3P0MA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
b'SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Fragment based drug design on PKA
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p0mA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p0mA02
3SW7A 5CNNA 3NGAA 4RLKA 5EKOA 3DS6A 4XG4A 3VS3A 3BQRA 3SOAA 4EOOA 5IUGA 4I5HA 3W2QA 1U54A 2PVYA 2W1IA 2YEXA 4J71A 3UDBA 3WZDA 4AWIA 2GQGA 2KULA 3GU6A 3BKBA 3Q5IA 2C5OA 3DCVA 5D11A 3COHA 3PJ2A 3D14A 3RHKA 4OLIA 4CG8A 5DGZA 3FXZA 5CSHA 4J8NA 2EWAA 4FV6A 2OZAB 4BCFA 3CQUA 1XQZA 3KN5A 5IF1A 4FT3A 2G2IA 4LI5A 1ZOHA 4GK3A 5AUZA 4M13A 5CEPA 3QTUA 3ZFXA 3FXXA 1GZ8A 2KTYA 5J9ZA 5J1WA 4O7SA 3NR9A 3KRWA 3MA3A 5E91A 4ZS0A 5C27A 3N4VA 3N4UA 3F5PA 4M14A 4EH8A 3ERKA 4I21A 2X7GA 4O0WA 3R9HA 3ATSA 3CTHA 4BIEA 5CF8A 2YDJA 4G34A 2UZTA 4DH7A 3LXLA 4FK6A 2EUFB 2F2CB 4NH1A 1YRPA 1FGIA 4KIPA 2JDOA 2X4FA 4NYEA 1PRYA 3G15A 1NVQA 3CS9A 5EM6A 3FZTA 4I93A 4BIBA 3EFLA 4ZAUA 3S4QA 1V0PA 5IQBA 4ZMFA 3CIKA 4AGUA 3FLZA 2PZPA 3NDMA 2XRWA 2QU5A 5CEQA 5DOSA 4H3QA 3FI8A 2B54A 3H0YA 4RJ3A 3BBTB 1BLXA 3LLTA 3QKMA 2WAJA 3SD0A 4ZMEA 2P4IA 2O8YA 4FSUA 1YW2A 2PY3A 3FXWA 5M57A 4GFGA 4DH3A 2JKQA 2C47A 2XK6A 2E9PA 3CBLA 3EN4A 3R0TA 2C6IA 4PQNA 4WA9A 3CGOA 2ITZA 3GCVA 3IOPA 3L8SA 3VS6A 3MH0A 2RL5A 3A2CA 1H26A 3H4JA 5DG5A 4ZTHA 4BDAA 5J7BA 3P0MA 4W4XA 2C5NA 1OKYA 3GU5A 4I6QA 4BGQA 4JQ7A 3KRJA 2C69A 5DH3A 4I20A 5C8KA 4AZFA 3VS4A 3ORPA 1WAKA 4ZTRA 4FTCA 3ULZA 4O7NA 2R4BA 3TACA 3OROA 5FRIA 3UIBA 4O7RA 5BVKA 2XVDA 3FLYA 2C6DA 4UMUA 4EQCA 1H4LA 4RIXB 4TYHA 3T3VA 4ALUA 3UZRA 3ZO2A 3AMBA 4ZEGA 3W55A 3G0FA 4I23A 3CPBA 2XJ1A 1MQ4A 4G31A 1Z5MA 5E1SA 3NIEA 3ORZA 4BKYA 3NYXA 4JIKA 3P78A 3SQQA 5L2WA 3IK3A 3G51A 3NUXA 4M3QA 3DY7A 2B9FA 5CVFA 3EQGA 5GJFA 5HCXA 4X3FB 2HW7A 3CLYA 3NUAA 2UVYA 5CT0A 2VUWA 3QWKA 4MNFA 2GNHA 3EQBA 4JJRA 2WFYA 4ZSLA 4I41A 4J95A 4LRKA 2RSVA 5H8BA 3ZSGA 4JXFA 3A7JA 1BMKA 3O8UA 4S32A 3W33A 5BVFA 3FSKA 4EOIA 2GNLA 2PVHA 3UPZA 5GZAA 5TE0A 1Q24A 2XA4A 2YLEA 1YDTE 3DT1A 2B4SB 2JKMA 3DOGA 1PXKA 3DZOA 5ITAA 3MYGA 1EH4A 5ANKA 4CQEA 3LOKA 4XBUA 4EK5A 5I9XA 2BILB 1NVSA 2JDRA 3UYTA 3VS1A 3F3WA 1U54B 4UX9A 3VIDA 2YDIA 4ARKA 2XNOA 4P5ZA 1ERKA 1AGWA 3PJ1A 3PRFA 4TWNA 4JLCA 4ACDA 3K3JA 4CKIA 4FL3A 5AAEA 5HNGA 3F3UA 4FIFA 3NAYA 4BICA 4ZTLA 4IVBA 4LRMA 4AW2A 3M11A 5CQWA 5ETFA 2BCJA 4O22A 2I0VA 2V22A 5B2KA 4LOOA 4QNYA 4E3CA 2XYUA 3C7QA 3PVWA 5DEWA 5LARA 3OWKA 4TZRA 2OXYA 4W4WA 2WTVA 2YJRA 1WZYA 3I1AA 3GC9A 2X6EA 2YACA 1PXJA 3E93A 4PP9A 4QP7A 4WNPA 4WSYA 5FTOA 4HNIA 4BCMA 4ITJA 5HVJA 3KXHA 3IS5A 1CM8A 4PL3A 3CEKA 4ZK5A 2EB2A 1OIRA 4AA5A 1PXLA 5L8JA 2IW6A 5AP3A 2BAJA 3JXWA 4KIQA 3Q4UA 1FPUA 1M17A 3F5XA 4YZNA 4HW7A 3HRCA 4AN9A 5FTQA 4PNIA 3V8TA 4JBQA 3R28A 4NM5A 4FOCA 3R8MA 3QLFA 3GGFA 2JAVA 4XG9A 3R8PA 3EHAA 3WARA 4R7HA 4A9UA 3IDBA 4FTJA 5K4IA 3Q2JA 5JK3A 4GK4A 5HQ0A 3C5UA 4Y73A 1UVRA 3WIGA 4DGMA 2QG7A 4NFMA 4KNBA 3EQIA 3U9NA 4RWLA 5AAFA 4MAOA 4QMNA 4QNAA 3BLRA 4RRVA 5KHXA 3NNVA 3C9WA 2WMVA 3PFQA 4IAZA 2WEVA 4KD1A 4BDJA 1G8SA 5AR3A 1PY5A 4DITA 3R04A 3CP9A 3BHVA 4QMYA 3TTJA 4AAAA 3ZC6A 4WG5A 4IAFA 2WEIA 2Y8OA 2B52A 4NKSA 3F2AA 1XR1A 5FP6A 4WRGA 5JQ5A 3FY2A 2YFXA 5IEVA 4FTOA 4FZAB 4ANSA 4TYHB 4JL9A 3EL7A 5J9LA 3FC1X 3JPVA 4D4RA 3FI4A 5L2IA 1CSNA 4DBNA 2WQNA 2CKQA 4QYGA 4FR4A 2XZSA 3PE1A 4E93A 2UW9A 2R3IA 3PXYA 5DRBA 5HLPA 4YJOA 4I94A 3P1AA 4DFNA 1VJYA 4U97A 3KVWA 2Z8CA 4FKVA 4DT8A 1PXPA 1B39A 3OEZA 5HX6A 3PY0A 4MK0A 4C37A 3MY5A 1ZMVA 2RFDA 3A7HA 5ETAA 3CKWA 4JDJA 1PXOA 3PP0A 2W5HA 5I9WA 1YXVA 3BEGA 1XH7A 1UKHA 4TRLA 4AA0A 1RQQA 4RPVA 3DJ7A 2XBAA 4ANNA 4K2RA 3PWYA 2WTWA 3QD4A 4FV3A 2YM8A 4FX3A 2CNUA 4O2PA 4EH3A 5A4LA 2DS1A 3QQGA 2Y6MA 5EW3A 2A4LA 3I0QA 2BFXA 4O0SA 4C4FA 1VYZA 3NIZA 1PMVA 3BWFA 2RKUA 4OW8A 4YC3A 2C6EA 2H6DA 4G1WA 3IG7A 4H3BA 3RPVA 4GS6A 5K9IA 4ACCA 2OIBA 2Z7RA 4AOTA 5CXZA 1H1WA 2GFSA 3BELA 3ZU7A 1PXIA 4U80A 4O7VA 5JRQA 3K5UA 3E88A 3LMIA 3R83A 1E1VA 2EXEA 4QMOA 2CCHA 1PMUA 3MJ2A 2G1TA 3CY2A 3OP5A 3SDJA 3ZZEA 5IQAA 1BI8A 3MTFA 4FZ6A 3V04A 3SX9A 1YWNA 5M53A 2W06A 3ZS5A 4CQGA 3KCKA 5C8MA 4ZLYA 3R73A 2C0IA 3DZQA 4BDGA 2PUPA 3ZDUA 1LR4A 3MH3A 1ZXEA 3QC4A 4MBLA 3UIUA 4Y8DA 4LG4A 5EOBA 3WOWA 3R30A 2GNGA 2V55A 3W8LA 4XLVA 2BR1A 3A8WA 3DXNA 1OL6A 5HVKA 2QO7A 1P14A 3EJ1A 4Y85A 4FF8A 4XRLA 1WBSA 2WOTA 3EB0A 4OUCA 4YC8A 4I5CA 5FXQA 5HTCA 4S33A 4FT7A 4BTFA 3AD5A 3GCSA 5JGAA 4S34A 1VYWA 4U45A 1URWA 4FSZA 4L68A 3TNQB 4U5JA 1H1SA 5HIDA 4BDFA 2LAVA 3C0GA 4ITIA 3KK9A 3HEGA 5EHYA 2Y0AA 1MQBA 2FSOX 5FLFA 2QO9A 3AG9A 2FO0A 4F09A 1P4OA 3HDMA 4E6CA 3ZFYA 4O83A 1WBTA 5AP0A 4FNYA 1XJDA 4FK3A 3FLSA 3RPOA 4FTMA 4K11A 4O6EA 3OY3A 4KRCA 4DEAA 4I0SA 4FEXA 2X2LA 4BFMA 1WBVA 2ETMA 4CCBA 2Z02A 4J99A 1WVYA 4XBRA 5IDPA 5CU6A 1YXUA 3BCEA 4LYNA 5KX8A 3DKGA 2IZUA 3AC2A 4RJ5A 3PP1A 3MS9A 1FINA 1UNGA 4EORA 3ZRKA 4AT4A 2J5EA 4ERWA 4PDOA 3NEWA 3ETAA 3LPBA 3PXQA 5HNBA 3LMHA 1G5SA 4EQUA 5BYZA 4LGGA 4BYJA 5DA3A 3LJ1A 3BHHA 3ZRLA 3AD6A 4U3ZA 4J1RA 4YTIA 5ETIA 3PJ3A 5HE2A 4IB1A 3I4BA 1B6CB 2XH5A 5AAGA 4WRSA 4YJQA 4QPSA 3TDWA 