5TE0A 2PVHA 5AEPA 5HE2A 4O83A 1YXUA 3DNDA 3KK9A 5ANDA 3HAVA 1J1CA 5HIBA 4QP6A 3KXNA 4FV1A 1QPDA 2HXQA 2GNIA 4G17A 4BB4A 4OR5A 4PDYA 3RKBA 5KBRA 4RA4A 1H1QA 3NIZA 2FA2A 1RJBA 2W5HA 4FTCA 3RAHA 2YISA 2OF2A 4FGBA 4DGGA 2GPHA 2GTMA 2WGJA 3D83A 3OD6X 4RVTA 4XOYA 3VRYA 2Z7RA 4NM0A 1XR1A 5FEEA 2UUEA 3ZZEA 1H28A 5GZ9A 1GZ8A 3NR9A 3PTGA 2ZV8A 4ANNA 4CMUA 3CCNA 4RSSA 2B7AA 2G2IA 4NFNA 2B1PA 4E5AX 4GVJA 2IJMA 4EBWA 3NNUA 4I24A 4IANA 3RM6A 3EQRA 4FKIA 3W2OA 3U6HA 4GW8A 3U55A 5KBQA 3FLSA 3HMMA 5FD2A 3RHXA 4ENYA 1NA7A 2FSTX 1YDTE 3FYKX 3QGWA 3QTXA 4RC4A 4YZCA 3JUHA 1IAHA 4BBEA 1UVRA 2W1DA 4YTFA 3TL8A 3FKNA 4YJNA 5BYLA 4DF3A 3NNVA 4UALA 4AGDA 5DI1A 3I6UA 4EHVA 2XNOA 3QHRA 3BPRA 4PX6A 3GC7A 3QU0A 2X2MA 2OBJA 4XP2A 4ASDA 4LL0A 4WT6A 2GHMA 3C4EA 4FVQA 5D11A 2XVDA 1XH9A 1SVGA 4DEAA 3A8XA 4JDIA 4QMYA 3ZO1A 5J9YA 4OBQA 4MF0A 5EKOA 5J1VA 4X3FC 4C3FA 2JGZA 4ZSAA 4KUJA 2VU3A 3RP9A 4IVDA 4ANQA 2PY3A 4C33A 2G15A 3AQVA 3MY5A 4M69A 4XCUA 2C5VA 4BZNA 1PY5A 4XNEA 3UP7A 4ZP5A 2ZV7A 4ARKA 4IM2A 4TT7A 4JIKA 4U42A 3VAPA 2H34A 5DMZA 3ORMA 3PZEA 4IBMA 4O1PA 2RFEA 1Z57A 3LCOA 5H9BA 2ETKA 5FLFA 3VUMA 3RCDA 4NK9A 4DH8A 2WFYA 3UIUA 4O91A 3S1HA 3FMHA 1O6YA 3GGFA 4ANBA 5JH6A 2VX3A 3S2PA 3Q6WA 2ERKA 5E90A 4MX9A 1Q3WA 4X2FA 5HIDA 2REIA 2PVRA 4JS8A 4FE2A 3DQXA 3KGAA 3LMIA 2QNJA 4CV9A 4HYIA 3V6SA 2R3PA 4EHGA 3BU3A 1M2PA 3NZ0A 4BCPA 4BIEA 2KULA 3DV3A 4BN1A 4FZ6A 2GQRA 1M2RA 3GU7A 3G2FA 4L8MA 4EH2A 1FGKA 4M69B 3ET7A 3LM5A 4IX6A 1OKZA 2BIYA 3GU4A 5C4LA 3UO5A 3MFRA 3MDYA 1DI8A 3IDBA 4EONA 1YOLA 5JK3A 3BEGA 4WIHA 4JBOA 5J1WA 1UNHA 4QMUA 2E9OA 4HPTE 4L9IA 5EK7A 3LQ3A 5KHXA 2ZM4A 4FTIA 4IWPA 3VJOA 2V55A 3BRBA 4O0XA 4L43A 3UC3A 2YIQA 3GNIB 4FNZA 4C7TA 4FSZA 5M44A 2BZHB 4X6QC 4BDAA 1Y6BA 3FAAA 4CG8A 2YCQA 3DXNA 4HYHA 4XRLA 1Y8GA 2R0UA 4PMSA 3U4WA 5M08A 2IZUA 3EN9A 4ZY5A 2XIXA 3EQIA 2A19B 3M11A 4FT3A 3I81A 2R7BA 3A8WA 4LMUA 4R7IA 4BDIA 3QUPA 5CT0A 4BCQA 4C4FA 4JOAA 1JVPP 5HO7A 3FI8A 2C6MA 4M97A 3R71A 3R8UA 3TKIA 4H3PA 4V0GA 2EXMA 3E62A 4QMOA 3MH3A 3G9NA 3R00A 4B9DA 2J90A 3SG8A 3PJ3A 4ZOGA 4TWCA 