3P0MA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Fragment based drug design on PKA
rcsb
source organism Homo sapiens
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p0mA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p0mA02
3I7BA 4KSQA 3H9RA 4NT4A 4OTGA 5AR4A 3BU5A 5C4LA 2Q0NA 3ERKA 3BQRA 4FV5A 4HW7A 1ZOHA 3F7ZA 4O82A 4L01A 4FL1A 4CTCA 1H4LA 3DJ6A 3QTSA 4AZSA 3OEFX 3B8RA 4NKAA 1ZOEA 3QLFA 5JGBA 3PWDA 3PUPA 2WQOA 4A9TA 5I9WA 1R39A 2VGPA 4FKGA 4FIJA 3HDNA 4XHKB 5JRQA 1OPJA 5LVOA 3DBFA 2R64A 3R8LA 3LVPA 4IANA 5I4NA 3FC1X 3W32A 2C47A 2YDJA 4H3PA 2Y8OA 3OZ6A 3KRRA 4MF0A 3UE4A 3SOCA 4N4SA 5H8BA 4BDAA 1Q8YA 4O0TA 5CAQA 2QOFA 2H6DA 1F3MC 3KXHA 4GG5A 2XK9A 2JIVA 3NAXA 3CPCA 4YSJA 3E92A 3FXZA 5HIEA 4QMWA 5E8SA 4WBBB 1KE9A 3ULIA 2GCDA 3DXNA 5E92A 3FLSA 4B4LA 2VAGA 4UYAA 3TT0A 2GFCA 3MIAA 1APME 3C4WA 1RQQA 5JFSA 4CRLA 3G6GA 4HYUA 5DNRA 4EOOA 5KBQA 4F9WA 3JR1A 4GJ3A 3GQIA 4UV0A 1Q99A 5BVEA 5C01A 2BIKB 2GS6A 5CU2A 2I0YA 3BX5A 4FT3A 2UZTA 2XA4A 3SG9A 2ZM4A 3F5XA 4ITHA 3ZRKA 2VWWA 3A7GA 4QP2A 2CHLA 3CY2A 4RSSA 5HNBA 4IM0A 3LOKA 4AN9A 3NUNA 4CSVA 2XK8A 4V0GB 4BGQA 3ACKA 3SLSA 1AQ1A 1J3HA 4HYSA 5FWKK 3RZFA 5E7RA 2JKQA 3UC4A 4E1ZA 5FDPA 3TWJA 2G2IA 2X81A 4I3ZA 4NZWB 1BX6A 5HVKA 5ITAA 3D15A 3QWJA 3O51A 4I6BA 4JG8A 4NM5A 3POOA 4TYEA 3ANRA 1OIQA 4HZRA 3TN8A 1RE8A 4FYNA 4AGDA 3JS2A 3ZHPC 3LXKA 2WXVA 5D11A 2CSNA 4DFYA 3OEZA 4FTJA 4FUYA 3VS6A 2C0TA 3ZDIA 3KKVA 4C0TA 3CBLA 2KTYA 2YM7A 4P5QA 4I0SA 3F3UA 3PRFA 5FEDA 3CJGA 5IA3A 2XIYA 4BYIA 4BYJA 2R2PA 3DS6A 4AW2A 4YJPA 1JSTA 2PHKA 2W4KA 3LCSA 2IVTA 4I22A 4QMQA 3GFEA 4J95A 1WMKA 4QP9A 3CTHA 4W9XA 5CU3A 3ALOA 4ALWA 2W05A 4WKQA 4ANOA 1DAWA 4JBVA 2UVZA 3BU3A 4J1RA 1FBNA 3PLSA 5FRIA 4ZMEA 4FZDB 3VBXA 2UW0A 4I0RA 3S3IA 4DA5A 1YI6A 5KHXA 3VS7A 3RWQA 1J91A 5L8KA 4CRSA 3DBEA 5C27A 3U8WA 5DEYA 2HXLA 5LVPA 5LMKC 3VBWA 3ZEWA 2B9HA 4Y5HA 5E91A 4QT1A 1HCLA 3O7LD 4AG8A 4FEVA 3ORLA 5KHWA 3FZOA 3DQWA 2QD9A 3WI6A 2HIWA 4YLKA 3ZBXA 5AADA 2P3GX 4JXFA 2C5VA 3U55A 2JC6A 3CP9A 3FMJA 4RWJA 3Q2JA 3SXRA 4MCVA 1OUYA 3QTZA 5JQ8A 4NJ3A 2OJGA 2QONA 2CLQA 2VZ6A 4I4EA 2PK9A 2R3RA 1H1WA 2X2LA 4LRJA 4K6ZA 3W2PA 2BZHB 5IDNA 2QQ7A 4U44A 4F0FA 2BILB 2NPQA 4BBFA 4BIBA 3VBVA 5EKNA 5I9VA 3C4EA 2VU3A 3OBJA 1UWJA 1J7IA 2WMSA 3SHEA 4PL4A 3IDBA 3OT8A 4LOPA 3BV2A 4R3CA 5AAEA 1JBPE 3A7HA 1Q3WA 3EQPA 5CU6A 1O6YA 4ONAA 1FPUA 4TTHB 5T3QA 4L68A 3FXWA 1OL1A 3FZ1A 3E3BX 4N0SA 5T6KA 4CEGA 5IEYA 4KS7A 5CALA 1WBPA 5AM6A 5EYMA 5LMKA 4D58A 5K4JA 3AT3A 3RAIA 3GU6A 3LW0A 5DG5A 4EH3A 1VYZA 2F57A 2HELA 2QLQA 2XK6A 4PMSA 4F08A 3EQGA 4LOOA 4MD9E 4KIQA 4WO5A 3EQDA 1Q8ZA 3S95A 3KREA 4M69A 2QI8A 4QQ5A 4D0WA 3DKFA 4JDJA 4QTAA 5HGIA 5TKDA 3LJ0A 4YTIA 4GRBA 3ATTA 4QMTA 4AGCA 3R8VA 4CZUA 1W98A 2W1GA 3Q4ZA 5CF4A 2IN6A 2ZDUA 3D83A 3P86A 4CVAA 5IPJA 2VTNA 1SYKA 2C6MA 4EJNA 3PVWA 4M7IA 4FVQA 3KRXA 4MBLA 4J8MA 3BYSA 3G15A 2DS1A 3OG7A 4FV4A 4GFOA 1PXMA 5AIRA 3OWJA 2UZWE 4G31A 5BVKA 1JKSA 4AZEA 4IWPA 1GZKA 4UMPA 4H3QA 5CSWA 3QRIA 2P2IA 2RSVA 1ZRZA 2JEDA 3NW5A 4PTEA 5AV2A 3VRZA 2Z8CA 5FM3A 4RIOA 2VWUA 4A4LA 5ETCA 2Z7LA 4RBLA 4MVFA 4C36A 4O91A 5C4KA 3N9XA 4W8DA 4DCEA 2X2MA 3D5UA 3QQGA 1ZYJA 2O0UA 1M7QA 2OJ9A 2XIKA 3O50A 1NA7A 3F9NA 4O0RA 4ZZNA 3SW7A 4EJ7A 5J7BA 2ETKA 2FO0A 3EFLA 4RG0A 5E1SA 3KF4A 3O17A 4B0GA 2UW8A 4AZTA 4B7TA 4BWPA 4KNBA 4U41A 1RDQE 4FKOA 4G5JA 3LFQA 4NW6A 5B0XA 4AW1A 5K5XA 3OS3A 3U9NA 3I60A 2Y7JA 3FI4A 3MH3A 4TRLA 4X2GA 4ANSA 3LAUA 2HWOA 5M53A 2ETMA 2OIBA 4ANMA 4LV5A 3ZMMA 4K2RA 2VN9A 3FUPA 4FV7A 5AR3A 3TEIA 3BE9A 5CVHA 1ZY5A 3OOGA 2PULA 5AUUA 3ORIA 4MWHA 3R21A 3THBA 2R0UA 5EI2A 3TNIA 4YHFA 3P0MA 4IWOA 2IW8A 3HV5A 4R3RA 4X6QC 4RQKA 3UODA 3EN9A 3LQ5A 2O5KA 3QQJA 4XG3A 4A9RA 4DEDA 4MNEB 5IQGA 4IB5A 2HOGA 2XBAA 4FEQA 4C38A 4CYJA 2HZ0A 2ZV7A 5KBRA 3GU8A 2J6MA 4A9SA 4OLIA 4ACGA 3R7IA 4C37A 2BR1A 3ZM4A 3F7WA 3AT4A 3ETAA 3FBVA 2Z02A 2Y4IC 4XS2A 4GK4A 2GNHA 4G3GA 3MPMA 1NW1A 2A1AB 5CF8A 1W84A 5EFQA 1JKTA 3K5VA 4GVJA 1IA9A 3TUBA 1KOAA 4RJ4A 3FI8A 4O7TA 2I1MA 3OUKA 3P78A 2R3OA 1XO2B 1UNLA 3CGOA 1KE6A 3RZBA 3ZO2A 5HBHA 5AR8A 2XMYA 3A60A 4FI1A 5CNOA 4B8LA 5AR2A 5IKWA 5AX3A 3NR9A 4ORKA 4CFVA 1J1BA 1FVVA 2GFSA 4ZTNA 1GAGA 3BHYA 4JT3A 2YDIA 3M11A 4EOQA 5HX6A 1ND4A 3HX4A 3V8TA 4DTKA 3V51A 4J8NA 5AEPA 3WARA 4JG6A 2OWBA 4LYNA 4C4HA 3PJ2A 4UXLA 5I9ZA 3PDTA 4CMUA 3WBLA 3E87A 3S00A 1XQZA 5B2MA 4Z3VA 3LFSA 4WD5A 3V3VA 4O6LA 4Y5QA 4XRJA 4L6QA 4QPSA 4QYYA 4RRVA 4NKSA 1Q41A 4ASEA 4XH6A 4R7BA 3OHTA 3UVRA 3P7BA 3R63A 4JR7A 4ZP5A 2IZRA 4LGGA 4U3YA 4NK9A 3HV4A 2XJ1A 5DRDA 3PG1A 4C59A 5BUEA 4BR3A 1M17A 3C5IA 3VHKA 4ZIMA 4TL0A 3H10A 4FTRA 5EW3A 4NTTA 5DT0A 4HNIA 4JBPA 3PVUA 4OTQA 4I23A 4QQJA 1Y6BA 3OW3A 3F2RA 2BUJA 2XF0A 4J99A 4R1VA 5A4EA 2QR8A 5AP0A 3R9OA 5E8XA 3GXLA 3T9IA 3AC8A 3PSDA 5JGAA 4DBXA 3OY1A 5KMIA 5FP6A 4O81A 3QXOA 5CAVA 1WBNA 2ZMCA 3KXGA 3R0TA 3QQLA 3DDQA 4YLJA 2JKKA 1T45A 3LHJA 3UIBA 3UQGA 3VHEA 1SVGA 4FT0A 5DLSA 2OSCA 5LVLA 5C8NA 3LMHA 1ZYLA 5BVDA 5A14A 2JBPA 1IR3A 4FK3A 4TY1A 1VR2A 4X3FB 1WCCA 3QQHA 4MHAA 2BRMA 2WOTA 3DZOA 