1PYEA 5JFXA 4RA4A 2ZJWA 3G0EA 3R9NA 4RA5A 4PMPA 3LCSA 4I1ZA 4F7NA 2WGJA 5GJDA 2YM3A 4DTBA 5CEOA 3A4OX 5HGIA 2X9EA 4FV4A 1OUKA 1R39A 5BVWA 1MRVA 5AV1A 3F69A 4B6LA 1XKKA 3FI2A 3G6HA 4IAYA 4BGGA 3BHUA 4ZSGA 2XNGA 4R1VA 3UZPA 4DFBA 1IR3A 3UMXA 3D2IA 3OCGA 2ZM1A 3FQHA 4AOIA 2W5AA 4U43A 1APME 3R2BA 3HMIA 3Q6UA 4KIOA 5AUYA 5KO1A 4WUNA 2ITYA 1YVJA 5F20A 4CFFA 4YJVA 3ZDIA 2VTLA 4K77A 3RVGA 4BWXA 1YWVA 2P3GX 5IPJA 3BGPA 4GFMA 4Y95A 4FG8A 4RZWA 3F61A 4HPTE 1XO2B 3NUPA 2FB8A 3OW3A 4RSSA 5FGKA 1W7HA 4IX5A 4IX6A 3T8OA 2VO7A 4II5A 5A4TA 5I3RA 5K5NA 3KGAA 2DYLA 2B9HA 4F6UA 3RM7A 2X1NA 3HV7A 3N9XA 4GKHA 2XNPA 4C33A 3SVVA 2QNJA 2BRBA 2B7AA 4ZSAA 3TDVA 4UMQA 5DHJA 3FI3A 4QYFA 4O7LA 4RQKA 4CSVA 1Y91A 2BHEA 2WMTA 3D4QA 5EM7A 5E8VA 1MRUA 1Q97A 5CEMA 3DPKA 1FGKA 4O0RA 1WBOA 2XIKA 4FSYA 5AX9A 4FNXA 4YLKA 4XEYA 3WZUA 2X4ZA 4IIRA 4NTTA 5F4NA 3AMAA 2CNQA 3ZUUA 4E26A 4YGAA 3DKCA 4R3RA 3C4ZA 5H2UA 5HU9A 3ZLSA 2WO6A 2PVJA 3TKUA 4JOAA 2PPQA 3LLAA 4X0MA 5IEYA 3ANRA 5AIKA 3QKLA 4BDDA 1F0QA 2CHLA 4HZSA 1VR2A 3RNYA 4D5KA 4JQ8A 2AYPA 3FAAA 3UVPA 4UWBA 4CMOA 4M67A 3LCDA 4QPMA 3ZEPA 5FG8A 3KXZA 3BV3A 5LVOA 4MXCA 5E90A 4F1MA 4EOLA 2W05A 3F3ZA 4EJNA 5BVEA 4FSNA 1FQ1B 3EN9A 4RVKA 4RMZA 5F95A 1W98A 2OJJA 4F1TA 2VN9A 3GQIA 3OMVA 4XV2A 4F6SA 5I5ZA 3HECA 4MF0A 3THBA 3EQPA 5AM7A 2CMWA 2P2IA 2QHMA 3BPRA 3L9LA 5KKRB 4BF2A 5AV4A 4CGAA 4M66A 3R02A 3TXOA 3F3TA 3LZBA 2OI4X 3CQWA 3MDYA 4EK4A 2WU7A 3RAIA 2A1AB 2EVAA 2YM4A 5FEQA 2OJFE 3CGFA 3H9FA 1Q3WA 2XKEA 3IECA 2A19B 3BHYA 3V5PA 4CFVA 1PJKA 4NM7A 3CXWA 3RALA 4DLJA 5DRDA 1OBDA 4ENXA 4TYJA 2V5QA 4RX7A 3NNXA 4EQMA 2I7QA 1WBNA 4UEUA 4GKIA 1XH9A 2BRHA 4NUSA 4CCUA 4QMTA 5D12A 3R8LA 5L8KA 3AC3A 4FEVA 2HZ0A 3AC5A 4QPAA 4QYYA 3HA6A 3KVXA 3ID6C 3Q53A 1FVRA 2BROA 3FE3A 3MB7A 4I22A 4QQCA 3FKOA 4QMPA 3U87A 3NPCA 4MEDA 4ASZA 2WKMA 1KOAA 2XJ0A 2BMCA 1AD5A 1ZYJA 3BRBA 2J0KA 5IH4A 5LQFA 3FHIA 3F7WA 4Y72A 4B7TA 3NS9A 3E3BX 4GT3A 4TWOA 4IFGA 1NA7A 2JDSA 3HRFA 4IM3A 4OTPA 4BHZA 2BKKA 4FV5A 4IWDA 2XIRA 1REKA 3NAXA 3LFNA 3OF0A 3QWJA 4IW0A 5HBEA 5LCKA 3ZXZA 4JX3A 3C51A 3DK7A 3MB6A 5M4FA 1JOWB 4G6NA 4FSTA 4Q5HA 4UYAA 5EDPA 2FGIA 2UW4A 3BGZA 1KE7A 1OPLA 2G15A 4IM0A 5AJQA 5JFVA 4XOYA 4FIJA 4HGSA 3ZLYA 1ZYSA 3GOKA 1BX6A 3QZIA 4RBLA 4MQ2A 4ACGA 3N51A 4W8DA 5LVNA 3QRKA 4IC8A 4IB3A 2QOCA 3PY1A 4GJ3A 4NW6A 5C9CA 3TWJA 4EKLA 3RI1A 4HCVA 5M51A 3MTLA 3E64A 4EJ7A 1BI7A 2YM6A 3RKBA 4FUYA 5IQIA 5ICPA 4GW8A 2C3JA 3QCSA 4MWIA 4MQ1A 3ZSHA 2X8IA 3A7IA 3R63A 4PL5A 2ZYBA 2C3IB 4FVRA 4NEUA 2I0HA 2ZDTA 1Q8TA 4ZP5A 4AW0A 4L8MA 4C4HA 4D28A 4BCKA 2XUUA 3OFMA 3NNUA 3ZM4A 2VWZA 4LQMA 5H9BA 5KBQA 3QTRA 4O86A 4FIGA 3RWPA 3BHTA 2P0CA 4USFA 3LQ3A 2X7OA 2WTCA 4O0YA 4YZCA 3W2RA 2BVAA 4ANQA 5AP2A 3R1YA 1DS5A 1GIIA 4A06A 2AC5A 4YP8A 4LMUA 4CT2A 4D0XA 4XYFA 4WNOA 4FTNA 1OMWA 3BLQA 2WMRA 3EWHA 3TIYA 4PX6A 5HU3A 2QKWB 3IW5A 3CD8A 3A61A 5HKMA 3TNIA 4CEGA 1S9IA 4WG4A 1H25A 2PE2A 1JQHA 4K9YA 3LAUA 3OD6X 4F0GA 2CGWA 5DLSA 4F64A 4U3YA 4E6DA 3LJ2A 3TKHA 4K33A 3BYSA 2ZMCA 2REIA 4FI1A 3VULA 1H28A 3WILA 3PXRA 3W2CA 3LM0A 3OC1A 3UOHA 4Q9ZA 1XBAA 2BZJA 3KKVA 3R2YA 3NYVA 1E9HA 4QP9A 4AGWA 5CU0A 1P2AA 5FBNC 1LUFA 3IO7A 4UALA 1ZMWA 4MTAA 4TTHB 2YERA 3CY3A 5AX3A 1KV1A 3TZ7A 4BI0A 5BUJA 4OTHA 5J8IA 4I0RA 2R3LA 5E8YA 3UMWA 3GU7A 5AP4A 3HZTA 5EI6A 3H9RA 3KK8A 4J97A 3UC4A 5IA1A 4KIKA 4YNOA 2YITA 4O7TA 2R3RA 3VBXA 4FV2A 4DFLA 3MW1A 2QVSE 2XEYA 4DH1A 4IAKA 4APPA 1Z57A 3KXXA 5M4IA 3LFQA 4FEQA 2BTRA 3IONA 3UG1A 4EOPA 1KWPA 4PDPA 5CU2A 4A9SA 5JEBA 4KKHA 4DGGA 4L3PA 4U79A 5CSWA 3FMHA 3LFAA 3Q52A 4XP0A 1JKSA 4UV0A 2X39A 2GSFA 3F6XA 2PVKA 4FV8A 4MBJA 4EHEA 5HLWA 5LXMA 2PTKA 4ORKA 3QAME 3EYHA 3FMNA 4WNMA 1FMOE 1H27A 3OWPA 4XH6A 4Z55A 2W17A 3O2MA 3T3UA 3B8QA 4F9WA 5HBHA 4UMPA 2YHVA 3EQCA 1NW1A 3UBDA 4DTKA 2UZBA 4RLLA 5CYIA 4HVHA 2YN8A 3IDPA 4XG7A 4FSMA 3EQFA 1HCKA 4ITHA 4DN5A 4WO5A 2B53A 4C38A 4KB8A 3TJDA 4DEBA 5JGBA 3PXZA 2QKRA 5AUUA 4CKJA 4M69A 4FNZA 1TQMA 2H9VA 3E5AA 3SW4A 4D2WA 1YOLA 2ONLC 3TNHA 3IW4A 4FGBA 4NWMA 3JY9A 4FKGA 3FQSA 4QD6A 3PZHA 3FMMA 4S2ZA 3ODYX 3R6XA 4NM0A 2HK5A 3VVHA 1OPJA 5M4UA 2CNVA 2YIRA 1STCE 4D4YA 3ORNA 5A9UA 4CKRA 2W4KA 3KN6A 2CLQA 2JFLA 4TNDA 3DA6A 3LFCA 3E7OA 2R0IA 3RK7A 3EQRA 5M4CA 2YJSA 2JDTA 5CWZA 3GI3A 3GOPA 1GY3A 4PL4A 2QONA 4X2FA 3VC4A 3NVMB 2ZV8A 5CX9A 5M06A 3C4FA 2OG8A 3G2FA 5EKNA 3FMKA 1KSWA 5CLPA 4PDYA 4RFYA 2J4ZA 4ONAA 4TW9A 3QCYA 2C6OA 2UZLA 4O7ZA 4GUEA 4CYIA 4HCTA 4EWHA 5IMEA 1SM2A 4UXLA 4IADA 4AW5A 2UW0A 1REJA 3GC8A 3HKOA 3QUEA 4L52A 5DR2A 4RWIA 4Z7GA 3SG8A 5HVYA 4JDHA 4PTEA 1IA8A 3VBWA 4FKIA 4YO6A 3P23A 2GMXA 3UO4A 1RJBA 2DUVA 4UWYA 5L6WL 3FC2A 3RGFA 3QTIA 3ZHPC 2QODA 5BUIA 3NLBA 4K6ZA 3I79A 3UG2A 3NNWA 4IAAA 3AT2A 1Q8WA 3E63A 2W1HA 4NIFA 4YLLA 3CJGA 2BDWA 3JVRA 3GFEA 4LMNA 3PXKA 3GCQA 3L9PA 4M8TA 4NK9A 4FKSA 4LV5A 4W4VA 3WI6A 4QMQA 3RHXA 3AGLA 4KINA 4NJDA 4XMOA 4EHVA 3VUGA 4LGDA 3U4UA 1ZZ2A 2WIPA 3KRRA 5A54A 2OGVA 4EHGA 5HO7A 3K3IA 2PVFA 4F08A 4WD5A 1LEWA 1T45A 1WMKA 1DM2A 3EOCA 4PPCA 3UE4A 3I0OA 1IG1A 4KIKB 3R7YA 3VUIA 3ZRMA 4OAVB 3HX4A 