3P0MA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Fragment based drug design on PKA
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p0mA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p0mA02
2XKCA 5D10A 3S0OA 3ANQA 1V1KA 3G5DA 4IB0A 3RP9A 1Z9XA 2W7XA 1OB3A 3R1QA 3QQLA 4A9SA 3P78A 5L4QA 1KOBA 3TKIA 4G1WA 2JDTA 4ZTNA 2XJ2A 2VAGA 3DJ7A 5BUEA 3EFJA 3PRIA 4HOKA 4EC8A 4ASZA 4C4EA 3UG1A 4IH8A 3LFEA 5DI1A 1JWHA 3QHRA 3SOAA 3KFAA 4RX9A 3FPQA 2VTIA 1S9JA 4O0VA 4IX4A 5E8SA 4MEDA 3I4BA 4PPCA 4EUUA 2WMXA 4I6FA 5FLFA 3C4EA 2C1AA 2XIXA 3Q96A 1KE5A 4IZ5A 4P90A 4F1MA 4EK8A 2P2IA 3LMHA 1RE8A 2R9SA 3MFSA 3TDWA 2FO0A 2ITYA 4LL5A 4CZUA 1PKDA 4EH8A 4WG4A 1IA9A 1OITA 5HX8A 3UOHA 4Y83A 3G9NA 3PYYA 4TWOA 4X2GA 4GSBA 4XBRA 3N4TA 3DNDA 4QTBA 4ZTLA 4G3GA 4YTIA 4FYOA 4MF1A 4AE6A 1DAWA 1KV1A 3BKBA 3FKNA 4IWQA 4AZTA 2Z7LA 3W10A 1NVSA 2YM8A 3VS4A 4OBQA 3UO5A 3CBLA 2C6LA 4LM5A 2WEIA 4AT5A 3A8WA 3AXWA 4CMUA 3AC8A 3BLRA 3IQ7A 4NEUA 4JDHA 1KE9A 4PTCA 3DKFA 4R5SA 3L8XA 3HV7A 1U4DA 3SD0A 1XR1A 4ACHA 2W05A 5KX8A 5IMXA 4JG6A 3K5VA 2R3MA 5CSXA 1AD5A 3NW5A 1Q8UA 3R7OA 3CD8A 4BIDA 1H1WA 4RIXA 1OBGA 3NW7A 4FZAB 3UOKA 4RJ6A 5FWKK 3BX5A 3ZU7A 1G3NA 1YXSA 3LFAA 2B9FA 4FK3A 1XO2B 1RDQE 2IO6A 4KSPA 4YLLA 2YIRA 2QOHA 2WO6A 2P3GX 4KUJA 4AA0A 3AC1A 3UYTA 3HMPA 1VYZA 4G3FA 1H25A 1ZMVA 3DBFA 4YZCA 1PMNA 3Q3BA 3TNHA 5KMKA 2JD5A 3EQCA 1NVQA 3LHJA 4RIOA 4X7QA 3KKVA 3R7YA 3ZUTA 4D28A 2DYLA 3W1FA 2VTHA 5CSWA 3DKOA 4IJPA 4JBPA 4DN5A 4L3LA 3S1HA 2VWIA 4RIXB 2IZRA 4I93A 3TI1A 4DH8A 3RWQA 2FYSA 5M55A 3PXYA 4J8MA 5LVNA 4DTBA 4NK9A 2IN6A 4ZXTA 4EJNA 2J0KA 2C5OA 5FTGA 1K9AA 2P33A 2CKPA 2Z7SA 4FKWA 4RGJA 2C68A 5EK7A 3EZRA 4I5PA 4A06A 3RPYA 4FNXA 1LUFA 2WFYA 2YACA 3PWYA 2R3IA 2WGJA 4IM2A 4L7SA 4QMTA 3L8VA 1JBPE 1PF8A 3CIKA 3PY3A 5AA8A 2ZM1A 1GIJA 4I20A 5CZIA 4O1PA 5HE0A 5AP1A 4PF4A 4EH4A 3G9LX 4BI0A 3OXTA 2CN8A 4PNIA 3F3VA 5I5ZA 1F5QA 3HUCA 3F5PA 4YURA 5A14A 3AG9A 1H00A 5HGIA 1BKXA 3UPXA 3KGAA 5HLWA 4J7BA 2OLCA 4I4EA 4FIFA 2B1PA 2OJFE 2WB8A 4F9AA 4J8NA 4QMVA 4C3PA 1NVRA 4FIEA 3MA3A 4EZ3A 4BN1A 2GTMA 3OT8A 4WD5A 3IGGA 2XK7A 4UMQA 4YLKA 5HLPA 3FWQA 4FKSA 4GRBA 3DFCB 4HNFA 2B0QA 1OKYA 3IOKA 3RK7A 5K5NA 4DGOA 4AZEA 1P2AA 2V62A 3LM0A 2J50A 2DS1A 3QD2B 4BDJA 1PXPA 2VWVA 3A7JA 2UW5A 5CXHA 5DT0A 2WQEA 3TJDA 5LJJA 2QU6A 1ZYSA 2VTSA 3R7GA 4L43A 3NEWA 1Z5MA 5ANDA 1YQJA 4XHKB 3F88A 3G2FA 4QMMA 2VWYA 3R8ZA 4IEBA 1JLUE 4M0ZA 1R3CA 5JRSA 4IC8A 3Q6WA 5CAPA 4DE4A 4HYIA 4ZSAA 2GSFA 3ZZEA 3BYVA 3NNUA 1KOAA 2WIHA 4YJVA 4AN9A 4YO4A 4CCUA 3CY3A 3HV4A 3O23A 4CZTA 3HMMA 3V8WA 4QPMA 5L8LA 3EN4A 5G6VA 3R9NA 2J5EA 2VTQA 5EFQA 5CT7A 3G0EA 4QYFA 4NCTC 5CANA 3VO3A 2ZM3A 4FEWA 4O21A 3FXWA 5IDNA 3ZSHA 3FC1X 4BIEA 3DS6A 4D2WA 3GB2A 3R22A 4TKSA 3F82A 4ACMA 2UZOA 4BDDA 4RLKA 1UWJA 4Z7HA 3UQFA 3N4VA 5HU9A 4D2VA 5GJGA 3IW4A 2FSOX 4LQMA 5D7AA 3AQVA 5BUJA 2Y4PA 4CMOA 2YJSA 4Q5EA 3V3VA 3P4KA 2NRYA 1OUKA 3QUEA 2X2LA 3BPRA 4IAAA 2CNVA 2BILB 3HV3A 5TOZA 2RFDA 4JQ7A 3LIJA 1Q61A 2OF2A 1ATPE 1ZOHA 3QTZA 5E8YA 2Y9QA 4R3PA 4EKLA 2JBPA 4IXPA 4I4FA 4OGRA 3SC1A 3RVGA 4W4XA 1M2PA 2GNGA 1OZ1A 3GU6A 4FL2A 3T8OA 3V6SA 3VS2A 2XNEA 2IW9A 4AFJA 4W4VA 2F9GA 3GEQA 3VUKA 4F9CA 5CXZA 5AV3A 1XJDA 2VTNA 2XNNA 3OG7A 3KXXA 4FV1A 4C4JA 4FIHA 4RQVA 5EQPA 2Y8OA 3GOPA 5AV1A 2CN5A 