2OIDA 3Q2MA 5AR2A 2FSLX 4OGRA 5C27A 3W2QA 1H1SA 3FHRA 3OWKA 4AT5A 4IDVA 3QQHA 1CMKE 2AC3A 4AGCA 4H36A 4EUUA 3TNQB 5E4HA 2QOHA 1V0PA 3ROYA 4HPUE 4DLJA 2I7QA 3ODZX 4G3GA 5DR6A 3T3VA 5KKRC 4NM7A 3UQGA 1MP8A 3PPZA 1NVRA 4X2KA 3ORKA 4BVUA 2WQBA 4I6BA 4IJ9A 3HMNA 5AV1A 5CS6A 3BU6A 2WQMA 3UVRA 2QO2A 2X7FA 1XH5A 4FMQA 2JD5A 4FZAB 4O1OA 4U8ZA 4AQCA 3NYVA 4LGHA 2C6IA 3DY7A 2HIWA 2F2CB 3ZSGA 4D9TA 5J79A 3N4TA 3QKKA 4X7QA 4D2SA 3WF8A 4QT1A 4N6YA 2WMWA 3LFCA 3HRBA 4MD9E 4BBMA 1XBAA 1QPEA 4EK5A 5FBOA 3VC4A 2JBOA 3V8TA 3ZONA 5B2LA 4O7TA 4DTBA 1U4DA 3Q96A 3SW4A 2DQ7X 4ANLA 1P2AA 1R78A 3F3WA 5EYKA 4QQTA 4APPA 3V6RA 4UEUA 4H05A 1A48A 3Q5ZA 4RC3A 4FYOA 3D7ZA 2BPMA 4E4LA 3P86A 4FV7A 3OBGA 2W1CA 3M42A 1CM8A 3DOGA 3UVPA 4XG8A 4TYHB 3L9NA 5L2WA 5IQHA 2FVDA
chains in the Genus database with same CATH superfamily
4ZY6A 2NP8A 4XBUA 4C4IA 4L7SA 3ANQA 3EQBA 3PJ8A 3F2RA 2F49A 2IVVA 4MQ2A 4A9TA 4XEYA 4XV2A 5KMOA 4FIJA 5LVOA 4B7TA 4QPMA 5IDNA 4HNIA 3CQWA 4J8NA 4U0IA 2C1BA 4TYEA 4FIFA 3R21A 2Z2WA 5FM3A 1H07A 3R2YA 4P5ZA 3II5A 4AGWA 3OWPA 4D4RA 4FNWA 3TXOA 3NNWA 2IEWA 2J4ZA 4FICA 2QOKA 5ACBC 4U5JA 3VUKA 3AXWA 3LOKA 3R73A 4IB0A 2BKZA 4M0YA 4D2RA 2CKQA 3MH1A 4JDJA 5HG7A 5DT4A 2Y6OA 1QMZA 3DGKA 3DK6A 3F5GA 3LFFA 3PXKA 2PZPA 4ZZMA 4AU8A 2YIXA 2OJ9A 2QHNA 1OVEA 2QR7A 3MN3A 4LQMA 4P5QA 3KULA 1G8JA 5M09A 3EWHA 4ZLYA 1WVWA 4H3BA 2BAJA 4XYFA 2ZFYA 4EZ3A 1YXSA 4WD5A 2QKWB 1HCKA 4QOXA 2UVZA 2XK9A 2UZLA 4CZUA 4QMTA 3G33A 2XMYA 3LXPA 1KE5A 3SOAA 4CSVA 2VTNA 3IW7A 4BCMA 2VO0A 3QALE 4G3DA 3RHKA 5CI6A 2OXYA 1SMHA 1G3NA 3CGFA 4KRDA 1YWRA 4WKQA 4FT9A 2PHKA 3V8SA 3QD0A 4KRCA 3E3PA 1JKKA 1YI4A 4W8DA 3GOKA 3I7CA 3SAYA 5IF1A 2PUNA 2WAJA 4GL9A 3D5WA 5D10A 4AZWA 4XG9A 2XEYA 4L42A 5HICA 3V01A 4H1MA 4J96A 4XV1A 3T9IA 3ZH8A 4ZMFA 3RZBA 3NUUA 4AXAA 2J0KA 2B54A 2BDFA 5E92A 2ZYBA 4HVGA 5A54A 4D1ZA 4KKGA 2LAVA 3D2IA 5KMMA 4OT6A 4Z16A 4RWJA 3AC3A 4GH2A 2C6DA 3KCFA 4AZFA 2XK8A 3UIMA 3WF9A 3E5AA 3DTCA 3KULB 5KMNA 3FY2A 3MWUA 2X2LA 3FLWA 3IKAA 2VWUA 4TZRA 4R7BA 1E1VA 3LCDA 4YHTA 3MGYA 3V5WA 3IGGA 4PNIA 4CT2A 