4DH5A 3S1HA 4M97A 2X0GA 2A27A 4FKWA 4KBCA 5BMSA 1U59A 3WBLA 4NU1A 2XK9A 3EFJA 4Q9SA 2W0JA 3KFAA 4IACA 5EFQA 4IE9A 4GEOA 3BWJA 2W7XA 3CSVA 3C4CA 3DB6A 2ITOA 4YJNA 4HVGA 3CCNA 1IAHA 3OY1A 1U5QA 2YCQA 3EFWA 5HE1A 4D1SA 2JIUA 5LJJA 1G8AA 3PRIA 2F4JA 1H07A 2IVSA 2H34A 5K3YA 1O9UA 3WF9A 3RM6A 4OTWA 4DH8A 2QOKA 4MD8E 2JKKA 3NWWA 4O84A 2Y7JA 2VWWA 1UWJA 2EXCX 3FDNA 2VX3A 3QQJA 4JI9A 2XK7A 3POOA 4IJ9A 4JAIA 3ZO1A 3QRUA 3JYAA 4BCNA 3KXGA 4DHFA 5AP5A 4QT1A 2R0UA 2QO2A 2WHBA 4JG7A 4PP7A 2XP2A 1PXNA 1GAGA 4FC0A 3W2SA 5CZIA 5AV3A 3HDNA 5B2MA 5F94A 4M7IA 5CAVA 4G3GA 4FTQA 4OTDA 2GFCA 5L3AA 3QRIA 3DBCA 5E8XA 2GDOA 4RWKA 3HGKA 4I4FA 2IPXA 4X3FC 5ANOA 4APCA 5DNRA 4EWQA 3IDCA 4B0GA 2Y4IB 3OS3A 3ROYA 2VTIA 2XIXA 3CC6A 3FLQA 5AIRA 2CJMA 3HV4A 4TNBA 3BE9A 4UZDA 3DLZA 1NVRA 3WF5A 4D58A 1UNLA 5K0KA 4MXYA 4X3JA 4LL5A 5FD2A 3QRTA 5IQFA 4YMJA 4BCQA 2XJ2A 2UZDA 4O0TA 3MFRA 3PG1A 1Q8UA 4FKRA 4MXXA 4RVMA 2J0JA 5J5SA 3DDPA 1QPJA 4EKKA 5DVRA 4CVAA 3D2KA 2YM7A 3TEIA 4KS7A 1JKLA 5B0XA 3QTZA 2UW5A 3AD4A 3FYJX 3ENMA 2Z7QA 3LFEA 4TWCA 4YHFA 3W10A 3BYMA 3O96A 2R3FA 4MD9E 3MY0A 3HVCA 3V8WA 4IM2A 3HRBA 4LUEA 5EG3A 4AN2A 4K8AA 3GQLA 4IAIA 2IN6A 2ETRA 4XX9A 4A4XA 2QHNA 3HUCA 3B8RA 3MIYA 3PPJA 4PV0A 4U44A 1PW2A 3MJ1A 5IA5A 5C26A 3COIA 1KUTA 5IQGA 4ASEA 1OGUA 3R1SA 2VAGA 2XF0A 3VW6A 4NIFB 5AR7A 3Q2MA 4YZMA 4I4EA 3R01A 3MY1A 1OIQA 1OKWA 4BIDA 2EB3A 3G5DA 2WTIA 1WVXA 3Q04A 4CMUA 2CDZA 5KZIA 3FLWA 4MVFA 1OL1A 4NZWB 4C2WA 2CLXA 4JS8A 1F3MC 3COKA 4AN3A 2C6KA 4X2NA 4M15A 2GTMA 4AW1A 4D2RA 3ET7A 1TQIA 2WD1A 5CASA 1LPUA 4RC3A 4O7YA 2ERKA 3C4EA 4E73A 3OXTA 4P7EA 4OBOA 3VBYA 5CANA 1W82A 4USEA 1FOTA 4YJUA 2OKRA 3NW7A 4AZEA 2PYWA 4ZTMA 2RG6A 3IW7A 3O8PA 3ORIA 1TVOA 2YIXA 3R1QA 1XH8A 4CZYB 4YTFA 3ORXA 5HI2A 5CALA 2UZOA 1IAJA 4L45A 3E92A 4LUDA 5DPVA 1ZAOA 2Z2WA 5HCZA 3CE3A 2V0DA 3L8PA 5HE3A 4IQ6A 5GZ9A 5T6KA 2WELA 1U5RA 4XHKB 3ZBXA 2OWBA 2XKDA 3C13A 4EOJA 3HNGA 4O82A 2JIIA 2VTQA 1JSUA 2BDJA 4JRVA 3RJCA 2WMAA 3GU4A 4FT9A 4DFUA 3ZC5A 1YWRA 4EHZA 3ORMA 3R22A 3UC3A 3VWAA 2NRYA 1XWSA 2VWVA 3I5ZA 4G3CA 4YZDA 2OW3A 3E8NA 4ENYA 1PF8A 5JGDA 3JR1A 2HY0A 2JGZA 3VJOA 3RCJA 1SNXA 3G6GA 4IDTA 5AA8A 3PUPA 3I60A 4XV1A 4EYJA 3ZXTA 2QR8A 4XV3A 4IWOA 5HTBA 2SRCA 1V0OA 4PMMA 1SZMA 1Q4LA 3COMA 3DTCA 4CG9A 4JR3A 3MSSA 4EUTA 3KC3A 3R8VA 3W32A 2JAMA 3F5GA 4FZ7A 1A06A 3UJGA 4HGLA 5AV2A 4DEGA 4L3LA 5ETCA 3MVLA 3VS0A 1O6KA 5CSPA 3Q6WA 4R7IA 4MXOA 3KRXA 2XNEA 4USDA 2Z7SA 2RG5A 3KMUA 2ZB0A 1YXSA 4M84A 4F7LA 5IA0A 4C36A 3QLGA 3ODZX 3VBQA 5HG8A 3KXNA 2R3PA 1XH4A 2XKCA 4JQEA 3LXKA 3Q60A 5CQUA 3VUHA 4XNEA 5LWNA 4X2JA 4DG3E 3OTVA 2C30A 4BDBA 5D9HA 4FUXA 2J51A 4GT4A 1KE6A 1ZRZA 5FWKK 5HO8A 4BDIA 4BBFA 4D2SA 2IG7A 5EM8A 2WMUA 2YZAA 4FIIA 4EH6A 5IZFA 3O50A 3PE2A 4H58A 3Q4ZA 4FTKA 4XLIA 1Q62A 2UZUE 3OBJA 3H9OA 3QXOA 3R21A 4O0VA 2ETKA 1SNUA 4EH7A 4V04A 2ZDUA 2OXXA 4XP2A 5DWRA 2VTHA 3MN3A 2HAKA 3KF7A 2VTTA 4TXCA 1M7NA 3BLHA 4C34A 3VN9A 4CRLA 5CAOA 1H0VA 3QALE 5J7HA 1LP4A 1WVWA 4DINA 5HTIA 3LM5A 2CN5A 2VWUA 4JG6A 4RIOA 4TL0A 1TKIA 3ZZWA 2PSQA 4MKCA 5AR8A 5EDQA 5KMJA 3TM0A 3AC8A 3R8ZA 4FV9A 4KBKA 2UVZA 4RC4A 4F70A 4D9TA 5J87A 5B2LA 3SHEA 5ACBC 3WYXA 2VRXA 4GL9A 2ITXA 2CSNA 3GCPA 3NCZA 3O51A 4FTRA 1BUHA 5E8TA 3ROCA 4BDEA 4JX7A 3EN5A 1JPAA 2E9UA 1W8CA 2PU8A 2JC6A 4YPDA 5L8LA 1JSTA 1Y8GA 2B9JA 5BYLA 1YOMA 2RFSA 4EK8A 1Q8YA 4UN0C 4U7ZA 4D2PA 5HICA 4LM5A 3DBEA 3E7VA 3L9NA 5E8UA 3GVUA 2YCSA 4DCAA 2P55A 2ZOQA 3P5KA 1UU9A 4LFIA 1M14A 2NNWB 5CY3A 2WQOA 3P86A 3V6RA 4D1ZA 4QQ5A 2VTOA 4FBXA 5KMOA 4PUZA 1H01A 2GHMA 3I7CA 4AZWA 4PPBA 2XS0A 2Y4PA 4RT7A 5E9EA 2RIOA 3OOGA 4MWHA 2O65A 2BZKB 4ALVA 5IMXA 5G1XA 1Q61A 2YCFA 4JNWA 4PDSA 3V5TA 5T68A 4LOQA 4B8LA 4BVUA 5HEZA 2W1FA 3VS5A 3A7FA 4C57A 3D83A 3QBNA 3O71A 2VWBA 3QA8A 4GIIA 4MHAA 4G6LA 3U6HA 3GB2A 2C1AA 3ZLXA 3FZ1A 5A3XA 4GRBA 3ITZA 2O63A 3KRLA 3WYYA 4G9CA 5FQDC 3QKKA 1GIHA 5E8ZA 3IW6A 4XG6A 1H1PA 1XH6A 5BUEA 4W4YA 3Q9YA 2YABA 3DAKA 4ANBA 3RBWA 3ZOSA 3WZJA 5L4QA 3S0OA 4TT7A 3FKLA 4KS8A 3FMDA 4MYGA 4R3PA 1R3CA 5GJGA 5AP7A 5A6OA 4EONA 3PZEA 4ZLOA 3P9JA 4AFJA 5LMKA 2X8EA 3FSFA 2YIWA 4HVSA 5BQ0A 1OVEA 3TIZA 2B0QA 4C2VA 2FSMX 2F9GA 4E6AA 2UUEA 3UIXA 2RF9A 2ZVAA 2UZWE 2C5VA 3H0ZA 2OICA 2QU6A 3ZUTA 5C01A 4EOMA 5J1VA 3VO3A 1O6LA 3WIKA 4AP7A 5H8GA 4QQJA 3U55A 2F7XE 4N6ZA 1OL5A 3VAPA 2UV2A 3TN8A 1DAWA 1J3HA 2ZV7A 3R71A 4G3EA 4U8ZA 2EU9A 4F99A 3PSBA 2IVTA 2VO0A 3TCPA 1CKIA 3DKOA 3MH2A 3QQFA 4BYIA 4WOVA 1E1XA 4HPUE 5EI8A 4FL2A 4L00A 4C0TA 3I5NA 2VTJA 4WBOA 4GYIA 3KU2A 4BWKA 2O64A 5L2QA 1IASA 3RPRA 1JWHA 3SXRA 3AQVA 4TPTA 3W2PA 4EZ7A 1K2PA 4Q5EA 4QO9A 1M7QA 2XEZA 4JBOA 5TO8A 4HYHA 4X7QA 2HOGA 4UY9A 5EYKA 4C4IA 2OH4A 3BU3A 4FZFB 4YJSA 1JKTA 4JDKA 5LWMA 2J90A 3U54A 3D5VA 2WMBA 1Y57A 3UP2A 5LMBA 2G01A 3VUKA 4AT5A 1CDKA 3EKNA 4CT1A 5HO6A 4DFYA 4YJTA 5K5XA 1JBPE 5C1QB 4ANLA 1CMKE 3ZTXA 3MFSA 4GVJA 5C03A 2R3JA 2WNTA 4ZTQA 4OBPA 2QG5A 4C4EA 3DJ6A 4BZNA 3QX2A 2F7ZE 5F1ZA 4R78A 3E3PA 2JBOA 3PG3A 3QUDA 5K0XA 3D5XA 3V5LA 3II5A 3OG7A 3PA4A 4IVCA 2GQSA 3OT3A 4BI1A 4CLJA 1IEPA 2C6TA 