5EI8A 5AUXA 3NUPA 2UUEA 2RG6A 2JITA 3Q32A 2C6IA 2F7ZE 2OH4A 2VNWA 2B53A 4PV0A 4OT6A 5FEEA 5ETIA 2GNLA 3FMEA 3NCGA 4IC7A 3DK7A 4K9YA 3FDNA 3ZFMA 4PNIA 3GU5A 4RX7A 4EOMA 2CGXA 2QURA 4H58A 4QQCA 2OF2A 2CN5A 4V01A 4R77A 4I5PA 4MXZA 4CMOA 1XJDA 3AT2A 4E6AA 1ZLTA 4UMQA 3PXRA 2ITOA 2ZMDA 4U45A 3RHXA 3C0GA 4CV9A 3DDPA 3PPJA 4C34A 4BTFA 4AW0A 3QGYA 2VWYA 4L3JA 3EFJA 5FEQA 4BGHA 3ZDUA 3BBTB 4ZLOA 4FL3A 4O0VA 4WA9A 2YCQA 3RGFA 3W55A 1JAMA 5HHWA 4XG4A 4ANBA 5E90A 2V7AA 3F6XA 3LQ3A 4FSYA 3KXZA 2VO7A 4N6ZA 2BAQA 3DB6A 2AC3A 1R0PA 4WOVA 3SXFA 4RGJA 3VQUA 3W1FA 3I1AA 4FA2A 1ZAOA 4XYFA 5FXSA 4ZS4A 3KA0A 4KBAA 4I21A 3BHVA 3KB7A 4FEUA 2AC5A 2C5OA 4TT7A 2WMUA 4PL5A 3MH0A 1Q24A 3TJDA 3WF5A 4CFUA 4AW5A 3UNZA 4BN1A 3WOWA 4HVGA 3B2TA 3PG3A 4BZDA 4GT4A 3GOPA 5LVMA 2OI4X 3GU4A 3TV7A 3E64A 3HMNA 3ZS5A 2XNNA 2R3IA 4XG2A 3UC3A 3MN3A 2XK7A 4AS0A 5GIOE 2YN8A 4R7IA 3O71A 2VTAA 2XCHA 1MP8A 2I40A 3PIYA 5ACKA 1E9HA 1YXUA 2J7TA 3EFKA 4P90A 4LL5A 3CTJA 3TXOA 5BPYA 3PJ1A 1Z57A 5HEZA 4QMZA 1Q5KA 4AX8A 5I0BA 5CEOA 4LMUA 4O2PA 4TWPA 1KV1A 3E93A 3CIKA 3H3CA 3NUSA 5IH4A 5AWMA 5ANGA 4IW0A 2QOBA 3A61A 3QAME 4EOLA 4NIFA 3DJ5A 1YDTE 3T9TA 4ASXA 4NUSA 4UWCA 1JPAA 2OBJA 3I4BA 3ZBFA 4OBPA 3LM5A 4FTMA 1SVEA 2ITQA 4YJQA 5CTPA 1XWSA 4XCUA 2W1ZA 2PZPA 5E8ZA 2GNFA 4BC6A 3WILA 4ZTRA 3NIZA 2UZLA 3KU2A 4F6WA 4RX9A 4EHZA 3W33A 2C0IA 4NYEA 2YACA 4XP3A 2VUWA 3RWPA 1ZYDA 4LGDA 1AD5A 5M09A 1XBBA 2FSMX 4RIWB 4DEEA 3C7QA 3FL5A 2I0EA 3QKKA 1ZARA 3QBNA 3MW1A 3TCPA 4WNMA 4Z9LA 2C3LA 5EKOA 3ZFXA 3I0OA 2X8DA 4U40A 3Q9WA 3ATSA 4YNEA 4ZMFA 3JVSA 4HGLA 4X7QA 4B99A 3BLQA 4YJSA 4AFEA 1TQMA 1OM1A 1HOWA 1UWHA 2FVDA 2ZM1A 1BMKA 3QWKA 4E4LA 2UZUE 4S30A 4F9CA 4WT6A 4NSTA 4D2WA 5F20A 4BY9E 4FT5A 3DLZA 3NUUA 3HNGA 4GFMA 4TYGA 2VTPA 3FAAA 1OL2A 3BU6A 3Q6UA 3QC4A 4IWDA 4AP7A 4ASDA 3PLAE 1H24A 3KXNA 4FKTA 4PP7A 3OWPA 5HE0A 3NEWA 1U59A 3DQXA 3UYSA 1ZY4A 2H96A 2OZAB 3HLLA 3VBTA 4EI4A 3QRJA 4R6VA 3ENHA 3ODYX 4M68A 5IQHA 2W1IA 3AGLA 5LWMA 4FV8A 3BBWA 1OI9A 3D14A 5F4NA 1UVRA 3A7JA 2UW6A 4IACA 2PZRA 4FIEA 1ERKA 4QMUA 4RFMA 5EQPA 3UP2A 4XLIA 5FDXA 3MH2A 2IW9A 2IVVA 5HO8A 4YUQA 4MKCA 2QNJA 4ALUA 2VTRA 4CT1A 3HUCA 4EK8A 3CQEA 1OIYA 4ZY6A 4YJRA 5JZJA 3KF7A 4CKJA 3HMMA 3EL8A 5L6WL 4Q9ZA 5JFXA 3RCJA 3IDCA 3ZLSA 3ELJA 4CFMA 3NNWA 4GIHA 3ZOSA 3G6HA 2F2CB 3NUXA 5HVYA 1IAJA 2VX0A 4XLVA 5A54A 2VTTA 4C4FA 4F7NA 3MA3A 1JVPP 4GH2A 3ZZWA 3AMBA 5E8YA 2WU7A 4FZAB 3QLGA 3VO3A 3EL7A 4BCKA 4S31A 4D1SA 1GIIA 4I1ZA 4C7TA 2J2IB 4EUUA 3UIMA 4YJNA 2WEIA 3QA8A 2B4SB 3UO6A 2WB8A 2JAMA 5AV1A 3TTIA 4DFXE 3QTUA 2C1BA 3AD6A 4GK2A 4QYGA 2ERKA 1EH4A 2XKDA 4YHTA 2OFUA 2QG7A 2CDZA 3MY0A 3PYYA 3DAEA 3DKOA 3I81A 4RVKA 3VS5A 4WNPA 3FI3A 2QOCA 3R01A 5EQEA 1E1XA 1MUOA 3JUHA 3WYXA 4MWIA 3AXWA 3HMPA 1WBOA 2XKCA 2V7OA 4G3DA 5AP6A 4ZJIA 5DYJA 2W1HA 2UW5A 3W2SA 5DIAA 4ZSJA 1M52A 2HENA 4YTCA 3WZDA 4JIKA 4TXCA 3UIUA 2ITWA 4FV6A 5EHOA 4GG7A 1G3NA 4IXPA 5CXHA 2YEXA 4AUAA 4BDKA 4FBXA 4GUBA 5CAOA 1IA8A 5DPVA 4BCHA 3LMIA 4UZDA 4DN5A 2VTHA 4IVCA 3OTVA 4Y83A 4XP2A 4PX6A 3KRWA 5DVRA 2XYNA 4TNBA 1H0VA 3KFAA 4AE9A 2BCJA 2UVXA 4BCMA 4FTCA 2UZNA 5DRBA 4C8BA 2VRXA 1LP4A 1WAKA 4TKSA 1YOLA 3REPA 4A4XA 4EH9A 3I5ZA 2PVKA 4YJUA 3Q5ZA 4ACCA 3F3WA 2XNGA 5JQ5A 4YU2A 3KEXA 1K2PA 4W4XA 4D1ZA 4RQVA 3W16A 4PPBA 5KZIA 3KRJA 4PMMA 3ORMA 3UYTA 4CXAA 2UVYA 1JKKA 2WMWA 5KX8A 1H1SA 1XH9A 4CQEA 5EQYA 3KULA 5I3OA 3RPOA 5A4TA 3PXZA 4L7SA 3TKIA 2OW3A 4J96A 5HLPA 3VQHA 3IW6A 2CNVA 1UU8A 4MBIA 4DH1A 5DT3A 5M44A 2ACXA 3VWAA 4C62A 4GKIA 3QRTA 4YPDA 1OVEA 4JRVA 3AC1A 4HVDA 3OD6X 3KK9A 3QZFA 4WRGA 5EM7A 5CEIA 3P9JA 2I7QA 3V04A 2RFNA 3E8NA 4X6RA 3RK9A 4PUZA 4QMVA 4X0MA 5IUHA 3OVVA 4JOAA 4LM5A 2NO3A 4F7LA 3FQSA 2ZM3A 4V04A 3RP9A 3HA8A 3LFFA 4G34A 4UY9A 2X9FA 3DY7A 4HGSA 5CX9A 4AWIA 3BKBA 4CZYB 5IEVA 3F61A 3KGAA 3O23A 4USEA 1U54B 3D7ZA 2QOQA 3HMIA 4RIYA 3TI1A 5B7VA 2CKPA 4UALA 2Y6MA 5HE3A 3QX4A 4DGNA 1YXSA 4G9RA 3WZEA 1WVXA 3E3PA 3LFDA 3QD0A 4FYOA 4KRCA 1PXKA 4FV2A 3OT3A 1Q61A 4RJ6A 3N4UA 4DT8A 2R3KA 4AA5A 3IGOA 4FKPA 3CSVA 4PDYA 4D2TA 2JKOA 4U81A 4XG6A 1YXXA 2XZSA 4E8AA 1OBDA 4EOPA 2IG7A 3SRVB 2Y9QA 3SVVA 1GNGA 2PE2A 3RM7A 4BCIA 4D5HA 4DF3A 1FMOE 2BRHA 2QVSE 4G17A 3I6WA 4E4MA 5KMJA 5CANA 5EK7A 4R1YA 4DLJA 2VTMA 3A4PA 3MA6A 4TYHA 5CXZA 4EH8A 3OOMA 3HMOA 3DBDA 3WIKA 2C6LA 5AP3A 5HG5A 3SAYA 4AXAA 4FV1A 3GU7A 2X8IA 2X7OA 2CPKE 2B0QA 5DA3A 1Q8TA 3HZTA 2ITYA 3BPRA 3WYYA 4E26A 3PSCA 3QUPA 3VUDA 4IE9A 3DAKA 4QMMA 3W2RA 2OFVA 2ZAZA 4DFBA 3RPRA 5HU9A 2WTDA 3EOCA 4WIHA 3HA6A 4WBOA 4EC8A 1RJBA 3NW6A 4M84A 2C6EA 4BKJA 3ZONA 4EEVA 1J7LA 4PWNA 4J53A 4X3FA 5H3QA 4F64A 4EOIA 4QQTA 4E93A 5KKRC 4G6LA 3UVPA 1FGKA 5F94A 4L00A 3FC2A 3W10A 3DLSA 4GT5A 4ZY5A 4JBOA 3C1XA 3VC4A 4EWQA 4U7ZA 1PRYA 1KE7A 2GNIA 3KK8A 1PXPA 3NW7A 3DOGA 4QYHA 4YR8A 4FIFA 4OTFA 3PSBA 3TG1A 1PF8A 4NL0A 5K0XA 3UMXA 3LIJA 4CFWA 1LR4A 2IVUA 5CF5A 2CNUA 5IQCA 3F5PA 2R3LA 3Q3BA 5DFPA 3RPYA 3FMLA 5HCXA 2PMLX 3LFAA 3AD5A 4PQNA 3A2CA 3FSFA 4ENXA 2V22A 4FVPA 4CD0A 3C50A 2C68A 5CEPA 4UMUA 5I3RA 5HU3A 1OBGA 4D4YA 2UW9A 2WTKC 2J0LA 