4YJRA

Syk kinase domain in complex with inhibitor gtc000225
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
270
structure length
263
Chain Sequence
YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 263
sequence length 270
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjrA01
5IQGA 1VR2A 3E3BX 3FKOA 4U8ZA 2JIIA 4LOOA 4DEAA 4BR3A 5CXHA 4G1WA 5KNJA 3E62A 3V5WA 4HVGA 2QR7A 3P7CA 5FDXA 1YXSA 1L8TA 3K3JA 4R7HA 3NW5A 5IISA 3H4JA 4KA3A 3GQIA 5L3AA 2DUVA 4MXAA 3W2QA 4YZMA 2W5AA 3KK8A 3LCDA 4H3PA 3H30A 3AMBA 4JDJA 3AMYA 3W18A 2ITOA 3QRIA 4RVMA 4W9XA 3LFAA 4NFNA 4EQMA 3Q53A 5CU4A 2R3HA 1DI8A 4OTQA 3ZRLA 1DI9A 4H58A 4LQMA 2CNQA 4CG8A 3FMLA 3ET7A 4IBMA 3TDVA 3E8CA 4KRCA 3CS9A 4BB4A 1SZMA 3AXWA 5EQPA 1PMNA 3EB0A 5D10A 3K54A 3D7TA 5G1XA 1JOWB 4EH3A 2R0UA 1NVRA 4IWPA 3VUHA 2C5XA 4IJPA 3R9NA 4XJ0A 3R9OA 3OUKA 3C4EA 3FHRA 4IWQA 5GIOE 3ZLXA 2C3LA 3NVKI 2F7ZE 4EH2A 4L01A 2UZWE 5DIAA 2O0UA 1KE9A 3A62A 5CSVA 4FKUA 4XS2A 4BWPA 3RWQA 3LMIA 3R1NA 1ZRZA 3MIAA 3A4OX 4M69B 4DYMA 2YN8A 3FUPA 3KA0A 4TWPA 4U43A 4BZDA 4QMSA 4LOQA 3CTJA 5CSPA 3JY9A 1DAWA 4ZIMA 4U0IA 1ZOHA 2J0JA 4FGRA 3VS6A 3MI9A 4CGAA 3POOA 3D9VA 3ALNA 4K6ZA 3NMUF 3FQEA 4IB1A 3B8RA 4RC3A 2WTDA 2C6TA 3OZ6A 4I5CA 1ZOGA 2GS7A 3N4VA 3TWJA 2A1AB 2YJRA 1TQIA 3V04A 3QTUA 3GENA 2HW6A 4BGQA 2PULA 4R7BA 2NPQA 2W1IA 1XBBA 1FPUA 2J90A 3O8PA 4MD8E 3P86A 2PUNA 3I81A 4GW8A 3VRZA 3ENMA 3VVHA 2HOGA 4TTHB 5AUUA 2OJ9A 4AQCA 5A4LA 5M51A 3S00A 4MF1A 5KBQA 4H3QA 4TWOA 2RSVA 3QC9A 3Q9XA 3C4WA 4I0RA 2C1AA 4IEBA 3TNHA 3ZLWA 4JQ7A 4F6UA 4CKJA 3FZSA 5AP1A 3PJ3A 3VW8A 5EKNA 3ATTA 2C1BA 3ID6C 2UV2A 4QP6A 5L2WA 3HAMA 2CPKE 3RAIA 5ANKA 5L4QA 4YTIA 3V5PA 3QRJA 4IC8A 2B55A 2BRGA 2PWLA 5C26A 2B4SB 3NUAA 3DBDA 4FKGA 4AW1A 3DBFA 1XHAA 3PA5A 4L44A 5F94A 2XK3A 3OWPA 4KIPA 2PZ5A 4L00A 5AP3A 3SDJA 4BDJA 1UKHA 4FT7A 4M68A 4XBRA 2YITA 3KULA 4XYFA 5HLPA 2BFYA 3EHAA 3L8PA 4PPCA 4BVUA 1M2RA 2J0KA 4FV2A 3U6IA 1NXKA 2OW3A 2X9FA 2VWZA 4G5JA 2HY0A 2C3IB 3EKNA 3PTGA 5M07A 3A8WA 4D4YA 1J7LA 3R7UA 4YP8A 2W9FB 4EK4A 1R0EA 3EWHA 3F66A 2QONA 2ITUA 2PMIA 3UOHA 4G6NA 4MBJA 4QP1A 1ZWSA 1YOLA 3MH3A 3NNVA 5A4QA 5CQUA 5HLWA 1V0BA 2DQ7X 3E92A 4AZWA 3V5TA 3VHEA 4NCTC 4O84A 4EQCA 3LFNA 4DHFA 5JEBA 4GMYA 3TUDA 3IW5A 4BHZA 5AIKA 5L8JA 4RFZA 2VTIA 3CJFA 4Q5EA 4F7NA 4F9YA 3NLBA 3OXIA 2W1CA 4BCIA 3IW4A 4MBIA 5AR3A 3E93A 2A27A 3FBVA 3BWFA 3E87A 5ANEA 4Z9LA 3RI1A 3DA6A 5EFQA 1UA2A 1WZYA 2QU6A 3Q4UA 2CN8A 1OUKA 3NIEA 4PX6A 5CY3A 5HX8A 3ATSA 2BIYA 5IUIA 3FKNA 4GFMA 3MB6A 3DAEA 3Q9WA 3HGKA 1OZ1A 2RKUA 2WTCA 3FDNA 4FV4A 3SXSA 3BBWA 2G1TA 3IW6A 3O7LD 3UDBA 4EC9A 3QX2A 4UMTA 4KIKB 3GOKA 2QURA 4CFFA 5FWKK 3OC1A 5M55A 4RJ3A 2WPAA 3VS1A 3BE9A 4C3RA 4X3FA 3JVSA 3FMNA 3ZFXA 4F99A 3UIUA 3U4WA 1H1WA 3MVMA 3QUPA 4U45A 4QMLA 4JRNA 3UQGA 3FKLA 2UUEA 3MN3A 5FEEA 4X0MA 5HQ0A 4FTMA 4HYHA 4GFOA 2UZDA 2Y6OA 3AC1A 4B8MA 4I41A 4E1ZA 4QQCA 3UNKA 3KXZA 2LGCA 5AFVA 1DM2A 2PZIA 4C2WA 1U5RA 2DS1A 4XUFA 4O21A 5F4NA 3DKGA 4C35A 2WQMA 3R04A 2XNGA 1J1CA 4RC2A 4ANLA 4BDHA 3GU4A 2I6LA 2BROA 4FKQA 3EFWA 4BKYA 3LKMA 3I7CA 4NUSA 5KMMA 1KWPA 4RSSA 5M06A 2QOCA 5H8GA 2Z60A 3EN7A 4P90A 2VWIA 4R3CA 1WBPA 3I60A 4BGHA 4EH7A 1Z5MA 2I0VA 3MBLA 3PVUA 4IB0A 2CSNA 2IW6A 4FVPA 4ZTRA 4G3EA 3D5VA 5GZAA 4DTAA 2YM3A 5C4KA 4PDSA 3V8SA 4YC8A 4CNHA 2V5QA 5CU3A 5CEMA 4PY1A 2PHKA 3PZEA 3RINA 3FZTA 4BL1A 2VD5A 4NT4A 3UQCA 1YHWA 2VWXA 3QZFA 1UKIA 1YWRA 4KWPA 5J9LA 4L68A 4O7ZA 2C6DA 2V7OA 2YCSA 3FI4A 3HYHA 5FBNC 5AV0A 3MW1A 4FKSA 4U79A 3L8XA 3OT3A 3D15A 4NK9A 2YM4A 4X7QA 1IASA 4G34A 4RJ5A 4C33A 2VX1A 3AQVA 3I6WA 2CKPA 4ZJVA 3E7OA 4N6ZA 3NSZA 4J52A 3O71A 4C38A 5I9YA 3BHUA 3C1XA 1YHVA 2ITVA 4FT0A 2GQRA 4YC3A 2QI8A 4WKQA 5LARA 4I0TA 4AT5A 4TXCA 3MS9A 4EYMA 3NZ0A 4FTLA 1GOLA 1ZOEA 1KUTA 2RG5A 3PWDA 4I24A 4FI1A 1BL6A 3DB8A 4G6OA 2VTLA 4KIQA 5HE2A 4FTKA 5AP2A 4D58A 4TYEA 4BWXA 3EFLA 2YCRA 1GIJA 3ZCLA 2C6LA 4XP0A 2CKQA 1H1RA 3AD6A 4FKJA 4GG7A 1F5QA 4FT3A 5JN2A 3HV3A 3VJNA 4BRXA 3EQHA 2FUMA 2YHVA 2ETKA 2W5BA 4UYAA 5H3QA 3HAVA 1CM8A 2ZB0A 4TYHA 5M08A 4G9RA 3DU8A 2YAAA 2BUJA 4JBPA 4CMUA 2R7IA 2XJ0A 4I0SA 1GZKA 3O8UA 2EB2A 4CT1A 3PVBA 4ZZMA 4R1YA 3T3UA 4JS8A 1YQJA 1Q5KA 5HGIA 2YEXA 3SAYA 4AFJA 5EDRA 3UP2A 4NL0A 2PMNX 5IQFA 4TZRA 3ZRMA 4UXQA 4RX9A 4ZY5A 3Q3BA 5DT0A 5EI2A 5HVJA 3ZBXA 4O0VA 1FBNA 4EOOA 4A9RA 3R7VA 1M7NA 2GS2A 4CZYB 4I4EA 4JBOA 2BDWA 2GNGA 4ASDA 4F9BA 4WUAA 4U42A 2XIYA 2XNMA 2IZUA 4JRVA 2B7AA 2IW8A 3ORMA 4TT7A 5DE2A 4RBLA 5DHJA 1WBNA 4ZTQA 3FWQA 5EHLA 3W8QA 4FSQA 4AZSA 3QCXA 4FC0A 4YPSA 5JSMA 3QTIA 4M0YA 3R7YA 1URWA 1O6KA 4RG0A 1Q24A 3FPMA 5EHOA 3N4TA 5CSXA 5B2LA 1R78A 2B9HA 2OIBA 2VX0A 1K2PA 2W1HA 3IDCA 4RX7A 3UIMA 3ZUTA 4F0IA 4RZWA 3MFUA 3RK9A 3PJ1A 2XCKA 4EJNA 3OOGA 5EKOA 4BGGA 5A3XA 3TV6A 4C57A 1YI4A 2YIXA 4L53A 2JBPA 3LFBA 4DLIA 4J71A 5CYIA 2A0CX 3WE8A 3NVMB 3E8DA 4FSZA 3A7IA 3PSDA 4DGLC 5HKMA 3OVVA 3D2IA 3KL8A 3ZLYA 2ITWA 3HDMA 3WF7A 4MXOA 3GCUA 4NEUA 3S0OA 2QKRA 4FBXA 2X8EA 2NRYA 4IC7A 4AFEA 4RPVA 5A4TA 5FUTA 4XG3A 5HG7A 4USEA 3KB7A 4QOXA 4X21A 4DH3A 4QQJA 3DFCB 5E1SA 3PJ8A 