3FBVA 1H24A 3SAYA 1ZYDA 5TKDA 4R7BA 3LHJA 3LQ8A 5TF9A 4BTKA 5BVDA 3NYOA 4QMXA 5DIAA 3TJCA 5GNKA 1QCFA 2BUJA 1ZWSA 3NUSA 2GCDA 4A4LA 4QP3A 4YSJA 3IGOA 4QP6A 2VTPA 4FKJA 4OBQA 4U0IA 3H30A 3S2PA 4I6HA 1H0WA 4EK6A 2CKOA 2A0CX 3D5WA 2NPQA 3KMWA 4RX9A 2QLQA 3UVQA 1XBCA 4QYEA 4U42A 4ZTSA 5LVLA 4XJ0A 4O1PA 2X7FA 5BYYA 4QRCA 3TV4A 2PUUA 1HOWA 3LVPA 3RPYA 2ZB1A 4NCTA 1NT2A 2PUNA 4QP2A 3U6IA 4IWPA 4G5PA 4OTGA 3DU8A 4XRJA 5AMNA 1H8FA 2DQ7X 2HZ4A 1GZNA 4AACA 4CFNA 3SLSA 3QF9A 5KKRC 2W4OA 3BYUA 5D10A 4FMQA 3F2RA 1RE8A 3QZGA 4GU6A 4V01A 3UNJA 2UW3A 4NJ3A 1Y6AA 5JZNA 5CF4A 3REPA 5KBRA 2R3GA 2QCSA 4G6OA 1OIYA 5AV0A 3TKIA 5LCJA 2IJMA 3HMMA 2W99B 3FMLA 4BKZA 2W1DA 3K54A 3OXIA 2E9NA 4C7TA 2WZJA 4HGEA 3AMYA 5FTGA 4FV1A 5IH6A 4X6RA 4A07A 5HD7A 4ACHA 4BWPA 5AUVA 3RINA 4YZBA 4YU2A 4ZY4A 1OKZA 1ZMUA 4ZY5A 1JSVA 4J98A 3VUTA 5JH6A 3QZHA 3FYKX 4DA5A 3RP9A 1MRYA 2OJGA 3GC7A 4QMWA 4EOKA 2WIHA 3ACKA 4A9TA 3VRYA 2FSTX 4D55A 4FGRA 4RGJA 3D7ZA 4P5QA 4ZSJA 3HP5A 4BZDA 4S30A 1CKPA 3DDQA 5KUPA 4C58A 3F9NA 3PPKA 4QMMA 5GHVA 4BKJA 3VRZA 5LOHA 1ZARA 2XRUA 4RG0A 3DFCB 5ANEA 3PSCA 2IO6A 4BN1A 5FDXA 3SC1A 3FJQE 3QX4A 3OUKA 4IWQA 3V3VA 3O17A 1M2RA 3DV3A 4G5JA 4LGHA 4B99A 4CFUA 4YURA 4U40A 2OLCA 4IVDA 3KXMA 5GZ8A 3C4WA 1FVVA 4BY9E 4PMSA 3KEXA 3PPZA 4XG2A 4GYGA 5DEYA 3UOLA 4KA3A 4F9BA 3F5UA 3FHRA 3UQFA 3V8SA 2VTRA 2C3KA 5AM6A 1JNKA 2VTMA 3ZEWA 5AWMA 3VQHA 1PMNA 1KE5A 2BKZA 5IA3A 3UP7A 1J7LA 2BZIB 3WZEA 2PZ5A 4XP3A 4EH2A 2WTKB 4E4XA 4FOBA 4L9IA 4YJRA 4RVTA 4YNEA 5DI1A 2FYSA 4FODA 3PY3A 4BB4A 4B9DA 5LVMA 4DYMA 3P7CA 4FEUA 5M07A 3JVSA 4JT3A 5AP1A 2UW8A 4YJPA 4DT9A 4EBWA 4AZSA 3P08A 2OFVA 1GIJA 2XM8A 3Q96A 4X6QC 2GS2A 5CEKA 4AUAA 3D0EA 3C0IA 4E5WA 4QMZA 2AC3A 1I09A 3DQXA 4ASXA 4ZZMA 3ZSIA 2PL0A 3DAJA 2YCRA 3BEAA 3GNIB 3LE6A 3LXNA 4MXAA 5L2SA 3SOCA 3IOKA 3HUBA 5CSXA 4BCOA 1V1KA 2W4JA 4RVLA 1B38A 5DT4A 4ZZOA 4QTAA 3RK5A 4Y46A 4DBXA 2O0UA 4JVGA 5KHWA 4BTMA 1ZYCA 1XBBA 4O7WA 4FG7A 3EL8A 2O3PA 3IPHA 2WTJA 1J1CA 1JVPP 4MNEA 4EH4A 2J0MB 4CV9A 2PHKA 2UW7A 3GFWA 4ZOGA 3SXSA 3VF8A 4Z7HA 5I0BA 4WKQA 5IQHA 1Y6BA 1S9JA 4RC2A 3S00A 4IZ5A 5BNJA 2BAQA 5I9VA 5I9YA 2PK9A 5AP6A 1J91A 2YWVA 4IDVA 4FVQA 4TWPA 3KREA 4HNFA 5J79A 1OM1A 1MUOA 3O23A 3ZUVA 2B1PA 4IANA 1CKJA 4I92A 3NUNA 3NW5A 3RWQA 1OKVA 1Q8ZA 3PVGA 3FV8A 2Q0NA 3PVBA 2UVXA 4NKAA 3NUUA 5I4NA 1JAMA 3C1XA 3T9TA 5AADA 3OOMA 3BX5A 4YHJA 4LRJA 2C3LA 4DEDA 1GOLA 4UMRA 4DEHA 1M52A 1H08A 5L6PA 4QMVA 2J9MA 4J7BA 4KSQA 2BIYA 2BAKA 3FY0A 3QYZA 3V01A 4GCJA 2IZTA 1QMZA 2VZ6A 4D9UA 2JIVA 2GNIA 4FIHA 1PHKA 3U6JA 4DGNA 2GTNA 4IH8A 4XUFA 2HW6A 1K3AA 2ZV2A 2YIQA 2GPHA 4ANMA 5JSMA 4KUJA 1P4FA 3KL8A 3ZO3A 4NSTA 4L44A 4UZHA 3CTJA 2HCKA 3UIMA 4ZZNA 3SA0A 3PJCA 5KE0A 3UODA 3LCOA 3AXWA 2GU8A 1CTPE 2R5TA 3UNZA 2I0EA 5EH0A 4F63A 5A4QA 2F7EE 2OK1A 3D5UA 1LEZA 4PY1A 1JLUE 1BL6A 4HYIA 4TYGA 4YO4A 3DAEA 5AR5A 5E7RA 4D4SA 3VS2A 1PKDA 5ANJA 4JBVA 3SGCA 3EIDA 4TYIA 3RMFA 3EZVA 2XM9A 3QXPA 5EW9A 4XG8A 5LMAA 5TR6A 4L3JA 4IJPA 1QL6A 3DTWA 5CF5A 3QTXA 5A14A 2J0LA 2IZSA 3HAVA 3CTQA 4N57A 5AR4A 3RAHA 4FTLA 3MBLA 5IQDA 4O27B 4O0XA 4A4OA 1Z9XA 4R5SA 2QOQA 3M1SA 1M2PA 4IZ7A 3VUDA 4BDHA 2R3KA 3PYYA 2XNNA 3PLAE 4NT4A 5KMKA 2XK4A 3HV6A 3MGYA 2FUMA 3PWDA 4HYSA 3R00A 3DFAA 3DKFA 2OO8X 3L8XA 4YTHA 2PE0A 3Q9ZA 4RIWA 4P90A 4Y83A 2IVVA 4C62A 3OCSA 1IA9A 3NYNA 2Y9QA 1OIUA 4BL1A 2PUIA 3OVVA 3PA5A 3K5VA 5CAQA 3QZFA 3CKXA 3W1FA 2X2KA 4ZTNA 3BI6A 3EKKA 1PMEA 4L42A 2RFEA 5G6VA 4GG5A 2QOFA 4JAJA 3UPXA 4AZVA 5CENA 4XS2A 2CKEA 3QCXA 3QYWA 4KSPA 5AR2A 2X2MA 4KAOA 3RPSA 1KE8A 4DC2A 3OUNB 4N4SA 4MNEB 3TNPC 4E5AX 1OL7A 5JKGA 5D1JA 5FEDA 5CAPA 1GZKA 4ZY6A 3MESA 1OI9A 4QOXA 4GUBA 4I3ZA 1UU8A 3S3IA 1YDRE 3LFDA 4DF3A 1TQPA 4RIYA 4OTRA 5HOAA 2X6DA 3TZMA 3CJFA 2C6LA 3DB8A 3PJ8A 2J6MA 4FNWA 3WF8A 5IDNA 4HCUA 4U81A 4G2FA 5A46A 2GQRA 3L9MA 5EI2A 4FSRA 3ZO4A 2QR7A 4EEVA 3VF9A 4G9RA 1NY3A 1ZY5A 2ZMDA 4ZJJA 3W18A 2VX1A 3A7GA 4I5MA 5HBJA 3CR0A 3U9CA 3WF7A 4DG2E 4HVDA 4E4MA 3R7GA 3EMGA 3NZ0A 1BKXA 4FIEA 3QRJA 4O96A 3H10A 5FP5A 4FT5A 2QQ7A 4F9AA 5CT7A 3WZKA 3FMJA 3W8QA 2XKFA 2CGXA 3FUPA 4IXPA 2ZM4A 3EN7A 4D4VA 3VNTA 3JUHA 4Q2AA 4BTJA 4M69B 4RX5A 2CGVA 3AGMA 3F7ZA 1QPDA 2IWIA 3C4XA 2YAKA 2BRGA 2IVUA 2LGCA 2WQMA 2I40A 1K9AA 2RGPA 3LXPA 3MFTA 3QU0A 4RJ4A 5BMMA 3V5WA 3SRVA 1YHVA 3A60A 3OEFX 2PVNA 2PMOX 3AOXA 3RZBA 3KQ7A 3FPQA 4BDCA 2ITWA 5K4JA 3MA6A 2PMNX 5J5TA 2HWPA 2WMQA 2R3HA 3H3CA 2BTSA 3SKCA 1L3RE 3GCUA 2OIQA 3ZONA 4DG0E 3MPTA 4FSQA 5I3OA 5HD4A 5HX8A 4QQTA 2PMLX 3HL7A 4W9WA 5CNOA 5DMZA 2VD5A 4E8AA 2AUHA 4LL0A 2VX0A 5IA4A 4I24A 3RZFA 2WMWA 2JEDA 3QCQA 4FKQA 3UO5A 2OJ9A 5GIOE 2VWXA 3OWLA 2GNFA 5DN3A 3JS2A 1WBPA 4FV7A 3ACJA 4HJOA 5EOLA 4RFMA 4I0TA 3MWUA 2YA9A 5DFPA 2W96B 3V6SA 2Y4IC 3FMEA 4TY1A 1BL7A 4K1BA 3U8WA 4ACMA 4CTCA 4EC8A 3BBWA 5ANIA 5CSVA 5F9EA 2BRNA 3BYOA 2WMXA 2IW9A 4XG3A 4GSBA 4ZXTA 2XBJA 4L43A 5EYDA 3LIJA 4RFZA 5HHWA 4FYNA 3NRMA 3TUDA 2UZNA 3K2LA 4FTAA 5I9ZA 4FE2A 3V5JA 2R3OA 5CAUA 4WT6A 2C5XA 4RIWB 4BGHA 2IZRA 4Z16A 3VQUA 2GHLA 2H96A 4KWPA 3QD0A 2QOIA 4L46A 4IMYA 5FM2A 