5GZ8A 4D5KA 5AV0A 4FKUA 5HO7A 2NNWB 3F3VA 1UKIA 3R8ZA 2XS0A 1KE5A 5HCYA 3MSSA 5DI1A 1QMZA 2XKEA 5H8EA 2DUVA 4LUEA 1R1WA 4BI2A 2OJFE 3FQHA 3MYGA 4RFYA 3F2NA 3VUMA 3HDMA 5D10A 1YVJA 4HJOA 3FMMA 3WZKA 5D1JA 4CYIA 3E7OA 3SGCA 4E4XA 4FE2A 4TYIA 5A3XA 4AOIA 1Y91A 4AZVA 2DQ7X 3GB2A 4QYEA 3FPQA 5HZNA 5C9CA 3R9NA 3FV8A 3S0OA 5IQBA 4M0YA 3CC6A 5DR9A 4MX9A 4KUJA 4AT3A 3IOKA 3QF9A 4G6NA 5I9YA 3ORPA 2W5HA 2P0CA 1YQJA 3C4XA 2BALA 3FSKA 3ORKA 4LGHA 3RAWA 2EB3A 3UNKA 1HCKA 2E9OA 1F5QA 1GJOA 1YHSA 4AAAA 3R28A 4BF2A 3QQUA 4FSMA 4HYHA 3ZC6A 1X8BA 1I44A 3QD4A 2XB7A 4FTTA 3GT8A 2WMXA 5KO1A 2BROA 4BCQA 5BX0A 4CG9A 3PFQA 2A19B 1NVSA 4EK6A 3KN6A 5EDPA 5IUGA 5HVJA 4FGBA 4G3CA 3UMWA 4I5CA 3O7LB 4CZTA 4FNWA 2EU9A 4IEBA 5A6NA 4EK4A 2YFXA 3S4QA 5J79A 4HPTE 3EZRA 2F4JA 2X39A 4FMQA 2W4JA 4CLJA 3SDJA 5JN2A 4C3FA 5FP5A 4D4RA 3Q4TA 4O7WA 5M08A 4O7VA 4JQ7A 1OPKA 4QTCA 4X21A 5EW9A 5HI2A 5CU4A 4O22A 4PDOA 4XV3A 2Z2WA 5CI7A 4RX5A 4OTDA 4RIWA 4CNHA 2YIRA 5CU0A 4U80A 4D9UA 3ZLWA 2GMXA 4C2WA 4A4OA 3QD3A 4TN6A 5EM5A 3UNJA 2ZV8A 4ASZA 4YMJA 4H05A 4XX9A 2VTIA 4QRCA 5CSPA 5CAPA 2UW4A 4JNWA 4X2NA 2OXYA 2B1PA 4NW5A 4S32A 3GOKA 4O21A 2RG5A 2XCKA 4XJ0A 5HKMA 4FR4A 5LXMA 3W8QA 2OIQA 5AM7A 4EK3A 4TW9A 3Q6WA 4DTBA 4PNKA 4U9AA 5GINE 2R3JA 5CQWA 4F99A 4ZAUA 5IH6A 2OK1A 2BZJA 1CTPE 5GJDA 3IGGA 2Q83A 4QP1A 3PPZA 4DGMA 4DFLA 5B2LA 3ZM9A 5GHVA 4WUNA 3BV3A 1B38A 1PMVA 3TZ9A 4FTKA 1VZOA 3VBQA 3VJOA 2XUUA 5CYIA 4QO9A 3RTPA 3IW4A 1PKDA 3MJ1A 5EOLA 3DFAA 4ANNA 2KULA 2OZAA 3IW5A 3LFBA 4RLLA 3G9LX 2OF4A 4AA4A 4YBKA 4D2VA 4I20A 4IZ7A 3NYOA 3OXIA 4A7CA 2P4IA 5CF6A 4XG7A 5LJJA 2PYWA 4O0SA 2EUFB 4YO4A 3FEGA 5AFVA 2WQMA 3PE2A 4ACDA 3PJ8A 4DEHA 3TJCA 1UNGA 3QYWA 1Y8YA 1BL6A 4YZ9A 4KRDA 3RVGA 2PUUA 4R7HA 4FTLA 3OROA 5L2QA 4H1MA 2WD1A 3ZC5A 4DEGA 4EH6A 5BUIA 5M56A 5GZ9A 5BYLA 5JEBA 5AP1A 1OITA 4E73A 4YC6A 4Z55A 4RZVA 4YO6A 2RFDA 2OICA 3DTWA 4U43A 4FTQA 3TDVA 5GNKA 3LZBA 3VUHA 1SNXA 2W1FA 4OTPA 1H08A 2HK5A 2JAVA 3MH1A 4MBJA 2CGVA 3P08A 4FG8A 3VUGA 5HLNA 5DR6A 4FTNA 4TWNA 3UJGA 3MVHA 2HY0A 4L45A 1SVHA 5FQDC 4IFGA 1CDKA 1ZXEA 2W5AA 3VF9A 3I5NA 3NX8A 4LFIA 4UBAA 3PXQA 4K0YA 4DH8A 2VWXA 1A06A 3DCVA 4BCNA 3TV4A 3PA3A 5BVFA 4YURA 3R6XA 5LQFA 4LQMA 3W18A 2YA9A 3K5UA 3GBZA 4O27B 2C3IB 4JDHA 1IAHA 2Z7SA 5ICPA 4G1WA 4ZJVA 3UG1A 4EH7A 2NRUA 4D1XA 5J9ZA 3LKMA 3PA4A 4Z7HA 3MPTA 2VTSA 3Q96A 4IB3A 4BTMA 1QPDA 3DTCA 4XOZA 3KXMA 3DK6A 3LFNA 4MXOA 3BGQA 3HKOA 4C61A 4DYMA 2NP8A 3FZPA 3DZQA 3GNIB 4HGEA 4L3LA 5HIBA 4EOSA 2C6DA 1JOWB 3KRLA 3MGYA 2BFYA 3FLYA 5A4QA 4O1OA 3R73A 4ZSGA 3H30A 3P7AA 3SXSA 1MQBA 1LEZA 3V5TA 4EOJA 3Q9YA 1G5SA 2HZ4A 4FKSA 1OKVA 1T46A 2OJJA 3PVGA 4IZAA 3N4VA 2WKMA 3COMA 5DH3A 4NFMA 4BCJA 3NAYA 5EH0A 5IQIA 3I79A 4BGGA 2XKFA 3ITZA 1I09A 3ODZX 5IDPA 4JI9A 5KCVA 2FB8A 2X7GA 3K3IA 5KUPA 1IRKA 3HV3A 4PPCA 5CNNA 5BYYA 1PJKA 2YJRA 2YIXA 2F7EE 2PVLA 3QCQA 4IAIA 2BTSA 5CEQA 3DNEA 1YWNA 1OKWA 5A9UA 5FD2A 4BKZA 4E6CA 3R2BA 5IH5A 4OT5A 3DBQA 4ARKA 4FV9A 2BKKA 3R00A 4FKVA 4L43A 2OO8X 4O0WA 5EOBA 3EQIA 2JFLA 5M07A 2J0JA 1O6LA 3QFVA 4O7SA 2JLDA 3FYJX 4N6YA 3HAVA 4L67A 3FYKX 3LE6A 3R71A 5K0KA 3WF9A 2BKZA 4C35A 3EQFA 3UGCA 3OMVA 2G01A 4L53A 5A4LA 3FHRA 4BVUA 3KN5A 5DEWA 2RF9A 1E1VA 4FNYA 3O0GA 5DGZA 2GNGA 1YOJA 4MTAA 4FKLA 4B8MA 4YPSA 4EZ3A 4DGLC 2CGWA 1R0EA 2JBOA 2JFMA 4QMNA 3IO7A 3GUBA 4W4YA 3W8LA 4AGUA 5IISA 4JVGA 3B8QA 4FC0A 4WRSA 3PTGA 3OWLA 3MFRA 4AN2A 5IMEA 4YC8A 3SX9A 4QD6A 5FXQA 3U87A 2CKEA 4RT7A 1BUHA 1H25A 4BCGA 5K3YA 4J97A 4RJ8A 3GEQA 4ZTHA 3R1NA 5J9YA 5L6PA 1MRVA 4FZFB 1YDSE 3PP0A 4C4IA 3MS9A 2IZSA 1CKJA 3OXTA 3PZHA 3QCSA 5GJGA 1GY3A 5CAUA 5JGDA 4FNXA 3U9CA 3VJNA 4KSPA 4DE4A 3GCVA 3NYVA 4FIHA 2BVAA 3LM0A 5BUJA 4QTDA 3LCTA 5E8WA 2XVDA 3ET7A 3H0ZA 2HAKA 3R9RA 2H9VA 2R3PA 3D9VA 3NRMA 3SRVA 3EKNA 4HCTA 2XM8A 4JG7A 4BHNA 5CSXA 2B52A 1DAYA 2V55A 1KE8A 2E9VA 3FMNA 4KWPA 3UG2A 3HV6A 3QCYA 3GFWA 5HE1A 4EH2A 3R8MA 1GZOA 2G15A 3GP0A 2YIQA 5EYCA 4PDSA 2R7IA 5HTBA 2YWPA 3EB0A 3BCEA 4A06A 4F9AA 2WO6A 4HZSA 3R83A 5IF1A 3MIYA 3MPAA 5F1ZA 3QALE 2VV9A 3P4KA 3A62A 2BDWA 3VS3A 3LCKA 1H28A 3NCZA 1VEBA 3FMKA 4QPAA 4DHFA 4F9YA 3CY3A 4RZWA 3UOJA 3ALNA 2IW6A 2I6LA 2Y4PA 5FBNC 4YTHA 4HYIA 2QCSA 5AAFA 1JSVA 4LMNA 3Q60A 3SG8A 1PY5A 4FKIA 2YM6A 4CQGA 3QZGA 4YZBA 1B6CB 2VWZA 4L9IA 3BI6A 1JWHA 1OUKA 5CZIA 4UB7A 3CE3A 5HTCA 4IZYA 2PMIA 3K2LA 4V0GA 1Y8GA 1UV5A 1PMNA 2R9SA 3CPBA 4FVRA 3D5WA 4XP0A 4YJOA 4C57A 3ZSIA 4UYNA 4FV0A 5CLPA 4EH5A 2VO3A 3C9WA 5IEXA 2Z7QA 3F66A 4FTOA 4AACA 4BL1A 2BDFA 4RMZA 3L9PA 5M06A 4L46A 3C4ZA 2BDJA 4AF3A 3D2IA 5LWNA 4XRLA 3A99A 2B55A 4YZCA 2ITXA 3OF0A 1U46A 3H4JA 3A8XA 4R8QA 4KKGA 5HD7A 4ERKA 3FKOA 4ZY4A 3BRBA 3ZTXA 1O6KA 4XV2A 4C02A 4HVSA 5KKRB 2YZLA 4F4PA 4L44A 3CLYA 1W7HA 4GUEA 1PYEA 5AA9A 1G8AA 3LJ2A 4DAWA 1J7UA 2JDSA 2VTOA 4OAVB 1JKLA 1Q62A 2O63A 3QD2B 4CLIA 2C6OA 3LCDA 5HICA 4M0ZA 4LI5A 1ATPE 5JKGA 4O6EA 3QL8A 4X2JA 4EWHA 2XNEA 3AMAA 4IMYA 2HZIA 2BHEA 2RFEA 1U5QA 1WFCA 3NDMA 4JRNA 4G16A 4S33A 2GQSA 2ZDTA 2J9MA 3DT1A 1IEPA 3MB6A 2EXCX 4RX8A 5CVGA 5F95A 4FSRA 3FQEA 