1ND4A 3W10A 3ZFYA 4EJ7A 2GPHA 3F5UA 2WQNA 5HG5A 1ZZ2A 4O7VA 1MQ4A 4IQ6A 2Q0BA 4ACCA 2YFXA 2WAJA 1MRUA 2B54A 2HAKA 2XK4A 2BRMA 2Y9QA 3F5GA 4DCAA 1FGIA 5FDPA 4L7SA 3OCSA 4P4CA 2HXLA 4FUXA 1F3MC 3ZZWA 1OBGA 3ROCA 4IAKA 3LFCA 4ANOA 3N9XA 2PVRA 3NDMA 3R7IA 2OK1A 3NS9A 4RRVA 2I7QA 3SQQA 4ANBA 1K3AA 5G6VA 5ETIA 4GJ2A 4HZRA 5FXRA 1UU7A 5BUIA 2WELA 5IA3A 2HELA 3BGQA 3GGFA 5A4CA 3CXWA 4ZZOA 4G3FA 1H8FA 2RFSA 3AD5A 2V22A 3F2AA 3NUUA 3PE2A 5FQDC 2IO6A 3MJ2A 4PMSA 3BX5A 3O23A 3ZS5A 4CFWA 3A4PA 3CPCA 3ZMMA 2CLQA 4BTJA 5IH5A 2JKMA 3U87A 1JWHA 3U9CA 4MTAA 4X3FC 5CANA 2A19B 2IWIA 4AGWA 3TIZA 3OROA 5CLPA 2PVKA 2DWBA 2WQEA 4IWDA 4DLJA 1I09A 3KXHA 4FZAB 4ZMFA 3SA0A 3U55A 4IVCA 4FKOA 5EM5A 4AZFA 3EH9A 3TTJA 1WVXA 4Z7GA 2QOKA 3EQFA 3BU6A 4O2PA 4R3RA 3DKFA 1RE8A 2YDJA 3C4ZA 4OTFA 4UB7A 2PYWA 4C37A 3KFAA 5GINE 3RGFA 4MNEA 4WOVA 3NUNA 5HNGA 4KSPA 3MA6A 4FNYA 5AX3A 5C8MA 5E1EA 5CAUA 3DBQA 4J8MA 4TRLA 1JSTA 3LFFA 3PIZA 1PXLA 1QPDA 4EHZA 3LOKA 2WMBA 3KCFA 2JAVA 4XOZA 3BYVA 5CEIA 3BYSA 3DLZA 2C5YA 2WMUA 5L8LA 4DFBA 2XKFA 3D5WA 4RJ8A 5TF9A 5M44A 3FMDA 3TJDA 3ODYX 3QQJA 3MV5A 4X2NA 3LHJA 3DKOA 4HCTA 3GVUA 3IO7A 4RA4A 4RQKA 2J5EA 5EDPA 2HYYA 3BIZA 4IFCA 5CAPA 1PRYA 2XNNA 4FV7A 4GV1A 4EHEA 5M4FA 4O7YA 3JS2A 1KE6A 4K2RA 3ORKA 4RMZA 3PJCA 3UO5A 5LVLA 4ZJJA 5FLFA 4TY1A 1ERKA 5JT2A 4F0GA 2WKMA 2ZJWA 2ITXA 4IAYA 4O6EA 3V8TA 1PYXA 1SMHA 5M4CA 2BRNA 2J2IB 5AR7A 4ZXTA 3RAHA 4FKVA 3MPMA 5AUZA 5E92A 5JMSA 2ZM1A 4FEXA 2RG6A 4U80A 4AXAA 4EH8A 1XO2B 2CLXA 3MESA 2CGWA 3PPZA 2Z2WA 4MK0A 5F20A 4J96A 4Q9SA 3FMEA 4B0GA 2QC6A 4IJ9A 4PPBA 4NJDA 4BC6A 3TJCA 2DYLA 4D9UA 3Q4ZA 3F5XA 4FTRA 3DFAA 2G9XA 3LZBA 3QWKA 2H8HA 3H9RA 4PMMA 5I9XA 4IDTA 5J7HA 1XJDA 4J99A 3H3CA 5E8WA 3PWYA 4CFVA 1URCA 3KU2A 1W82A 3TIYA 2WNTA 2GQGA 3I4BA 1Q3DA 4EORA 2E9OA 4ERWA 3CD8A 4PP9A 2WO6A 1Y8GA 3GU6A 4JXFA 3F2NA 2JDVA 5HIEA 2OBJA 2PUUA 2IVVA 4QYHA 2E9VA 5M09A 4O0RA 4UBAA 1WCCA 4FVRA 4MVFA 4BCMA 2BZJA 2C3KA 4MH7A 4UWBA 5JFXA 2VTHA 5K4IA 3UO4A 5E91A 1LP4A 3IS5A 5JGBA 3IOKA 1IA9A 3VBWA 4P5QA 3BPRA 5AV1A 2KTYA 4IAFA 3HV6A 2GFSA 5BVFA 4DTKA 2A4LA 3QRTA 4FSMA 3UZPA 4B6LA 4S32A 3TXOA 2BAKA 3ZOSA 1I44A 5HO7A 4OBQA 4JDKA 1IG1A 2GU8A 2R64A 5FEDA 4U41A 1WBOA 3GP0A 4FTQA 4KBKA 5FXSA 5CAOA 2CNVA 1Q97A 4ENYA 3IKAA 4OAUC 4FTAA 1Q4LA 3S2PA 3R00A 4RJ4A 3DK7A 3MFRA 3EYHA 3F9NA 3ZXZA 4U81A 2YWPA 3IK3A 2Z7RA 3ANQA 4QTBA 2W96B 4CLJA 2QOIA 4CXAA 3QQUA 3Q96A 3O2MA 4WA9A 1M2PA 5HCYA 1U5QA 3THBA 3HMPA 2UW8A 3CLYA 2BIKB 1LEWA 4RIYA 4MD7E 3WE4A 3QQKA 3SXRA 4L67A 4JIAA 4ZTNA 3FL4A 4F0FA 5B2KA 5JK3A 2NNWB 2OFUA 3QXOA 4WT6A 4F1MA 3DS6A 4HVIA 2IJMA 3RM7A 5CVHA 5IPJA 1P4OA 2CHLA 3KEXA 3OD6X 5IDNA 2J0IA 4DFUA 1XH7A 3KF7A 3W8LA 3HEGA 2YA9A 4D55A 3VNTA 1JBPE 1YDSE 5AEPA 4NU1A 3F69A 3D0EA 4I6HA 4M8TA 4O0YA 4O0WA 3EQGA 5J8IA 3TTIA 3ZO1A 4X6QC 1KV1A 4USFA 1JVPP 2BVAA 3R7EA 3V51A 4BKZA 5BPYA 2J7TA 1JPAA 4BN1A 2FSTX 4WUNA 4F6SA 1JLUE 1GZ8A 3OT8A 4GEOA 4QP7A 2FSOX 4I6BA 4YTCA 1PXKA 3GQLA 4DT9A 5DEWA 2HY81 3VBVA 4Y5HA 1LUFA 1IR3A 1H07A 1PHKA 2F7EE 4CV8A 4RWKA 4FGBA 1YKRA 3NGAA 4FKPA 3DXPA 4RJ6A 2W06A 3CKXA 2YIQA 3MH2A 3DV3A 1FGKA 3GC7A 3UC3A 4R7IA 4P2KA 4IX5A 4QMVA 3ALOA 3MB7A 3UE4A 3PA4A 4MBLA 1LR4A 5GIPE 5IQHA 3OBJA 3SLSA 5DGZA 5IH4A 2ITPA 2R3FA 4FTOA 4LI5A 3ZBFA 3OY3A 2OJJA 4IM0A 4ZTMA 3KRRA 3F61A 3VF8A 2WIHA 4RLKA 4PQNA 3BELA 3NCZA 1S9IA 4A9TA 4BZOA 3QRUA 4N6YA 3FI2A 2WMXA 2O8YA 2WQBA 3TEIA 1M2QA 4XMOA 4I5MA 4WHZA 1UWHA 3PY0A 2BAJA 5IQCA 2Q0NA 4FV0A 4QT1A 3PRIA 5CF5A 4TW9A 5L6OA 4EOQA 4LUDA 4GUBA 3SRVB 5M56A 3H10A 2YERA 4TNDA 1B39A 2CNUA 4BCJA 4FV6A 1M14A 4PV0A 2PVJA 4V01A 3FXXA 3UYSA 4OT5A 2WFYA 5HD7A 4R5YA 2IVSA 4GIHA 2W7XA 4J53A 4LG4A 3QKLA 4UMPA 4BIDA 2XP2A 4BTKA 4IHPA 4LUEA 5CAVA 2XNOA 4IM3A 1YXXA 3KXXA 2P0CA 5HCZA 1GY3A 1T45A 4YTFA 5FRIA 2BMCA 5B7VA 2R3PA 4FEVA 1JSUA 1ZAOA 3SW4A 3T8OA 4C4FA 4KNBA 4S33A 4AT3A 3W2SA 2R9SA 5KMLA 3RAWA 2ITNA 3RM6A 4GU6A 5AMNA 2VO6A 2X2MA 1VJYA 2PMOX 4QO9A 4D9TA 2P55A 3BLQA 2HENA 1XH4A 2UZBA 4EL9A 2WB8A 4UX9A 4CRLA 4BDKA 5IQIA 4IANA 4H05A 5CASA 2GSFA 3VULA 1GIIA 1WBSA 3MA3A 3BV3A 5BUEA 4W4WA 4L9IA 2ERZE 2XH5A 4B9DA 4MCVA 4DINA 5AA9A 1W7HA 5T68A 4ZZNA 4BBEA 3VN9A 5J1VA 3Q9YA 4QP4A 2W05A 4GFGA 3V5QA 5KKRC 3CGOA 2JLDA 3P9JA 3DZQA 3FY2A 2YDKA 4EBWA 5BX0A 4M69A 2ETRA 3PLSA 2JBOA 2ESMA 1YVJA 4FV5A 3HECA 3OEFX 4E93A 1KOBA 2QHNA 2ZAZA 4RLLA 4W9WA 1LPUA 3QGYA 3UP7A 4EI4A 2ITQA 4FIHA 2REIA 4OTWA 3RK7A 1OL5A 4O38A 2Z7LA 3ZFMA 5IEVA 4HYSA 2HWPA 1OIUA 5I9UA 1MP8A 3N51A 4G31A 1BKXA 2R3IA 2BAQA 2R3QA 5I9WA 3SW7A 1IAHA 1O9UA 3L8VA 3TNQB 1ZMUA 3TL8A 4LMNA 4YNEA 3DTWA 3UPXA 4DEEA 5JGDA 3MIYA 4GT5A 2PZRA 4FZ6A 3NIZA 1OKVA 3PXZA 3QU0A 2H6DA 5BVEA 2VO7A 4FSWA 5I9ZA 4EKKA 1KSWA 3DKCA 3W2PA 1YRPA 4KBAA 3FPQA 4YURA 5HBJA 3DT1A 3TZ7A 4C8BA 1YI3A 5E9EA 3R1YA 4XH6A 2R2PA 3QX4A 4M0ZA 5BMMA 1REJA 2VGOA 2A2AA 2XKDA 5EOBA 2XIRA 4QYGA 4C4IA 3LXNA 4BIBA 5AM6A 4OTRA 4AP7A 4EK6A 2GHMA 4EBVA 4FE2A 4HVSA 2VWUA 5LWMA 2PE0A 4F9AA 2ZDUA 3QXPA 1XKKA 4FSYA 4PWNA 2P33A 5C8KA 5IA4A 1Z57A 2C0TA 4L6QA 4FNXA 2ZV8A 4YC6A 1NVQA 1H25A 