5M44A 2VTSA 2E2BA 1IRKA 2O2UA 3RAWA 3OCBA 1VEBA 1UWHA 4GFOA 5AUWA 1QPCA 2E9VA 2VV9A 2C4GA 3BE2A 2HENA 4FSWA 2H8HA 1GNGA 2HY81 3ZM9A 4UB7A 4EI4A 4PWNA 4C35A 5BX0A 3I81A 3NVKI 3TL8A 5EYMA 1Q99A 3PIYA 4JBPA 2PZYA 3VBVA 4EZ3A 5A4CA 4D0WA 4BBEA 2CGUA 3TT0A 4A7CA 2BRMA 2JFMA 3FLNC 4CFXA 2BDFA 4R1YA 4RIYB 3ANQA 5T3QA 4BI2A 5KMNA 4ZS4A 2F57A 3QHRA 3CPCA 4HVIA 3EQDA 3Q32A 4FICA 3OZ6A 4NTSA 4TYEA 3SG9A 1UU7A 5CS6A 3RAKA 3IW8A 3D94A 2XCHA 1YHWA 3KULA 4YHTA 3UO6A 5E4HA 3DBQA 3O7LB 2I1MA 4WIHA 4DAWA 3I7BA 3BZ3A 4U6RA 2XB7A 3D9VA 1O6YA 2BALA 3L8VA 4L7SA 5CXHA 3GENA 1SVHA 4AFEA 4IZYA 5DT3A 2ZM3A 3OBGA 3I6WA 4RWJA 5HE0A 4BCHA 5KMMA 3DK6A 3DJ5A 1A9UA 4AGCA 3QC9A 4HOKA 5D41A 1YI3A 1UU3A 3R7EA 3R7VA 4F1OA 5JRSA 3QHWA 3ATTA 4C02A 3MVJA 2C6MA 3SRVB 4PRJA 4AQCA 3HMPA 3QA0A 2B9IA 5KZ0A 3RNIA 3PA3A 2PZRA 4O91A 2EXMA 4FKTA 4G17A 5FXRA 3O7LD 4AX8A 1G3NA 1F5QA 3TV6A 4AA4A 2YLFA 4UWCA 4EUUA 3FPMA 4EZ5A 2XNMA 2YISA 4CLIA 5IISA 2QOOA 3TTIA 5IG1A 1YI6A 2GNJA 3E8DA 4FKLA 1FMKA 1WFCA 2JKOA 3G90X 1OB3A 3R7OA 2VTNA 3KA0A 3KF4A 4M0ZA 2V7AA 3HAMA 3EYGA 2ITVA 1OL2A 1UNHA 4NFNA 2RFNA 5C8NA 2P33A 4PTCA 5TOZA 2I0YA 3ENHA 3EFKA 1YXTA 4EH5A 4I6FA 2HXQA 3M42A 2XK3A 4CD0A 2OJIA 3VHKA 4QTDA 4J53A 5LVPA 5DYJA 4AZTA 4YBJA 2JD5A 3LJ0A 3FZPA 4CFWA 3ZMMA 4C4GA 3TI1A 3TNWA 4FL1A 3F2NA 3JY0A 2VGOA 4IB5A 3CQEA 1JKKA 3M2WA 4IX4A 4H05A 3QGYA 4O81A 4QP8A 5M55A 2ITTA 3AT4A 2WMSA 4Z3VA 1NXKA 4F7JA 4X2GA 3DBDA 4U41A 4FTIA 2W1EA 4CRSA 2JDVA 5J95A 4OTIA 2GS6A 5CU3A 3ZBFA 3E62A 5E8SA 5AEPA 4N6YA 5CZHA 3BU6A 4N0SA 2JBPA 2UZEA 4CMTA 1OITA 1J7UA 4QTBA 2X8DA 2PE1A 4OTFA 2ITPA 4H1JA 2HZNA 2YIYA 4BR3A 3MV5A 3TZ9A 1FBNA 2J50A 2DWBA 2R2PA 4R8QA 5HIBA 4W8EA 3B2TA 3IQ7A 1M2QA 4IZAA 1A48A 2FA2A 2VO3A 5JFSA 4ZIMA 4GU9A 4XCUA 4L53A 4Y5QA 4EL9A 2WQEA 2YM5A 5FDPA 2QC6A 4KABA 4V0GA 2XNBA 1Q3DA 4WHZA 4AE6A 2HELA 4IBMA 4GG7A 4QTEA 4ZJVA 2WU6A 5JT2A 2PMIA 2PVLA 1DAYA 2J5FA 5JN2A 3LKMA 2QOHA 4F0FA 5HLNA 4HYUA 3GBZA 4QMSA 5IUHA 2X9FA 2O5KA 5ANGA 2YZLA 3HA8A 3KULB 4M0YA 4YTCA 3DNDA 4DE4A 2CKPA 4X2KA 2IW8A 3PVUA 4O0UA 1U46A 2E9OA 2W1ZA 3ORLA 3ULIA 3Q4TA 5FXSA 4G3FA 4C59A 3MI9A 3ZH8A 3PIXA 3L1SA 5CI7A 3Q3BA 4AG8A 1GJOA 4OAUC 5IU2A 2HYYA 4IFCA 4RJ6A 1YXXA 1YQJA 3KCFA 3MFUA 4DFXE 4AF3A 3TZ8A 3C5IA 2FVDA 3ZFMA 4J52A 3R1NA 3DNEA 5DR6A 5E1EA 3UOKA 1SMHA 4FTTA 4MXZA 4FKPA 4EH9A 5HIEA 2PULA 4QMLA 3GEQA 3UYSA 3R9RA 5D7AA 4EC9A 1URCA 3LMGA 3HP2A 5ACKA 3S95A 2X81A 2QD9A 3Q9XA 3V5QA 4X21A 3MPMA 3LQ5A 1T46A 3SXFA 1X8BA 2V62A 2QI8A 2W9ZB 2WPAA 3OT8A 2W5BA 3FZOA 4F4PA 4AT3A 3LFFA 2OF2A 2UW6A 3VUMA 4H36A 3C0HA 4YSMA 3ZCLA 3WE8A 4MCVA 4C4JA 2P2HA 3UTOA 4ERKA 4F0IA 5AFVA 1H1RA 3DK3A 2OU7A 3F82A 3KB7A 4AXAA 1ZOEA 4L7FA 2VO6A 3FL5A 1XH5A 3QTQA 4GJ2A 4LOPA 4DLIA 2QLUA 4HZRA 4CYJA 4E4NA 3BGQA 4IHPA 3BV2A 4KBAA 5CEIA 3PLSA 4IX3A 2B55A 3A4PA 4J8MA 4YUQA 4R6VA 4NL0A 3UGCA 4FVPA 3HLLA 3GUBA 3O0GA 3P7BA 3R7UA 1ND4A 5IQEA 5EQPA 3ZYAA 1H1QA 2YWPA 5DT0A 4QP1A 5IUIA 2WOUA 4YR8A 4BCJA 3B2WA 1YHSA 4M12A 2OF4A 2J2IB 2VTAA 1L8TA 4IVAA 4RX8A 3QD3A 5HG9A 4R77A 4JG8A 4CXAA 2QOBA 5DR9A 2BHHA 3GP0A 5BVNA 2Z7LA 4F9YA 3QQHA 4ZLZA 2WQBA 4JIAA 3Q9WA 3PDTA 1SVGA 4I5PA 3U51A 2Q83A 4GMYA 4IB0A 2F49A 4DGOA 3NW6A 4I6BA 1DI9A 1ZZLA 2NRUA 2R9SA 4C8BA 3AC4A 4H39A 3R9DA 4FG9A 4AE9A 3LCKA 4PNKA 4D2TA 3QL8A 4BZOA 2XCKA 4D1XA 4LV8A 2R3MA 5BVOA 2VNWA 2C68A 3C50A 2ITNA 4GIHA 3QGWA 4FT0A 3RCDA 1YKRA 4FKUA 2BZHB 2UZVA 2HZIA 4R5YA 4DEIA 3OCTA 5KMLA 3CD3A 3NX8A 5EQEA 3FL4A 5L2TA 4YLJA 2F2UA 3QTWA 2PVRA 4E7WA 2R64A 4BC6A 4V0GB 2G2FA 4BHNA 5EHLA 5HESA 3RK9A 4PMTA 4RZVA 2XIZA 4WNKA 5EHOA 3VHEA 4O2ZA 4FYOA 5A4EA 3UZTA 1J1BA 3UQGA 3DQWA 3U4WA 1ATPE 3Q5ZA 3OWJA 2VNYA 3E87A 2HXLA 1XHAA 4NM3A 4A9YA 1KV2A 5EW8A 4AU8A 1GZOA 3ALOA 3G9LX 3WE4A 4G16A 5ANDA 4KKEA 2GHGA 2ZV9A 4CZUA 1OBGA 5H3QA 1QPEA 2W1GA 1OUYA 4HGTA 5HG5A 4E20A 1R0EA 1W83A 4JRNA 4EOSA 3W16A 1SVEA 4JDIA 4ZSEA 3OXZA 2R3QA 3ELJA 4CZTA 4D5HA 2YDKA 3D7TA 4N70A 4PPAA 3F88A 3SV0A 4C3PA 2FH9A 2JLDA 3LCTA 3IGGA 1WCCA 4GV1A 4UYNA 1P5EA 1W0XC 2JITA 2R3NA 4F6WA 2A2AA 5C4LA 4NW5A 5CF6A 3UVRA 5GIPE 5EM5A 1R78A 3G9NA 3HV3A 4TKSA 5CVHA 2WB8A 4AOJA 3MH1A 3W2OA 2HIWA 3PSDA 2ITUA 3QTSA 2J7TA 4W9XA 3GXLA 3A8XA 2C1BA 4AS0A 1HCLA 5M09A 4UBAA 5EDRA 2GS7A 5I9UA 3R7IA 2OBJA 1WBWA 2BIKB 3VBTA 5IQCA 3N4TA 4C61A 5E92A 3RTPA 2PWLA 3QQKA 2C0OA 3OTUA 3P4KA 3NSZA 3LW0A 2OXDA 3EZRA 2OIDA 3QQLA 5JMSA 3A62A 3NUYA 4KRDA 5EYCA 4CV8A 1BYGA 1Q41A 3P79A 5IH5A 5GINE 1KE9A 2WTDA 4FZDB 3DXQA 3DXPA 4R3CA 5CTPA 2VU3A 2PZIA 3A99A 4ANOA 5C4KA 3VJNA 4P4CA 2ACXA 3PXFA 4UMTA 1Y8YA 3F3VA 4IC7A 4MBIA 3FWQA 4OTQA 4WSQA 2ONLA 4CFMA 3R8UA 1YI4A 5L6OA 5BPYA 5B7VA 4FTUA 4BCIA 3G33A 4OT5A 5M56A 3NMUF 4MF1A 1FVTA 3R9OA 4FEWA 4Z9LA 4GVAA 5AA9A 1I44A 4RJ8A 4GK2A 2C5YA 4K18A 4OR5A 5CVGA 2ZAZA 4B4LA 5LMKC 4M68A 4FKOA 2NP8A 1Q5KA 2Q0BA 5KNJA 4ALWA 5DE2A 5FUTA 1MP8A 5FEEA 1OECA 4MH7A 4C3RA 1J7IA 3MPAA 2CPKE 4ZJIA 4MX9A 3LFBA 2XIYA 5CU4A 3EQHA 4P2KA 3V51A 5HORA 2OFUA 4XOZA 4PTGA 4DFZE 5A6NA 3QFVA 3QQUA 2OH0E 4C3FA 3D15A 4U9AA 4O1OA 3KY2A 3WF6A 4BRXA 