4GU6A 5I5ZA 1KSWA 4DGGA 2PVNA 4HPUE 3G33A 4F0GA 2QU5A 2W9FB 4QNYA 4YP8A 3ZYAA 2YHVA 3PJCA 2XIXA 3F3TA 4JX3A 4ZSAA 1MRUA 3RPSA 1XBAA 1M2PA 3NSZA 3CJFA 1K3AA 2O8YA 4KIPA 3VS2A 4BDBA 3PXYA 5TE0A 4U0IA 5FXRA 3RK7A 3DAJA 2P2HA 3ZCLA 3O96A 4RJ5A 2PVHA 4IAZA 2IVSA 5AUWA 1OPLA 1FVTA 1H26A 1U4DA 4HCUA 1ZYCA 4UWBA 3ZLYA 4ANQA 4EZ5A 3OCGA 5C1QB 2OG8A 4OTWA 4MAOA 4YGAA 4PF4A 3AG9A 3CKWA 3NGAA 3PE1A 3FHIA 4FZ7A 2GQRA 2IZTA 1OL7A 3EQHA 2RGPA 2ITTA 4RPVA 3JY9A 3FL4A 3NVMB 4ZS0A 2PVJA 4YZNA 2GDOA 2OXDA 2ZB1A 3O2MA 3HEGA 3HRBA 5AA8A 2PZ5A 4IIRA 1IG1A 3V01A 1P2AA 1CM8A 3CTQA 5DWRA 2W96B 4LOQA 3IW8A 3KCKA 3QTWA 5JRSA 4BDHA 4WG5A 1A48A 1OIUA 4WG3A 5D41A 3D5VA 2CNQA 3B2WA 4O7NA 3AC4A 4JJRA 2XIRA 3MESA 5IG1A 1DS5A 4M69B 4OTIA 4Z16A 3E8EA 3R7GA 3SQQA 2PU8A 3VAPA 3KMWA 4FKWA 4QMPA 5AAGA 5J1VA 5EM8A 1H00A 4ZK5A 2G2FA 4CG8A 2W06A 1P4OA 4RWIA 1NVQA 2I0HA 3GC0A 4KKEA 1KWPA 1WVYA 1WBTA 2ZV9A 5DN3A 3COHA 1IASA 4HOKA 1SM2A 4PP9A 3KVXA 4XUFA 3UP7A 3TKHA 5I9XA 2V5QA 4RJ7A 4QP3A 2A0CX 3UBDA 3R8PA 1FVRA 4RA5A 4BHZA 4MH7A 4RC4A 5C26A 1GZ8A 2WTCA 5KZ0A 5H2UA 2I0VA 4NH1A 4KINA 3IECA 2E2BA 1S9IA 2PL0A 3A7IA 1OMWA 4GFGA 3SW4A 4BFMA 2Y6OA 4O86A 2X6DA 2VTQA 3JPVA 4ZJJA 4NTSA 4E5WA 5FM2A 2C6KA 5IA1A 1O9UA 2W0JA 5E8TA 4IHPA 5KNJA 4E5AX 4AZWA 3R04A 2EWAA 4O7LA 2GS2A 4HCVA 3K3JA 4GK3A 4GU9A 1PXJA 5K4IA 4FL2A 4BI1A 5L3AA 4F7SA 4GEOA 2J0MB 3BQCA 1VJYA 4BDIA 4BRXA 4II5A 1Q3DA 3PA5A 2VGOA 3BGPA 3D7TB 3Q53A 2EVAA 3FY2A 3NYXA 2QR7A 3BYVA 5D7VA 2BZIB 3ORNA 3E63A 5I9UA 3V8SA 4F1MA 1W0XC 4I24A 4OGRA 2VO0A 3JY0A 3GCQA 4FIGA 4I92A 4KABA 4L8MA 4RLKA 2XNPA 2CKQA 3A8WA 1MQ4A 3KXXA 4ERWA 2BTRA 3PY3A 3NZ0A 5FLFA 5ANIA 1QPEA 4G2FA 4AOJA 3PIZA 4L3PA 4XNEA 3ZRLA 4M67A 5T68A 3OTUA 3UZTA 4NU1A 4IBMA 5HORA 1Q8WA 2A4LA 4RVMA 5M4UA 2HY81 2YM3A 3G0FA 4OBOA 4FK6A 4BZNA 4F63A 1H07A 3FI2A 4FSWA 2X6EA 3VS1A 3W2OA 2G9XA 4BICA 5IQEA 3HRCA 1W82A 4I4FA 5JT2A 4C4EA 4MNEA 2ITZA 3UDBA 3P23A 2QODA 4EQCA 3QA0A 4J98A 2J5FA 4FOCA 2O3PA 5A46A 2E9PA 2WEVA 2QHNA 4LRKA 3NIEA 3KVWA 4YBJA 3BWFA 5BVOA 4IAYA 5DR2A 2WIPA 3C0IA 3QTQA 5TT7A 4Y73A 2AUHA 5HG8A 4QMOA 2YITA 3NUAA 2WTWA 2C0OA 2UZOA 3BEGA 3R1SA 4GL9A 2WQNA 4MXCA 4IB1A 3V5JA 3SOAA 3DA6A 3JVRA 5IA5A 4JBQA 2ITUA 4O0YA 3DBCA 1WBSA 3C4CA 4DC2A 4DEBA 1PMUA 4HNFA 2W5BA 4UEUA 4D9TA 2QOOA 3ZH8A 2H34A 3E8CA 3I7CA 4CFNA 3WIGA 3CKXA 3PIXA 3RCDA 4XMOA 2WTJA 2Y4IB 2GS7A 2PMNX 2QKWB 3O8UA 2YCRA 2WPAA 3EFWA 3AGMA 1H1QA 4M14A 3E88A 5M4CA 1XHAA 4ZOGA 3GCPA 4EL9A 3TNPC 2JDTA 4FKRA 4HVIA 5LMBA 3BE2A 5LOHA 3PZEA 3N4TA 5L2SA 1YKRA 2OKRA 3F5GA 4I5MA 1ZZ2A 2WMBA 2ZB0A 4GS6A 3V5LA 4IVBA 2CKOA 3E62A 4OR5A 4BTKA 4X3FC 4FSTA 4NM7A 1Q4LA 4RVTA 3AC5A 4RWKA 2RL5A 5CVFA 3VULA 2VWIA 2YERA 1ZYSA 3KCFA 1OZ1A 3M1SA 4Y95A 3Q52A 5CQUA 4K8AA 4DFNA 1M2QA 1MRYA 2R3HA 3GCUA 4JAIA 4GMYA 3UVQA 2QOLA 5CT7A 4B6LA 4GW8A 2OLCA 2W17A 3ZUTA 2QC6A 4QNAA 3QXPA 4PL3A 3QHWA 4IAKA 3R7YA 3AOXA 1YI3A 4W4WA 2C4GA 2YLEA 4I41A 2OJIA 4D55A 5AP4A 3QYZA 3PY0A 1W8CA 1M2RA 2O65A 2ONLA 3SV0A 3C4FA 3VIDA 2XYUA 3L1SA 3SD0A 3C13A 4MXAA 4Q9SA 2BPMA 2EB2A 4BB4A 2VTLA 3I0QA 3RNYA 1M14A 4DITA 4RA4A 1L3RE 3ULZA 2PVFA 2PE0A 4G3EA 5KMLA 3MV5A 3VRYA 5CY3A 4O83A 2W4OA 4IM2A 2QU6A 3EQRA 1PXNA 2GTMA 3PXKA 3NYNA 4TWOA 4ZSEA 4IX6A 4X2KA 4U79A 4AN3A 3LXNA 4ZLYA 3A4OX 3MWUA 3FJQE 3IQ7A 4ID7A 4J7BA 4BDFA 2FYSA 2Q0BA 2UZBA 5E9EA 4CFXA 3RPVA 2YCSA 4M97A 1TQPA 5J1WA 3RHKA 3FLNC 2C3KA 3L9MA 3MFUA 2R3GA 4BDEA 2B9IA 3BYMA 5CT0A 4D4VA 4R3PA 2B7AA 2OIDA 2X9EA 3MY5A 4EC9A 4BKYA 5M4FA 3V8WA 4Y8DA 2ERZE 2YM4A 3PWYA 3QQFA 4OW8A 2PTKA 2Z7RA 2ITVA 3LFEA 2YIYA 3QCXA 4AU8A 3CCNA 1XH6A 4FZ6A 5TO8A 2BRGA 4IAAA 4DT9A 5M51A 1PHKA 3UOKA 2W1CA 4IVDA 4C4JA 3PY1A 3Q5IA 4YHJA 5M4IA 1W83A 2YISA 2GHGA 3FY0A 3CGFA 4FSNA 4PTGA 4EYMA 1PXOA 1H8FA 1QCFA 4FSUA 3EN4A 4PTCA 1RW8A 4AOTA 4L52A 2FGIA 4EZ7A 1YDRE 3EN7A 3DB8A 5FTOA 3D94A 5BVNA 3R7VA 4O2ZA 1OECA 2ETRA 3UOLA 3EQCA 4XBRA 5BVWA 1R78A 2GHLA 3NPCA 4RC3A 2HXQA 4FOBA 4Y85A 5JFWA 3R9DA 1Q8UA 2QO2A 3VS4A 3R7EA 2P55A 4Y46A 1XH7A 3ZLXA 4KD1A 2BHHA 3T8OA 4DH5A 4ZLZA 5J9LA 4FGRA 4AQCA 5HG7A 2PZYA 4FUXA 4H39A 4YNOA 4OBQA 3TIZA 1WZYA 4QP6A 1WBVA 4RIXB 2R3FA 3L8SA 4D28A 3U6IA 4IC8A 3L8XA 3ZRMA 2ZV2A 2YM5A 1OKZA 2X7FA 2F9GA 2FUMA 2VNYA 3QU0A 3UPXA 4CV8A 4XV9A 4FSZA 3ID6C 5L6OA 3FPMA 1V0OA 4KS8A 5CEKA 3ENMA 4DEIA 4J52A 4UXQA 4NWMA 3R1QA 4D2RA 1TVOA 3R22A 1XBCA 1BI8A 3COKA 3MVJA 4NIFB 2XM9A 4GSBA 2NRYA 2Y0AA 5C8MA 3TL8A 3ZXTA 3UO5A 2HWPA 4F6SA 2CGUA 2GPHA 4K33A 2YDKA 4ANLA 4AFJA 3JYAA 3PPKA 4EBWA 3HGKA 4QOXA 3QZIA 4EONA 4FG7A 2OGVA 2PY3A 5GJFA 2F2UA 5ANDA 1ZMVA 3QX2A 2DWBA 3W2CA 3P79A 3RAKA 4GT3A 3HAMA 4CGAA 2IWIA 4IB0A 2WZJA 5KMMA 4KBCA 3OCTA 3KMMA 2J51A 2OZOA 3DK3A 4NM0A 5ANKA 2VD5A 1H1PA 4J71A 4QYFA 4FX3A 5DBXA 1LPUA 3TZMA 1NXKA 2ITPA 2HW7A 5AR5A 2PPQA 4I6QA 3TIYA 2WMAA 4KIKB 4EQUA 4FF8A 4D2SA 3H0YA 4WSYA 1WBWA 3KL8A 2YIWA 1DM2A 4ZTQA 5HBEA 3VW6A 4IX3A 5BMMA 3OW4A 3ZUUA 4EUTA 5F9EA 3NNXA 1BYGA 3KMUA 2G1TA 3DXPA 3DKGA 4U3ZA 2R4BA 5J95A 3GENA 3U6JA 4FODA 2C5XA 4FKJA 3QTXA 2R3MA 1OGUA 3RM6A 4CTBA 4O7ZA 