4ZTSA 3FC2A 3OMVA 2YM5A 3HP5A 3OWKA 3QTZA 4M84A 3R22A 2HIWA 3DQXA 4XP2A 5AR4A 3R8ZA 2OLCA 5H2UA 4QP8A 4NKAA 4D4VA 3HNGA 3SG9A 4FTCA 2R3MA 1PXIA 1J91A 3LQ3A 4KKEA 4YZBA 1JQHA 3FZRA 2OWBA 4PTEA 4ZTHA 4QMXA 4ARKA 3R01A 4NFMA 3CY3A 1XH5A 2KULA 3EMGA 3VUMA 4RWJA 5CS6A 3R73A 5DRDA 3SOAA 4WNPA 4DH1A 3ZTXA 2C4GA 4XG4A 3P1AA 4EHGA 1WAKA 5AV3A 3BHTA 3CTHA 5DH3A 2PZPA 5M53A 4YZ9A 4E6AA 5HCXA 4MXCA 3R1QA 3R7OA 4BDEA 4HVHA 3MVHA 2EU9A 3QTSA 4IIRA 4J8NA 4WO5A 3MWUA 3BQRA 4YHTA 3C0GA 5FBOA 2OSCA 4B4LA 1WBWA 2VN9A 3P78A 1REKA 1RDQE 4KIOA 1F0QA 2Z8CA 4EZ7A 2YIRA 3B8QA 3BKBA 4QQ5A 1SVGA 4IVDA 3SD0A 5E8TA 3JXWA 5E8XA 5EYMA 4F7SA 3PG3A 4FUYA 1ZYLA 3BYOA 5H8BA 3CIKA 3RK5A 2VO3A 4K77A 4F08A 3L1SA 3HUBA 3REPA 2WHBA 4KIKA 3Q32A 5CXZA 2V7AA 4O83A 4NM0A 3FC1X 1CSNA 2O65A 3D5XA 1OPLA 5GZ8A 3B2WA 5LVPA 3R02A 3QZGA 4OR5A 3KRXA 3ZC6A 2WEIA 4BHNA 3SGCA 5L2SA 3A7GA 4M66A 2WTVA 4LV8A 5HORA 2QLUA 2OF2A 3QCYA 2W4JA 3G6GA 2QODA 3LXLA 4ACMA 4UMUA 4AGDA 2RGPA 3ACJA 4GIIA 4RZVA 5ACBC 4FZFB 4U6RA 3WF5A 3GNIB 2QD9A 5FTQA 4D2SA 1PMEA 1GJOA 4E6DA 4C3FA 4C62A 4IZYA 2J0MB 2WMTA 3KXMA 2ZDTA 3NEWA 4AOJA 3WILA 5K3YA 3MPTA 3ZONA 5IA1A 3RHKA 5J5TA 4R6VA 3CQUA 4YHFA 5J7BA 3E88A 1ZMWA 2PSQA 4MYGA 4R3PA 2PVMA 4DH5A 3R8PA 2X4FA 4PTCA 1KE8A 3OUNB 3HV7A 4A9SA 3FMKA 2X1NA 5IKWA 4ACHA 5E4HA 4TWCA 4DCEA 5IEYA 3ACKA 2NO3A 2R3OA 2J4ZA 2X7FA 4JT3A 4DE4A 2VZ6A 3OCTA 2PUIA 3GC9A 3LM0A 2VTMA 3QCSA 4C59A 4W4YA 5JH6A 5KO1A 3G9LX 3VS4A 4S34A 4XNEA 5BUJA 5CU0A 3SHEA 4BCGA 4FL3A 4O22A 2B9IA 3TKHA 4I23A 5C1QB 3V5JA 1JKTA 4DGGA 3JY0A 4NWMA 3UG2A 5TO8A 3V01A 4PL4A 3T9TA 5EQYA 5HBHA 1PXOA 3PG1A 3RHXA 5FP6A 3RWPA 1U4DA 5DYJA 3GC8A 2EWAA 4KABA 4OTGA 4JX3A 4NYEA 3EZRA 3QWJA 2F9GA 2JAMA 4GK3A 4RFYA 3N4UA 4E5AX 3F3WA 3WZKA 4WD5A 4M3QA 3UC4A 3F3TA 3VS5A 2VGPA 5LCJA 3UOKA 5CNOA 2VWYA 3ZUUA 4U3YA 4RX8A 5B0XA 2QCSA 3UIXA 4FIGA 3ZO3A 1Q62A 3NNUA 3R6XA 5LMKA 4BDDA 2R3KA 3CD3A 3AC5A 5CU2A 3OWJA 4BWKA 2W4KA 4HJOA 5K0XA 1M52A 2W1GA 1JKKA 2XJ2A 4JI9A 5GHVA 3M2WA 1APME 2F4JA 4NH1A 4YHJA 4IAAA 3B2TA 2YCFA 2IG7A 3NNXA 2P4IA 2Y0AA 4UMQA 3QQLA 2BDFA 3KF4A 4A4XA 4NIFB 4PDOA 3FY0A 4A9UA 3UTOA 5CX9A 4MEDA 4X2JA 4LL5A 5AP4A 5EW3A 3FI3A 4I93A 3PYYA 4XLIA 2QG7A 4LV5A 4AW2A 4UZDA 5EK7A 1PXMA 3UVRA 5C03A 5CSWA 3D5UA 5C01A 3R28A 5AP0A 2AYPA 4ZSAA 3OCGA 3BYMA 3GUBA 3QYWA 3R71A 4L42A 2ZMCA 4EZ3A 1ZYDA 3SXFA 3VIDA 2BCJA 4AA5A 4YO4A 4ZY4A 4HGTA 4RQVA 2CDZA 4O7TA 3V6RA 3RZBA 4FL2A 3KMUA 3KN6A 4M15A 4WBOA 3VHKA 5JZNA 2F49A 4D5KA 2CJMA 4YUQA 1VEBA 4MKCA 4DGNA 3EQRA 5B2MA 4HYIA 5CVFA 2V0DA 4A4OA 4DEIA 3COIA 2H9VA 3NW7A 4JG8A 4Y83A 3KRJA 4XX9A 4G5PA 4GT4A 5CAQA 4GK4A 3W2OA 5FXQA 2XEZA 4GG5A 2XIZA 1PMUA 3HMIA 3OP5A 4JG6A 4BCPA 2ONLC 3QCQA 2OG8A 4IACA 4FG9A 3F3VA 3II5A 4WSQA 2B0QA 3BCEA 3OY1A 4FODA 3LLAA 4ZS0A 4G2FA 2FSLX 1MRYA 4I1ZA 4CYIA 3CQWA 4C58A 3F2RA 5K4JA 3QZIA 4I6QA 2GDOA 4GKHA 1ZZLA 3CBLA 2BR1A 2C6KA 3IONA 3BEAA 3IQ7A 4FG7A 4Y46A 5TKDA 2BALA 4GRBA 3ZLSA 4BCNA 3LFEA 3LLTA 4E8AA 3FXWA 3C5IA 4FTNA 5DR9A 2PU8A 4P5ZA 5DFPA 3GCVA 5GJFA 4BDCA 5AX9A 4E6CA 2Y4IB 1P14A 5JRSA 2VTAA 3BBTB 3VW6A 4EH4A 4E20A 3AT4A 4AS0A 4DGMA 3Q2JA 4QTCA 5ACKA 3BI6A 1J7IA 2VAGA 5CEOA 2XMYA 1XWSA 4PNIA 3AT3A 4XG7A 3CE3A 4FV9A 1U59A 5IH6A 4XV9A 4TWNA 3FMHA 3HRBA 5M4UA 1NW1A 2PTKA 5HE3A 1GZOA 5BVOA 3HLLA 3U6HA 1H1PA 5IQBA 2PVYA 3I1AA 1KOAA 2UW3A 3NUXA 5A6NA 4YLKA 3QUDA 3BGZA 5AP6A 3FMMA 3OS3A 5EYKA 2R7BA 2XK9A 4O91A 4YLJA 4DEGA 3WF9A 4RX5A 2XJ1A 4BI2A 3FAAA 4U3ZA 4GUEA 1NT2A 2YISA 4RIWA 3Q4TA 4HGLA 3OW4A 4QPAA 3V3VA 3I6UA 4QMUA 4BDAA 4WBBB 5E8YA 3ZEPA 4L7FA 4BICA 3ODZX 3MSSA 1PKDA 1U46A 4AW0A 4MXZA 3MY0A 3LMHA 2ZM3A 3V8WA 1XR1A 4XEYA 2OO8X 3UNJA 2G01A 3BLHA 5BVWA 4FIFA 5HESA 4CTCA 2BZKB 3HP2A 2IPXA 2YM8A 3EJ1A 4QPMA 3FQSA 3F82A 2FYSA 3NR9A 1XH8A 4FIIA 3T9IA 3LFQA 3TCPA 2X7OA 2CMWA 3PUPA 4UZHA 4BFMA 5EW8A 2WZJA 5ETAA 5IUHA 3C9WA 1VYWA 2QO7A 1OKYA 3GC0A 4JNWA 5DT3A 3DBEA 5AR8A 5EHYA 3VBTA 4FG8A 1QPJA 3ZSHA 3FEGA 4OLIA 1BX6A 5CEKA 4I94A 2QQ7A 4BYIA 4RIWB 1OUYA 5GJGA 4IFGA 5GZ9A 2UW9A 1OGUA 4QYYA 3OXZA 3VS0A 2I0YA 3FLZA 3GT8A 3QQGA 3A8XA 4D1SA 5ITAA 1YDRE 4QD6A 5EDQA 4BBFA 4RJ7A 4J95A 4PUZA 4EKLA 1IAJA 2C6MA 4QTAA 4XV2A 4NZWB 4AGCA 3O17A 1T46A 4GCJA 3MY5A 3FYKX 2GNLA 3GXLA 1XH6A 5K5NA 3K5VA 2CCIA 2UZLA 1OITA 2G2IA 2RFDA 4GH2A 4R5SA 3Q5ZA 2BILB 3LQ8A 1J3HA 3C50A 4ITJA 2PPQA 3ORNA 5HX6A 2CN5A 2UZEA 4LL0A 5CVGA 4EUUA 3FLWA 3EQBA 1IA8A 4DT8A 3DCVA 4FKRA 3FE3A 4LGHA 3FZPA 4E6QA 4L3JA 3Q60A 1M17A 2PVLA 3OOMA 4NW6A 3ELJA 5I4NA 2UZNA 3GU8A 5BYLA 2OKRA 4E4LA 4XBUA 2WMVA 3F3UA 4TYJA 4KKGA 4YJSA 3LXKA 4RIXB 3TZ8A 3U4UA 2UZTA 4L3LA 4CQEA 1NA7A 4QYEA 5HTBA 2JFMA 3QLGA 5KHXA 2UW6A 2GNFA 4K11A 2GS6A 5LMBA 2R3GA 5LMKC 4LGDA 3GU7A 3UYTA 1FINA 3DZOA 3ULIA 3HKOA 4ZY6A 3OFMA 3EQPA 4FOBA 4HGSA 3RPSA 4CCUA 2CKOA 4M97A 3UZRA 4HNFA 5E7RA 2XM9A 3GB2A 4IMYA 3F7WA 4YZCA 4NTSA 4IW0A 4XG9A 3F5PA 2X8IA 4MF0A 1Y6AA 2CCHA 3CC6A 4YBJA 3L9NA 4QTDA 1ATPE 2EXMA 4JQ8A 1U54B 4YTHA 4ZSEA 2FGIA 2P3GX 5D9HA 4IZ5A 3PLAE 1RJBA 1OPKA 1OI9A 2XNEA 3ITZA 5AV2A 4AX8A 2C0OA 4I4FA 1YXTA 1Q8YA 