3AKLA 5KHWA 2WPAA 1MUOA 4FL3A 2YIRA 4FSUA 4PPAA 2R64A 3U51A 2XBJA 4M66A 1YHVA 2X4FA 4JXFA 4BZOA 3FMEA 1J7IA 2YN8A 2QG7A 1O9UA 2DS1A 3PA3A 4QTAA 4RJ8A 4U40A 4AW1A 1ZMVA 2JAMA 2W5AA 5CAPA 3R9HA 2HWPA 5E8YA 3EFKA 5EHLA 2PSQA 4G6LA 1UV5A 4RJ6A 4AN2A 4CFNA 2R9SA 4NJ3A 4BZDA 3LFBA 3NSZA 3QAME 3HMIA 3QTUA 4QP3A 4AW2A 2ESMA 3DZQA 4PTGA 5E8XA 1IRKA 3V5LA 3ID6C 3BYVA 3DFCB 3DTWA 3HA8A 1UU3A 2Y7JA 4I0RA 2WU6A 3QC4A 5IQAA 4DHIB 3FY0A 5H8GA 1WBTA 4QMSA 5HHWA 3TT0A 4RVKA 5I9YA 3NCZA 4G34A 4DE4A 4MH7A 4MCVA 1YOMA 3UZPA 5HD7A 4ZK5A 4ZSGA 3ZDUA 2BRMA 4ALWA 4NH1A 4YLJA 4RIYB 4A9RA 2C6TA 4CYIA 5LXMA 4JRNA 4PMMA 4EOPA 1PXPA 3EQFA 5IEXA 5DIAA 4AGUA 4EHEA 3H9OA 5FRIA 1Y91A 2HY0A 4GVAA 3RINA 4FSRA 4YZ9A 3ZCLA 4WRGA 2B9IA 5E7RA 4C3RA 3VUHA 4BCOA 4R3CA 3E3BX 5K9IA 2XKFA 2HK5A 3E92A 2IVTA 2YM4A 4ACDA 1W2FA 3OS3A 1SNXA 4MXXA 2CMWA 4XG6A 3LJ1A 3V51A 2EXEA 2YAAA 4GYGA 4WRSA 5DLSA 1Q8UA 4C8BA 4EBVA 4O86A 1VLRA 2QONA 3P4KA 4FUYA 2AEGA 4FEVA 4FKTA 4P90A 1XH6A 2BTRA 1XKKA 3NUPA 3OW4A 5CSWA 4AF3A 1GAGA 2OU7A 3A7FA 1DAWA 5JFXA 4DT9A 3LQ8A 4DEBA 2RSVA 2P33A 4QMQA 3SVVA 3LAUA 3JR1A 4WOVA 4O4FA 5B0XA 4FV8A 2BHHA 1Q8WA 1SZMA 2YM8A 3LE6A 2ZOQA 1IR3A 3OBJA 4LUEA 5CI7A 2BDWA 5DG5A 3RAIA 3K3JA 4N57A 5H2UA 3C51A 1MQ4A 3LMGA 2BIKB 2P0CA 3ZMMA 5KMKA 2G2FA 4KS7A 5TOZA 2E2BA 5CU0A 2CPKE 4E1ZA 3D7TB 3FZ1A 3Q4CA 3R7GA 4FTNA 5BVFA 4UX9A 3ZUTA 5CQUA 3COIA 3TZ8A 2F7ZE 5HZNA 2ITYA 1REJA 2XCHA 1Q3DA 4EQUA 2FGIA 4NIFB 4DFBA 5K0XA 4K77A 2PVFA 1G5SA 3QRTA 1IAJA 3BKBA 4IADA 3UGCA 4BFMA 2QLUA 4PF4A 3QYZA 3VBQA 3EFJA 4C37A 2XM8A 3PSBA 5EH0A 1FQ1B 1W0XC 4JLCA 3EMGA 4QPSA 3VBWA 2CCHA 2YCRA 4IAIA 2ZMDA 2H8HA 4EI4A 3SDJA 2YEXA 2QU5A 4Q5EA 4BDHA 3KXZA 3AMYA 4KB8A 5C1QB 4OTHA 4E3CA 3NUAA 5C01A 4IMYA 3P79A 4I5MA 3LKMA 3QZFA 4TWOA 5HIEA 4DEGA 1YXTA 5A6NA 3PYYA 2XK7A 3AD5A 3OCBA 3PA5A 3PFQA 3IDCA 1FMKA 2R3JA 4L53A 5EHOA 4F9CA 2G01A 4IZ7A 2Y6MA 2OIBA 2Z8CA 4FKSA 3TUDA 4WA9A 4DFZE 2V7AA 3W16A 4EORA 4AOIA 4PL3A 5TO8A 3C9WA 5BUJA 4DAWA 4I6LA 2VZ6A 3ORNA 4GFMA 4PL5A 3HV4A 2QOBA 1YOJA 4NW5A 4BL1A 4N4SA 3DLSA 1TQIA 1ZOEA 