3EQBA 4IDTA 4DGOA 3FXXA 4FNZA 4JAJA 5IQFA 4TNDA 5KE0A 5EW8A 3RI1A 3DU8A 3COIA 4MK0A 3BYOA 3P7CA 2CMWA 2RKUA 3PJ3A 5JSMA 3RINA 5CSVA 5H8GA 1SZMA 3EJ1A 2REIA 2GNJA 4JDIA 1BL7A 2W99B 1UU3A 4QMYA 5CENA 2CLXA 4JIAA 3VBYA 1OL6A 1L8TA 2XRUA 4BIEA 2B54A 5EHLA 1PMEA 5DE2A 4M3QA 2X2KA 1U5RA 5L8JA 2PUNA 3AD4A 3MTLA 2UZEA 3HP2A 3Q4CA 4KIOA 1A9UA 4FG9A 1S9JA 2PVMA 2O64A 4AT5A 2OXXA 4U6RA 3UZRA 3MJ2A 3FLQA 1ZMWA 3QQKA 4BDDA 5H9BA 2UV2A 3QUEA 3FZRA 5CSHA 1H0WA 3OBGA 5ACBC 5FTGA 4Q5HA 2VX1A 4XBUA 3ZO1A 3LPBA 2E9UA 4H36A 3EHAA 4I93A 2WIHA 2W1EA 4EBVA 4FV3A 3S1HA 4UX9A 1YW2A 2UZDA 2WTIA 4WNKA 1TQIA 3VUTA 3I6UA 3L9NA 5CWZA 3EN6A 5HE2A 3DJ7A 4YTFA 1SNUA 3Q04A 4I5HA 4BBEA 5BNJA 2XRWA 1BLXA 4GJ2A 5HOAA 4U42A 4FTAA 4O84A 3MDYA 4FT9A 2QO9A 2J5EA 2VTJA 4D4SA 5IQAA 5IU2A 1UA2A 2YJSA 2XJ0A 4LRMA 4IM3A 2RIOA 4ZTLA 4I6HA 2OU7A 3EZVA 3MTFA 1V1KA 3GC8A 4MEDA 5AR7A 4F1TA 2DYLA 2R0IA 5FG8A 3ZO3A 4FEWA 4P2KA 4QMXA 2ZVAA 4WSQA 2HW6A 2XBJA 4YZDA 4IJ9A 4C2VA 3MI9A 4M15A 4QMLA 4W9WA 1PXIA 3IS5A 4APPA 5CASA 4JL9A 2J90A 4G6OA 5ETAA 2VWVA 3LXPA 2WMQA 1QPCA 3UIXA 3NVKI 5A4CA 2JDRA 5HTIA 5IA2A 4AZFA 3D7TA 3F82A 5G6VA 3FLZA 4AT4A 4WHZA 5LCKA 1OIRA 3G51A 4G5PA 2B9JA 3ANQA 3C0HA 4C58A 4X3JA 1KOBA 4D0XA 1CSNA 3R7UA 2XEZA 3TKUA 3MVMA 5DOSA 5E4HA 1GIHA 2JKMA 3QUDA 3MFTA 4BWKA 1J1CA 4C4GA 4BBMA 3BHTA 5E8VA 2EXMA 2FSLX 1K9AA 4MD7E 4WG4A 3SC1A 4EK5A 4EYJA 2F7XE 3NWWA 4USDA 3HRFA 3ZZEA 1JSUA 2XK4A 4IX4A 4ZZOA 3VN9A 4N57A 4F09A 2JIIA 2VX3A 4DH3A 1NT2A 3KC3A 5HD4A 4RFZA 3G0EA 3Q2MA 4CCBA 1WVWA 1QL6A 3MB7A 2LAVA 3QGWA 1JQHA 3FMDA 4BCPA 4UMRA 4OUCA 3TM0A 4C3RA 2ITNA 3RMFA 4ZEGA 4IADA 4PRJA 4S2ZA 3MVLA 3SA0A 2VO6A 4JS8A 3KULB 3GC7A 3GC9A 4BDJA 2IJMA 4TYJA 5L4QA 5AUZA 3POZA 2UW3A 3IPHA 4MQ2A 4IX5A 5AUTA 3NUYA 5HNIX 5M55A 5ANOA 2A27A 2C30A 1R3CA 2J50A 2R3NA 3LJ1A 3BHHA 3BLRA 1P14A 3F3ZA 3OP5A 4IDVA 5G1XA 4W4VA 4F65A 2HYYA 2WQBA 3KY2A 3TZ7A 3U4UA 2XJ2A 4CKRA 5HLWA 4K11A 5IA0A 4F1OA 2P33A 4USFA 5HBJA 3M2WA 5HG9A 4IVAA 2YM8A 4UMTA 5JFVA 1AGWA 4HGTA 4RC2A 3S2PA 4O7YA 3DKCA 4LV8A 4U5JA 2ESMA 4U8ZA 2CCHA 4UWYA 4YJTA 5D7AA 3R8UA 3VS0A 2JDOA 2C5NA 3MY1A 4XEYA 3F5UA 3F88A 4O7RA 4DLIA 2WNTA 4IAFA 2PUIA 4O96A 4BDGA 3WZJA 2C69A 5JK3A 4RIYB 3AMYA 4KAOA 3CS9A 3AC2A 3ORZA 2YABA 5AP5A 4MXXA 2XK3A 3G9NA 3OY3A 4IWQA 3G2FA 1UU7A 3PVBA 1U54A 3IK3A 3RK5A 3A7FA 2C1AA 5ANEA 4EHGA 1PKGA 3T3UA 2GQGA 1ZZLA 4A9UA 4QTEA 1UU9A 2PSQA 4C3PA 4NJDA 3R1YA 3HL7A 5B2KA 4HVHA 5IQDA 3OFMA 4W8EA 5C03A 5BMSA 5L2WA 2PZIA 4QTBA 5C8KA 3LMGA 4BWXA 1OB3A 2FSOX 3UZPA 3BWJA 2QO7A 5KMKA 5LVNA 2XP2A 5IA4A 5L8LA 2RFSA 4TYHB 2JD5A 3CR0A 4IQ6A 1FOTA 2CCIA 2BAJA 5E8UA 3E8DA 3FKNA 4O1PA 3OWKA 2EXEA 4ENYA 2V62A 4OAUC 4NFNA 2CN8A 5BYZA 5HX8A 5FTQA 3BIZA 1ZOGA 2O2UA 2X4ZA 3OC1A 4GCJA 4RWLA 5ETFA 1Z5MA 4PY1A 4E6QA 1H1RA 4Q5EA 4PDPA 5TOZA 3WZUA 3NLBA 1GIJA 3QZHA 3GGFA 4PMPA 1Y6AA 3CQWA 4QPMA 4E7WA 3HP5A 5HCZA 2Z60A 5J7HA 3MFSA 2JIUA 3DV3A 3P5KA 3H9OA 2BMCA 3GI3A 4DG2E 2YAKA 4P7EA 1FINA 5FGKA 3BELA 3TDWA 2WFYA 4FEXA 2WMVA 1YXVA 1XR1A 2F49A 4MD8E 4XV1A 5KMOA 4QP4A 2C6TA 2WHBA 4E3CA 4E20A 4YLLA 1P4FA 3VUKA 4E6DA 3ZEPA 3TNHA 4E4NA 1LEWA 4DINA 3KQ7A 2WU6A 4G3FA 1ZWSA 4GIIA 3FMHA 5K9IA 3EH9A 3IONA 3ORXA 3WF6A 3AC3A 2WOUA 4Z7GA 3ZSGA 4KKHA 4JR3A 3ROYA 2J0IA 3MBLA 1CKIA 4H3BA 5CI6A 5J87A 3BZ3A 3C5UA 3AQVA 1DI8A 4I0TA 3TNQB 3TNWA 5AX9A 2PVYA 2VWBA 4ACMA 4H1JA 2LGCA 1PW2A 5EG3A 3W2QA 3D4QA 2W7XA 4K18A 1FQ1B 4DG0E 5TF9A 1CKPA 4FKQA 4I6FA 3HV7A 3EWHA 4L42A 5AP7A 3RBWA 3V5WA 4MXYA 4YC3A 4EHEA 4ZTMA 5BQ0A 2WQEA 4O38A 3ZXZA 4F6UA 2A2AA 2BZKB 3WF7A 3DXQA 4K77A 4BIDA 5JH6A 4XG9A 4P5ZA 1OL5A 4LG4A 5AUYA 3BLHA 2WTVA 4ACHA 4WNOA 2R5TA 5AJQA 1XH4A 2OH0E 4XOYA 3UO4A 1DI9A 2XNOA 4GYGA 5ANJA 3DGKA 5CZHA 4ZTSA 5AUVA 4DBNA 4M8TA 4QP7A 1Z9XA 4FTUA 3IW7A 3LLTA 4Q2AA 3GVUA 4BI0A 4YSMA 4RIXA 3TUDA 2WTKB 3EMGA 4CMTA 4GKHA 2XEYA 2BIYA 3RALA 3BGZA 3GCSA 1F0QA 2ZOQA 5EYDA 4L7FA 5EDQA 3QRKA 2IZUA 3K54A 3U4WA 2J4ZA 2CJMA 4MNFA 2J0KA 3O8PA 1JNKA 1NVRA 2WMRA 3DFCB 4N70A 3OCSA 2YLFA 2WMTA 5IUIA 4KBKA 4P4CA 5DMZA 1PXLA 2GTNA 5D12A 2BRNA 2W9ZB 3C51A 2X0GA 4MQ1A 3QRUA 2PUPA 4TPTA 3ZSHA 3EYGA 4QP8A 3CXWA 2V0DA 4M66A 4MF1A 4XG8A 1XH5A 1YHVA 2B9FA 1FMKA 3QKMA 4JX7A 4BCOA 2JGZA 3FZTA 1YOMA 4EORA 4QMSA 2ZYBA 3G5DA 1BI7A 4TWCA 4A07A 4C33A 4S34A 4AA0A 1Q97A 4U97A 5LMAA 2FSTX 2GU8A 3L8VA 1REKA 2H8HA 3O8TA 1URCA 3L8PA 1YWRA 4FICA 3JXWA 3NMUF 5DHJA 4KIKA 1TKIA 3QTRA 4IFCA 3FZSA 3UPZA 4D2PA 1Y57A 5AV4A 3D0EA 4ZZMA 3U6HA 1YWVA 2X8EA 5FBOA 2YZAA 2SRCA 3LQ8A 3GQLA 4DH7A 5GIPE 3F2AA 4CCUA 2XIZA 4BDCA 4ZSLA 1GZNA 3ORTA 5L2IA 2C3JA 2C5YA 3UQFA 5J5TA 1YRPA 4IJPA 3CD3A 3QTIA 3RNIA 1UNHA 3PP1A 4EHVA 2HZNA 4NM3A 4ALVA 4DG3E 2XNMA 4EQMA 4LUDA 3WE4A 3ZO4A 5DT4A 2W1DA 3DPKA 1NY3A 1REJA 3CEKA 4ITIA 3OCBA 3TV6A 1KUTA 3V5PA 5M57A 4M13A 3H9FA 4AGWA 1H27A 4DEAA 3D5XA 3R30A 5D9HA 5IZFA 4O0UA 5FUTA 3LLAA 4UN0C 3EN5A 5AV3A 3E5AA 4BCFA 5LARA 5HIDA 3LFCA 1YHWA 4WUAA 4OTRA 4E5BA 2UZVA 1G8SA 2BRBA 3R2YA 2QOIA 5KMNA 4G9CA 4EOKA 2YAAA 4MYGA 5K5NA 2FA2A 3R9HA 4FIIA 2PWLA 3Q9XA 3BYUA 