5KMIA 4AGDA 5AUTA 2XK8A 2OZAA 3FZRA 1PKGA 1RDQE 4J96A 4QMUA 2BPMA 3FQEA 5KCVA 2G2HA 2Y6OA 4KKGA 3OHTA 4A9RA 4OT6A 4QTCA 4YPSA 3EH9A 4EBVA 4YBKA 2NO3A 4O6LA 5DBXA 3EN6A 3MVHA 2ESMA 4GH2A 4O38A 2QURA 3TG1A 5HZNA 1ZLTA 3POZA 1V0BA 2XMYA 4B8MA 4H1MA 5J9YA 3F66A 3TV7A 3VW8A 1PYXA 2PVMA 4D2VA 2Z60A 3Q4CA 3TUCA 1VZOA 3ALNA 2ITQA 3AC1A 2I6LA 3BU5A 4EK3A 4BCPA 4CTBA 3MIAA 3DGKA 3DLSA 4PF4A 3VS7A 1U4DA 1UV5A 2ERZE 1AQ1A 2R7IA 4E1ZA 2XYNA 5IA2A 3D7TB 3QD2B 3QUPA 3FZSA 4O21A 3I6UA 1PXMA 1OPKA 4RJ7A 1ZOGA 1UA2A 1ZYLA 4DEEA 1SYKA 4GT5A 3HMOA 4BCGA 2WTKC 3KMMA 3OW4A 2QOLA 4UXQA 3UNKA 3AT3A 3E8CA 5FM3A 4DGLC 5CI6A 5H8EA 4F9CA 3HMNA 1YOJA 3DBFA 3HYHA 1R0PA 5E8WA 4DCEA 3FEGA 5IEXA 4S31A 4YZ9A 3FKNA 2CN8A 3O8TA 4H3PA 5EK7A 1R1WA 3BQCA 2OZOA 4IEBA 4XV9A 1ZY4A 4G3DA 2FSLX 4E5BA 4L6QA 2HWOA 3GU8A 4Y5HA 5FBOA 4V05A 4FA2A 5JQ8A 2C0TA 4WBBB 3IKAA 2R7BA 3BYVA 3GC0A 2G9XA 2W9FB 3ZLWA 4E4LA 5AUXA 5IKWA 3UQCA 4DTAA 2V7OA 4MD7E 3HV5A 4RIXA 4L67A 1H00A 4E6QA 1RW8A 5EQYA 5JZJA 4BDKA 4WG3A 2VWIA 4ID7A 3MVMA 4K0YA 4NCTC 4TN6A 1YDSE 4F7SA 3ORTA 3E8EA 1DI8A 4JR7A 4L01A 4WUAA 5HG7A 2VWYA 4YC6A 1W84A 4QP4A 4ASDA 4OGRA 4X3FA 3NCGA 1KOBA 2W1CA 4RQVA 5JFWA 2YAAA 3PIZA 3GT8A 1UKIA 4FV0A 1OZ1A 4BBMA 3UOJA 3LFSA 3P7AA 3PTGA 3T9IA 4QYHA 4F65A 4CNHA 5HNIX 5TT7A 2VGPA 2J0IA 2OSCA 4EYMA 4EOQA 3TUBA 3BIZA 5M08A 3ORKA 5HCYA 2BFYA 5D7VA 2CCIA 2WXVA
chains in the Genus database with same CATH superfamily
3SW7A 5CNNA 3NGAA 4RLKA 5EKOA 3DS6A 4XG4A 3VS3A 3BQRA 3SOAA 4EOOA 5IUGA 4I5HA 3W2QA 1U54A 2PVYA 2W1IA 2YEXA 4J71A 3UDBA 3WZDA 4AWIA 2GQGA 2KULA 3GU6A 3BKBA 3Q5IA 2C5OA 3DCVA 5D11A 3COHA 3PJ2A 3D14A 3RHKA 4OLIA 4CG8A 5DGZA 3FXZA 5CSHA 4J8NA 2EWAA 4FV6A 2OZAB 3TYKA 4BCFA 1ST0A 3CQUA 1XQZA 3KN5A 5IF1A 4FT3A 2G2IA 4LI5A 1ZOHA 4GK3A 5AUZA 4M13A 5CEPA 3QTUA 3ZFXA 3FXXA 1GZ8A 2KTYA 5J9ZA 5J1WA 4O7SA 3NR9A 3KRWA 3MA3A 5E91A 4ZS0A 5C27A 3N4VA 3N4UA 3F5PA 4M14A 4EH8A 3ERKA 4I21A 2X7GA 4O0WA 3R9HA 3ATSA 3CTHA 4BIEA 5CF8A 2YDJA 4G34A 2UZTA 4DH7A 3LXLA 4FK6A 2EUFB 2F2CB 4NH1A 1YRPA 1FGIA 4KIPA 2JDOA 2X4FA 4NYEA 1PRYA 3G15A 1NVQA 3CS9A 5EM6A 3FZTA 4I93A 4BIBA 3EFLA 4ZAUA 3S4QA 1V0PA 5IQBA 4ZMFA 3CIKA 4AGUA 3FLZA 2PZPA 3NDMA 2XRWA 2QU5A 5CEQA 5DOSA 4H3QA 3FI8A 2B54A 3H0YA 4RJ3A 3BBTB 1BLXA 3LLTA 3QKMA 2WAJA 3SD0A 4ZMEA 2P4IA 2O8YA 4FSUA 1YW2A 2PY3A 3FXWA 5M57A 4GFGA 4DH3A 2JKQA 2C47A 2XK6A 2E9PA 3CBLA 3EN4A 3R0TA 2C6IA 4PQNA 4WA9A 3CGOA 2ITZA 3GCVA 3IOPA 3L8SA 3VS6A 3MH0A 2RL5A 3A2CA 1H26A 3H4JA 5DG5A 4ZTHA 4BDAA 5J7BA 3P0MA 4W4XA 2C5NA 1OKYA 3GU5A 4I6QA 4BGQA 4JQ7A 3KRJA 2C69A 5DH3A 4I20A 5C8KA 4AZFA 3VS4A 3ORPA 1WAKA 4ZTRA 4FTCA 3ULZA 4O7NA 2R4BA 3TACA 3OROA 5FRIA 3UIBA 4O7RA 5BVKA 2XVDA 3FLYA 2C6DA 4UMUA 4EQCA 1H4LA 4RIXB 4TYHA 3T3VA 4ALUA 3UZRA 3ZO2A 3AMBA 4ZEGA 3W55A 3G0FA 4I23A 3CPBA 2XJ1A 1MQ4A 4G31A 1Z5MA 5E1SA 3NIEA 3ORZA 4BKYA 3NYXA 4JIKA 3P78A 3SQQA 5L2WA 3IK3A 3G51A 3NUXA 4M3QA 3DY7A 2B9FA 5CVFA 3EQGA 5GJFA 5HCXA 4X3FB 2HW7A 3CLYA 3NUAA 2UVYA 5CT0A 2VUWA 3QWKA 4MNFA 2GNHA 3EQBA 4JJRA 2WFYA 4ZSLA 4I41A 4J95A 4LRKA 2RSVA 5H8BA 3ZSGA 4JXFA 3A7JA 1BMKA 3O8UA 4S32A 3W33A 5BVFA 3FSKA 4EOIA 2GNLA 2PVHA 3UPZA 5GZAA 5TE0A 1Q24A 2XA4A 2YLEA 1YDTE 3DT1A 2A98A 2B4SB 2JKMA 3DOGA 1PXKA 3DZOA 5ITAA 3MYGA 1EH4A 5ANKA 4CQEA 3LOKA 4XBUA 4EK5A 5I9XA 2BILB 1NVSA 2JDRA 3UYTA 3VS1A 3F3WA 1U54B 4UX9A 3VIDA 2YDIA 4ARKA 2XNOA 4P5ZA 1ERKA 1AGWA 3PJ1A 3PRFA 4TWNA 4JLCA 4ACDA 3K3JA 4CKIA 4FL3A 5AAEA 2XANA 5HNGA 3F3UA 4FIFA 3NAYA 4BICA 4ZTLA 4IVBA 4LRMA 4AW2A 3M11A 5CQWA 5ETFA 2BCJA 4O22A 2I0VA 2V22A 5B2KA 4LOOA 4QNYA 4E3CA 2XYUA 3C7QA 3PVWA 5DEWA 5LARA 3OWKA 4TZRA 2OXYA 4W4WA 2WTVA 3UDSA 2YJRA 1WZYA 3I1AA 3GC9A 2X6EA 2YACA 1PXJA 3E93A 4PP9A 4QP7A 4WNPA 4WSYA 5FTOA 4HNIA 4BCMA 4MUQA 4ITJA 5HVJA 3KXHA 3IS5A 1CM8A 4PL3A 3CEKA 4ZK5A 2EB2A 1OIRA 4AA5A 1PXLA 5L8JA 2IW6A 5AP3A 2BAJA 3JXWA 4KIQA 3Q4UA 1FPUA 1M17A 2X0OA 3F5XA 4YZNA 3HRCA 4HW7A 4AN9A 5FTQA 4PNIA 3V8TA 4JBQA 3R28A 4NM5A 4FOCA 3R8MA 3QLFA 3GGFA 2JAVA 4XG9A 3R8PA 3EHAA 3WARA 4R7HA 4A9UA 3IDBA 4FTJA 5K4IA 3Q2JA 5JK3A 4GK4A 5HQ0A 3C5UA 4Y73A 1UVRA 3WIGA 4DGMA 2QG7A 4NFMA 4KNBA 3EQIA 3U9NA 4RWLA 5AAFA 4MAOA 4QMNA 4QNAA 3BLRA 4RRVA 5KHXA 3NNVA 3C9WA 2WMVA 3PFQA 4IAZA 2WEVA 4KD1A 4BDJA 1G8SA 5AR3A 1PY5A 4DITA 3R04A 3W0OA 3CP9A 3BHVA 4QMYA 3TTJA 4AAAA 3ZC6A 4WG5A 4IAFA 2WEIA 2Y8OA 2B52A 2AQXA 4NKSA 3F2AA 1XR1A 5FP6A 4WRGA 5JQ5A 3FY2A 2YFXA 5IEVA 4FTOA 4FZAB 4ANSA 4TYHB 4JL9A 3EL7A 5J9LA 3FC1X 3JPVA 4D4RA 3FI4A 5L2IA 1CSNA 4DBNA 2WQNA 2CKQA 4QYGA 4FR4A 2XZSA 3PE1A 4E93A 2UW9A 2R3IA 3PXYA 5DRBA 5HLPA 4YJOA 4I94A 3P1AA 4DFNA 1VJYA 4U97A 3KVWA 2Z8CA 4FKVA 4DT8A 1PXPA 1B39A 3OEZA 5HX6A 3PY0A 4MK0A 4C37A 3MY5A 1ZMVA 2RFDA 3A7HA 5ETAA 3CKWA 4JDJA 1PXOA 3PP0A 2W5HA 5I9WA 1YXVA 3BEGA 1XH7A 1UKHA 4TRLA 4AA0A 1RQQA 4RPVA 3DJ7A 2XBAA 4ANNA 4K2RA 3PWYA 2WTWA 3QD4A 4FV3A 2YM8A 4FX3A 2CNUA 4O2PA 4EH3A 5A4LA 2DS1A 3QQGA 2Y6MA 5EW3A 2A4LA 3I0QA 2BFXA 4O0SA 4C4FA 1VYZA 3NIZA 1PMVA 3BWFA 2RKUA 4OW8A 4YC3A 2C6EA 2H6DA 4G1WA 3IG7A 4H3BA 3RPVA 4GS6A 