4PWNA 4IAKA 3ZRLA 3MA6A 4OUCA 3RPOA 3ZO3A 3W16A 4MNFA 5IEXA 4PQNA 5BPYA 2CKQA 3HV6A 4DCEA 5KE0A 4RA4A 4G3DA 4WBOA 5AUWA 3UO6A 2F7XE 3ZUVA 1WMKA 5JGAA 4QNYA 1R0PA 1MQ4A 1GZOA 3UDBA 4U7ZA 4DFXE 4QO9A 5JK3A 4ZSGA 5HCZA 4YJTA 5DPVA 2YAAA 3NUUA 3RHKA 4R3RA 3UODA 1XH6A 3FMLA 3DGKA 4UXQA 3QU0A 4RFYA 5E8UA 2PVKA 3R1SA 1L8TA 1X8BA 1QL6A 2VWBA 4FT3A 3BYSA 3QC4A 3QRTA 4FKLA 5CI6A 3RPRA 3JXWA 1H07A 1PMUA 3HECA 1V0BA 4N70A 3UE4A 2HWPA 2WQBA 3FBVA 3UNZA 4D5KA 3H0ZA 1MQBA 5L6WL 3FLZA 3SG9A 4TRLA 5J79A 2OBJA 4JVGA 1PXJA 4FMQA 3O7LB 2RG6A 2BZKB 5HVKA 2I7QA 3LLAA 1Z57A 3KC3A 5F4NA 3MB6A 2JDOA 3QQFA 3DLZA 4D58A 3QXOA 4EOKA 1U5QA 3FLNC 4AF3A 3BWJA 3OBGA 1ZARA 2UW7A 3AOXA 5DNRA 4EOLA 3B8RA 5T6KA 4RJ7A 4MXYA 4EZ7A 3QRIA 2J0MB 1OUYA 4MAOA 5FRIA 4RVMA 3FMEA 3QX2A 4H3BA 3C4ZA 3PJ2A 3TXOA 5FQDC 3LQ3A 3G90X 5IZFA 2HW7A 4RC2A 4AA5A 2XNGA 3F6XA 4R8QA 4L44A 4BTKA 3S3IA 3L8SA 2ZV8A 2P2HA 2X9FA 2HZ4A 4RWKA 4EI4A 3FMNA 4D1ZA 5IH5A 3BQRA 3MFTA 4GT4A 4U5JA 4LRJA 4XOZA 4B8MA 5JMSA 5K5XA 5GNKA 5E4HA 2HY81 4BDKA 2PZYA 3F69A 4ERWA 5H9BA 3QTRA 2IWIA 4GYGA 2VRXA 3M11A 1WCCA 2JBOA 4FVRA 2BIKB 3AD4A 3HA6A 1H1QA 4C4FA 5DR6A 4GVAA 3BCEA 3BI6A 3H9OA 2ACXA 4ITJA 3VQHA 4A9RA 4CYJA 5EI6A 2X8IA 5C01A 3R8MA 3S2PA 3FZOA 3CTJA 2R3LA 2IJMA 3JUHA 4B9DA 5IQDA 2J6MA 2H6DA 4DG0E 3VQUA 1JAMA 3VBWA 4NM5A 3NIZA 2XMYA 5DFPA 4BGGA 4Q9ZA 5LMKC 3U6JA 3OBJA 1WBSA 3HP2A 2R5TA 4FODA 2V0DA 4RC4A 4ZSLA 1HOWA 3ROCA 4BCFA 2QD9A 3GCUA 3JR1A 3QTQA 3NNVA 3QZHA 3COMA 4IB3A 3MN3A 4NFNA 4WNMA 1BLXA 3HDMA 4MYGA 5EM5A 3KRXA 3T9IA 1OI9A 2VWUA 4YU2A 4FV4A 4JDIA 5AWMA 4FEUA 3ATSA 5HD4A 2PMIA 2YM5A 2QOIA 4MD9E 1K3AA 3KU2A 2UZVA 3VULA 4O7SA 4ZY6A 3A4PA 2Y7JA 4HGLA 1Y91A 3ORXA 3C0GA 3ZDUA 4HVIA 3SW4A 1YWVA 4C37A 4USDA 4XG6A 2W5BA 5LVPA 5AADA 2XA4A 2X39A 3ORTA 3PWDA 2PMNX 3V8SA 2P4IA 3LFSA 4DG3E 5CAUA 4EHZA 4F6WA 4PL4A 4FNZA 3D94A 5JEBA 3LFBA 5L6OA 3B2WA 2XK4A 4RZWA 3S95A 5CEMA 2E9UA 2I0EA 2V7AA 4BCOA 3I7CA 5KKRC 1BMKA 4ZIMA 3LFDA 3ZOSA 2YAKA 1GY3A 3ZLYA 4L46A 4J97A 4W8EA 1IA8A 3M42A 1YRPA 5I0BA 5EI2A 3BEGA 3DAJA 3TZ8A 2J0LA 5C03A 4BCQA 2BRMA 4M66A 4W4WA 4DEEA 5BMSA 2UVZA 3PP1A 3W2PA 5CSHA 4FKUA 4EK6A 1YOLA 4H3PA 2EUFB 4XP2A 2XKEA 1YDRE 5KZ0A 5DHJA 3SLSA 3W2CA 1TVOA 2QOQA 4Y95A 1YVJA 3VF9A 4J99A 3FI2A 3WF9A 5EQYA 4EQCA 2QC6A 4C7TA 4QOXA 3LXKA 3W8LA 2KTYA 3ORNA 4AT3A 2GHGA 2UW3A 3GNIB 2PE2A 5KBQA 3TIZA 3H9FA 5L2IA 4FKGA 1E1XA 2WMSA 4C57A 4QQJA 5HOAA 2Y4IC 3FDNA 1ZYDA 4FV5A 4G34A 5CF4A 3B2TA 3FV8A 4BDAA 4HVDA 4YJSA 5J87A 4EORA 1J1CA 4LV8A 2DWBA 3FSFA 4EUTA 1R78A 1SNUA 5AIRA 4BDIA 2XJ1A 1LEWA 2ZMCA 3DZOA 4GFMA 5E1SA 4YTCA 3FY0A 1L3RE 4FV0A 2R3QA 4FKOA 3O0GA 2BRGA 4EH5A 1U5RA 4C61A 3FPMA 5HD7A 1STCE 3MVHA 2WD1A 3QKLA 4JAIA 4TWPA 3QQGA 4PMTA 1SM2A 5CNNA 2X81A 3FMKA 5CTPA 5AP3A 5IUIA 4AXAA 4QQ5A 1DM2A 5AR2A 3FKLA 3ZC6A 5CT0A 1OL6A 3JVSA 3Q4TA 1FOTA 4FV3A 5DEWA 3VUIA 2BKKA 3UP7A 5E92A 3OROA 2PUPA 3BV3A 3DQWA 2CGWA 4FKQA 3U6HA 3LJ0A 3ZO2A 4N6ZA 4U6RA 3PIXA 4C4IA 2QO2A 4A9UA 5HO6A 3MFUA 4YBJA 4QP2A 5ACBC 3MIYA 5FBNC 4R7IA 4D4YA 3NNXA 1ZRZA 3QCYA 3UZPA 3A7FA 3P08A 5K3YA 3PRFA 3Q4CA 5ANGA 3HRBA 3ZLXA 5DA3A 3HAMA 4GCJA 2Q0BA 3R83A 4MCVA 4DINA 5FEQA 3GU5A 5JZJA 4U3ZA 3ORLA 5LARA 3W18A 3DLSA 2E2BA 1R0EA 2A1AB 2W96B 2R3OA 3ZXTA 4UYAA 3KMMA 3I6UA 3RPSA 5JFSA 5IU2A 5CWZA 