2HCKA 4YJVA 3RJCA 1H01A 3Q4UA 4DCAA 2IPXA 4KB8A 1ZMUA 3RAHA 2PE1A 2BAKA 2ZJWA 4BZOA 3HUBA 3V5QA 2YWVA 3TUCA 3G90X 1JLUE 3HECA 2GHMA 3VVHA 1URWA 4EKLA 4F7JA 2IO6A 3E7VA 5E1EA 3VF8A 4UZHA 2E9NA 2QHMA 2WAJA 4FSQA 2UW7A 5LCJA 3PXFA 2PVRA 5AMNA 3R7OA 1B39A 4EH4A 2QOHA 5AIKA 3ZUVA 3HVCA 2QOKA 1P5EA 3R02A 4ITJA 3SKCA 2YCFA 1KV2A 4V05A 3VNTA 4RJ3A 3PRIA 5EI6A 3TZ8A 3V6RA 4GYIA 2PMOX 3OUNB 2QG5A 3BEAA 2JDVA 5AP2A 3V6SA 2XNBA 3LCOA 3N51A 4PMTA 1FGIA 3T3VA 2QKRA 2R3QA 3NS9A 4FT7A 4GVAA 3FWQA 4IH8A 5HNGA 4R5YA 4GV1A 3WF8A 4CKIA 2WGJA 3TACA 4X2FA 3FLWA 4LL0A 3NNUA 5A6OA 3QC9A 4DFUA 3Q9ZA 4KA3A 5HQ0A 2BFXA 5JMSA 4JDKA 5GZAA 3II5A 4F0IA 1V0PA 3EKKA 2FH9A 3UOHA 1XH8A 5HO6A 3TTJA 3QHRA 1SMHA 4K1BA 3RKBA 1LUFA 1VYWA 2WELA 3QKLA 4PPAA 5CEMA 5L2TA 4NCTC 3D2KA 4YZMA 5JZNA 3ZFYA 1STCE 3IOPA 5J8IA 3HYHA 4BTJA 4A9YA 3ACJA 3LXLA 4JQEA 3NNVA 5J5SA 3FE3A 3ZU7A 4NEUA 4IZ5A 5TR6A 4DFZE 3BHUA 3CD8A 4RVLA 4DTAA 1UKHA 3M42A 3IKAA 1BKXA 4JLCA 3WE8A 3IDPA 4F70A 4I94A 3FKLA 4B9DA 4OTHA 3VUIA 2ONLC 4F9BA 4JQ8A 4Y72A 5HESA 5EM6A 4AE6A 5EDRA 2G2HA 1GOLA 3IG7A 4APCA 3CQUA 3DNDA 1OKYA 2XH5A 3VW8A 1QPJA 2GSFA 4FTIA 4M12A 2X4FA 1PYXA 4R78A 3OXZA 1YI4A 3EIDA 3UTOA 1V0BA 3P1AA 3U51A 1CMKE 4R5SA 4TZRA 4CFFA 4ZXTA 3U54A 5CS6A 3ROCA 5EYKA 2QLUA 4EKKA 4NCTA 5IMXA 2AYPA 3UQCA 2X1NA 3F69A 4CT2A 1XKKA 1YXTA 2R7BA 3L9LA 3EYHA 1M7NA 4O0XA 5EHYA
chains in the Genus database with same CATH superfamily
3I7BA 4KSQA 3H9RA 4NT4A 4OTGA 5AR4A 3BU5A 5C4LA 2Q0NA 3ERKA 3BQRA 4FV5A 4HW7A 1ZOHA 3F7ZA 4O82A 4L01A 4FL1A 4CTCA 1H4LA 3DJ6A 3QTSA 4AZSA 3OEFX 3B8RA 4NKAA 1ZOEA 3QLFA 5JGBA 3PWDA 3PUPA 2WQOA 4A9TA 5I9WA 1R39A 2VGPA 4FKGA 4FIJA 3HDNA 4XHKB 5JRQA 1OPJA 5LVOA 3DBFA 4JMQA 2R64A 3R8LA 3LVPA 4IANA 5I4NA 3FC1X 3W32A 2C47A 2YDJA 4H3PA 4I6LA 2Y8OA 3OZ6A 3KRRA 4MF0A 3UE4A 3SOCA 4N4SA 5H8BA 4BDAA 1Q8YA 4O0TA 5CAQA 2QOFA 2H6DA 1F3MC 3KXHA 4GG5A 1W2FA 2JIVA 2XK9A 3CPCA 3NAXA 4YSJA 3E92A 3FXZA 5HIEA 4QMWA 5E8SA 2IEWA 1KE9A 4WBBB 3ULIA 2GCDA 3DXNA 5E92A 3FLSA 4B4LA 2VAGA 4UYAA 3TT0A 2GFCA 3MIAA 1APME 3C4WA 1RQQA 5JFSA 4CRLA 3G6GA 4HYUA 5DNRA 4EOOA 5KBQA 4F9WA 3JR1A 4GJ3A 3GQIA 4UV0A 1Q99A 5BVEA 5C01A 2BIKB 2GS6A 5CU2A 2I0YA 3BX5A 4FT3A 2UZTA 2XA4A 3SG9A 2ZM4A 3F5XA 4ITHA 3ZRKA 2VWWA 3A7GA 4QP2A 2CHLA 1W2DA 3CY2A 4RSSA 5HNBA 4IM0A 3LOKA 4AN9A 3NUNA 4CSVA 2XK8A 4V0GB 4BGQA 3ACKA 3SLSA 1AQ1A 1J3HA 4HYSA 5FWKK 3RZFA 5E7RA 2JKQA 3UC4A 4E1ZA 5FDPA 3TWJA 2G2IA 2X81A 4I3ZA 4NZWB 1BX6A 5HVKA 5ITAA 3D15A 3QWJA 3O51A 4I6BA 4JG8A 4NM5A 3POOA 4TYEA 3ANRA 3BL7A 1OIQA 4HZRA 3TN8A 1RE8A 4FYNA 4AGDA 3JS2A 3ZHPC 3LXKA 2WXVA 5D11A 2CSNA 4DFYA 3OEZA 4FTJA 4FUYA 3VS6A 2C0TA 3ZDIA 3KKVA 4C0TA 3CBLA 2KTYA 2YM7A 4P5QA 4I0SA 3F3UA 3PRFA 5FEDA 4QEBA 3CJGA 5IA3A 2XIYA 4BYIA 4BYJA 2R2PA 3DS6A 4AW2A 4YJPA 1JSTA 2PHKA 2W4KA 3LCSA 2IVTA 4I22A 4QMQA 3GFEA 4J95A 1WMKA 4QP9A 3CTHA 4W9XA 5CU3A 3ALOA 4ALWA 2W05A 4WKQA 4ANOA 1DAWA 4JBVA 2UVZA 3BU3A 4J1RA 1FBNA 3PLSA 5FRIA 4ZMEA 4FZDB 3VBXA 2UW0A 4I0RA 3S3IA 4DA5A 1YI6A 5KHXA 3VS7A 3RWQA 1J91A 5L8KA 4CRSA 3DBEA 5C27A 3U8WA 5DEYA 2HXLA 5LVPA 5LMKC 3VBWA 3ZEWA 2B9HA 4Y5HA 5E91A 4QT1A 1HCLA 3O7LD 4AG8A 4FEVA 3ORLA 5KHWA 3FZOA 3DQWA 2QD9A 3WI6A 2HIWA 4YLKA 3ZBXA 5AADA 2P3GX 4JXFA 2C5VA 3U55A 2JC6A 3CP9A 3FMJA 4RWJA 3Q2JA 3SXRA 4MCVA 1OUYA 3QTZA 5JQ8A 4NJ3A 1XMMA 2OJGA 2QONA 2CLQA 2VZ6A 4I4EA 2PK9A 2R3RA 1H1WA 2X2LA 4LRJA 4K6ZA 3W2PA 2BZHB 5IDNA 2QQ7A 4U44A 4F0FA 2BILB 2NPQA 4BBFA 4BIBA 3VBVA 5EKNA 5I9VA 3C4EA 2VU3A 3OBJA 1UWJA 1J7IA 2WMSA 3SHEA 4PL4A 3IDBA 3OT8A 4LOPA 3BV2A 4R3CA 5AAEA 1JBPE 3A7HA 1Q3WA 3EQPA 5CU6A 1O6YA 4ONAA 1FPUA 4TTHB 5T3QA 4L68A 3FXWA 1OL1A 3FZ1A 3E3BX 4N0SA 5T6KA 4CEGA 5IEYA 4KS7A 5CALA 1WBPA 5AM6A 5EYMA 5LMKA 4D58A 5K4JA 3AT3A 3RAIA 3GU6A 3LW0A 5DG5A 4EH3A 1VYZA 2F57A 2HELA 2QLQA 2XK6A 4PMSA 4F08A 3EQGA 4O4BB 4LOOA 4MD9E 4KIQA 4WO5A 3EQDA 1Q8ZA 3S95A 3KREA 4M69A 2QI8A 4QQ5A 4D0WA 3DKFA 4JDJA 4QTAA 5HGIA 5TKDA 3LJ0A 4YTIA 4GRBA 3ATTA 4QMTA 4AGCA 3R8VA 4CZUA 1W98A 2W1GA 3Q4ZA 5CF4A 2IN6A 2ZDUA 3D83A 3P86A 4CVAA 5IPJA 2VTNA 1SYKA 2C6MA 4EJNA 3PVWA 4M7IA 4FVQA 3KRXA 4MBLA 4J8MA 3BYSA 3G15A 2DS1A 3OG7A 4FV4A 4GFOA 1PXMA 5AIRA 3OWJA 2UZWE 4G31A 5BVKA 1JKSA 4AZEA 4IWPA 1GZKA 4UMPA 4H3QA 5CSWA 3QRIA 2P2IA 2RSVA 1ZRZA 2JEDA 3NW5A 4PTEA 5AV2A 3VRZA 2Z8CA 5FM3A 4RIOA 2VWUA 4A4LA 5ETCA 2Z7LA 4RBLA 4MVFA 4C36A 4O91A 5C4KA 3N9XA 4W8DA 4DCEA 2X2MA 3D5UA 3QQGA 1ZYJA 2O0UA 1M7QA 2OJ9A 2XIKA 3O50A 1NA7A 3F9NA 4O0RA 4ZZNA 3SW7A 4EJ7A 5J7BA 2ETKA 2FO0A 3EFLA 4RG0A 5E1SA 3KF4A 3O17A 4B0GA 2UW8A 4AZTA 4B7TA 4BWPA 4KNBA 4U41A 1RDQE 4FKOA 4G5JA 3LFQA 4NW6A 5B0XA 4AW1A 5K5XA 3OS3A 3U9NA 3I60A 2Y7JA 3FI4A 3MH3A 4TRLA 4X2GA 4ANSA 3LAUA 2HWOA 5M53A 2ETMA 2OIBA 4ANMA 4LV5A 3ZMMA 4K2RA 2VN9A 3FUPA 4FV7A 5AR3A 3TEIA 3BE9A 5CVHA 1ZY5A 3OOGA 2PULA 5AUUA 3ORIA 4MWHA 3R21A 3THBA 2R0UA 5EI2A 3TNIA 4YHFA 3P0MA 4IWOA 2IW8A 3HV5A 4R3RA 4X6QC 4RQKA 3UODA 3EN9A 3LQ5A 2O5KA 3QQJA 4XG3A 4A9RA 4DEDA 4MNEB 5IQGA 4IB5A 2HOGA 2XBAA 4FEQA 4C38A 4CYJA 2HZ0A 2ZV7A 5KBRA 3GU8A 2J6MA 