5K9IA 4ACCA 2OIBA 2Z7RA 4AOTA 5CXZA 1H1WA 2GFSA 3BELA 3ZU7A 1PXIA 4U80A 4O7VA 5JRQA 3K5UA 3E88A 3LMIA 3R83A 1E1VA 2EXEA 4QMOA 2CCHA 1PMUA 3MJ2A 2G1TA 3CY2A 3OP5A 3SDJA 3ZZEA 5IQAA 1BI8A 3MTFA 4FZ6A 3V04A 3SX9A 1YWNA 5M53A 2W06A 3ZS5A 4CQGA 3KCKA 5C8MA 4ZLYA 3PUFC 3R73A 2C0IA 3DZQA 4BDGA 2PUPA 3ZDUA 1LR4A 3MH3A 1ZXEA 3QC4A 4MBLA 3UIUA 4Y8DA 4LG4A 5EOBA 3WOWA 3R30A 2GNGA 2V55A 3W8LA 4XLVA 2BR1A 3A8WA 3DXNA 1OL6A 5HVKA 2QO7A 1P14A 3EJ1A 4Y85A 4FF8A 4XRLA 1WBSA 2WOTA 3EB0A 4OUCA 4YC8A 4I5CA 5FXQA 5HTCA 4S33A 4FT7A 4BTFA 3AD5A 3GCSA 5JGAA 4S34A 1VYWA 4U45A 1URWA 4FSZA 4L68A 3TNQB 4U5JA 1H1SA 5HIDA 4BDFA 2LAVA 3C0GA 4ITIA 3ML1A 3KK9A 3HEGA 5EHYA 4FJVA 2Y0AA 1MQBA 2FSOX 5FLFA 2QO9A 3AG9A 2FO0A 4F09A 1P4OA 3HDMA 4E6CA 3ZFYA 4O83A 1WBTA 5AP0A 4FNYA 1XJDA 4FK3A 3FLSA 3RPOA 4FTMA 4K11A 4O6EA 3OY3A 4KRCA 4DEAA 4I0SA 1TFFA 2X2LA 4BFMA 4FEXA 1WBVA 2ETMA 4CCBA 2Z02A 4J99A 1WVYA 4XBRA 5IDPA 5CU6A 1YXUA 3BCEA 4LYNA 5KX8A 3DKGA 2IZUA 3AC2A 4RJ5A 3PP1A 3MS9A 1FINA 1UNGA 4EORA 3ZRKA 4AT4A 2J5EA 4ERWA 4PDOA 3NEWA 3ETAA 3LPBA 3PXQA 5HNBA 3LMHA 1G5SA 4EQUA 5BYZA 4LGGA 4BYJA 5DA3A 3LJ1A 3BHHA 3ZRLA 3AD6A 4U3ZA 4J1RA 4YTIA 5ETIA 3PJ3A 5HE2A 4IB1A 3I4BA 1B6CB 2XH5A 5AAGA 4WRSA 4YJQA 4QPSA 3TDWA 1PYEA 5JFXA 4RA4A 2ZJWA 4AXFA 3G0EA 3R9NA 4RA5A 4PMPA 3LCSA 4I1ZA 4F7NA 2WGJA 5GJDA 2YM3A 4BJJB 5CEOA 4AXEA 4DTBA 3A4OX 5HGIA 2X9EA 4FV4A 1OUKA 1R39A 5BVWA 1MRVA 5AV1A 3F69A 4B6LA 1XKKA 3FI2A 3G6HA 4IAYA 4BGGA 3BHUA 4ZSGA 2XNGA 4R1VA 3UZPA 4DFBA 1IR3A 3UMXA 3D2IA 3OCGA 2ZM1A 3FQHA 4AOIA 2W5AA 4U43A 1APME 3W0RA 3R2BA 3HMIA 3Q6UA 4KIOA 5AUYA 5KO1A 4WUNA 2ITYA 1YVJA 5F20A 1W2CA 4CFFA 4YJVA 3ZDIA 2VTLA 4K77A 3RVGA 4BWXA 1YWVA 2P3GX 5IPJA 3BGPA 4GFMA 4Y95A 4FG8A 4RZWA 3F61A 4HPTE 1XO2B 1W2DA 2FB8A 3NUPA 3OW3A 4RSSA 1W7HA 4IX5A 5FGKA 4IX6A 3T8OA 2VO7A 4II5A 5A4TA 5I3RA 5K5NA 3KGAA 2DYLA 2B9HA 4F6UA 3RM7A 2X1NA 3HV7A 3N9XA 5BV3A 4GKHA 2XNPA 4C33A 3SVVA 2QNJA 2BRBA 2B7AA 4ZSAA 3TDVA 4UMQA 5DHJA 3FI3A 4QYFA 4O7LA 4RQKA 4CSVA 1Y91A 2BHEA 2WMTA 3D4QA 5EM7A 4DHZA 5E8VA 1MRUA 1Q97A 5CEMA 3DPKA 1FGKA 4O0RA 1WBOA 2XIKA 4FSYA 5AX9A 4FNXA 4YLKA 4XEYA 3WZUA 2X4ZA 4IIRA 4NTTA 5F4NA 3AMAA 2CNQA 3ZUUA 4E26A 4YGAA 3DKCA 4R3RA 3C4ZA 5H2UA 5HU9A 3ZLSA 2WO6A 2PVJA 3TKUA 4JOAA 2PPQA 3LLAA 4X0MA 5IEYA 3ANRA 5AIKA 3QKLA 4BDDA 3TMOA 1F0QA 2CHLA 4HZSA 1VR2A 3RNYA 4D5KA 4JQ8A 2AYPA 3FAAA 3UVPA 4UWBA 4CMOA 4M67A 3LCDA 4QPMA 3ZEPA 5FG8A 3KXZA 3BV3A 4O4EA 5LVOA 4MXCA 5E90A 4F1MA 4EOLA 2W05A 3F3ZA 4EJNA 5BVEA 4FSNA 1FQ1B 3EN9A 4RVKA 4RMZA 5F95A 1W98A 2OJJA 4F1TA 2VN9A 3GQIA 3OMVA 4XV2A 4F6SA 5I5ZA 3HECA 4MF0A 3THBA 3EQPA 5AM7A 2CMWA 2P2IA 2QHMA 3BPRA 3L9LA 5KKRB 4BF2A 5AV4A 4CGAA 4M66A 3R02A 3TXOA 3F3TA 3LZBA 2OI4X 3CQWA 3MDYA 4EK4A 2WU7A 3RAIA 2A1AB 2EVAA 2YM4A 5FEQA 2OJFE 3CGFA 3H9FA 1Q3WA 2XKEA 3IECA 2A19B 3BHYA 3V5PA 4CFVA 1PJKA 4NM7A 3CXWA 3RALA 4DLJA 4O4FA 5DRDA 1OBDA 4ENXA 4TYJA 2V5QA 4RX7A 3NNXA 4EQMA 2I7QA 1WBNA 4UEUA 4GKIA 1XH9A 2BRHA 4NUSA 4CCUA 4QMTA 5D12A 3R8LA 5L8KA 3AC3A 4FEVA 2HZ0A 3AC5A 4QPAA 4QYYA 3HA6A 3KVXA 3ID6C 3Q53A 1FVRA 2BROA 3FE3A 3MB7A 4I22A 4QQCA 3FKOA 4QMPA 3U87A 3NPCA 3NFFB 4MEDA 4ASZA 2WKMA 1KOAA 2XJ0A 2BMCA 1AD5A 1ZYJA 3BRBA 2J0KA 5IH4A 5LQFA 3FHIA 3F7WA 4Y72A 4B7TA 3NS9A 3E3BX 4GT3A 4TWOA 4IFGA 1NA7A 2JDSA 3HRFA 4IM3A 4OTPA 4BHZA 2BKKA 4FV5A 4IWDA 2XIRA 1REKA 3NAXA 3LFNA 3OF0A 3QWJA 4IW0A 5HBEA 5LCKA 3ZXZA 4JX3A 3C51A 3DK7A 3MB6A 5M4FA 1JOWB 4G6NA 4FSTA 4Q5HA 4UYAA 5EDPA 2FGIA 2UW4A 3BGZA 1KE7A 1OPLA 2G15A 4IM0A 5AJQA 5JFVA 4XOYA 4FIJA 4HGSA 3ZLYA 1ZYSA 3GOKA 1BX6A 3QZIA 4RBLA 4MQ2A 4ACGA 3N51A 4W8DA 5LVNA 3QRKA 4IC8A 4IB3A 2QOCA 3PY1A 4GJ3A 4NW6A 5C9CA 3TWJA 4EKLA 3RI1A 4HCVA 5M51A 3MTLA 3E64A 4EJ7A 1BI7A 2YM6A 3RKBA 4FUYA 5IQIA 5ICPA 4GW8A 2C3JA 3QCSA 4MWIA 4MQ1A 3ZSHA 2X8IA 3A7IA 3R63A 4PL5A 2ZYBA 2C3IB 4FVRA 4NEUA 2I0HA 2ZDTA 1Q8TA 4ZP5A 4AW0A 4L8MA 4C4HA 4D28A 4BCKA 2XUUA 3OFMA 3NNUA 3ZM4A 2VWZA 4LQMA 5H9BA 5KBQA 3QTRA 4O86A 4FIGA 3RWPA 3BHTA 2P0CA 4USFA 3LQ3A 2X7OA 2WTCA 4O0YA 4YZCA 3W2RA 2BVAA 4ANQA 5AP2A 3R1YA 1DS5A 1GIIA 4A06A 2AC5A 4YP8A 4LMUA 4CT2A 4D0XA 4XYFA 4WNOA 4FTNA 1OMWA 3BLQA 2WMRA 3EWHA 3TIYA 4PX6A 5HU3A 2QKWB 3IW5A 3CD8A 3A61A 5HKMA 3TNIA 4CEGA 1S9IA 4WG4A 1H25A 2PE2A 1JQHA 4K9YA 3LAUA 3OD6X 4F0GA 2CGWA 5DLSA 4F64A 4U3YA 4E6DA 3LJ2A 3TKHA 4K33A 3BYSA 2ZMCA 2REIA 4FI1A 3VULA 1H28A 3WILA 3PXRA 3W2CA 3LM0A 3OC1A 3UOHA 4Q9ZA 1XBAA 2BZJA 3KKVA 3R2YA 3NYVA 1E9HA 4QP9A 4AGWA 5CU0A 1P2AA 5FBNC 1LUFA 3IO7A 4UALA 1ZMWA 4MTAA 4TTHB 2YERA 3CY3A 5AX3A 1KV1A 3TZ7A 4BI0A 5BUJA 3W0MA 4OTHA 5J8IA 4I0RA 2R3LA 5E8YA 3UMWA 3GU7A 5AP4A 3HZTA 5EI6A 3H9RA 3KK8A 4J97A 3UC4A 5IA1A 4KIKA 4YNOA 2YITA 4O7TA 2R3RA 3VBXA 4FV2A 4DFLA 3MW1A 2QVSE 2XEYA 4DH1A 4IAKA 4APPA 1Z57A 3KXXA 5M4IA 3LFQA 1VLRA 4FEQA 2BTRA 3IONA 3UG1A 4EOPA 1KWPA 4PDPA 5CU2A 4A9SA 5JEBA 4KKHA 4DGGA 4L3PA 4U79A 5CSWA 3FMHA 3LFAA 3Q52A 3VONA 4XP0A 1JKSA 4UV0A 2X39A 3BL9A 2GSFA 3F6XA 2PVKA 4FV8A 4MBJA 4EHEA 5HLWA 5LXMA 2PTKA 4ORKA 3QAME 3EYHA 3FMNA 4WNMA 1FMOE 1H27A 3OWPA 