3UQCA 4O2PA 4FTJA 3EN6A 3IECA 3MW1A 3DBCA 3TV7A 4DTKA 2CNQA 2W1EA 2XNGA 3FI4A 3ZM9A 4QRCA 1V0BA 2VO7A 2W1FA 3R8VA 4C36A 2PMNX 3ZEWA 1KOBA 4F6SA 2W7XA 3EFWA 3TV4A 3DAKA 1PXIA 2FH9A 3R30A 3EQHA 3NGAA 3QRJA 2W4JA 3F3UA 3TNHA 4O4CA 5K5NA 3C0GA 4RX9A 3FZOA 3BGZA 4RX7A 3PE1A 4WSQA 3Q9ZA 5BUIA 5LMKA 2ACXA 4XBRA 3UDSA 4LUDA 1ST4A 4J7BA 2WIHA 1RE8A 3L1SA 4UZDA 3KF4A 4YPDA 3Q2JA 1PJKA 3EL8A 1WMKA 4I92A 5IMXA 5JRQA 3D0EA 5AUZA 3QRUA 3UG2A 3P9JA 5G6VA 4BDDA 5L3AA 4XRJA 4JBQA 5AFVA 3HZTA 3OXIA 4OTGA 2VTLA 2UW4A 5AR5A 2QVSE 3FLYA 2ETMA 3ULIA 4XP3A 4F7SA 1IG1A 4FT0A 2JITA 4FA2A 2VGOA 3DAEA 3QUDA 4U44A 5C26A 3EN7A 1OBGA 4GT3A 4MXCA 4O0SA 4M84A 2YWVA 3FV8A 4G5JA 2C6OA 5EI8A 5HE0A 3ZC6A 4FIGA 3NUSA 2XAOA 3M2WA 4JR3A 3TTJA 4B0GA 4D5HA 1OZ1A 4DEHA 1YQJA 5D12A 2OJIA 3G0FA 4KBAA 3GB2A 4JQ8A 4C38A 3AKJA 2A0CX 2WELA 3WZKA 4JR7A 3JS2A 4BF2A 4QPAA 2VTQA 2I6LA 2W17A 3TDWA 3JY0A 4UWYA 5EW8A 4RGJA 4IACA 4AOJA 2PVNA 5ANJA 2H96A 4OTWA 5AP4A 3GUBA 4YTCA 5KMLA 3PJ2A 4QEBA 1M52A 2WQOA 3FZTA 2CN5A 3EOCA 3TWJA 4BDEA 2AQXA 1YHWA 2FSMX 4MNEB 1BYGA 3MB7A 3P0MA 4ZSJA 3UMWA 1NVSA 3R7YA 4CFXA 2GMXA 3UC4A 4CEGA 4DFXE 4F0IA 5A14A 3QKMA 3EYGA 3V5QA 3VBTA 2OWBA 2F57A 3NNXA 3PDTA 2BRNA 4AACA 2XNBA 3QUEA 2AYPA 2J6MA 4P4CA 3S4QA 2YCFA 5AM6A 5IQBA 3LJ2A 1U5RA 4O27B 2OICA 3EQDA 1ZYCA 4XMOA 4HJOA 4K9YA 1RQQA 2X6DA 4Z9LA 3GT8A 2UVYA 1WBPA 4H1JA 5EOBA 5HCYA 4J71A 3V8WA 1AD5A 4F64A 1IA9A 3EHAA 4JAJA 3ZU7A 4G3CA 1KUTA 3QQUA 3EQPA 3SLSA 3HVCA 4NYEA 2QQ7A 3P23A 4M12A 1WCCA 3MJ1A 2GS7A 4GFOA 1H1WA 4CRSA 2PZYA 5BVKA 4DT8A 4FEQA 4KD1A 4OBPA 3AKKA 1OPKA 1ZYDA 4FV6A 3O7LD 1BI8A 4QMWA 2OGVA 2VTPA 4FOCA 3CXWA 4FRFA 3CSVA 4O81A 2WMQA 4U97A 4YNEA 3UO4A 4U41A 3HDMA 4Y85A 5IA5A 5B2MA 2X4ZA 2Z60A 3NUNA 3GVUA 3DQWA 5KZ0A 5CX9A 3ZBFA 4EC8A 4ZJJA 4MK0A 3PZHA 3BL7A 5I9WA 3VUDA 2PPQA 4C57A 2X39A 1VZOA 2KTYA 3NEWA 5CENA 5I4NA 4FTQA 4CZYB 2CLXA 3WOWA 2CJMA 2X81A 3VF8A 3DA6A 3UJGA 3PXFA 4UMPA 5L2TA 2W1IA 5LVNA 2BZKB 4YC6A 3HUBA 4MNFA 4RWKA 1R39A 4WUAA 3A61A 1E9HA 2XIKA 3CJFA 3O8TA 5EG3A 5HKMA 4C62A 4E5WA 5CY3A 1W8CA 