4A9SA 4OLIA 4ACGA 3R7IA 4C37A 2BR1A 3ZM4A 3F7WA 3AT4A 3ETAA 3FBVA 2Z02A 2Y4IC 4XS2A 4GK4A 2GNHA 4G3GA 3MPMA 1NW1A 2A1AB 5CF8A 1W84A 5EFQA 1JKTA 3K5VA 4GVJA 1IA9A 3TUBA 1ST0A 1KOAA 4RJ4A 3FI8A 4O7TA 2I1MA 2IF8A 3OUKA 3P78A 2R3OA 1XO2B 3TYKA 1UNLA 3CGOA 1KE6A 3RZBA 3ZO2A 5HBHA 5AR8A 2XMYA 3A60A 4FI1A 5CNOA 4B8LA 5AR2A 3NFFB 5IKWA 5AX3A 3NR9A 4ORKA 4CFVA 1J1BA 1FVVA 2GFSA 4ZTNA 1GAGA 3BHYA 4JT3A 2YDIA 3M11A 4EOQA 5HX6A 1G8JA 1ND4A 3HX4A 3V8TA 4DTKA 3V51A 4J8NA 5AEPA 3WARA 4JG6A 2OWBA 3W0MA 4LYNA 4C4HA 3PJ2A 4UXLA 5I9ZA 3PDTA 4CMUA 3WBLA 3E87A 3S00A 1XQZA 5B2MA 4Z3VA 3LFSA 4WD5A 3V3VA 4O6LA 4Y5QA 4XRJA 4L6QA 4QPSA 4QYYA 4RRVA 4NKSA 1Q41A 4ASEA 4XH6A 4R7BA 3OHTA 3UVRA 3P7BA 3R63A 4JR7A 4ZP5A 2IZRA 4LGGA 4U3YA 4NK9A 3HV4A 2XJ1A 5DRDA 3PG1A 4C59A 5BUEA 4BR3A 1M17A 3C5IA 3VHKA 4ZIMA 4TL0A 3H10A 4FTRA 5EW3A 4NTTA 4AXCA 5DT0A 4HNIA 4JBPA 3PVUA 4OTQA 4I23A 4QQJA 1Y6BA 3OW3A 3F2RA 2BUJA 2XF0A 4J99A 4R1VA 5A4EA 2QR8A 5AP0A 3R9OA 5E8XA 3GXLA 3T9IA 3AC8A 3PSDA 5JGAA 4DBXA 3OY1A 5KMIA 5FP6A 4O81A 3QXOA 5CAVA 1WBNA 2ZMCA 3KXGA 3R0TA 3QQLA 3DDQA 4YLJA 2JKKA 1T45A 3LHJA 3UIBA 3UQGA 3VHEA 1SVGA 4FT0A 5DLSA 2OSCA 5LVLA 5C8NA 3LMHA 1ZYLA 5BVDA 5A14A 2JBPA 1IR3A 4FK3A 4TY1A 1VR2A 4X3FB 1WCCA 3QQHA 4MHAA 2BRMA 2WOTA 3DZOA 5EI8A 5AUXA 3NUPA 2UUEA 2RG6A 2JITA 3Q32A 2C6IA 2F7ZE 2OH4A 2VNWA 2B53A 4PV0A 4OT6A 5FEEA 5ETIA 2GNLA 3FMEA 3NCGA 4IC7A 3DK7A 4K9YA 3FDNA 3ZFMA 4PNIA 3GU5A 4RX7A 4EOMA 2CGXA 2QURA 4H58A 4QQCA 2OF2A 2CN5A 4V01A 4R77A 4I5PA 4MXZA 4CMOA 1XJDA 3AT2A 4E6AA 1ZLTA 4UMQA 3PXRA 2ITOA 2ZMDA 4U45A 3RHXA 3C0GA 4CV9A 3DDPA 3PPJA 4C34A 4BTFA 4AW0A 3QGYA 2VWYA 4L3JA 3EFJA 5FEQA 4BGHA 3ZDUA 3BBTB 4ZLOA 4FL3A 4O0VA 4WA9A 2YCQA 3RGFA 3W55A 1JAMA 5HHWA 4XG4A 4ANBA 5E90A 2V7AA 3F6XA 3LQ3A 4FSYA 3KXZA 2VO7A 4N6ZA 2BAQA 3DB6A 2AC3A 1R0PA 4WOVA 3SXFA 4RGJA 3VQUA 3W1FA 3I1AA 4FA2A 3PUFC 1ZAOA 4XYFA 5FXSA 4ZS4A 3KA0A 4KBAA 4I21A 3BHVA 3KB7A 4FEUA 2AC5A 2C5OA 4TT7A 2WMUA 4PL5A 3MH0A 1Q24A 3TJDA 3WF5A 4CFUA 4AW5A 3UNZA 4BN1A 3WOWA 4HVGA 3B2TA 3PG3A 4BZDA 4GT4A 3GOPA 5LVMA 2OI4X 3GU4A 3TV7A 3E64A 3HMNA 3ZS5A 2XNNA 2R3IA 4XG2A 3UC3A 3MN3A 2XK7A 4AS0A 5GIOE 2YN8A 4R7IA 3O71A 2VTAA 2XCHA 1MP8A 2I40A 3PIYA 5ACKA 1E9HA 1YXUA 2J7TA 3EFKA 4P90A 4LL5A 3CTJA 3TXOA 5BPYA 3PJ1A 1Z57A 5HEZA 4QMZA 1Q5KA 4AX8A 5I0BA 5CEOA 4LMUA 4O2PA 4TWPA 1KV1A 3E93A 3CIKA 3H3CA 3NUSA 5IH4A 5AWMA 5ANGA 4IW0A 2QOBA 3A61A 3QAME 4EOLA 4NIFA 3DJ5A 1YDTE 3T9TA 4ASXA 4NUSA 4UWCA 1JPAA 2OBJA 3I4BA 3ZBFA 3W0RA 4OBPA 3LM5A 4FTMA 1SVEA 2ITQA 4YJQA 5CTPA 1XWSA 1W2CA 4XCUA 2W1ZA 2PZPA 5E8ZA 2GNFA 4BC6A 3WILA 4ZTRA 3NIZA 2UZLA 3KU2A 4F6WA 4RX9A 4EHZA 3W33A 2C0IA 4NYEA 2YACA 4XP3A 2VUWA 3RWPA 1ZYDA 4LGDA 1AD5A 3VONA 5M09A 1XBBA 2FSMX 4RIWB 4DEEA 3C7QA 3FL5A 2I0EA 3QKKA 1ZARA 3QBNA 3MW1A 3TCPA 4WNMA 4Z9LA 2C3LA 5EKOA 3ZFXA 3I0OA 2X8DA 4U40A 3Q9WA 3ATSA 4YNEA 4ZMFA 3JVSA 4HGLA 4X7QA 4B99A 3BLQA 4YJSA 4AFEA 1TQMA 1OM1A 1HOWA 1UWHA 2FVDA 2ZM1A 1BMKA 3QWKA 4E4LA 2UZUE 4S30A 4F9CA 4WT6A 4NSTA 4D2WA 5F20A 4BY9E 4FT5A 3DLZA 3NUUA 3HNGA 4GFMA 4TYGA 2VTPA 3FAAA 1OL2A 3BU6A 3Q6UA 3QC4A 4IWDA 4AP7A 4ASDA 3PLAE 1H24A 3KXNA 4FKTA 4PP7A 3OWPA 5HE0A 3NEWA 1U59A 3DQXA 3UYSA 1ZY4A 2H96A 2OZAB 3HLLA 3VBTA 4EI4A 3QRJA 4R6VA 3ENHA 3ODYX 4M68A 5IQHA 2W1IA 3AGLA 3P5JC 5LWMA 4FV8A 3BBWA 1OI9A 3D14A 5F4NA 1UVRA 3A7JA 2UW6A 4IACA 2PZRA 4FIEA 1ERKA 3NFGB 4QMUA 4RFMA 5EQPA 3UP2A 4XLIA 5FDXA 3MH2A 2IW9A 2IVVA 5HO8A 4YUQA 4MKCA 2QNJA 4ALUA 2VTRA 4CT1A 3HUCA 4EK8A 3CQEA 1OIYA 4ZY6A 4YJRA 5JZJA 3KF7A 3ML1A 4AXEA 4CKJA 3HMMA 3EL8A 5L6WL 4Q9ZA 5JFXA 3RCJA 3IDCA 3ZLSA 3ELJA 4CFMA 3NNWA 4GIHA 3ZOSA 3G6HA 2F2CB 3NUXA 5HVYA 1IAJA 2VX0A 4XLVA 5A54A 2VTTA 4C4FA 4F7NA 3MA3A 1JVPP 4GH2A 3ZZWA 3AMBA 5E8YA 2WU7A 4FZAB 3QLGA 3VO3A 3EL7A 4BCKA 4S31A 4D1SA 1GIIA 4I1ZA 4C7TA 2J2IB 4EUUA 3UIMA 4YJNA 2WEIA 3QA8A 2B4SB 3UO6A 2WB8A 2JAMA 5AV1A 3TTIA 4DFXE 3QTUA 2C1BA 3AD6A 4GK2A 4QYGA 2ERKA 1EH4A 2XKDA 4YHTA 2OFUA 2QG7A 2CDZA 3MY0A 3PYYA 3DAEA 3DKOA 3I81A 4RVKA 3VS5A 4WNPA 3UDSA 3FI3A 2QOCA 3R01A 1TFFA 5EQEA 1E1XA 1MUOA 3JUHA 3WYXA 4MWIA 3AXWA 3HMPA 1WBOA 2XKCA 2V7OA 4G3DA 5AP6A 4ZJIA 4O4DA 5DYJA 2W1HA 2UW5A 3W2SA 5DIAA 4ZSJA 1M52A 2HENA 4YTCA 3WZDA 4JIKA 4TXCA 3UIUA 2ITWA 4FV6A 5EHOA 4GG7A 1G3NA 4IXPA 5CXHA 2YEXA 4AUAA 4BDKA 4FBXA 4GUBA 5CAOA 1IA8A 5DPVA 4BCHA 3LMIA 4UZDA 4DN5A 2VTHA 4IVCA 3OTVA 4Y83A 4XP2A 4PX6A 3KRWA 5DVRA 4DDIA 2XYNA 4TNBA 1H0VA 3KFAA 4AE9A 2BCJA 2UVXA 4BCMA 4FTCA 2UZNA 5DRBA 4C8BA 2VRXA 1LP4A 1WAKA 4TKSA 1YOLA 3REPA 4A4XA 4EH9A 3I5ZA 2PVKA 4YJUA 3Q5ZA 4ACCA 3F3WA 2XNGA 5JQ5A 4YU2A 3KEXA 1K2PA 4W4XA 4D1ZA 4RQVA 3W16A 4PPBA 5KZIA 3KRJA 4PMMA 3ORMA 3UYTA 4CXAA 2UVYA 1JKKA 2WMWA 5KX8A 1H1SA 1XH9A 4CQEA 5EQYA 3KULA 5I3OA 3RPOA 5A4TA 3PXZA 4L7SA 3TKIA 2OW3A 4J96A 5HLPA 3VQHA 3IW6A 2CNVA 1UU8A 4MBIA 4DH1A 5DT3A 5M44A 2ACXA 3VWAA 4C62A 4GKIA 3QRTA 4YPDA 1OVEA 4JRVA 3AC1A 4HVDA 3OD6X 3KK9A 3QZFA 4WRGA 5EM7A 4DHZA 5CEIA 3P9JA 2I7QA 3V04A 2RFNA 3E8NA 4X6RA 3RK9A 4PUZA 4QMVA 4X0MA 5IUHA 3OVVA 4JOAA 4LM5A 