2C6TA 3GC8A 2P55A 4K2RA 1J7IA 3VIDA 2VU3A 5E8WA 3QALE 4P2KA 3O71A 3BELA 4FZ7A 2WXVA 5IDPA 2FSLX 4NKSA 2WMBA 4QYEA 5BYLA 4ZTSA 3MDYA 4CLJA 2WQOA 2QOCA 4GUEA 4PDSA 4BWXA 4EOIA 3GP0A 4J95A 3WZJA 2UV2A 4LGGA 3QTUA 2UVXA 4UMTA 4J98A 4KD1A 4BBFA 4LOPA 2C0TA 4S2ZA 5DVRA 4Z7GA 3R30A 5DT4A 2A27A 4XLIA 4BI1A 3TNPC 3KK9A 3BHYA 5HG5A 1DI8A 4CTCA 5HTIA 2HY0A 3G0FA 4FSMA 4O0YA 4FKJA 5ETFA 3VS0A 2B53A 3ZBXA 4BZOA 2ITPA 4IZYA 4HPTE 4PY1A 4XX9A 5M06A 4YTFA 3E63A 3EMGA 2J90A 2QNJA 4J52A 3W55A 1A9UA 4R5YA 3DKGA 4FGRA 3PFQA 4CKJA 2PMLX 1XH9A 2WTVA 2X7FA 3LCDA 3OWPA 3PUPA 4UWYA 5CAVA 3R8PA 4BHNA 2OJGA 3ATTA 2G15A 4FG9A 3E3PA 5CU4A 4O84A 1P5EA 2PHKA 5EYCA 3KY2A 2WTKC 5K0KA 1FQ1B 4YPSA 5E1EA 3UYSA 2F4JA 4IDTA 2OI4X 1G8SA 5IQCA 1UNHA 4F6SA 5M57A 5DYJA 4ANLA 4XOYA 3W2OA 4IX5A 3OVVA 1XH8A 1YXVA 4MQ1A 5IA3A 2XEYA 1PXOA 2Z60A 5DRBA 3EKNA 2EB2A 3NUYA 4FSQA 4OLIA 3T3VA 2F49A 5JGBA 4G5JA 5D1JA 1PY5A 1VZOA 3V01A 4BL1A 4FUXA 5AR5A 2IZTA 4OBOA 5J5SA 3F3WA 1U59A 4FTUA 2VTTA 3IW6A 4BTMA 5A6NA 2R3HA 3QF9A 4FNWA 4U41A 3ZUUA 4RZVA 3QQJA 4E4LA 5I3OA 3EQFA 2JDRA 3P7CA 4WG5A 2C3JA 2G01A 3FY2A 4YHJA 5J1VA 5BMMA 1UU8A 4HPUE 5IQAA 2F7EE 5LVLA 4EZ5A 2R7IA 3L9PA 3GCPA 2UZNA 3OEZA 4UV0A 4RJ8A 3ZLWA 4FSNA 1TQIA 3PPKA 2PVRA 5KMIA 2OH0E 3PPZA 4CFXA 4O82A 4KBAA 4RMZA 5E8VA 2E9NA 3UIMA 4LGHA 3OWLA 2UZTA 4QYGA 3ODYX 1UU9A 4O86A 3GC0A 3TZMA 3HAVA 4MQ2A 2ITQA 3ZFYA 3VS1A 1WBPA 2CLXA 2YWPA 3A61A 4I6QA 4JNWA 4PL5A 4ZLZA 3COKA 4O2ZA 5IQBA 3CY2A 3FZRA 1QMZA 2EXCX 5EDQA 2ZV2A 1HCLA 3KXGA 4R7HA 5H2UA 2C5XA 2YZLA 4ONAA 3EB0A 3KXZA 3KF4A 5IPJA 4TYHA 4KIOA 2QR8A 3LE6A 4FF8A 3ALNA 5AUZA 2C3LA 4YZ9A 4AOJA 5CALA 1CDKA 2RIOA 5C4LA 4FIGA 4FSRA 4K11A 4MNEA 4KB8A 1M17A 1YDSE 2OH4A 5L2QA 5HX6A 2VWZA 1UU7A 2XRUA 3NAYA 5J9ZA 1M7NA 3P7BA 3FL4A 3NX8A 4RWLA 4IACA 3U9NA 2QOBA 3QLFA 4AGWA 4U43A 1SVEA 2PZRA 4KAOA 4GYIA 4MD8E 5FP5A 2RSVA 3QCSA 1B38A 3NWWA 4TYHB 5CU6A 5IEVA 3VHEA 4FUYA 2BMCA 5IG1A 2O5KA 4IMYA 4R6VA 4PNKA 3BYOA 4MNEB 4NU1A 4IAIA 3SHEA 3ZC5A 2WTWA 5GIOE 4G6OA 2BDWA 5AM7A 3LQ8A 2ITUA 3CD3A 5LQFA 2B9JA 3OXIA 5DR2A 4E4XA 1WZYA 1PXMA 1YOMA 4YNEA 5HCXA 4RFZA 4BYIA 3QQKA 4P5QA 3CPBA 2QCSA 4D0XA 5CU0A 3G33A 1H27A 3KRLA 2PE0A 5FEEA 3QRUA 3P79A 1LEZA 4FTIA 1W0XC 2EXMA 2BCJA 1OPLA 1W8CA 5DEYA 5B0XA 2PZ5A 3LCOA 4KS7A 1FMOE 1GZNA 3VBXA 1JSTA 3UMWA 4I3ZA 5LCKA 2EVAA 5CEQA 3SOCA 2VUWA 4M69A 4DBXA 3G6GA 3ORPA 1FGIA 3OOMA 3QA8A 5CF5A 4CMTA 4AN3A 5HO8A 4R1YA 2FGIA 3NUAA 4UN0C 1KE6A 4R77A 1F0QA 2YDJA 5EW3A 3AMAA 1LR4A 3F9NA 4YNOA 3PVGA 4C02A 4C3FA 1OMWA 3V5JA 4O83A 1IASA 5AJQA 2ONLA 5BVWA 2UZLA 4NUSA 4DGMA 4EC9A 3Q04A 4LFIA 3CGOA 2VWWA 4IVDA 4DEBA 2VTRA 1UKHA 1JOWB 1FINA 2PVNA 3D4QA 3DZQA 3NNWA 3QCQA 4M69B 5AP7A 3R7IA 3SQQA 4AW0A 1WVXA 2QLUA 2V22A 1CTPE 3UVQA 1WVYA 1M14A 2HENA 4WSYA 4Y5HA 4EHVA 2OFVA 3MY0A 2WHBA 3PIZA 3R1NA 4UMPA 2BAJA 3RK9A 4UWBA 3WYXA 1QPJA 1M2RA 4QTAA 4ZTMA 4FKTA 1K2PA 4BTJA 4TPTA 2QG7A 3SXSA 4ANBA 1KE7A 1EH4A 4CYIA 4IM3A 3IDBA 3HUBA 2QODA 4L45A 2W9ZB 4JBOA 2F57A 1IG1A 3ULIA 4TYGA 4UMRA 4YJNA 2X0GA 3GU4A 4FR4A 3PLAE 4G16A 2PTKA 3NUNA 5JQ8A 4G6NA 2XP2A 3LXNA 4TWNA 5CAOA 4E1ZA 3R04A 3TG1A 1MRYA 3Q53A 4GFGA 4ZSEA 4X6QC 3RALA 5LXMA 2VD5A 2DUVA 3FJQE 5AP4A 3QYWA 3UIBA 4QMYA 4KKGA 3MPAA 3BWFA 4BCJA 4PV0A 3HGKA 2YABA 3CKXA 3IONA 2WMWA 