3S0OA 2QG5A 5LVMA 2O5KA 4JG7A 3ZSIA 4PV0A 4II5A 4HCUA 2UW7A 2OO8X 4AXDA 4YC8A 3A7HA 3O5AA 5GZAA 5I3RA 2F7EE 2W5BA 4JX3A 5L8LA 4A9UA 3OUNB 5E8SA 4F08A 1O6KA 3MFSA 3QX4A 2X0GA 3U8WA 2ZB1A 3ZLWA 3WIGA 2Z7LA 3JY9A 3W55A 4NKSA 1DAYA 2YJSA 4EEVA 5TT7A 4NCTA 5CAQA 4KKHA 1FVVA 2JDOA 3R22A 4OTFA 3SC1A 3QFVA 3SXRA 3U9NA 2IZSA 5EKNA 5DA3A 2HW6A 3LXLA 2CGVA 1PHKA 2I0YA 4I5PA 4IC8A 4UBAA 2R3LA 2GNHA 3QD3A 2YZAA 4JBPA 4ITJA 3COMA 1URWA 3PVBA 1ND4A 1XO2B 2JDTA 2YM5A 4W4VA 4EHZA 1BUHA 5HBJA 1VYWA 3FQSA 3OXZA 3VIDA 3F2AA 3VO3A 2YM7A 4ONAA 3ZHPC 5CT7A 3R8LA 5DBXA 1PYEA 1JSUA 4NJDA 3QD4A 3R1NA 3ZC5A 2ITPA 2OH4A 2BAQA 3SG9A 4BTMA 3TEIA 3OVVA 3E7VA 3I6WA 4QMLA 4EL9A 3AMBA 4QDVA 1OKWA 3O2MA 3ORIA 3UOKA 4MKCA 4RLKA 4CYJA 4BKZA 4F9YA 2RL5A 3FMLA 3TI1A 3VQHA 4G9RA 5ETAA 4EH7A 3H30A 5L6PA 5LWMA 4CMTA 5J7BA 5AA9A 4BTKA 3PWYA 3R6XA 3B2WA 3UYSA 3UBDA 1W84A 3FC2A 4RIWA 3W2CA 3O96A 5JT2A 4R1VA 3SRVB 3ACJA 1EH4A 3AT2A 1ST0A 4NTSA 3MH2A 4AX8A 4A07A 5HLWA 3MS9A 2GHLA 4GIHA 1IA8A 1KWPA 2WD1A 3M1SA 4G2FA 3KU2A 3QCQA 4I6HA 4NUSA 4O0WA 3CJGA 3KXXA 3L8XA 5EQYA 3SKCA 3AD6A 5A4EA 1PXNA 3BEAA 3I4BA 2OSCA 4NKAA 4TYGA 5HX6A 4N70A 5CNNA 3VUGA 5BYYA 4W4YA 1XWSA 2WKMA 3T9TA 4FKJA 2BCJA 4JG6A 4F1MA 2ITXA 3LFEA 5AR3A 3JVRA 4EJ7A 4BY9E 2B52A 4IAZA 5EM5A 1KE7A 3DFAA 3VWAA 3KRJA 5FTGA 3AC5A 4YP8A 3QYWA 5HTCA 3F3VA 3WE4A 4AAAA 5D1JA 4D2WA 4YNOA 5AUYA 4O96A 3PPKA 2VO6A 2ZB0A 3G90X 5IUGA 4KIQA 4YBJA 2X7GA 4P7EA 5J95A 3SQQA 5KX8A 4AUAA 4MWHA 5J8IA 2CN8A 2JKOA 5FTQA 2R7IA 5AP5A 3WYXA 5JFWA 3W8QA 4R5YA 4YJTA 5FP6A 1JAMA 3K2LA 4TW9A 3HA6A 3GCUA 5IDPA 3VS1A 5HCZA 2B9JA 2JFLA 3MVLA 4RJ5A 1H0VA 2OIQA 3DXQA 5AA8A 4GT4A 5AIKA 5AIRA 3TIYA 1OMWA 4C2WA 4WG5A 4PDOA 5IQDA 3VS5A 4ID7A 5M57A 3O17A 4RIOA 1M2QA 3D14A 4AN9A 5GIPE 5AUVA 3BLAA 4K6ZA 3CY3A 3DAJA 2XIYA 4JX7A 3BE9A 2C68A 2ETRA 4PMTA 4WNMA 1Q8YA 4ZSEA 4C2VA 4C58A 4L3JA 4EOMA 4ZAUA 3FEGA 1PMNA 1Z9XA 3DLZA 2W1GA 4DFYA 4F1TA 3QRIA 4F7LA 2XARA 3PLAE 2ZAZA 4Y95A 3R8ZA 3QQGA 2OK1A 1TFFA 3O71A 4RFYA 4YJPA 3RGFA 5AP7A 2R5TA 3HECA 4YHJA 3IOPA 4HGSA 1UKIA 4ITIA 4QMMA 