2NO3A 4F7LA 3FQSA 2ZM3A 4V04A 3RP9A 3HA8A 3LFFA 4G34A 4UY9A 2X9FA 3DY7A 4HGSA 5CX9A 4AWIA 3BKBA 4CZYB 5IEVA 3F61A 3KGAA 3O23A 4USEA 1U54B 3D7ZA 2QOQA 3HMIA 4RIYA 3TI1A 5B7VA 2CKPA 4UALA 2X0QA 2Y6MA 5HE3A 3QX4A 4DGNA 1YXSA 4G9RA 3WZEA 1WVXA 3E3PA 3LFDA 3QD0A 4FYOA 4KRCA 1PXKA 4FV2A 3OT3A 1Q61A 4RJ6A 3N4UA 4DT8A 2R3KA 4AA5A 3IGOA 4FKPA 3CSVA 4PDYA 4D2TA 2JKOA 4U81A 4XG6A 1YXXA 2XZSA 4E8AA 1OBDA 4EOPA 2IG7A 4QDVA 3SRVB 2Y9QA 3SVVA 1GNGA 2PE2A 3RM7A 4BCIA 4D5HA 4DF3A 1FMOE 2BRHA 2QVSE 4G17A 3I6WA 4E4MA 5KMJA 5CANA 5EK7A 4R1YA 4DLJA 2VTMA 3A4PA 3MA6A 4TYHA 5CXZA 4EH8A 3OOMA 3BL9A 3HMOA 3DBDA 3WIKA 2C6LA 5AP3A 5HG5A 3SAYA 4AXAA 4FV1A 3GU7A 2X8IA 2X7OA 2CPKE 2B0QA 5DA3A 1Q8TA 3HZTA 2ITYA 3BPRA 3WYYA 4E26A 3PSCA 3QUPA 3VUDA 4IE9A 3DAKA 4QMMA 3W2RA 2OFVA 2ZAZA 4DFBA 3RPRA 5HU9A 2WTDA 3EOCA 4WIHA 3HA6A 4WBOA 4EC8A 1RJBA 3NW6A 4M84A 2C6EA 4BKJA 3ZONA 4EEVA 1J7LA 4PWNA 4J53A 4X3FA 5H3QA 4F64A 4EOIA 4QQTA 4E93A 5KKRC 4G6LA 3UVPA 1FGKA 5F94A 4L00A 3FC2A 3W10A 3DLSA 4GT5A 4ZY5A 4JBOA 3C1XA 3VC4A 4EWQA 4U7ZA 1PRYA 1KE7A 2GNIA 3KK8A 1PXPA 3NW7A 3DOGA 4QYHA 4YR8A 4FIFA 4OTFA 3PSBA 3TG1A 1PF8A 4NL0A 5K0XA 3UMXA 3LIJA 4CFWA 1LR4A 2IVUA 5CF5A 2CNUA 5IQCA 3F5PA 2R3LA 3Q3BA 5DFPA 3RPYA 3FMLA 5HCXA 2PMLX 3LFAA 4FRFA 3AD5A 4PQNA 3A2CA 3FSFA 4ENXA 2V22A 4FVPA 4CD0A 3C50A 2C68A 5CEPA 4UMUA 5I3RA 5HU3A 1OBGA 4D4YA 2UW9A 2WTKC 2J0LA 5GZ8A 4D5KA 5AV0A 4FKUA 5HO7A 3PFYA 2NNWB 3F3VA 1UKIA 3R8ZA 2XS0A 1KE5A 5HCYA 3MSSA 5DI1A 1QMZA 2XKEA 5H8EA 2DUVA 4LUEA 1R1WA 4BI2A 2OJFE 3FQHA 3MYGA 4RFYA 3F2NA 3VUMA 3HDMA 5D10A 1YVJA 4HJOA 3FMMA 3WZKA 5D1JA 4CYIA 3E7OA 3SGCA 4E4XA 4FE2A 4TYIA 5A3XA 4AOIA 1Y91A 4AZVA 2DQ7X 3GB2A 4QYEA 3FPQA 5HZNA 5C9CA 3R9NA 3FV8A 3S0OA 5IQBA 4M0YA 3CC6A 5DR9A 4MX9A 4KUJA 4AT3A 3IOKA 3QF9A 4G6NA 5I9YA 3ORPA 2W5HA 2P0CA 1YQJA 3C4XA 2BALA 3FSKA 3ORKA 4LGHA 3RAWA 2EB3A 3UNKA 3AKKA 4BJJA 1HCKA 2E9OA 1F5QA 1GJOA 1YHSA 4AAAA 3R28A 4BF2A 3QQUA 4FSMA 4HYHA 3ZC6A 1X8BA 1I44A 3QD4A 2XB7A 4FTTA 3GT8A 2WMXA 5KO1A 2BROA 4BCQA 5BX0A 3W0SA 4CG9A 3PFQA 2A19B 1NVSA 4EK6A 3KN6A 5EDPA 5IUGA 5HVJA 4FGBA 4G3CA 3UMWA 4I5CA 3O7LB 4CZTA 4FNWA 2EU9A 4IEBA 5A6NA 4EK4A 2YFXA 3S4QA 5J79A 4HPTE 3EZRA 2F4JA 2X39A 4FMQA 2W4JA 4CLJA 3SDJA 5JN2A 4C3FA 5FP5A 4D4RA 3Q4TA 4O7WA 5M08A 4O7VA 4JQ7A 1OPKA 4QTCA 4X21A 5EW9A 5HI2A 5CU4A 4O22A 4PDOA 4XV3A 2Z2WA 5CI7A 4RX5A 4OTDA 4RIWA 4CNHA 2YIRA 5CU0A 4U80A 4D9UA 3ZLWA 2GMXA 4C2WA 4A4OA 3QD3A 4TN6A 5EM5A 3UNJA 2ZV8A 4ASZA 4YMJA 4H05A 4XX9A 2VTIA 4QRCA 5CSPA 5CAPA 2UW4A 4JNWA 4X2NA 2OXYA 2B1PA 4NW5A 4S32A 3GOKA 4O21A 2RG5A 2XCKA 4XJ0A 5HKMA 4FR4A 5LXMA 3W8QA 2OIQA 5AM7A 4EK3A 4TW9A 3Q6WA 4DTBA 4PNKA 4U9AA 5GINE 2R3JA 5CQWA 4F99A 4ZAUA 5IH6A 2OK1A 2BZJA 1CTPE 5GJDA 3IGGA 2Q83A 4QP1A 3PPZA 4DGMA 4DFLA 5B2LA 3ZM9A 5GHVA 4WUNA 3BV3A 1B38A 1PMVA 3TZ9A 4FTKA 1VZOA 3VBQA 3VJOA 2XUUA 5CYIA 4QO9A 3RTPA 3IW4A 1PKDA 3MJ1A 5EOLA 3DFAA 4ANNA 2KULA 2OZAA 3IW5A 3LFBA 4RLLA 3G9LX 2OF4A 4AA4A 4YBKA 4D2VA 4I20A 4IZ7A 3NYOA 3OXIA 4A7CA 2P4IA 5CF6A 4XG7A 5LJJA 2PYWA 4O0SA 2EUFB 4YO4A 3FEGA 2AQXA 5AFVA 2WQMA 3PE2A 4ACDA 3PJ8A 4DEHA 3TJCA 1UNGA 3QYWA 1Y8YA 1BL6A 4YZ9A 4KRDA 3RVGA 2PUUA 4R7HA 4FTLA 3OROA 5L2QA 4H1MA 2WD1A 3ZC5A 4DEGA 4EH6A 5BUIA 5M56A 5GZ9A 5BYLA 5JEBA 5AP1A 1OITA 4E73A 4YC6A 4Z55A 4RZVA 4YO6A 2RFDA 2OICA 3DTWA 4U43A 4FTQA 3TDVA 5GNKA 3LZBA 3VUHA 1SNXA 2W1FA 4OTPA 1H08A 2HK5A 2JAVA 3MH1A 4MBJA 2CGVA 3P08A 4FG8A 3VUGA 5HLNA 5DR6A 4FTNA 4TWNA 3UJGA 1XMLA 3MVHA 2HY0A 4L45A 1SVHA 5FQDC 4IFGA 1CDKA 1ZXEA 2W5AA 3VF9A 3I5NA 3NX8A 4LFIA 4UBAA 3PXQA 4K0YA 4DH8A 3BLAA 2VWXA 1A06A 3DCVA 4BCNA 3TV4A 3PA3A 5BVFA 4YURA 3R6XA 5LQFA 4LQMA 3W18A 2YA9A 3K5UA 3GBZA 4O27B 2C3IB 4JDHA 1IAHA 2Z7SA 5ICPA 4G1WA 4ZJVA 3UG1A 4EH7A 2NRUA 4D1XA 5J9ZA 3LKMA 3PA4A 4Z7HA 3MPTA 2VTSA 3Q96A 4IB3A 4BTMA 1QPDA 3DTCA 4XOZA 3KXMA 3DK6A 3LFNA 4MXOA 3BGQA 3HKOA 4C61A 4DYMA 2NP8A 3FZPA 3DZQA 3GNIB 4HGEA 4L3LA 5HIBA 4EOSA 2C6DA 1JOWB 3KRLA 3MGYA 2BFYA 3FLYA 5A4QA 3KIOC 4O1OA 3R73A 4ZSGA 3H30A 3P7AA 3SXSA 1MQBA 1LEZA 3V5TA 4EOJA 2XANA 3Q9YA 1G5SA 2HZ4A 4FKSA 1OKVA 1T46A 2OJJA 3PVGA 4IZAA 3N4VA 2WKMA 3COMA 5DH3A 4NFMA 4BCJA 3NAYA 5EH0A 5IQIA 3I79A 4BGGA 2XKFA 3ITZA 1I09A 3ODZX 5IDPA 4JI9A 5KCVA 2FB8A 2X7GA 3K3IA 5KUPA 1IRKA 3HV3A 4PPCA 5CNNA 5BYYA 1PJKA 2YJRA 2YIXA 2F7EE 2PVLA 3QCQA 4IAIA 2BTSA 5CEQA 3DNEA 1YWNA 1OKWA 5A9UA 5FD2A 4BKZA 4E6CA 3R2BA 5IH5A 4OT5A 3DBQA 4ARKA 4FV9A 2BKKA 3R00A 4FKVA 4L43A 2OO8X 4O0WA 5EOBA 3EQIA 2JFLA 5M07A 2J0JA 1O6LA 3QFVA 4O7SA 2JLDA 3FYJX 4N6YA 3HAVA 4L67A 3FYKX 3LE6A 3R71A 5K0KA 3WF9A 2BKZA 4C35A 3EQFA 3UGCA 3OMVA 2G01A 4L53A 5A4LA 3FHRA 4BVUA 3KN5A 5DEWA 2RF9A 1E1VA 4FNYA 3O0GA 5DGZA 2GNGA 1YOJA 4MTAA 4FKLA 4B8MA 4YPSA 4EZ3A 4DGLC 2CGWA 1R0EA 2JBOA 2JFMA 4QMNA 3IO7A 3GUBA 4W4YA 3W8LA 4AGUA 5IISA 4JVGA 3B8QA 4FC0A 4WRSA 3PTGA 3OWLA 3MFRA 4AN2A 5IMEA 4YC8A 3SX9A 4QD6A 5FXQA 3U87A 2CKEA 4RT7A 1BUHA 1H25A 4BCGA 5K3YA 4J97A 4RJ8A 3GEQA 4ZTHA 3R1NA 5J9YA 5L6PA 1MRVA 4FZFB 1YDSE 3PP0A 4C4IA 3MS9A 2IZSA 1CKJA 3OXTA 3PZHA