1YDTE 3ITZA 5M09A 3QHWA 2HOGA 3FZSA 4O7RA 2QR7A 2NP8A 2VNYA 4O0XA 3F5XA 1AGWA 3ELJA 4PL3A 5I3RA 2W5AA 5DRDA 4CFUA 3E93A 3UVRA 3TDVA 4G3EA 4QMZA 1WBNA 3JVRA 3OWJA 4AFEA 3F3ZA 4L7FA 5J7BA 2FB8A 2WNTA 4E3CA 3LCSA 4RJ5A 4Y5QA 4LOOA 2IVVA 5AUXA 3TV4A 1RW8A 3VS5A 5CF6A 5EI8A 3Q2JA 2XBJA 2BDFA 1OKVA 2R3JA 2R64A 2ITWA 3HVCA 4FTLA 3T9TA 5HBJA 2E9VA 4O7NA 2BHHA 3MV5A 4JIAA 4AW5A 4E7WA 1ZLTA 4L01A 2A19B 4RLLA 3VUDA 4M67A 1Q8YA 3VUMA 4A7CA 5IMEA 1YXUA 4DH5A 2W1GA 4YMJA 2OIQA 4U45A 4NL0A 5BVFA 2B52A 3FZ1A 1FBNA 1YWRA 4LMUA 3WF6A 4EH7A 4CRLA 1W83A 2OF4A 2QKWB 4HVSA 4FX3A 3HRCA 4HVGA 3U6IA 1F3MC 5EM8A 1QPEA 2ONLC 3OD6X 4RBLA 3ZEWA 4FZFB 3CTHA 5ICPA 3JY0A 4ITIA 4O0TA 5C27A 5BYYA 3EQBA 4L3PA 2HELA 4L68A 3PXZA 4GEOA 4TW9A 5GZ9A 3CSVA 3HYHA 3ZONA 2ZVAA 3QD0A 2BDJA 4DGLC 3LFQA 4MX9A 3B8QA 4D4RA 3GT8A 5A46A 2JITA 4AQCA 4FSUA 3EOCA 1GJOA 1Q41A 3HMNA 5I9XA 3BGQA 4D9UA 3DDQA 5I9YA 4ORKA 4M84A 4QMLA 1Q8ZA 4W9WA 5HKMA 4IX6A 3EQHA 2R7BA 4MKCA 4OTGA 1JVPP 4RRVA 4ACDA 3UZRA 3QC9A 5J5TA 2ETKA 3V8TA 5AUUA 1CSNA 1O6LA 5L3AA 3GCVA 5TKDA 5EW8A 2GDOA 3JY9A 3BHUA 3PXKA 5HBHA 5LOHA 1W7HA 3MJ2A 3QQUA 4IE9A 5CQUA 5HTBA 3TT0A 5A4LA 5DH3A 3U4UA 4WNKA 3SW7A 3S00A 5AP0A 2J5FA 4FG7A 4WA9A 4DFLA 3ENHA 4CSVA 4WHZA 2P0CA 1JQHA 5E9EA 4X3FA 4UBAA 3UGCA 3OY1A 2JKQA 1SVHA 2J2IB 3EH9A 5JKGA 4QMNA 1J7LA 2QG5A 3BGZA 5GJDA 3R8UA 4B99A 2A0CX 4GS6A 2ETMA 2VX1A 2YEXA 3ERKA 3MWUA 2AC5A 2JC6A 4Y73A 4PPAA 5IQIA 3KULA 3HL7A 4FYNA 4FTAA 5AMNA 4RA5A 4YZBA 5FP6A 2I0VA 4EK4A 3FQSA 5JZNA 2XK9A 3G6HA 2GQRA 3NLBA 3A7GA 4EH3A 3CXWA 4IZ7A 2BTSA 1ZZLA 2R0IA 3D83A 4EOJA 2IVSA 1H28A 2XK8A 3G15A 2W17A 2C6KA 2YISA 4K9YA 2I0HA 5AUYA 4NJ3A 2HAKA 4JRVA 5AX3A 3D7TA 3VJOA 4ALUA 3PA5A 4BCNA 3DKCA 1WFCA 2XUUA 2Y6OA 5AV4A 5IQEA 4X3FB 4HCTA 3DQXA 4NFMA 3O17A 3UP2A 3VBQA 4MWIA 3NIEA 3VS3A 4ANSA 3M2WA 2XIYA 4E4NA 4FVPA 2IVUA 3KULB 4A07A 1T46A 2O2UA 3EFKA 3FLQA 3W33A 3R9RA 3CPCA 4RX8A 4BRXA 2J0IA 4FA2A 2YA9A 3PA4A 2W1EA 2C30A 4QPAA 3KN6A 1ZYLA 4KIQA 3D7TB 4DFNA 4W8DA 3TACA 3E5AA 2G2HA 3MPTA 4XH6A 2Z8CA 4GVJA 4QT1A 4XG2A 5HQ0A 1FPUA 4L8MA 4XV1A 4BGQA 1Y57A 4C3RA 2PUUA 3MH0A 4XP0A 2FVDA 2BKZA 4D4SA 4DTKA 4F7JA 3V04A 4GK2A 5IA1A 2CKEA 4XUFA 3VVHA 3VUGA 2GNFA 2WELA 4I6BA 3C13A 3GI3A 3O7LD 2WMTA 3AC2A 5AIKA 4AU8A 3CP9A 5F9EA 1WAKA 3A60A 5KHXA 4HCUA 4ALWA 3ACKA 4J53A 2GTNA 4JX3A 4EWQA 5TT7A 4GMYA 3IDPA 4ZZMA 4GKHA 3LJ1A 1UVRA 4E6CA 4UMUA 3KCKA 5F95A 1OECA 5J8IA 5L2WA 4WUAA 2QVSE 2XYUA 4LGDA 2ZYBA 3NYOA 2PVLA 4AW2A 4E93A 4ZY5A 1E9HA 4B0GA 3O2MA 4AZFA 4DH1A 2GMXA 3NYVA 4APPA 3A7HA 3AT2A 2HZ0A 3CQEA 1M7QA 3NUPA 4BWPA 4BYJA 2QOKA 4TY1A 3HKOA 3RM7A 3I5NA 3PJ1A 4GK3A 4P5ZA 3FSKA 5AAFA 4AG8A 4JDJA 5HZNA 5KMMA 3QTIA 2F2UA 4WSQA 3EL7A 3ORKA 3R21A 5FDXA 3ID6C 4M8TA 4X3FC 4FL3A 5CQWA 4FV9A 4BVUA 2W5HA 3RCJA 1PW2A 3GFEA 4ZEGA 4GL9A 5AX9A 4KS8A 1OKZA 3EN7A 2YHVA 4RX5A 2JGZA 4O0RA 3O8PA 4BDCA 4O22A 1IRKA 5EH0A 3TZ7A 4OTDA 4U97A 4GG5A 1FVRA 2YCSA 3OCSA 3E8DA 3QD3A 4CZYB 2VO0A 3V5WA 1OIRA 2OZAA 3II5A 4IX3A 5H8EA 1VR2A 2BROA 2OW3A 2IZSA 3U51A 4IJ9A 2SRCA 2BZJA 3AMBA 3R02A 3VBYA 4YUQA 2W4OA 4GIIA 4JQ8A 5KMOA 4D55A 5HNIX 5BX0A 5C9CA 4IVBA 3JPVA 4X2NA 3ZM4A 2XM8A 4G3CA 3KXNA 3O51A 2GNLA 3AD6A 4MD7E 4V01A 3MH2A 2VGOA 3QWJA 5I9UA 4EQMA 1Q8TA 1KE8A 1MRVA 2YM6A 3C4XA 3EJ1A 5I9WA 