1OI9A 4ACMA 1JNKA 3R9RA 2PZ5A 2P4IA 3Q04A 5FDPA 3GI3A 1F0QA 4UWCA 2WMXA 3THBA 3R0TA 3WZEA 3KB7A 2GS6A 3GC0A 2ONLA 2W4KA 2UZEA 2H6DA 4FK6A 2B9HA 1TZDA 2BROA 1BX6A 4Z55A 4BCJA 4IW0A 3MTFA 3MA3A 5D7VA 3ENMA 4APCA 5CEPA 2V22A 3TDVA 2PTKA 5E1EA 2QO7A 3H10A 3UIXA 4EH9A 3LCSA 3QKLA 3QTQA 2BRGA 1UA2A 5IA3A 4QP9A 4DBNA 3Q4ZA 4JVGA 1PXMA 2WXVA 3TUCA 3H3CA 3BCEA 2OFUA 4F9BA 4M3QA 4EUTA 2RIOA 3PUPA 4GK4A 4RWLA 2PVYA 2JEDA 3DK7A 4FT5A 4YSMA 5EOLA 3QRKA 3U54A 4K2RA 1ZMWA 2P2IA 3BQRA 5ANIA 3KCKA 4UWBA 5CEQA 4O0UA 3GFEA 2JIIA 3CBLA 5AP1A 3FSKA 2BVAA 3PY0A 5IH6A 1ATPE 3FWQA 4M68A 3CKWA 1G8AA 4FC0A 1OM1A 3FMDA 4FZFB 1KV2A 5C8NA 4DEDA 3A4PA 1XJDA 4I41A 4WNKA 4I93A 3TZMA 2FUMA 4C35A 2Q0BA 4IX4A 1NXKA 3UODA 2A27A 2J0LA 4QQCA 4D55A 4G6OA 5JGDA 5DR9A 4FTTA 5FDXA 4BICA 4D0WA 3I7BA 2XP2A 2GSFA 5KE0A 3AT4A 3C4WA 1KSWA 1QL6A 5DEYA 5IQEA 2R3HA 2WZJA 3DJ5A 2XJ2A 2CCIA 4CKIA 1VR2A 3QWKA 1LR4A 3ALOA 5LVPA 3LQ5A 2XK4A 5KUPA 3PUFC 3UNZA 5K4JA 5F95A 5ACKA 3CTQA 1TQPA 1ZY4A 4M15A 4O21A 5HX8A 4HCVA 3E8NA 2B53A 3N9XA 4L44A 4UN0C 3PY3A 5D41A 3COHA 5ETCA 4V0GB 5BX0A 2BALA 2CGWA 3POOA 2PMIA 4FKLA 4KA3A 3UP2A 4PPBA 5I9VA 3L8PA 4EH5A 3VS2A 4QP1A 5CAOA 2YA9A 1GOLA 5CU4A 4X6RA 1P4FA 4RRVA 5EDPA 4IC7A 3ENHA 4JQEA 4Y46A 5AAGA 1XQZA 2IO6A 3RPRA 3R7EA 3OMVA 3V3VA 3MH0A 3VULA 4DDIA 4AZTA 2UW3A 5BVDA 4AP7A 2XALA 1WBSA 2ITQA 4YGAA 4AW5A 3C0IA 4IZYA 5AX3A 1LEWA 5I9XA 4DDGA 3GC9A 1Q62A 3EKNA 2O63A 4AS0A 1M7QA 3B8QA 2UZNA 3MTLA 3AC1A 2VNYA 1HOWA 4AN3A 2R3FA 1ZZLA 4HCTA 4PWNA 4YHFA 4O0VA 4YJRA 4R8QA 4ZMEA 4I22A 5JMSA 2GU8A 3NFGB 3V5PA 4FV3A 4P2KA 2Y4IC 3QLGA 3PIXA 4FKGA 2C69A 4JDHA 4FKUA 4ACGA 2CKOA 1UWHA 1ZARA 2XH5A 4FUXA 4OAUC 5AP0A 2BHEA 1J7LA 4KABA 3IO7A 3TTIA 4L52A 3W0QA 5HG8A 2VWBA 4PL4A 3K5VA 4IXPA 4E8AA 3NW7A 3DKFA 4U79A 4Z7GA 3CLYA 5EYMA 4MYGA 5HGIA 3U4UA 4HYUA 5HO8A 4EK8A 2FO0A 2UZTA 4MUQA 2OZOA 3P7AA 4O0YA 3I5NA 3MV5A 3SV0A 3NMUF 4Z3VA 5JRSA 1U54A 2G9XA 4QDEA 4YJVA 5IPJA 2FYSA 4CT1A 2O0UA 3KMWA 4DYMA 5JSMA 4I5CA 2BR1A 4WG4A 3Q4TA 5AR8A 4A4XA 2GFSA 4ALUA 3KXGA 3KREA 4OTQA 5EI6A 4HGEA 