2X9EA 3GOPA 5M4IA 2SRCA 4A07A 5FM3A 2XB7A 4FK3A 4U5JA 2O3PA 5CSHA 5CEPA 3RPYA 4CCBA 3BHYA 4FYOA 4JG7A 1AGWA 4NM3A 4DG2E 3KGAA 5AR2A 1ZY4A 3KC3A 1TQMA 4D2PA 4DAWA 4O7RA 3SVVA 5EM8A 2VTTA 5HU3A 3UVQA 5CF4A 2JD5A 5FGKA 5FTGA 2ZM4A 5LVMA 3O0GA 3LFSA 5AAGA 2GFCA 2VNYA 3PXYA 4UXLA 3TN8A 3VRYA 4OT6A 3W2RA 3QYZA 4AWIA 1BMKA 4O6LA 1P2AA 3MGYA 3QALE 5BQ0A 3NNWA 5HVKA 2R3RA 3SG8A 2Y4IC 3BHVA 2VX3A 4FKTA 4JX7A 2XK7A 5CF8A 2R3JA 2X7GA 3PXQA 4YJUA 5DMZA 4GKIA 5AUWA 4XHKB 4AN9A 3O51A 3MPAA 2CKEA 3BZ3A 4ZP5A 4BIEA 3FZ1A 2UW7A 5H8EA 4RVTA 3UG1A 4UY9A 3R83A 3KMMA 2OZAB 1R0PA 3KY2A 4CLIA 4DG3E 2HW7A 2GTMA 3QD0A 2I40A 3GBZA 3MY1A 4BTFA 2BKZA 4D1XA 3GFWA 2W1ZA 2X6DA 3VUKA 4DTBA 3GCPA 1OIYA 1PXPA 3A99A 1YXUA 3C0HA 3MVLA 4FT9A 2IW9A 4II5A 3WARA 4S30A 2JKQA 4NTTA 4GSBA 4OBPA 4RVKA 3G15A 4DA5A 3C7QA 1CTPE 4CV9A 2BTSA 3UGCA 4DFZE 3R2YA 5DA3A 3NYNA 2ZV9A 4EOLA 2XM8A 2WU7A 3IW8A 3UIBA 3KKVA 2EUFB 3LVPA 5CU6A 2X0GA 5L6WL 3P5KA 3VS7A 4O1PA 3PXKA 3LJ1A 4BCFA 5DI1A 5KMKA 5AV4A 3MFTA 5I9VA 3M11A 4CFXA 2XKEA 4L3PA 3NYOA 4JQEA 4IX6A 4KS8A 1Q8UA 3RCJA 3CP9A 5HI2A 2BKKA 4FT5A 3COMA 3LFDA 1SNUA 3CJGA 3W33A 4R1VA 2WMRA 2IVTA 4D4SA 5JZJA 2YCQA 4PF4A 3BU3A 1V1KA 1PY5A 3CEKA 1FVVA 5HIDA 4KSQA 5KMIA 2GQSA 3MTLA 1NY3A 4M14A 5ANJA 4AF3A 4DFYA 4C4EA 2PZYA 2C6IA 2IZRA 3SKCA 4DH8A 3RP9A 4YJRA 3BHHA 3KQ7A 4YR8A 2ITYA 5HLNA 3QTQA 3PFQA 3TV7A 2UW4A 5IMEA 3L9LA 4U97A 4FTJA 4L43A 4X2KA 3QQFA 5DT4A 3E8NA 1H28A 4L8MA 2P2HA 2G2FA 3FXZA 3QL8A 3JR1A 5JRQA 3IDPA 5J87A 3OF0A 1O6LA 2UZVA 3SRVA 2F57A 4K0YA 3L8SA 4RGJA 5KX8A 1H0VA 2V55A 4AOIA 1OPJA 2VTOA 3KRWA 5AP7A 3ZM4A 4D2VA 3NUPA 4XOYA 2IZTA 1J1BA 3VS3A 5JQ8A 4JVGA 5ANIA 4PRJA 4V0GA 3U54A 3LCKA 2XIKA 1X8BA 1E1XA 4DITA 2W99B 4OGRA 1CKIA 5C8NA 1JKLA 2HXQA 3BV2A 5HNIX 3BQCA 1G3NA 4RIOA 1QPCA 1ZLTA 3HX4A 4FSTA 3VUIA 3DK6A 5DN3A 3W55A 3H9FA 2GCDA 3PP1A 3ZYAA 2XBJA 4PTGA 4YNOA 1CKJA 3AD4A 2XK8A 5EH0A 3OXTA 2YM7A 4D2WA 1H0WA 1ZARA 4Y5QA 2C68A 3OHTA 3TZMA 3JVRA 5DNRA 5LVOA 1E9HA 3U51A 5AAEA 5AUYA 4BY9E 2QO9A 4C4GA 2FSMX 2JDRA 5EW9A 2X2LA 2B9FA 2XIXA 2HCKA 3Q2MA 4XG2A 3F88A 5CI7A 1QCFA 3I5NA 1YOMA 4Q5HA 4EOJA 4DBXA 4V0GB 3C5UA 3M42A 5HBEA 4A7CA 3DJ7A 3HRFA 3AC4A 4JAIA 5DEYA 3Q6UA 4ITHA 3QA8A 4OTPA 3CR0A 5E8SA 2O2UA 3LCOA 4IVBA 2YDIA 4D5HA 4EWQA 5HNBA 5KMNA 4AACA 4B8LA 3PIYA 3U8WA 1XH9A 4ZEGA 4WRGA 5L6PA 2OJFE 3DNDA 4V04A 5HVYA 3SC1A 3A7HA 1ZXEA 4QPSA 1MRVA 2FH9A 2JGZA 2OIDA 4UV0A 4ZMEA 4APPA 3BYUA 3PRFA 3V5LA 1FQ1B 4QNAA 3IW7A 4G3DA 1CDKA 2BPMA 3F7ZA 3A7JA 2VTQA 4D2TA 4CEGA 4O7SA 2X39A 3R8LA 3RMFA 4L45A 3D14A 4F1OA 4Q9ZA 4PDYA 4O0UA 1Q41A 3R63A 1HCLA 5LMAA 4CTBA 4IXPA 4PNKA 3PVGA 4HCVA 3FHIA 4HNIA 4N57A 1ZYCA 3I0QA 3ORIA 3QFVA 1H24A 4RC4A 2EXCX 4X2GA 5DWRA 1PKGA 4A4LA 4O7NA 4H1JA 2XRWA 2PE2A 3H0YA 2QR8A 3I7BA 4PMTA 2FVDA 4JAJA 3S4QA 4J97A 1AD5A 2VWVA 1O6YA 2Y4PA 1BI7A 5F9EA 4EOIA 4E4XA 3G0FA 1OKZA 4ACDA 4HW7A 5LJJA 2PVNA 1YDTE 3TG1A 1W98A 4YPDA 2BHEA 4MHAA 2OFVA 3UO6A 2XEYA 5KZIA 5C27A 3W2CA 1W8CA 4WRSA 3TKUA 5A46A 4CFMA 3CTQA 4FTUA 3EQIA 1M7QA 4FZDB 5IQEA 3RCDA 4IE9A 5HO8A 2W1DA 2VNWA 2XK6A 1QPEA 5L2IA 2HZ4A 3EYGA 5HD4A 3UJGA 1V0OA 3PE1A 4G3GA 3LPBA 1OM1A 2E9NA 4F09A 5CNNA 4QYFA 3VC4A 3HZTA 2VTNA 2RL5A 4AN3A 3ZM9A 4QMWA 2BZHB 3D94A 2OJIA 4W4VA 4FIJA 3Q6WA 2HZNA 2XCHA 3PXFA 2ONLA 4I5PA 3PSCA 3R8VA 4KS7A 5D12A 2WMWA 4I92A 4AOTA 4F63A 4O86A 4YJOA 3E8EA 1BI8A 4NM7A 3RPRA 4QTEA 5IMXA 2WMAA 4BI1A 1GZNA 3LQ5A 5EM7A 2C5NA 4F6WA 3VJOA 4FSRA 5HE1A 3WZUA 2QLQA 2XS0A 4QP9A 4JR7A 5HHWA 4E26A 4O0TA 5BVDA 3DQWA 3D7TB 5AWMA 4N0SA 2XVDA 2BRHA 3IGGA 2R5TA 3RNYA 3VS2A 2XNBA 4EOKA 3C4CA 4KKHA 5DPVA 3Q52A 3C4XA 5J95A 4FNZA 4AG8A 1OL7A 2CGUA 2CGXA 3PXRA 2JITA 5TE0A 3OG7A 4JIKA 4ALUA 4APCA 2PVHA 4MX9A 2ITZA 3CGFA 5D1JA 4GU9A 2XRUA 2EB3A 3FLSA 3WBLA 4ZOGA 3LCTA 3R21A 3VUDA 5CT0A 3MYGA 4W8EA 2W5HA 3TV4A 4AN2A 2J51A 3QHWA 4X6RA 4CRSA 1OL1A 2QU5A 2UZUE 3SV0A 5AIRA 2YIWA 3OTUA 2F7XE 4CMTA 2HZIA 3MFSA 5DG5A 5A6OA 4O81A 4S31A 4MQ1A 5E8ZA 5IA5A 4Z7HA 4U9AA 4ALVA 4FZ7A 3FLQA 4FKLA 2IVUA 3LAUA 2PVFA 3BRBA 2XZSA 4ANNA 3U6JA 2X4ZA 2NP8A 5IA2A 4U44A 4ORKA 2X6EA 3W32A 3OBGA 1R1WA 1QMZA 3DLSA 3VWAA 4QP2A 4AZTA 5I5ZA 1K9AA 4BYJA 2QOHA 4EK8A 2QVSE 2UVZA 4Y73A 3FJQE 1W0XC 1YHSA 4KB8A 2XBAA 2JDSA 3D4QA 3HV5A 4HZSA 3OWLA 1W83A 5BNJA 3EL8A 2QOLA 5GJDA 4H36A 3ZZEA 1L3RE 4XCUA 2X8DA 5HG9A 3UQFA 1OBDA 2OICA 3EOCA 3PVWA 2YM6A 5HO6A 3RBWA 4AE9A 3DPKA 4O82A 1NVSA 3IG7A 4LM5A 4UALA 3LMGA 4D0XA 4YZDA 5JFWA 2J0LA 2IZSA 3R7GA 4ZSGA 4F9CA 2ITTA 2O5KA 1H4LA 4BF2A 5I3OA 1GNGA 4Y95A 4IB5A 2JEDA 3AC3A 5KHWA 2XF0A 3HMNA 3WF6A 3P4KA 3ORTA 4YJVA 3BEGA 3P7BA 4LRMA 3HVCA 3KULB 2I0HA 3ULZA 4GT3A 1IRKA 4Z3VA 5T6KA 4WG5A 3QUEA 2ETMA 3DDQA 1BL7A 2WOTA 4E7WA 5J79A 1PJKA 4AA4A 5A4EA 1VZOA 1XBAA 2C5OA 3KCKA 3PJ2A 3PY1A 1HCKA 4TPTA 5AUVA 3NYVA 4E73A 4EHVA 1J7UA 3CSVA 1AQ1A 4DG0E 3PZHA 3BE2A 3D2KA 2G15A 4CMOA 3P0MA 4GYIA 4YLLA 5EM6A 1ZY5A 4IDVA 2W4OA 4XP3A 2RFNA 1FVRA 1TKIA 2WGJA 2ZB1A 5JKGA 4CFNA 3FZOA 3QQHA 4Q2AA 3ZC5A 1H08A 4BCQA 2WOUA 4ITIA 4GJ3A 5CT7A 3QLFA 4AU8A 2R3LA 3AT2A 1W84A 5IZFA 