3QAME 5B7VA 2BVAA 2OZAB 3NGAA 4GU6A 4II5A 3R7VA 5K4JA 3OT3A 1OKWA 5H8BA 3RWPA 4XYFA 3R01A 2WMAA 4FT9A 4AA4A 3FMHA 2HXLA 4IQ6A 2QOOA 4L6QA 2I1MA 4I24A 4IANA 2ZB0A 3E8EA 4IB1A 2Q83A 3EWHA 3L9LA 1U46A 5FTQA 2JIIA 3KRWA 3BGPA 3K5UA 5DLSA 4I0RA 3C4CA 4AZWA 4EEVA 5HVYA 3VNTA 2W1ZA 2C1BA 2GU8A 3BU5A 4N57A 2R3NA 4BDGA 4C2VA 3R8VA 3F5UA 4DG2E 2NO3A 3K3JA 2QHMA 1XHAA 1GZKA 3GU8A 3I7BA 3E64A 2JKMA 1NA7A 3D14A 3MIAA 1IR3A 2YCQA 3LJ2A 2Y0AA 4KABA 4QP8A 4ZOGA 4F9WA 5EYMA 1ERKA 3LM5A 4CFNA 4XG3A 3VN9A 1PRYA 3KK8A 2RGPA 1SYKA 1OIUA 5ANOA 3NYNA 3EN9A 3KVXA 4YLJA 4OTPA 3MY5A 1YI3A 4XNEA 1I44A 1ZMUA 1TQPA 4CQGA 5J1WA 4EHGA 4YR8A 2HIWA 4S33A 4DTAA 2E9OA 4IW0A 3OS3A 1UU3A 5C8MA 4CG9A 3E88A 3PP0A 3BIZA 5A4QA 2UZWE 4YO6A 4PPBA 1LP4A 4AOTA 5HHWA 3V6RA 4EYJA 3DPKA 4G17A 4WBBB 3A99A 5T68A 4IWDA 4PDYA 4APCA 5AR7A 3ACJA 3NAXA 2OKRA 3LOKA 2ZDTA 3IOPA 4M12A 4W9XA 4L53A 4LMNA 3HA8A 5KCVA 4FSTA 1H26A 5CVGA 5HE3A 3TIYA 3ZO1A 3FI3A 2YN8A 4C34A 3R6XA 2HZNA 1HCKA 2CCIA 2VO3A 4HJOA 4UY9A 4U3YA 3TV7A 4TYIA 2AUHA 2CGXA 1UA2A 2J51A 2I0YA 3MI9A 1P4OA 5M4FA 3FI8A 4C38A 3Q4UA 4D2SA 3U55A 3DJ5A 3ZHPC 4NM0A 4IHPA 3RNIA 4GFOA 4WG3A 4FT0A 4WOVA 5L2SA 5ETAA 4XP3A 2JLDA 3JS2A 5JFVA 3FMDA 3UBDA 2GS7A 1PXNA 4UZHA 3RAHA 3NW6A 4U40A 2RF9A 3UNJA 4R78A 1Q24A 3FQEA 1H1RA 2J9MA 1LPUA 4S34A 3FHIA 5EM7A 3TWJA 2UW4A 4DFUA 5FXRA 4QMOA 3TNWA 2VWXA 4KKHA 2OIDA 3O96A 3D2KA 4YC8A 2WU6A 3DT1A 5M4IA 4TT7A 3C0IA 3RZFA 3FE3A 3PXFA 4U42A 3PSDA 3VBVA 4QMUA 3W2SA 4KKEA 3RGFA 3BZ3A 5IEYA 4PP9A 3GU7A 2OFUA 3PJ8A 5DBXA 4DH3A 2QI8A 3F2NA 5H3QA 5B2LA 2W99B 2BUJA 5AFVA 4JS8A 4S31A 4A4XA 1ZOGA 3FL5A 3QKMA 3U4WA 5JQ5A 5A4CA 4KBCA 3KB7A 2W0JA 1J7UA 3GC7A 4HYHA 4ANNA 4IBMA 5E91A 4CTBA 3DBDA 4DT9A 1WBTA 2XCHA 3FI4A 4E20A 4U79A 3GXLA 4V0GA 4BDEA 3OUNB 4O0UA 4XEYA 1VEBA 3HP5A 2UZEA 4HYSA 4UWCA 4EONA 3VAPA 4MXXA 5FDPA 4MK0A 4WT6A 3I81A 4AOIA 3BHHA 2O65A 2OGVA 4I6HA 4CKIA 4FTKA 2YIQA 3TUDA 1NT2A 4USFA 4RT7A 4J71A 5CF8A 3TNQB 3DK6A 4O96A 3IECA 3O8UA 3VS7A 4F63A 4BZDA 3CQUA 4B7TA 4EH2A 3NDMA 3ZZWA 4FZDB 3EKKA 5HIBA 3AT4A 2QONA 4N4SA 2AYPA 2WPAA 2YIYA 3PZHA 1Y8YA 2WIPA 4V0GB 3SKCA 3Q9YA 4EK3A 5IUHA 5D9HA 4FOCA 4IAFA 4QTCA 4EOMA 3C4WA 2X4FA 3VHKA 4ACGA 1B39A 4IB5A 3REPA 2UZBA 3Q60A 2W1CA 4HZRA 3RMFA 3QFVA 2FH9A 4LRKA 4UB7A 3OMVA 5CEPA 5K0XA 5IQGA 3ANRA 1QPDA 3I6WA 2GHMA 4OTFA 4OTHA 4AGCA 5T3QA 2J7TA 4C36A 4F0GA 5L8KA 3UO4A 3Q32A 1PXIA 2HW6A 4RQKA 1BL7A 3WF8A 4EH9A 3ZH8A 5HG9A 2B7AA 3DY7A 5IF1A 3PG1A 3LFCA 4TTHB 3VS6A 5HIEA 2X2KA 3LCKA 2O8YA 3LPBA 4FOBA 5DT3A 2VTLA 2WQMA 2Z7RA 4FI1A 4U9AA 4PDPA 4O27B 3PG3A 4P4CA 3RM6A 3WZEA 1YKRA 4QP9A 3F66A 2GS6A 1JKTA 4I0TA 2BRHA 2XKFA 1JKKA 1QPCA 5CU2A 3BV2A 4DAWA 4NM7A 3I79A 3WI6A 3MBLA 3F5GA 2R2PA 2UW6A 4WO5A 5AR8A 2VX3A 2FSMX 4Q5HA 5F1ZA 1PKGA 1PMEA 4FICA 3H0YA 4ZTQA 4C2WA 1BUHA 1YWNA 2B9HA 2V55A 3QWKA 4JBVA 4IAZA 3NZ0A 4GG7A 4MXOA 4G9RA 3DNEA 2XBAA 4M15A 4TNBA 1CM8A 3DAKA 4FL1A 4XG8A 4YBKA 2PVHA 3CJGA 5BYZA 3RTPA 4B8LA 2B54A 3LZBA 4FTMA 4DF3A 4LYNA 4H58A 5ETIA 4Z16A 4DGNA 2UZUE 4Y72A 4BDFA 3KRJA 3VC4A 4AS0A 5FM2A 3W32A 3IW7A 3PXQA 4E6DA 5A4TA 4C62A 4G9CA 4O6EA 2VGPA 5F94A 4QPSA 2UVYA 4CCBA 4ZY4A 1OL2A 4IZAA 2GNHA 3K3IA 4H39A 2C5NA 4GKIA 2ITVA 4H3QA 2O63A 1XBCA 2ESMA 2O0UA 4FEQA 2ERKA 4I23A 5LVOA 1UWHA 3PJCA 2JAVA 3GBZA 