4I0TA 3WF6A 4LDTA 2WTKB 3Q4UA 5LJJA 5CSHA 4AA4A 4BJJA 1FMOE 4AA5A 4ZS0A 5FXQA 3GU5A 4I5HA 3CD3A 3P7CA 5IQFA 3SGCA 5BVEA 3HUCA 3UDZA 1APME 3LFDA 3R02A 2PMLX 2VTIA 3ZLXA 3WBLA 3ULZA 1YI3A 3PE2A 5H8BA 4FOBA 3RNYA 3G15A 3U6JA 4AQKA 1BL7A 3E63A 3AC4A 4D4SA 2ITNA 3IQ7A 3ZFYA 3DDPA 4YZDA 1RDQE 4E6DA 5L8KA 5HORA 5LMAA 1F3MC 4E73A 5M56A 5IMEA 1CKJA 4M14A 2Q83A 2YACA 3A4OX 3OCTA 4XLIA 2W1ZA 3F66A 4RJ3A 2X9EA 2HOGA 1SVEA 4J95A 2Y0AA 4J53A 4L01A 4YJOA 5JGBA 5F94A 4EKKA 5CANA 1A06A 4RVLA 4RA5A 1DI9A 4BI2A 1CTPE 3TJDA 4BDKA 1T45A 3HRCA 3RAWA 2GCDA 4EH3A 3HEGA 1GZKA 2NRYA 3G0EA 3P5KA 2QC6A 4AZSA 5JEBA 3E64A 3GCSA 1NT2A 1BLXA 2ZDUA 3QBNA 1WFCA 4X3FA 3FZRA 4ERWA 2HYYA 3UDTA 4I20A 2HAKA 2ERZE 4QYYA 5LARA 4N0SA 3VS7A 3ZBXA 3BBTB 4C4EA 4EZ5A 5M06A 5T68A 3KC3A 3QD2B 5IU2A 1Q8TA 2B55A 4IM3A 1PMVA 5A6OA 2WOUA 3ZM4A 5HU9A 3H0YA 3DKOA 5FEQA 4D1XA 5M55A 4BTFA 4NU1A 3SXSA 4BRXA 4D2VA 3RBWA 3WE8A 5DYJA 2WMUA 2UZVA 4F7NA 3ORZA 2RG5A 3WF7A 2W06A 3CPBA 2GQGA 3HV5A 3P7BA 2PVLA 5AV4A 4RIXA 2WMTA 3KRRA 4NM3A 4X3JA 4IB1A 4G3EA 4R3PA 3DBEA 1P14A 2YLEA 5E9EA 4UMUA 2QR8A 3OEZA 4AFJA 2XCKA 3AD4A 3FI2A 3F88A 2C47A 4ITHA 3K5UA 4A4LA 4F9WA 3NS9A 3PVGA 5AV2A 5LCJA 5FQDC 2O2UA 3IGOA 3NWWA 4H58A 1R0EA 4DG2E 3ITZA 3R28A 3TJCA 2E9NA 3A62A 4DFNA 3G9LX 4R7HA 3F5PA 2I0HA 3W2SA 2UZBA 3QCYA 4O22A 5EHYA 4U6RA 2F2UA 4LRKA 4BCGA 4HVSA 2UW5A 3LZBA 2BRHA 3MPMA 4FKRA 1W7HA 1XH4A 3D2KA 3OHTA 4USDA 2WTJA 4V01A 4J8MA 3PSDA 4YTIA 5C8MA 1MQBA 5CTPA 3ORTA 1FOTA 2UV2A 5KCVA 4MXZA 4BDBA 2HELA 4YLLA 4ZSLA 4GRBA 3MPAA 4FV0A 4O2ZA 4UB7A 4C3PA 3OWLA 4LM5A 3QTZA 2WMRA 3BWFA 2VTTA 5IEVA 2QCSA 1PRYA 2PULA 2AUHA 5DHJA 3L9MA 4PDPA 5FXRA 3BHTA 2YZLA 2WB8A 1GY3A 4WBOA 3P5JC 1U5QA 1ZOHA 5L2SA 3HV3A 1SNUA 4F99A 1QCFA 5DVRA 5CQWA 3HDNA 4BYJA 3PVWA 2WQEA 3PRFA 2YHVA 3KEXA 4UY9A 4V05A 4AE6A 4D2PA 2YAKA 3POZA 2A98A 1Q8ZA 3CE3A 3NYNA 1S9IA 4FTKA 4B8MA 2XYUA 3PXQA 4M13A 1KE8A 4CLJA 3W1FA 3LVPA 4TRLA 2CDZA 5HE1A 4ZEGA 3CTHA 1LUFA 2EVAA 5IA0A 3QL8A 4U81A 4FTAA 5BYZA 1ZLTA 4W9WA 3SW7A 2F4JA 3QA0A 1LEZA 2JIUA 2EB2A 5HESA 3VQUA 