4CFUA 1SYKA 2VWBA 4QMTA 4XG6A 5L2QA 5L2TA 4TYIA 5LVNA 3HRCA 5EG3A 1Q61A 3QA0A 4FL1A 4NIFA 1V0PA 4B99A 3UMWA 2WMSA 2ZV7A 3R30A 3LM5A 5H9BA 4WNMA 1SM2A 4ZTLA 4ANMA 3Q5IA 4U40A 2RFEA 4J7BA 1R3CA 2BZIB 4ID7A 5HU9A 2YIYA 4IAZA 4F7JA 4G6LA 2WIPA 4F64A 1H00A 1DS5A 3E3PA 4FK6A 2W1FA 5CWZA 4G16A 4N4SA 3R9HA 1OL2A 1Q8TA 1BUHA 5HE0A 3RPVA 3I5ZA 2F2UA 1WVWA 5ETFA 3R8MA 3FSFA 4HOKA 1H1SA 2E2BA 4K33A 4D2RA 4EQUA 1H26A 2VUWA 3K3IA 2G2HA 3QAME 4BKJA 2R3NA 3TDWA 4XRJA 4PPAA 4LFIA 2J9MA 4CD0A 3EKKA 2ZOQA 4ZK5A 4X3FB 2WD1A 5E90A 3PA3A 1Q8ZA 2C5VA 2PMLX 2RIOA 3EN6A 3LE6A 5IDPA 4JJRA 3FLYA 1PMVA 3MH1A 2ZVAA 4YZNA 4JDIA 4FEUA 1MUOA 2H96A 2EVAA 2YAKA 3ORPA 3NRMA 1STCE 3RVGA 3ORLA 4IZ7A 4FEWA 3QKMA 2QOBA 4FV8A 3D83A 4OUCA 2J6MA 4BDIA 2WQOA 4FF8A 4J98A 4FMQA 5D41A 4RT7A 5GNKA 4LRJA 4JR3A 1JAMA 3E5AA 5HG8A 3DOGA 5DR2A 3TT0A 3UMXA 4UN0C 4K8AA 4DC2A 4YJQA 3WZDA 1UWJA 2C30A 4C4JA 3I0OA 5D7AA 5FG8A 1OIRA 4FVQA 1E1VA 5JFSA 2WXVA 3G51A 3VQUA 1TQPA 4EEVA 1G8AA 3TZ9A 1FVTA 1H27A 4QMYA 4XV1A 4DBNA 3MH0A 1CKPA 2Q83A 2GNHA 3DK3A 4FICA 4UWCA 4K1BA 2I1MA 3A2CA 3ZH8A 4LMUA 1FMKA 2XNPA 3QBNA 4I3ZA 3PP0A 3RZFA 3I79A 2QOFA 3QC4A 4X2FA 1UNGA 4YO6A 2OH0E 5IEXA 3AGLA 2IN6A 4YJTA 3WYXA 3VBYA 4M13A 2GHLA 5JFVA 3HL7A 3GFEA 3LW0A 3KVWA 3NCGA 4XG8A 4IZAA 3VF9A 3DXQA 4ZLOA 3WZJA 4AAAA 4BTMA 3MTFA 2JDTA 2HK5A 3K5UA 2ZV2A 4FV3A 3MVJA 4JOAA 3ZO2A 4HVDA 3ZDIA 2JKOA 2OZOA 2O63A 1LEZA 2OXXA 3OTVA 4ZAUA 3ZUVA 1ZYSA 3EQDA 4OAVB 1H1QA 3PSBA 2VWWA 4MWIA 3G9NA 3L9PA 5ETCA 3DAJA 1OB3A 4X3JA 1OVEA 4ANSA 3PDTA 2ERKA 2OU7A 1Y6BA 5HICA 4EH5A 4PL5A 4G3CA 4ZLYA 5A14A 4EH9A 1KE5A 3VBXA 3EZVA 4CG9A 3FV8A 1YW2A 2C6EA 3TACA 4BDBA 4D28A 5CF6A 4YSMA 3SX9A 4QMNA 4ZLZA 4KAOA 1YXVA 4TYHB 3A60A 2B53A 2ZMDA 1B6CB 2HZ0A 3E7VA 3O96A 3UNZA 4AT4A 5LQFA 1UNHA 3GU5A 1EH4A 5AP5A 1S9JA 5CZIA 3QTXA 3VQHA 3D7ZA 2Z7QA 4WG4A 5J9ZA 3H0ZA 4O7LA 4RVLA 3PY3A 4FOCA 3COKA 4EOPA 3P23A 2WTWA 3RTPA 4F65A 3R0TA 4CZTA 1JSVA 2OXYA 3C13A 4MXYA 4AZEA 4DN5A 3Q9ZA 5K9IA 3IDBA 2AUHA 3DTCA 2HWOA 4I22A 3EFKA 3VUTA 5EYCA 1ZMVA 4FV1A 5DLSA 1OKWA 3OW3A 3ORZA 3ROYA 5CTPA 3O50A 4IB3A 5ANOA 4BCOA 3AG9A 4G9CA 4D1ZA 2CGVA 2UVXA 1YWNA 3F3ZA 4XRLA 5EI8A 2OH4A 2JFLA 4C2VA 4F7LA 2C47A 4E3CA 5HTCA 3DDPA 3HA8A 3Q4CA 5KE0A 3HUCA 4LRKA 3FL5A 2GNIA 4FTIA 3Q04A 2YABA 1SVEA 4O96A 3UBDA 2GMXA 2JDOA 4C34A 4ERKA 1UU9A 4CKIA 3UODA 1OL6A 1DAYA 5DOSA 5JGAA 2VTJA 1Q99A 2BRBA 5LWNA 4N70A 3P08A 5I0BA 2WTJA 5IF1A 2GNJA 2W9ZB 3HMOA 4H39A 1P5EA 4HCUA 4F70A 2BTRA 1G8SA 5EQEA 1A48A 4WSYA 5IG1A 5E8VA 5IUGA 4W8DA 1UV5A 2RF9A 3QZHA 3NUYA 4LOPA 5K0KA 5BVKA 2WTKB 5CALA 4ZS4A 1JKSA 2I0EA 3JUHA 4RIXA 4DFLA 1IEPA 4Y8DA 5HZNA 1QL6A 1PW2A 3L9MA 2WU6A 4MAOA 4C36A 3A61A 2FB8A 2AC3A 3TKIA 3HMMA 3W16A 3KXNA 4CVAA 4PP7A 1A06A 2VTRA 3G33A 1KV2A 4RFMA 3F6XA 2Y8OA 5FEQA 4EUTA 4O7WA 2GHGA 3EN4A 3CY2A 2JIUA 3FLNC 1A9UA 4MQ2A 2OI4X 3NW6A 2FA2A 2ZYBA 1PXJA 3ZU7A 3EN5A 3IOPA 4IVAA 2W0JA 3KRLA 3AOXA 4IH8A 4OTIA 4ASXA 1XQZA 3M1SA 3S3IA 4E5BA 3R2BA 4IX3A 4KBCA 4FSUA 1UNLA 5CQWA 5AUXA 2QNJA 4EH6A 2C0IA 5TT7A 4ALWA 1Q8WA 4OW8A 4AW5A 3EIDA 4JBQA 4IX4A 3E63A 3JYAA 4L52A 1Y8YA 1U54A 3WI6A 4GK2A 4Y72A 1PF8A 2R4BA 3EL7A 4LYNA 1H01A 1JNKA 4U7ZA 5ANGA 4FX3A 4AZVA 3VUGA 2PY3A 2WEVA 4UWYA 3AGMA 5KBRA 2O64A 3LJ2A 4HGEA 3UVPA 3ZO4A 1RW8A 3POZA 4MWHA 3RAKA 4DEDA 4W4XA 4UMRA 4DF3A 3NAXA 3HDNA 1CMKE 4I20A 4O1OA 3A7FA 5EOLA 3R8UA 3DY7A 3PIXA 2YWVA 2P2IA 2BDJA 5BYZA 5C9CA 3VAPA 3ORXA 4O0XA 3P79A 2QOOA 3IPHA 1BYGA 3IECA 3TNWA 5KMOA 3PPJA 5KMJA 2ACXA 2E9UA 5EYDA 4L46A 4BDGA 2VV9A 2JKKA 1RQQA 4I21A 2EXEA 1YI6A 2QO2A 5A54A 3OEZA 3QD2B 4KRDA 3ZXTA 5HOAA 4QQTA 2LAVA 2PK9A 3IGOA 3DBCA 3WYYA 3EFJA 4QMQA 2XYNA 4EC8A 4O2ZA 3KREA 3QF9A 4HPUE 4MNEB 4O27B 5AAFA 5KCVA 4E4NA 5AADA 2VRXA 4A06A 3WOWA 5AR5A 4FYNA 4FTTA 3E64A 4I5HA 4AE6A 2VU3A 3LIJA 4BCHA 1VYZA 2YLEA 3W1FA 2OZAA 5CEQA 3UZTA 4DFNA 4C0TA 2PUPA 1SNXA 2X2KA 2C6OA 3BGPA 3QGWA 4PL3A 3C0IA 4D4RA 1SVHA 3ZSIA 3FI8A 2J5FA 4AA0A 4EOSA 4QMPA 2J50A 4R77A 2FO0A 4RWLA 2W1EA 2YJSA 3WF8A 5FP5A 3AC8A 3TI1A 4A9YA 4B7TA 2Y6MA 3UOJA 2F2CB 2JIVA 3LXPA 1HOWA 2WMQA 3DJ5A 2B9JA 5IQDA 4JBVA 4TKSA 2GTNA 5CI6A 1Z9XA 5FM2A 3G6HA 5I3RA 4NM5A 5M57A 2VO0A 2Y7JA 4C61A 4GS6A 3JPVA 5AJQA 5KKRB 5E8UA 2PE1A 2OF4A 4MXXA 3V6SA 4J1RA 3C4FA 3DNEA 3LJ0A 3GEQA 4CKRA 4OBOA 3UPZA 1KE7A 4QRCA 3H9OA 3K2LA 3DAKA 5BVNA 3AC2A 4NJ3A 1B38A 2OXDA 4LGGA 4CQGA 5IU2A 4PDPA 4QMOA 4Z16A 5LOHA 1OECA 3DJ6A 4BI0A 4M67A 5FTOA 4ASEA 3COHA 4IWOA 5A9UA 4GVJA 2VTPA 4QMMA 4M7IA 3ZDUA 5K5XA 5HEZA 2QKWB 5HTIA 3G5DA 2PL0A 4ENXA 4JLCA 4YJPA 4CSVA 3O7LB 2VTSA 5CENA 4ZSJA 2OIQA 4QMZA 4TYGA 5ANDA 3WZEA 3QD3A 2YZLA 5AM7A 3ETAA 3GCSA 5CZHA 1TVOA 4HPTE 3NX8A 5FD2A 4K9YA 3U9NA 3BU5A 1OIQA 4YGAA 4E5WA 2C69A 1FOTA 5D11A 5KZ0A 1Y91A 1BLXA 4JDHA 4ZJIA 1PXNA 4UEUA 3PPKA 4CZUA 2XUUA 2NRUA 3LCSA 4QNYA 4ANQA 4DGOA 4FNWA 5BMSA 1WBVA 1UVRA 4H3BA 2JC6A 4OTDA 4D0WA 3TUCA 3OCBA 3FQHA 3S1HA 1ZYJA 3VBQA 1XBCA 3C51A 3VO3A 2BFXA 2YLFA 3KN5A 4NW5A 2H34A 3RJCA 5J9YA 1Q3WA 5AUTA 3WIKA 2XA4A 4IM2A 4PMPA 3TNPC 5BYYA 1WMKA 4XLVA 4FR4A 1UU3A 