4XH6A 4Z55A 2W17A 3O2MA 3T3UA 3B8QA 4F9WA 5HBHA 4UMPA 2YHVA 3EQCA 1NW1A 3UBDA 4DTKA 2UZBA 4RLLA 5CYIA 4HVHA 2YN8A 3IDPA 4XG7A 4FSMA 3EQFA 1HCKA 4ITHA 4DN5A 3NFGB 4WO5A 2B53A 4C38A 4KB8A 3TJDA 4DEBA 5JGBA 3PXZA 2QKRA 5AUUA 4CKJA 4M69A 4FNZA 1TQMA 2H9VA 3E5AA 3SW4A 4D2WA 1YOLA 2ONLC 3TNHA 3IW4A 4FGBA 4NWMA 3JY9A 4FKGA 3FQSA 4QD6A 3PZHA 3FMMA 4S2ZA 3ODYX 3R6XA 4NM0A 2HK5A 3VVHA 1OPJA 5M4UA 2CNVA 2YIRA 1STCE 4D4YA 3ORNA 5A9UA 4CKRA 2W4KA 3KN6A 2CLQA 2JFLA 4TNDA 3DA6A 3LFCA 3E7OA 2R0IA 3RK7A 3EQRA 5M4CA 2YJSA 2JDTA 5CWZA 3GI3A 3GOPA 1GY3A 4PL4A 2QONA 4X2FA 3VC4A 3NVMB 2ZV8A 5CX9A 5M06A 3C4FA 2OG8A 3G2FA 5EKNA 3FMKA 1KSWA 5CLPA 4PDYA 4RFYA 1XMMA 2J4ZA 4ONAA 4TW9A 3QCYA 2C6OA 2UZLA 4O7ZA 4GUEA 4CYIA 4HCTA 4EWHA 5IMEA 1SM2A 4UXLA 4IADA 4AW5A 2UW0A 1REJA 3GC8A 3HKOA 3QUEA 4L52A 5DR2A 4RWIA 4Z7GA 3SG8A 5HVYA 4JDHA 4PTEA 1IA8A 3VBWA 4FKIA 4YO6A 3P23A 2GMXA 3UO4A 1RJBA 2DUVA 4UWYA 5L6WL 3FC2A 3RGFA 3QTIA 3ZHPC 2QODA 5BUIA 3NLBA 4K6ZA 3I79A 3UG2A 3NNWA 4IAAA 3AT2A 1Q8WA 3E63A 2W1HA 4NIFA 4YLLA 3CJGA 2BDWA 3JVRA 3GFEA 4LMNA 3PXKA 3GCQA 3L9PA 4M8TA 4NK9A 4FKSA 4LV5A 4W4VA 3WI6A 4QMQA 3RHXA 3AGLA 4KINA 4NJDA 4XMOA 4EHVA 3VUGA 4LGDA 3U4UA 1ZZ2A 2WIPA 3KRRA 5A54A 2OGVA 4EHGA 5HO7A 3K3IA 2PVFA 4F08A 4WD5A 1LEWA 1T45A 1WMKA 1DM2A 3EOCA 4PPCA 3UE4A 3I0OA 1IG1A 4KIKB 3R7YA 3VUIA 3ZRMA 4OAVB 3HX4A 4DH5A 3S1HA 4M97A 2X0GA 2A27A 4FKWA 4KBCA 5BMSA 1ST4A 1U59A 3WBLA 4NU1A 2XK9A 3EFJA 4Q9SA 2W0JA 3KFAA 4IACA 5EFQA 4IE9A 4GEOA 3BWJA 2W7XA 3CSVA 3C4CA 3DB6A 2ITOA 4YJNA 4HVGA 3CCNA 1IAHA 3OY1A 1U5QA 2YCQA 3EFWA 5HE1A 4D1SA 2JIUA 5LJJA 1G8AA 3PRIA 2F4JA 1H07A 2IVSA 2H34A 5K3YA 1O9UA 3WF9A 3RM6A 4OTWA 4DH8A 2QOKA 4MD8E 2JKKA 3NWWA 4O84A 2Y7JA 2VWWA 1UWJA 2EXCX 3FDNA 2VX3A 3QQJA 4JI9A 2XK7A 3POOA 4IJ9A 4JAIA 3ZO1A 3QRUA 3JYAA 4BCNA 3KXGA 4DHFA 5AP5A 4QT1A 2R0UA 2QO2A 2WHBA 4JG7A 4PP7A 2XP2A 1PXNA 1GAGA 4FC0A 3W2SA 5CZIA 5AV3A 3HDNA 5B2MA 5F94A 4M7IA 5CAVA 4G3GA 4FTQA 4O4DA 4OTDA 2GFCA 5L3AA 3QRIA 3DBCA 5E8XA 2GDOA 4RWKA 3HGKA 4I4FA 2IPXA 4X3FC 5ANOA 4APCA 5DNRA 4EWQA 3IDCA 4B0GA 2Y4IB 3OS3A 3ROYA 2VTIA 2XIXA 3CC6A 3FLQA 5AIRA 2CJMA 3HV4A 4TNBA 3BE9A 4UZDA 3DLZA 1NVRA 3WF5A 4D58A 1UNLA 5K0KA 4MXYA 4X3JA 4LL5A 5FD2A 3QRTA 5IQFA 4YMJA 2X0QA 2XJ2A 2UZDA 4O0TA 4BCQA 3MFRA 3PG1A 1Q8UA 4FKRA 4MXXA 4RVMA 2J0JA 5J5SA 3DDPA 1QPJA 4EKKA 5DVRA 4CVAA 3D2KA 2YM7A 3TEIA 4KS7A 1JKLA 5B0XA 3QTZA 2UW5A 3AD4A 3FYJX 3ENMA 3UDZA 2Z7QA 3LFEA 4TWCA 4YHFA 3W10A 3BYMA 3O96A 2R3FA 4MD9E 3MY0A 3HVCA 3V8WA 4IM2A 3HRBA 4LUEA 5EG3A 4AN2A 4K8AA 3GQLA 4IAIA 2IN6A 2ETRA 4XX9A 4A4XA 2QHNA 3HUCA 3B8RA 3MIYA 3PPJA 4PV0A 4U44A 1PW2A 3MJ1A 5IA5A 5C26A 3COIA 1KUTA 5IQGA 4ASEA 1OGUA 3R1SA 2VAGA 2XF0A 3VW6A 4NIFB 5AR7A 3Q2MA 4YZMA 4I4EA 3R01A 3MY1A 1OIQA 1OKWA 4BIDA 2EB3A 3G5DA 2WTIA 1WVXA 3Q04A 4CMUA 2CDZA 3KIOC 5KZIA 3FLWA 4MVFA 1OL1A 4NZWB 4C2WA 2CLXA 4JS8A 1F3MC 3COKA 4AN3A 2C6KA 4X2NA 4M15A 2GTMA 4AW1A 4D2RA 3ET7A 1TQIA 2WD1A 5CASA 1LPUA 4RC3A 4O7YA 2ERKA 3C4EA 4E73A 3OXTA 4P7EA 4OBOA 3VBYA 4DDIA 5CANA 1W82A 4USEA 1FOTA 4YJUA 2OKRA 3NW7A 4AZEA 2PYWA 4ZTMA 2RG6A 3IW7A 3O8PA 3ORIA 1TVOA 2YIXA 3R1QA 1XH8A 4CZYB 4YTFA 3ORXA 5HI2A 5CALA 2UZOA 1IAJA 4L45A 3E92A 4LUDA 5DPVA 1ZAOA 2Z2WA 1W2FA 5HCZA 3CE3A 2V0DA 3L8PA 5HE3A 4IQ6A 5GZ9A 5T6KA 2WELA 1U5RA 4XHKB 3ZBXA 2OWBA 2XKDA 3C13A 4EOJA 3HNGA 4O82A 2JIIA 2VTQA 1JSUA 2BDJA 4JRVA 3RJCA 2WMAA 3GU4A 4FT9A 4AXCA 4DFUA 3ZC5A 1YWRA 4EHZA 3ORMA 3R22A 3UC3A 3VWAA 2NRYA 1XWSA 2VWVA 3I5ZA 4G3CA 4YZDA 2OW3A 3E8NA 4ENYA 1PF8A 5JGDA 3JR1A 2HY0A 2JGZA 3VJOA 3RCJA 1SNXA 3G6GA 4IDTA 5AA8A 3PUPA 3I60A 4XV1A 4EYJA 3ZXTA 2QR8A 4XV3A 4IWOA 5HTBA 2SRCA 1V0OA 4PMMA 1SZMA 1Q4LA 3COMA 3DTCA 4CG9A 4JR3A 3MSSA 4EUTA 3KC3A 3R8VA 3W32A 2JAMA 3F5GA 4FZ7A 1A06A 3UJGA 4HGLA 5AV2A 4DEGA 4L3LA 5ETCA 3MVLA 3VS0A 1O6KA 5CSPA 3Q6WA 4R7IA 4MXOA 3KRXA 2XNEA 4USDA 2Z7SA 2RG5A 3KMUA 2ZB0A 1YXSA 4M84A 4F7LA 5IA0A 4C36A 3QLGA 3ODZX 3VBQA 3UDTA 5HG8A 3KXNA 2R3PA 1XH4A 2XKCA 4JQEA 3LXKA 3Q60A 5CQUA 3VUHA 4XNEA 5LWNA 4X2JA 4DG3E 3OTVA 2C30A 4BDBA 5D9HA 4FUXA 2J51A 4GT4A 1KE6A 1ZRZA 5FWKK 5HO8A 4BDIA 4BBFA 4D2SA 2IG7A 5EM8A 2WMUA 2YZAA 4FIIA 4EH6A 5IZFA 3O50A 3PE2A 4H58A 3Q4ZA 4FTKA 4XLIA 1Q62A 1XMLA 2UZUE 3OBJA 3H9OA 3QXOA 3R21A 4O0VA 2ETKA 1SNUA 4EH7A 4V04A 2ZDUA 2OXXA 4XP2A 5DWRA 3BLAA 2VTHA 3MN3A 2HAKA 3KF7A 2VTTA 4TXCA 1M7NA 3BLHA 4C34A 3VN9A 4CRLA 5CAOA 1H0VA 3QALE 5J7HA 1LP4A 1WVWA 4DINA 5HTIA 3LM5A 2CN5A 2VWUA 4JG6A 4RIOA 4TL0A 1TKIA 3ZZWA 2PSQA 4MKCA 5AR8A 5EDQA 5KMJA 3TM0A 3AC8A 3R8ZA 4FV9A 4KBKA 2UVZA 4RC4A 4F70A 4D9TA 5J87A 5B2LA 3SHEA 5ACBC 3WYXA 2VRXA 4GL9A 2ITXA 2CSNA 3GCPA 3NCZA 3O51A 4FTRA 1BUHA 5E8TA 3ROCA 4BDEA 4JX7A 3EN5A 1JPAA 2E9UA 1W8CA 2PU8A 2JC6A 4YPDA 5L8LA 1JSTA 1Y8GA 2XAOA 2B9JA 5BYLA 1YOMA 2RFSA 4EK8A 1Q8YA 4UN0C 4U7ZA 4D2PA 5HICA 4LM5A 3DBEA 3E7VA 3L9NA 4O4CA 5E8UA 3GVUA 2YCSA 4DCAA 2P55A 2ZOQA 3P5KA 1UU9A 4LFIA 1M14A 2NNWB 5CY3A 2WQOA 3P86A 3V6RA 4D1ZA 4QQ5A 2VTOA 4FBXA 5KMOA 4PUZA 1H01A 2GHMA 3I7CA 4AZWA 4PPBA 2XS0A 2Y4PA 4RT7A 5E9EA