1PYXA 3HP5A 2BRBA 3TKHA 1PXOA 1Q4LA 3IW8A 4R78A 4LFIA 4OLIA 1ZYSA 4G5PA 3Q3BA 5DRBA 2PVKA 3W2PA 3WYYA 1P5EA 4AT4A 4D9UA 5M51A 4IHPA 3V04A 3W10A 3FMJA 4DH7A 2ZM3A 4ZS4A 2QU6A 2XK6A 2DYLA 2XB7A 3WZDA 4ZTMA 5AAEA 1CSNA 2XNNA 3QZHA 3R01A 5E8ZA 5IKWA 4BDJA 1OKYA 4FG8A 4BGQA 4DH3A 5BVNA 5HVKA 3EB0A 4FI1A 2ITOA 5AADA 2O3PA 4U3YA 4BGGA 4HVIA 4I21A 1M7NA 4X2NA 3FXXA 2E9PA 1W98A 3A2CA 3HL7A 4CD0A 5A4CA 4AAYA 3CGOA 1I44A 2RG6A 1QPJA 3EL7A 2P3GX 3LFSA 4S33A 4ANOA 4EQMA 2CNVA 2GFCA 1TVOA 1Q5KA 2R3OA 3IONA 5CF6A 4EH4A 2WU7A 4U45A 5EFQA 2B9FA 3IK3A 5BQ0A 4CLIA 3DB6A 1ZWSA 4ZY4A 3VW8A 3ETAA 2P55A 3HKOA 2UW0A 4LMNA 4FV2A 4DBXA 5C4KA 3GXLA 4FKWA 3CR0A 2NO3A 4EOOA 2VTAA 4AA0A 4G6NA 3R83A 4CG9A 3E8DA 4DHZA 3G5DA 3MIYA 4YTHA 4F7JA 4XG3A 2F7XE 3SXFA 5HEZA 1Q24A 2P2HA 4GK2A 4FTUA 4IAYA 3FQEA 5AP2A 4WNPA 4DH5A 2E9VA 5FM2A 5DH3A 4GUEA 3VS4A 4RJ4A 4OW8A 4TY1A 1URCA 3F3TA 4L3LA 1Y6AA 3RK9A 2C0TA 3DXPA 4O7RA 3NLBA 3KL8A 3FXWA 4FSQA 4X2GA 1YHSA 3FMMA 4MXOA 5BPYA 5KKRB 1J7UA 3C4XA 2X0PA 1YW2A 2IZTA 3P78A 3VS0A 4AZEA 4TWPA 4I4EA 1I09A 4EOIA 4EOJA 3MJ2A 2XS0A 4YURA 4X2JA 1KE9A 3L9PA 3FL5A 4FEWA 4FV4A 3SD0A 4CVAA 2VTHA 3ZYAA 3ATTA 2VX0A 3ZO3A 4BCIA 3MY1A 1KOAA 1PF8A 4RFMA 2WTDA 4F70A 4F0FA 3SA0A 3GP0A 3ZLYA 3T3UA 2C1AA 3N51A 3EN4A 3NW5A 2BKKA 3UIBA 1M14A 1OITA 5DOSA 3KK8A 4OUCA 3TV6A 2J0MB 3BQCA 3MSSA 4IJPA 4I23A 4LOQA 3L8VA 4PTEA 4BHNA 4CQEA 4I1ZA 4Y5HA 3EZVA 4RX8A 3VBVA 5IEYA 4EOLA 3BELA 4HGLA 2Y9QA 4I6FA 1XMLA 4F1OA 2BTSA 4I4FA 3BLHA 2GS2A 3QQFA 3KVWA 3WZJA 5ICPA 3I5ZA 3E8CA 4FG7A 3RAKA 2PUIA 2B4SB 2QKRA 3PPJA 3KQ7A 3D5XA 4KNBA 4FEXA 4O7SA 5HNGA 1H26A 1U46A 5F1ZA 3R7VA 2OXDA 2XYNA 4YSJA 4IDTA 4DGNA 3ZRMA 3TNPC 2A4LA 2WOTA 5HVJA 5K3YA 4G9CA 4E6QA 3TN8A 1KE6A 2R3NA 4LGGA 4Y72A 3GC8A 5GIOE 2XA4A 3UDBA 1YXXA 4LGDA 3E8EA 2C6EA 2XKEA 4B4LA 2WQNA 3OG7A 3CD8A 3DZOA 2YITA 2VV9A 5DFPA 5A3XA 3RMFA 2BFXA 1BKXA 4UXQA 3RTPA 5CASA 3MPTA 1OB3A 3HLLA 4NT4A 4YJSA 1JOWB 5ANEA 4C61A 4HNFA 3EIDA 3UPXA 3FI3A 2GDOA 3BE2A 4KIKA 3VN9A 3UMXA 3NAXA 2ITVA 1Q99A 3DB8A 5J9ZA 1PXLA 4S34A 1ZAOA 4KWPA 4YZMA