2OJGA 4CYJA 4YMJA 5ICPA 4FSNA 4BBMA 3DGKA 3P7AA 3FYJX 4I6FA 2UW5A 3QKKA 3DXNA 4IADA 3CQEA 4RWIA 3RNIA 2X81A 3FSKA 3CCNA 3FMJA 1PYEA 1WFCA 4DH7A 3NUSA 3DB6A 5KUPA 1G5SA 2Z02A 2QG5A 1R39A 2WTKC 3EQCA 3ERKA 2WTIA 5LCKA 1GIHA 3S95A 3SOCA 4DFXE 4AGUA 2UVYA 3ZRKA 3HV4A 1FMOE 3EN9A 4YSJA 4FIEA 5TOZA 4Z55A 3RPOA 4CT2A 1YWVA 4EK3A 3ZSGA 2YZAA 4JL9A 4S2ZA 2B1PA 2QOQA 5F1ZA 5F95A 3R1SA 1P4FA 5DBXA 5L8KA 4O0SA 4F1TA 5IA0A 4G17A 3G90X 4NCTA 4RA5A 3TM0A 3NYXA 4ZSLA 4FA2A 2Z7SA 3GCQA 4HYUA 2QHMA 4TN6A 4ASZA 4EWHA 4KINA 4RIYB 3MJ1A 1GAGA 4EYJA 4C3PA 4E4MA 3NPCA 3KVXA 3QTRA 4WG3A 3UOLA 5LXMA 2R0IA 1WVYA 4KD1A 4UYNA 4F9WA 3ZEWA 5J5SA 2UW0A 3CKWA 5DRBA 5DVRA 4MD9E 5HIBA 2E9PA 4TNBA 3NWWA 3BLRA 3O8TA 3ENHA 3KXGA 3QD4A 3KK9A 2OGVA 4GVAA 4P7EA 4TL0A 4MNFA 5D7VA 5EI6A 4BDFA 4F4PA 3GI3A 3KMWA 4DEHA 4IAIA 3NAYA 4WNKA 4EK5A 3RALA 4ACGA 4K18A 3T3VA 4DEBA 4Y85A 3WIGA 2BHHA 4ONAA 4M12A 3TUBA 5C4LA 3BWJA 5TR6A 4C4HA 3AMAA 2B52A 3G2FA 3QHRA 4WNOA 1MQBA 5IQAA 5JQ5A 5AA8A 4KUJA 3G0EA 5T3QA 4BZNA 3QRKA 4EZ5A 1UU8A 4AUAA 4YJNA 1YOJA 2XKCA 2YACA 4FEQA 4H1MA 4OTHA 3R9DA 4XV3A 3HA6A 2XYUA 5J1WA 5DR6A 3TNIA 4EONA 4GYGA 4BCKA 3R9RA 4NKSA 3QTWA 4QP3A 3MDYA 2W17A 4C7TA 4WIHA 1Y57A 4EOMA 3ZHPC 2V62A 3ANRA 4FKIA 4NSTA 4R8QA 4YU2A 4R78A 4C02A 1OMWA 3RKBA 4YBKA 4USDA 4FKWA 3CPBA 2C3JA 2UZOA 2AC5A 1WBTA 4V05A 4GL9A
chains in the Genus database with same CATH superfamily
5IQGA 1VR2A 3E3BX 3FKOA 4U8ZA 3UDTA 2JIIA 4LOOA 4DEAA 4BR3A 5CXHA 4G1WA 5KNJA 3E62A 3V5WA 4HVGA 2QR7A 3P7CA 5FDXA 1YXSA 1L8TA 3K3JA 4R7HA 3NW5A 5IISA 3H4JA 4KA3A 3GQIA 5L3AA 2DUVA 4MXAA 3W2QA 2XAOA 4YZMA 2W5AA 3KK8A 3LCDA 4H3PA 3H30A 3AMBA 4JDJA 3AMYA 3W18A 2ITOA 3QRIA 4RVMA 4W9XA 3LFAA 4NFNA 4EQMA 3Q53A 5CU4A 2R3HA 1DI8A 4OTQA 3ZRLA 1DI9A 4H58A 4LQMA 2CNQA 4CG8A 3FMLA 3ET7A 4IBMA 3TDVA 3E8CA 4KRCA 3CS9A 4BB4A 1SZMA 3AXWA 5EQPA 1PMNA 3EB0A 5D10A 3K54A 3D7TA 5G1XA 1JOWB 4EH3A 2R0UA 1NVRA 4IWPA 3VUHA 2C5XA 4IJPA 3R9NA 4XJ0A 3R9OA 3OUKA 3C4EA 3FHRA 4IWQA 5GIOE 3ZLXA 2C3LA 3NVKI 2F7ZE 4EH2A 4L01A 2UZWE 5DIAA 2O0UA 1KE9A 3A62A 5CSVA 4FKUA 4XS2A 4BWPA 3RWQA 3LMIA 3R1NA 1ZRZA 3MIAA 3A4OX 4M69B 4DYMA 2YN8A 3FUPA 3KA0A 2AEGA 4TWPA 4AXCA 4U43A 4BZDA 4QMSA 4LOQA 3CTJA 5CSPA 3JY9A 1DAWA 4ZIMA 4U0IA 1ZOHA 2J0JA 4FGRA 3VS6A 3MI9A 4CGAA 3POOA 3D9VA 3ALNA 4K6ZA 3NMUF 3FQEA 4IB1A 3B8RA 4RC3A 4O4EA 2WTDA 2C6TA 3OZ6A 4I5CA 1ZOGA 2GS7A 3N4VA 3TWJA 2A1AB 2YJRA 1TQIA 3V04A 3QTUA 3GENA 2HW6A 4BGQA 2PULA 4R7BA 2NPQA 2W1IA 1XBBA 1FPUA 2J90A 3O8PA 4MD8E 3P86A 2PUNA 3I81A 4GW8A 3VRZA 3ENMA 3VVHA 2HOGA 4TTHB 5AUUA 2OJ9A 4AQCA 5A4LA 5M51A 3S00A 4MF1A 5KBQA 4H3QA 4TWOA 2RSVA 3QC9A 3Q9XA 3C4WA 4I0RA 2C1AA 4IEBA 3TNHA 3ZLWA 4JQ7A 4F6UA 4CKJA 3FZSA 5AP1A 3PJ3A 3VW8A 5EKNA 3ATTA 2C1BA 3ID6C 2UV2A 4QP6A 5L2WA 3HAMA 2CPKE 3RAIA 5ANKA 5L4QA 4YTIA 3V5PA 3QRJA 4IC8A 2B55A 2BRGA 2PWLA 5C26A 2B4SB 3NUAA 3DBDA 4FKGA 4AW1A 3DBFA 1XHAA 3PA5A 4L44A 5F94A 2XK3A 3OWPA 4KIPA 2PZ5A 4L00A 5AP3A 3SDJA 4BDJA 1UKHA 4FT7A 4M68A 4XBRA 2YITA 3KULA 4XYFA 5HLPA 2BFYA 3EHAA 3L8PA 4PPCA 4BVUA 1M2RA 2J0KA 4FV2A 3U6IA 1NXKA 2OW3A 2X9FA 2VWZA 4G5JA 2HY0A 2C3IB 3EKNA 3PTGA 5M07A 3A8WA 4D4YA 1J7LA 3R7UA 4YP8A 2W9FB 4EK4A 1R0EA 3EWHA 3F66A 2QONA 2ITUA 2PMIA 3UOHA 4G6NA 4MBJA 5JGDA 4QP1A 1ZWSA 1YOLA 3MH3A 3NNVA 5A4QA 5CQUA 5HLWA 1V0BA 2DQ7X 3E92A 4AZWA 3V5TA 3VHEA 4NCTC 4O84A 4EQCA 3LFNA 4DHFA 5JEBA 4GMYA 3TUDA 3IW5A 4BHZA 5AIKA 5L8JA 4RFZA 2VTIA 3CJFA 4Q5EA 4F7NA 4F9YA 3NLBA 3OXIA 2W1CA 4BCIA 3IW4A 4MBIA 5AR3A 3E93A 2A27A 3FBVA 3BWFA 3E87A 5ANEA 4Z9LA 3RI1A 3DA6A 5EFQA 1UA2A 1WZYA 2QU6A 3Q4UA 2CN8A 1OUKA 3NIEA 4PX6A 5CY3A 5HX8A 3ATSA 2BIYA 5IUIA 3FKNA 4GFMA 3MB6A 3DAEA 3Q9WA 3HGKA 1OZ1A 2RKUA 2WTCA 3FDNA 4FV4A 3SXSA 3BBWA 2G1TA 3IW6A 3O7LD 3UDBA 4EC9A 3QX2A 4UMTA 4KIKB 3GOKA 2QURA 4CFFA 5FWKK 3OC1A 5M55A 4RJ3A 2WPAA 3VS1A 3BE9A 4C3RA 4X3FA 3JVSA 3FMNA 3ZFXA 4F99A 3UIUA 4I6LA 3U4WA 1H1WA 3MVMA 3QUPA 4U45A 4QMLA 4JRNA 3UQGA 3FKLA 2UUEA 3MN3A 5FEEA 4X0MA 5HQ0A 4FTMA 4HYHA 4QDVA 4GFOA 2UZDA 2Y6OA 3AC1A 4B8MA 4I41A 4E1ZA 4QQCA 3UNKA 3KXZA 2LGCA 5AFVA 1DM2A 2PZIA 4C2WA 1U5RA 2DS1A 4XUFA 4O21A 5F4NA 3DKGA 4C35A 5HTCA 2WQMA 3R04A 2XNGA 1J1CA 4RC2A 4ANLA 4BDHA 3GU4A 2I6LA 2BROA 4FKQA 3EFWA 4BKYA 3LKMA 3I7CA 4NUSA 5KMMA 1KWPA 4RSSA 5M06A 2QOCA 5H8GA 2Z60A 3EN7A 4P90A 2VWIA 4R3CA 1WBPA 3I60A 4BGHA 4EH7A 1Z5MA 2I0VA 3MBLA 3PVUA 4IB0A 2CSNA 2IW6A 4FVPA 4ZTRA 4G3EA 3D5VA 5GZAA 4DTAA 2YM3A 5C4KA 4PDSA 3V8SA 4YC8A 4CNHA 2V5QA 5CU3A 5CEMA 4PY1A 2PHKA 3PZEA 3RINA 3FZTA 4BL1A 2VD5A 4NT4A 3UQCA 1YHWA 2VWXA 3QZFA 1UKIA 1YWRA 4KWPA 5J9LA 4L68A 4O7ZA 2C6DA 2V7OA 2X0QA 2YCSA 3FI4A 3HYHA 5FBNC 5AV0A 3MW1A 4FKSA 4U79A 3TYKA 3L8XA 3OT3A 3D15A 4NK9A 2YM4A 4X7QA 1IASA 4G34A 4RJ5A 4C33A 2VX1A 3AQVA 3I6WA 2CKPA 4ZJVA 3E7OA 4N6ZA 3NSZA 4J52A 3O71A 4C38A 5I9YA 3BHUA 3C1XA 1YHVA 3BL9A 2ITVA 4FT0A 2GQRA 4YC3A 2QI8A 4WKQA 5LARA 4I0TA 4AT5A 4TXCA 3MS9A 4EYMA 3O5AA 3NZ0A 4FTLA 1GOLA 1ZOEA 1KUTA 2RG5A 3PWDA 4I24A 4FI1A 1BL6A 3DB8A 4G6OA 2VTLA 4KIQA 5HE2A 4FTKA 5AP2A 4D58A 4TYEA 4BWXA 3EFLA 