4AE9A 2YERA 3UMXA 5EOBA 2CLQA 1CMKE 5IQFA 2I40A 2C6MA 3KREA 5LMAA 4E6QA 3OXZA 3LQ5A 1URCA 3PTGA 2BR1A 4QTDA 3E3BX 2J4ZA 3D5VA 4NM3A 3OOGA 5AUVA 4O7LA 4X6RA 3C0HA 4CLIA 3GQIA 4ENXA 2ITOA 2X2MA 4WNPA 1A06A 4ZLYA 4A9TA 2XCKA 4JX7A 3KVWA 4FTTA 1GIIA 2JFMA 3TCPA 2GS2A 2XM9A 4NTSA 2PY3A 4U80A 4M97A 3NR9A 4C59A 4JDKA 2W4JA 4LRMA 2V5QA 3NUXA 4F0IA 3DA6A 2GFCA 5I9ZA 4PTEA 3R9DA 3W2RA 4ZMFA 3I5ZA 5ACKA 1SVGA 3KL8A 1PMVA 5A54A 1NXKA 2IPXA 3EQRA 5IA4A 2ZJWA 3VUTA 4OT6A 4D5HA 4IC7A 2WU7A 4EQUA 2X1NA 3FQHA 4E5BA 3MPMA 3VRZA 4JL9A 4KSQA 4F99A 4QMXA 2XJ0A 3VBTA 3SVVA 5CI7A 3H3CA 5GZAA 2OO8X 2C0OA 4C4HA 1NW1A 2VTPA 1SZMA 3Q9XA 1YHWA 4NWMA 4O7TA 2W4KA 5M08A 3O50A 5AR4A 1PHKA 3H10A 3NCGA 1OGUA 1OIQA 4FTCA 5ANIA 3UVPA 4F64A 5JFWA 4JG8A 3D5XA 4L3JA 4M14A 2BAQA 1J91A 4LV5A 3F2RA 2VTOA 5AP5A 4DEIA 3POOA 2WQNA 3CS9A 2PZPA 2R3FA 4ACCA 2VTJA 3TV6A 3BHVA 3CR0A 2B4SB 4PMSA 4M7IA 4DFYA 4BF2A 3KEXA 3FYJX 4ARKA 4ASXA 3ENMA 3UTOA 2O3PA 4NH1A 2X4ZA 3BHTA 4IWPA 2JEDA 4FKRA 1H1SA 4TYEA 5EM6A 4O0SA 2NNWB 4D2RA 3DJ6A 1JKLA 5GINE 2YDIA 5BVNA 3E7OA 3QRJA 3PVUA 4NW6A 4Y8DA 2IZUA 2FA2A 3QX4A 3RCDA 4EOPA 3PJ3A 3QKKA 2VO7A 4R3CA 1YI6A 5KMLA 4MBJA 4CKRA 4TYJA 3NPCA 2XRWA 3HMOA 4KIKA 4FK6A 1P14A 3ZFMA 3HRFA 2EWAA 3LLTA 3TJCA 5HI2A 1BI8A 3AC4A 1XH4A 3U9CA 3DB8A 3UQCA 2WMUA 3DBQA 4YC3A 4ITHA 5AV0A 2PVFA 3VUHA 4CQEA 4QQTA 3E8CA 5C1QB 4CT2A 5A3XA 3F61A 2OICA 3TN8A 1ZY4A 3ZXZA 4H1JA 4A4OA 4CFVA 3OP5A 1AQ1A 2C69A 3GCQA 5AAEA 2ETRA 2XF0A 3AT3A 4ASDA 3GQLA 3WIKA 4I5HA 2H34A 4FSYA 4KIKB 4YSJA 3DU8A 5M07A 5HBEA 4FT5A 4O38A 4GUBA 4MXZA 5FXQA 4C35A 3CC6A 3RPVA 3DK7A 2OXYA 4IADA 3GCSA 5M53A 3WF7A 3FLSA 2VX0A 3O8TA 3IDCA 4ZP5A 5DR9A 5TE0A 4D4VA 3SDJA 3N9XA 1SNXA 3ULZA 4EBWA 5EG3A 2ZDUA 3ZLSA 4QD6A 4LUEA 5A6OA 2NPQA 3QGYA 3C1XA 3ROYA 2XEZA 1MRUA 4U8ZA 5FGKA 3R73A 4GJ2A 2HYYA 2R3KA 2X6DA 3EZVA 2CJMA 1PJKA 3H9RA 1W84A 3OCGA 2BPMA 3BEAA 4XRLA 2W06A 3L1SA 3V5TA 4AW1A 2JDSA 3MSSA 4MF0A 2JFLA 3RI1A 4BWKA 2BFYA 3F3UA 4PDOA 4K33A 1TQMA 3UPZA 5DE2A 4YJQA 4ZJIA 4AN2A 2YLFA 1IAHA 1Q8WA 3PZEA 4BIBA 5HIDA 4EL9A 2OXDA 4MXAA 5CVFA 1YHSA 1ZY5A 4RJ3A 3QYZA 3C5IA 4YJRA 4S32A 1ZYCA 3HEGA 5IH6A 3MH3A 3QZIA 3IKAA 4E5WA 1OL5A 4RWJA 2XIKA 4I21A 3ZM9A 3R63A 3C5UA 3TZ9A 2PVMA 2BHEA 3ALOA 1PXKA 1XBAA 3WE8A 4V05A 3CJFA 3L9MA 3VWAA 4U0IA 3AC3A 3NSZA 3COIA 3V51A 3P86A 4FV2A 5JN2A 4Z9LA 3QXPA 5D11A 4HCVA 3BBWA 4HGEA 3WZDA 2G2FA 4BY9E 2XVDA 3N4UA 2EXEA 4NJDA 1JSVA 5HNBA 3EFWA 4H36A 4C33A 2WMRA 2GFSA 4HYUA 1VYWA 4YJPA 4FIIA 3ZFXA 4EHEA 2PUIA 3NCZA 4I41A 3RZBA 5GHVA 5M44A 5M51A 3CTQA 4V04A 2GNIA 4CT1A 5KMJA 3FAAA 1NY3A 3E92A 3PSBA 4KA3A 3EQGA 5LCJA 4RIWA 3FHRA 3HMIA 5EDPA 2QO9A 3MVMA 2I6LA 4BKZA 3OCTA 4XV2A 2CHLA 3ZRKA 5ETCA 4NCTA 2WAJA 2C3IB 4CXAA 3LMIA 2QU5A 4EH6A 4ZSJA 3SG8A 3EYGA 2OIBA 3PXRA 5BUIA 3EIDA 4C58A 2QLQA 3CKWA 3FXZA 4E6AA 4EKKA 1H4LA 2IW6A 2C0IA 3EQIA 2WMVA 4KRDA 3RHXA 4Z3VA 5AEPA 4FVQA 4MBIA 3PSCA 1R39A 2CCHA 2XNPA 3FXXA 3Q4ZA 4EBVA 3QD4A 3CE3A 4X0MA 4NIFA 4PRJA 4K18A 4YSMA 3ZS5A 4FTNA 3UC3A 2X8DA 1KSWA 4FTJA 4RIWB 3U54A 4JG7A 1Y6AA 2R4BA 1GZ8A 4DEDA 1XQZA 4DGGA 3KXMA 5CLPA 1OIYA 2LAVA 2CNUA 3PVBA 1OPJA 3R2BA 4KNBA 1ZOEA 4HGTA 5DWRA 2X7GA 3OUKA 1OBDA 4YJOA 2BZHB 4GT3A 3TNIA 1IAJA 3QTWA 4I1ZA 3DV3A 1APME 3PE2A 3BQCA 4JR7A 1H01A 4BKYA 1FMKA 3A2CA 2C5YA 2X7OA 4NIFB 4FE2A 3UOLA 5HU3A 4G6LA 4EK5A 4ZMEA 3NUSA 1XH5A 2B9IA 3W8QA 3C9WA 4XJ0A 4N6YA 1PYEA 5K9IA 1V0PA 2VNWA 4WUNA 5AAGA 4JJRA 4Q9SA 2QKRA 3A7IA 4ANOA 4FEXA 2CSNA 2CGVA 4I22A 3TEIA 5GZ8A 4O2PA 4YJUA 2XK6A 4C4GA 3I0QA 4WRSA 4FTRA 3OWKA 1Q3DA 2BTRA 3FLWA 4FIJA 4PUZA 3WZUA 4CRSA 4D1XA 5BVOA 2G1TA 2R0UA 3EQDA 4QP4A 1RJBA 2PK9A 4JAJA 3QTXA 2HCKA 4FZ6A 4R1VA 3E8NA 3NRMA 4BCIA 3D5UA 4IVAA 5IKWA 3LAUA 5KBRA 2HZIA 2Z7QA 4BB4A 3F3TA 3IGOA 1CKIA 4AWIA 2GHLA 4BBEA 3M1SA 4F09A 2UW9A 2CPKE 3TM0A 1BI7A 2C6EA 2EB3A 3P5KA 1UNGA 4YZMA 4S30A 4FG8A 4CGAA 3AGMA 3QQHA 2XK3A 3E62A 3GGFA 4QP1A 2CDZA 2BFXA 4QP3A 3R28A 3FZPA 3R9OA 2WEVA 3U87A 4DLIA 5CVHA 5JGDA 1GAGA 2H96A 5EDRA 4MXCA 1OL7A 4JR3A 3SV0A 4EJ7A 3BU3A 4FSZA 3EHAA 3ZRMA 3WIGA 4E5AX 3D5WA 4NKAA 3SX9A 5B2MA 2PL0A 1YHVA 3ZCLA 3OW4A 1H8FA 3A62A 2VZ6A 3EYHA 4TN6A 3BE9A 3UJGA 4KINA 3H4JA 1PYXA 4GJ3A 4IVCA 4JIKA 3WILA 1JNKA 2C6DA 5EHLA 4BHZA 3ORIA 2WTCA 4UEUA 5EHOA 4HVHA 3DDPA 5GJFA 3ZMMA 4X2JA 4OTWA 5CEIA 3GFWA 2JKOA 4Y46A 4KRCA 5J7HA 4DA5A 1ZXEA 3C51A 4L52A 5M56A 3RKBA 2ZV7A 2WTJA 4XV3A 1R1WA 3AMYA 3D2IA 3QCXA 5E8TA 4F7LA 4BCMA 4PP7A 3WOWA 4RG0A 2CMWA 4MTAA 4BFMA 2ITTA 3KQ7A 3AGLA 3W2QA 2OK1A 3HX4A 2IW8A 4MWHA 1JPAA 3KF7A 2PYWA 2BIYA 1H24A 4CD0A 2WKMA 3V5QA 3LXPA 3OF0A 3R00A 4BCHA 2ERZE 5FG8A 1YW2A 1TKIA 2YIXA 3KMWA 3Q5ZA 4QYYA 3ODZX 2WZJA 3A4OX 5LMKA 1CKPA 1GIHA 2X8EA 1IEPA 5I4NA 2UW8A 2YM3A 3K54A 3KA0A 4JQEA 3RAKA 4RVTA 2PU8A 4K6ZA 5KUPA 1DI9A 2ITZA 3BRBA 1UKIA 4IM0A 4RC3A 1JSUA 2YCFA 4XLVA 2XNOA 5HTCA 2ITXA 2OJ9A 3KMUA 4ENYA 2PPQA 4BTFA 3LKMA 5TO8A 2JIVA 3SXRA 1OPKA 4DEHA 4FV6A 4NSTA 5M4CA 4AZSA 1MUOA 5AP2A 2OJJA 2YLEA 3LFFA 4OW8A 4FKPA 3HV5A 2FUMA 3IPHA 4LL0A 5EW9A 5IUGA 4DCAA 4FT7A 5EKOA 3LVPA 4BI2A 3BBTB 3CQWA 4CNHA 5HG7A 4WKQA 4QRCA 3MW1A 3OTVA 3PY1A 4DYMA 3OY3A 3N51A 2JAMA 4EOOA 2WTIA 2XB7A 2ZB1A 3MGYA 3QA0A 4CFWA 3ORMA 3IS5A 1JKSA 4PMPA 4BCPA 2VTAA 3R71A 3EN6A 5IH4A 5A4EA 2BRBA 3EN5A 4BC6A 4K8AA 4K77A 5CSPA 4H1MA 3IG7A 3ET7A 3EQPA 4OTIA 2E9PA 4YHTA 5KHWA 3WBLA 2REIA 5BVDA 4F7NA 3OC1A 5CS6A 3OFMA 1ZZ2A 4FV8A 2WMQA 2PWLA 3HZTA 3LW0A 4ZTHA 4DT8A 4EOSA 4Q2AA 4QMPA 5F20A 5ANKA 3VF8A 2G2IA 1CKJA 5EHYA 4BZNA 3P23A 5EKNA 5L6PA 4O1OA 3U8WA 5KKRB 1GNGA 3KRRA 3DFAA 2CGUA 2JDVA 3DOGA 5KZIA 4O7WA 5AUTA 4UZDA 2PZIA 3D7ZA 2ZOQA 4RX7A 4YPDA 3FUPA 5E7RA 3VRYA 4FTOA 1A48A 2GQSA 4ZS4A 4QNAA 4OAUC 1ZAOA 2YITA 4L42A 5CEOA 3LFNA 1KWPA 3R0TA 2QO7A 2Z02A 4IIRA 1O9UA 5HORA 2XZSA 4JXFA 3RNYA 3HDNA 4DITA 3MTFA 2ZMDA 4NTTA 4OT5A 4H05A 3D15A 3P0MA 4XBUA 2A2AA 1YI4A 3PLSA 4X2KA 4D2PA 2OWBA 2Z2WA 4DBNA 3SA0A 1E1VA 4X21A 3F7WA 3ETAA 4FBXA 4ZJVA 4LI5A 2OZOA 4NW5A 5CEKA 5LMBA 4BR3A 4DC2A 1WBWA 1YXXA 1Q3WA 5JH6A 3PE1A 2F7ZE 4HGSA 2GNJA 4ANMA 3FZTA 3OCBA 1XWSA 2Y4IB 3KXHA 4FTQA 3ZTXA 5BVEA 3RJCA 4A9YA 3FLYA 4ANQA 4O7YA 5AP6A 2OSCA 5DG5A 5K4IA 3UNKA 5J9YA 1WBVA 4F7SA 1O6KA 4JBQA 4AX8A 1BYGA 3P1AA 5HE1A 1M2QA 4B4LA 3R8LA 3QUDA 4ALVA 3QL8A 2UZDA 5ANEA 1BL6A 3WYYA 1Q62A 3IW5A 5BNJA 4FSWA 3Q52A 4TNDA 4UYNA 4NZWB 3MFRA 4ZTRA 4F6UA 3BU6A 4GK4A 5IA5A 1ZMWA 3GOKA 4Z55A 4JOAA 4UALA 5C26A 2V7OA 1M52A 5L8JA 3DCVA 5FXSA 4BGHA 3WE4A 5CASA 5ANJA 4ZLOA 3FYKX 2AC3A 4ZZOA 4KIPA 4RFMA 5DIAA 5TF9A 4TL0A 4J1RA 3PIYA 3F7ZA 4G31A 3CCNA 4E8AA 5EOLA 4C8BA 4UX9A 3BLHA 