2YCRA 1GIJA 3ZCLA 2C6LA 4XP0A 2CKQA 1H1RA 3AD6A 1W2CA 4FKJA 4GG7A 1F5QA 4FT3A 5JN2A 3HV3A 3VJNA 4BRXA 3EQHA 2FUMA 2YHVA 2ETKA 2W5BA 4UYAA 5H3QA 3HAVA 1CM8A 2ZB0A 4TYHA 5M08A 4G9RA 3DU8A 2YAAA 2BUJA 4JBPA 4CMUA 2R7IA 2XJ0A 4I0SA 1GZKA 3O8UA 2EB2A 4CT1A 3PVBA 4ZZMA 4R1YA 3T3UA 4JS8A 1YQJA 1Q5KA 5HGIA 2YEXA 3SAYA 4AFJA 5EDRA 3UP2A 4NL0A 2PMNX 5IQFA 4TZRA 3ZRMA 4UXQA 4RX9A 4ZY5A 3Q3BA 5DT0A 5EI2A 5HVJA 3ZBXA 4O0VA 1FBNA 4EOOA 4A9RA 3R7VA 1M7NA 2GS2A 4CZYB 4I4EA 4JBOA 2BDWA 2GNGA 4ASDA 4F9BA 4WUAA 4U42A 2XIYA 2XNMA 2IZUA 4JRVA 2B7AA 2IW8A 3ORMA 4TT7A 5DE2A 4RBLA 5DHJA 1WBNA 4ZTQA 3FWQA 5EHLA 3W8QA 4FSQA 4AZSA 3QCXA 4FC0A 4YPSA 5JSMA 3QTIA 4M0YA 3R7YA 1URWA 1O6KA 4RG0A 1Q24A 3FPMA 5EHOA 3N4TA 5CSXA 5B2LA 1R78A 2B9HA 2OIBA 2VX0A 1K2PA 2W1HA 3IDCA 4RX7A 3UIMA 3ZUTA 4F0IA 4RZWA 3MFUA 3RK9A 3PJ1A 2XCKA 4EJNA 3OOGA 5EKOA 4BGGA 5A3XA 3TV6A 4C57A 1YI4A 2YIXA 4L53A 2JBPA 3LFBA 4DLIA 4J71A 5CYIA 2A0CX 3WE8A 3NVMB 3E8DA 4FSZA 3A7IA 3PSDA 4DGLC 5BV3A 5HKMA 3OVVA 3D2IA 3KL8A 3ZLYA 2ITWA 3HDMA 3WF7A 4MXOA 3GCUA 4NEUA 3S0OA 2QKRA 4FBXA 2X8EA 2NRYA 4IC7A 4AFEA 4RPVA 5A4TA 5FUTA 4XG3A 5HG7A 4USEA 3KB7A 4QOXA 4X21A 4DH3A 4QQJA 3DFCB 5E1SA 3PJ8A 1ND4A 3W10A 3ZFYA 4EJ7A 2GPHA 3F5UA 2WQNA 5HG5A 1ZZ2A 4O7VA 1MQ4A 4IQ6A 2Q0BA 4ACCA 2YFXA 2WAJA 1MRUA 2B54A 2HAKA 2XK4A 2BRMA 2Y9QA 3F5GA 4DCAA 1FGIA 3W0QA 5FDPA 4L7SA 3OCSA 4P4CA 2HXLA 4FUXA 1F3MC 3ZZWA 1OBGA 3ROCA 4IAKA 3LFCA 4ANOA 3N9XA 2PVRA 3NDMA 3R7IA 2OK1A 4AQKA 3NS9A 4RRVA 2I7QA 3SQQA 4ANBA 1K3AA 5G6VA 5ETIA 4GJ2A 4HZRA 5FXRA 1UU7A 5BUIA 2WELA 5IA3A 2HELA 3BGQA 3GGFA 5A4CA 3CXWA 4ZZOA 4G3FA 1H8FA 2RFSA 3AD5A 2V22A 3F2AA 3NUUA 3PE2A 5FQDC 2IO6A 3MJ2A 4PMSA 3BX5A 3O23A 3ZS5A 4CFWA 3A4PA 3CPCA 3ZMMA 2CLQA 4BTJA 5IH5A 2JKMA 3U87A 1JWHA 3U9CA 4MTAA 4X3FC 5CANA 2A19B 2XAMA 2IWIA 4AGWA 3TIZA 3OROA 5CLPA 2PVKA 2DWBA 2WQEA 4IWDA 4DLJA 1I09A 3KXHA 4FZAB 4ZMFA 3SA0A 3U55A 4IVCA 4FKOA 5EM5A 4AZFA 3EH9A 3TTJA 1WVXA 4Z7GA 2QOKA 3EQFA 3BU6A 4O2PA 4R3RA 3DKFA 1RE8A 2YDJA 3C4ZA 4OTFA 4UB7A 2PYWA 4C37A 3KFAA 5GINE 3RGFA 4MNEA 4WOVA 3NUNA 5HNGA 4KSPA 3MA6A 4FNYA 5AX3A 5C8MA 5E1EA 5CAUA 3DBQA 4J8MA 4TRLA 1JSTA 3LFFA 3PIZA 1PXLA 1QPDA 4EHZA 3LOKA 2WMBA 3KCFA 2JAVA 4XOZA 3BYVA 5CEIA 3BYSA 3DLZA 2C5YA 2WMUA 5L8LA 4DFBA 2XKFA 3D5WA 4RJ8A 5TF9A 5M44A 3FMDA 3TJDA 4QDEA 3ODYX 3QQJA 3MV5A 4X2NA 3LHJA 3DKOA 4HCTA 3GVUA 3IO7A 4RA4A 4RQKA 2J5EA 5EDPA 2HYYA 3BIZA 4IFCA 5CAPA 1PRYA 2XNNA 4FV7A 4GV1A 4EHEA 5M4FA 4O7YA 3JS2A 1KE6A 4K2RA 3ORKA 4RMZA 3PJCA 3UO5A 5LVLA 4ZJJA 5FLFA 4TY1A 1ERKA 5JT2A 4F0GA 2WKMA 2ZJWA 2ITXA 4IAYA 4O6EA 3V8TA 1PYXA 1SMHA 5M4CA 2BRNA 2J2IB 5AR7A 4ZXTA 3RAHA 4FKVA 3MPMA 5AUZA 5E92A 5JMSA 2ZM1A 4FEXA 2RG6A 4U80A 4AXAA 4EH8A 1XO2B 2CLXA 3MESA 2CGWA 3PPZA 2Z2WA 4MK0A 5F20A 4J96A 4Q9SA 3FMEA 4B0GA 2QC6A 4IJ9A 4PPBA 4NJDA 4BC6A 3TJCA 2DYLA 4D9UA 3Q4ZA 3F5XA 4FTRA 3DFAA 3W0SA 2G9XA 3LZBA 3QWKA 2H8HA 4AAYA 3H9RA 4PMMA 5I9XA 4IDTA 5J7HA 1XJDA 4J99A 3H3CA 5E8WA 3PWYA 4CFVA 1URCA 3KU2A 1W82A 3TIYA 2WNTA 2GQGA 3I4BA 1Q3DA 4EORA 2E9OA 4ERWA 3CD8A 4PP9A 2WO6A 1Y8GA 3GU6A 4JXFA 3F2NA 2JDVA 5HIEA 2OBJA 2PUUA 2IVVA 4QYHA 2E9VA 5M09A 4O0RA 4UBAA 1WCCA 4FVRA 4MVFA 4BCMA 2BZJA 2C3KA 4MH7A 4UWBA 5JFXA 2VTHA 5K4IA 3UO4A 5E91A 1LP4A 3IS5A 5JGBA 3IOKA 1IA9A 3VBWA 4P5QA 3BPRA 5AV1A 2KTYA 4IAFA 3HV6A 2GFSA 4F78A 5BVFA 4DTKA 2A4LA 3QRTA 4FSMA 3UZPA 4B6LA 4S32A 3TXOA 2BAKA 3ZOSA 1I44A 5HO7A 4OBQA 4JDKA 1IG1A 2GU8A 2R64A 5FEDA 4U41A 1WBOA 3GP0A 4FTQA 4KBKA 5FXSA 5CAOA 2CNVA 1Q97A 4ENYA 3IKAA 4OAUC 4FTAA 1Q4LA 3S2PA 3R00A 4RJ4A 3DK7A 3MFRA 3EYHA 3F9NA 3ZXZA 4U81A 2YWPA 3IK3A 2Z7RA 3ANQA 4QTBA 2W96B 4CLJA 2QOIA 4CXAA 3QQUA 3Q96A 3O2MA 4WA9A 1M2PA 5HCYA 1U5QA 3THBA 3HMPA 2UW8A 3CLYA 2BIKB 1LEWA 4RIYA 4MD7E 3WE4A 3QQKA 3SXRA 4L67A 4JIAA 4ZTNA 3FL4A 4F0FA 5B2KA 5JK3A 2NNWB 2OFUA 3QXOA 4WT6A 4F1MA 3DS6A 4HVIA 2IJMA 3RM7A 5CVHA 5IPJA 3W0PA 1P4OA 2CHLA 3KEXA 3OD6X 5IDNA 2J0IA 4DFUA 1XH7A 3KF7A 3W8LA 3HEGA 2YA9A 4D55A 3VNTA 1JBPE 1YDSE 5AEPA 4NU1A 3F69A 3D0EA 4I6HA 4M8TA 1VLRA 4O0YA 4O0WA 3EQGA 5J8IA 3TTIA 3ZO1A 4X6QC 1KV1A 4USFA 2NYAA 1JVPP 2BVAA 3R7EA 3V51A 4BKZA 5BPYA 2J7TA 1JPAA 4BN1A 2FSTX 4WUNA 4F6SA 1JLUE 1GZ8A 3OT8A 4GEOA 4QP7A 2FSOX 4I6BA 4YTCA 1PXKA 3GQLA 4DT9A 5DEWA 2HY81 3VBVA 4Y5HA 1LUFA 1IR3A 1H07A 1PHKA 2F7EE 4CV8A 4RWKA 4FGBA 1YKRA 3NGAA 4FKPA 3DXPA 4RJ6A 2W06A 3CKXA 2YIQA 3MH2A 3DV3A 1FGKA 3GC7A 3UC3A 4R7IA 4P2KA 4IX5A 4QMVA 3ALOA 3MB7A 3UE4A 3PA4A 4MBLA 1LR4A 5GIPE 5IQHA 3OBJA 3SLSA 5DGZA 5IH4A 2ITPA 2R3FA 4FTOA 4LI5A 3ZBFA 3OY3A 2OJJA 4IM0A 4ZTMA 3KRRA 3F61A 3VF8A 2WIHA 4RLKA 4PQNA 3BELA 3NCZA 1S9IA 4A9TA 4BZOA 3QRUA 4N6YA 3FI2A 2WMXA 2O8YA 2WQBA 3TEIA 1M2QA 4XMOA 4I5MA 4WHZA 1UWHA 3PY0A 2BAJA 5IQCA 2Q0NA 4FV0A 4QT1A 3PRIA 5CF5A 4TW9A 5L6OA 4EOQA 4LUDA 4GUBA 3SRVB 5M56A 3H10A 2YERA 4TNDA 1B39A 2CNUA 4BCJA 4FV6A 1M14A 4PV0A 2PVJA 4V01A 3FXXA 3UYSA 4OT5A 2WFYA 5HD7A 4R5YA 2IVSA 4GIHA 2W7XA 4J53A 4LG4A 3QKLA 4UMPA 4BIDA 2XP2A 4BTKA 4IHPA 4LUEA 5CAVA 2XNOA 4IM3A 1YXXA 3KXXA 2P0CA 5HCZA 1GY3A 1T45A 4YTFA 5FRIA 2BMCA 5B7VA 2R3PA 4FEVA 1JSUA 1ZAOA 3SW4A 3T8OA 4C4FA 4KNBA 4S33A 4AT3A 3W2SA 2R9SA 5KMLA 3RAWA 2ITNA 3RM6A 4GU6A 5AMNA 2VO6A 2X2MA 1VJYA 2PMOX 4QO9A 4D9TA 2P55A 3BLQA 2HENA 1XH4A 2UZBA 4EL9A 2WB8A 4UX9A 1TFFA 4CRLA 4BDKA 5IQIA 4IANA 4H05A 5CASA 2GSFA 3VULA 1GIIA 1WBSA 3AKKA 3MA3A 3BV3A 5BUEA 4W4WA 4L9IA 2ERZE 2XH5A 4B9DA 4MCVA 4DINA 5AA9A 1W7HA 5T68A 4ZZNA 4BBEA 3VN9A 5J1VA 3Q9YA 4QP4A 2W05A 4GFGA 3V5QA 5KKRC 3CGOA 2JLDA 3P9JA 3DZQA 3FY2A 2YDKA 4EBWA 5BX0A 4M69A 2ETRA 3PLSA 2JBOA 2ESMA 1YVJA 4FV5A 3HECA 3OEFX 4E93A 1KOBA 2QHNA 2ZAZA 4RLLA 4W9WA 1LPUA 3QGYA 3UP7A 4EI4A 2ITQA 4FIHA 2REIA 4OTWA 3RK7A 1OL5A 4O38A 2Z7LA 4O4CA 2XALA 3ZFMA 5IEVA 4HYSA 2HWPA 1OIUA 5I9UA 1MP8A 3N51A 4G31A 1BKXA 2R3IA 2BAQA 2R3QA 5I9WA 3SW7A 1IAHA 1O9UA 3L8VA 3TNQB 1ZMUA 3TL8A 1W2FA 4LMNA 3DTWA 4YNEA 3UPXA 4DEEA 3MIYA 4GT5A 4FRFA 2PZRA 4FZ6A 3NIZA 1OKVA 3PXZA 3QU0A 2H6DA 5BVEA 2VO7A 4FSWA 5I9ZA 4EKKA 1KSWA 3DKCA 3W2PA 1YRPA 4KBAA 3FPQA 4YURA 5HBJA 3DT1A 3TZ7A 4C8BA 1YI3A 5E9EA 3R1YA 4XH6A 2R2PA 3QX4A 4M0ZA 5BMMA 1REJA 2VGOA 2A2AA 2XKDA 5EOBA 2XIRA 4QYGA 4C4IA 3LXNA 4BIBA 5AM6A 4OTRA 4AP7A 4EK6A 2GHMA 4O4DA 4EBVA 4FE2A 4HVSA 2VWUA 5LWMA 2PE0A 4F9AA 2ZDUA 3QXPA 1XKKA 4FSYA 4PWNA 2P33A 5C8KA 5IA4A 1Z57A 2C0TA 1G8JA 4L6QA 4FNXA 2ZV8A 4YC6A 1NVQA 1H25A 4ZTSA 3FC2A 3OMVA 2YM5A 3HP5A 3OWKA 3QTZA 4M84A 3R22A 2HIWA 3DQXA 4XP2A 5AR4A 3R8ZA 3BLAA 2OLCA 5H2UA 4QP8A 4NKAA 4D4VA 3HNGA 3SG9A 4FTCA 2R3MA 1PXIA 1J91A 3LQ3A 4KKEA 4YZBA 1JQHA 3FZRA 2OWBA 4PTEA 4ZTHA 4QMXA 4ARKA 3R01A 4NFMA 3CY3A 1XH5A 2KULA 3EMGA 3VUMA 4RWJA 5CS6A 3R73A 5DRDA 3SOAA 4WNPA 4DH1A 3ZTXA 2C4GA 4XG4A 3P1AA 4EHGA 1WAKA 5AV3A 3BHTA 3CTHA 5DH3A 2PZPA 5M53A 4YZ9A 4E6AA 5HCXA 4MXCA 3R1QA 3R7OA 4BDEA 4HVHA 3MVHA 2EU9A 3QTSA 4IIRA 4J8NA 4WO5A 3MWUA 3BQRA 4YHTA 3C0GA 5FBOA 2OSCA 4B4LA 1WBWA 2VN9A 3P78A 1REKA 1RDQE 4KIOA 1F0QA 2Z8CA 4EZ7A 2YIRA 3B8QA 3BKBA 4QQ5A 1SVGA 4IVDA 3SD0A 5E8TA 3JXWA 5E8XA 5EYMA 4F7SA 3PG3A 4FUYA 1ZYLA 3BYOA 5H8BA 3CIKA 3RK5A 2VO3A 4K77A 4F08A 3L1SA 3HUBA 3REPA 2WHBA 4KIKA 3Q32A 5CXZA 2V7AA 4O83A 4NM0A 3FC1X 1CSNA 2O65A 3D5XA 1OPLA 5GZ8A 3B2WA 5LVPA 3R02A 3QZGA 4OR5A 3KRXA 3ZC6A 2WEIA 4BHNA 3SGCA 5L2SA 3A7GA 4M66A 2WTVA 4LV8A 5HORA 2QLUA 2OF2A 3QCYA 2W4JA 3G6GA 2QODA 3LXLA 4ACMA 4UMUA 4AGDA 2RGPA 3ACJA 4GIIA 4RZVA 5ACBC 4FZFB 4U6RA 3WF5A 3GNIB 2QD9A 5FTQA 4D2SA 1PMEA 1GJOA 4E6DA 4C3FA 4C62A 4IZYA 2J0MB 2WMTA 3KXMA 2ZDTA 3NEWA 4AOJA 3WILA 5K3YA 3MPTA 3ZONA 5IA1A 3RHKA 5J5TA 4R6VA 3CQUA 4YHFA 5J7BA 3E88A 1ZMWA 2PSQA 4MYGA 4R3PA 2PVMA 4DH5A 3R8PA 2X4FA 4PTCA 1KE8A 3OUNB 3HV7A 4A9SA 3FMKA 2X1NA 5IKWA 4ACHA 5E4HA 4TWCA 4DCEA 5IEYA 3ACKA 2NO3A 2R3OA 2J4ZA 2X7FA 4JT3A 4DE4A 2VZ6A 3OCTA 2PUIA 3GC9A 3LM0A 2VTMA 3QCSA 4C59A 4W4YA 5JH6A 5KO1A 3G9LX 3VS4A 4S34A 4XNEA 5BUJA 5CU0A 3SHEA 4BCGA 4FL3A 4O22A 3PUFC 2B9IA 3TKHA 4I23A 5C1QB 3V5JA 1JKTA 4DGGA 3JY0A 4NWMA 3UG2A 5TO8A 3V01A 4PL4A 3T9TA 5EQYA 5HBHA 1PXOA 3PG1A 3RHXA 5FP6A 3RWPA 1U4DA 5DYJA 3GC8A 2EWAA 4KABA 4OTGA 4JX3A 4NYEA 3EZRA 3QWJA 2F9GA 2JAMA 4GK3A 4RFYA 3N4UA 4E5AX 3F3WA 3WZKA 4WD5A 4M3QA 3UC4A 3F3TA 3VS5A 2VGPA 5LCJA 3UOKA 3NFFB 5CNOA 2VWYA 3ZUUA 4U3YA 4RX8A 5B0XA 2QCSA 3UIXA 4FIGA 3ZO3A 1Q62A 3NNUA 3R6XA 5LMKA 3VONA 4BDDA 2R3KA 3CD3A 4AXEA 3AC5A 5CU2A 3OWJA 4BWKA 2W4KA 4HJOA 5K0XA 1M52A 2W1GA 1JKKA 2XJ2A 4JI9A 5GHVA 3M2WA 1APME 2F4JA 4NH1A 4YHJA 4IAAA 3B2TA 2YCFA 2IG7A 3NNXA 2P4IA 2Y0AA 4UMQA 3QQLA 2BDFA 3KF4A 4A4XA 4NIFB 4PDOA 3FY0A 4A9UA 3UTOA 5CX9A 4MEDA 4X2JA 4LL5A 5AP4A 5EW3A 3FI3A 4I93A 3PYYA 4XLIA 2QG7A 4LV5A 4AW2A 4UZDA 5EK7A 4DDIA 1PXMA 3UVRA 5C03A 5CSWA 3D5UA 5C01A 3R28A 5AP0A 2AYPA 4ZSAA 3OCGA 3BYMA 3GUBA 3QYWA 3R71A 4L42A 2ZMCA 4EZ3A 1ZYDA 3SXFA 3VIDA 2BCJA 4AA5A 4YO4A 4ZY4A 4MUQA 4HGTA 4RQVA 2CDZA 4O7TA 3V6RA 3RZBA 4FL2A 3KMUA 3KN6A 4M15A 4O4BB 4WBOA 3VHKA 5JZNA 2F49A 3TMOA 4D5KA 2CJMA 4YUQA 1VEBA 4MKCA 4DGNA 3EQRA 5B2MA 4HYIA 5CVFA 2V0DA 4A4OA 4DEIA 3COIA 2H9VA 3NW7A 4JG8A 4Y83A 3KRJA 4XX9A 4G5PA 4GT4A 5CAQA 4GK4A 3W2OA 5FXQA 2XEZA 4GG5A 2XIZA 1PMUA 3HMIA 3OP5A 4JG6A 4BCPA 2ONLC 3QCQA 2OG8A 4IACA 4DHJA 4FG9A 3F3VA 3II5A 4WSQA 2B0QA 3BCEA 3OY1A 4FODA 3LLAA 4ZS0A 4G2FA 2FSLX 1MRYA 4I1ZA 4CYIA 3CQWA 4C58A 3F2RA 5K4JA 3QZIA 4I6QA 2GDOA 4GKHA 1ZZLA 3CBLA 2BR1A 2C6KA 3IONA 3BEAA 3IQ7A 4FG7A 4Y46A 5TKDA 2BALA 4GRBA 3ZLSA 4BCNA 3LFEA 3LLTA 4E8AA 3FXWA 3C5IA 4FTNA 5DR9A 2PU8A 4P5ZA 5DFPA 3GCVA 5GJFA 4BDCA 5AX9A 4E6CA 2Y4IB 1P14A 5JRSA 2VTAA 3BBTB 3VW6A 4EH4A 4E20A 3AT4A 4AS0A 4DGMA 3Q2JA 4QTCA 5ACKA 3BI6A 1J7IA 2VAGA 5CEOA 2XMYA 1XWSA 4PNIA 3AT3A 4XG7A 3CE3A 4FV9A 1U59A 5IH6A 4XV9A 4TWNA 3FMHA 3HRBA 5M4UA 1NW1A 2PTKA 5HE3A 1GZOA 2IF8A 5BVOA 3HLLA 3U6HA 1H1PA 5IQBA 2PVYA 3I1AA 1KOAA 2UW3A 3NUXA 5A6NA 4YLKA 3QUDA 3BGZA 5AP6A 3FMMA 3OS3A 5EYKA 2R7BA 2XK9A 4O91A 4YLJA 4DEGA 3WF9A 4RX5A 2XJ1A 4DHZA 4BI2A 3FAAA 4U3ZA 4GUEA 1NT2A 2YISA 4RIWA 3Q4TA 4HGLA 3OW4A 4QPAA 3V3VA 3I6UA 4QMUA 4BDAA 4WBBB 5E8YA 3ZEPA 4L7FA 4BICA 3ODZX 3MSSA 1PKDA 1U46A 4AW0A 4MXZA 3MY0A 3LMHA 2ZM3A 3V8WA 1XR1A 4XEYA 2OO8X 3UNJA 2G01A