4MBLA 3GUBA 3WARA 4F70A 4OAVB 4XG9A 3GVUA 5H8GA 3ZO4A 5HE2A 4F9BA 5IA2A 5J95A 3DXNA 2JKKA 4QTEA 3POZA 3QBNA 3VJNA 4HW7A 5DOSA 1XBBA 4EOQA 3THBA 3MVJA 4OBPA 1H08A 4B6LA 3DTCA 4WIHA 4RWIA 4GT5A 1FVTA 3Q9WA 4OR5A 4YTHA 4NT4A 1Q5KA 2H9VA 3V5PA 5IQHA 3PA3A 2YFXA 1V0OA 4W4YA 3MY1A 3OW3A 4BCKA 5HG8A 2PVJA 2C6OA 2WTDA 4XCUA 2R3PA 4QYHA 3T3UA 5CNOA 2VTMA 4O0WA 3PDTA 1W98A 1I09A 3NYXA 1FGKA 2YCRA 5FEDA 2XYNA 4AACA 4JI9A 5J9LA 4JLCA 3QZGA 4AT4A 1O6YA 3OHTA 3AC5A 1J3HA 4XV9A 3TKUA 3RBWA 3TTIA 3MYGA 4YHFA 3I1AA 4X2FA 3QUPA 1W82A 3IK3A 3MS9A 4O7VA 1U54A 2XNBA 4BCGA 2QHNA 4I92A 5HESA 4ZS0A 3QTSA 2DQ7X 3IO7A 2W1DA 2X6EA 5EYDA 3TTJA 4F4PA 3RAWA 1FVVA 4OTQA 3C7QA 3NS9A 3WF5A 2VV9A 5E8XA 2ZAZA 2Q0NA 5C8KA 4O81A 3MJ1A 4N0SA 4XG7A 2W9FB 4RVKA 2IVTA 4CVAA 5DN3A 4E4MA 3Q2MA 4J96A 3RINA 2QURA 3H30A 2PUNA 1H1PA 3ZEPA 2UUEA 1U54B 2WTKB 4DEAA 3DAEA 2YM7A 3UC4A 5EQEA 4XG4A 4TWCA 2QOFA 3Q9ZA 4CFFA 4F0FA 3K2LA 1RQQA 3VW6A 4DHFA 1ZWSA 4F08A 5DGZA 4YZDA 1T45A 4FNYA 5AM6A 5D12A 3MESA 4K1BA 5A9UA 5HNGA 2GPHA 3UIUA 4G2FA 2IG7A 5E90A 3DTWA 4F1OA 4BDHA 4BKJA 4CFMA 1VJYA 3CGFA 3BLQA 5CAQA 1Y6BA 3Q5IA 3MTLA 5CENA 3MH1A 5IISA 2YJRA 4DFZE 2C47A 3VW8A 4D2TA 2RFSA 5IA0A 1WBOA 2GCDA 4PX6A 5CU3A 1Q4LA 3UOJA 3DB6A 4IDVA 3P7AA 5HO7A 4AAAA 5FTOA 2RKUA 4RIYA 3FEGA 4AP7A 2W1HA 1MP8A 2Y6MA 2LGCA 2O64A 4YC6A 3DBCA 4KWPA 4LG4A 1H0VA 3NVMB 1Q99A 3FMJA 2H8HA 5C8NA 2G9XA 3R7EA 3QGWA 4CG8A 2XS0A 2C3KA 2PVYA 2YIWA 3OEFX 3RAIA 3TKHA 4D1SA 3SGCA 2PULA 3D0EA 2HXQA 4RVLA 2VN9A 3L8PA 4E73A 4HNIA 4YZNA 4EYMA 4F9YA 4FV7A 5TR6A 2C5VA 4RPVA 3R1YA 2RL5A 2HK5A 2YWVA 4QMSA 2PMOX 5EYKA 4RIYB 2BRNA 4MHAA 1ZYJA 3AD5A 4M68A 3LXLA 4A4LA 3QZFA 5LWMA 3MVLA 2CKOA 3TL8A 4ZJJA 5FBOA 4OTRA 4WRGA 1J1BA 3UQGA 4O7ZA 1GOLA 3L9NA 4I0SA 3NMUF 4ZK5A 3WZKA 2J0JA 2UW0A 4QP7A 5C4KA 4PTGA 3S4QA 1KV2A 5KNJA 4YP8A 4IFCA 3EL8A 4ID7A 2BZIB 3COHA 3OTUA 4PMMA 2C4GA 3D9VA 4AGUA 5FUTA 4MH7A 3R7UA 1QCFA 3ZSIA 1Q97A 2W1FA 2XH5A 2C6IA 3FC2A 4USEA 4K0YA 5JSMA 3EFLA 3C4FA 3UIXA 3ZBFA 5I9VA 5ITAA 4O91A 5KO1A 1REKA 4TZRA 4AZVA 2KULA 3E87A 2NRUA 1URWA 4DEGA 1Y8GA 1UNLA 3FKOA 2PE1A 3SAYA 3LMGA 1YOJA 5DMZA 3GENA 4FEVA 4I5MA 2ZM4A 1SMHA 4IAYA 1OVEA 4BDBA 4AUAA 1OL1A 4TXCA 3KN5A 5CY3A 5BVKA 4DH7A 4ZAUA 4ASEA 3SXFA 1H0WA 4KBKA 4FKIA 4EWHA 3P9JA 5LVMA 4O6LA 4FKVA 3I60A 3PY0A 3MB7A 4I5CA 4AGDA 5JT2A 3ZSGA 4FGBA 4HZSA 4M13A 2XKDA 4QP6A 2RFNA 2FSTX 3R9HA 2EU9A 2BALA 5AR3A 5FD2A 4G5PA 2RG5A 3BYUA 4GW8A 4U81A 5D41A 3BYMA 4UXLA 5HLNA 3E7VA 2XNMA 1DS5A 2R3RA 4LUDA 3IW8A 2WOUA 3ZDIA 4C0TA 4CV9A 5FM3A 3QRKA 2HWOA 4GU9A 2ITNA 1KUTA 3BE2A 3V5LA 3DBEA 4Y85A 3NVKI 5CSVA 3QLGA 3A8XA 3UG2A 3ORZA 4M3QA 3F2AA 4X3JA 4CV8A 5AV2A 5AA9A 4LOQA 1ND4A 4GH2A 4QMQA 4MVFA 2BAKA 4FC0A 2OU7A 4BBMA 3R2YA 4WNOA 2YM4A 4F1TA 4NYEA 4GIHA 5GIPE 3RK5A 3TUBA 4CEGA 5KMNA 2XIZA 1YXTA 4L9IA 5JRQA 3TUCA 3JYAA 4JT3A 3HNGA 5HEZA 2OXXA 1PXLA 1P4FA 4U44A 5E8ZA 3ZYAA 1DAYA 2PSQA 4JRNA 5CYIA 4GV1A 4F65A 5HVJA 2WOTA 4L67A 2W1IA 4R7BA 2XIRA 2CNQA 5HICA 3C50A 3FMMA 5LWNA 4I94A 2OJIA 3KCFA 3SRVA 3LCTA 1BX6A 4IWOA 4XS2A 2A4LA 2X9EA 2GQGA 2QQ7A 5HCYA 4ZZNA 4IFGA 1WVWA 4QMWA 1XKKA 5L2TA 5M4UA 1XH7A 3CEKA 1G5SA 3GC9A 2F2CB 2RFEA 2VO6A 3CLYA 3DK3A 4L00A 4XMOA 5CZHA 5G1XA 2OG8A 2ZV9A 3PPJA 5BQ0A 1G8AA 4RJ4A 2B55A 4P7EA 5CX9A 4D9TA 4DLJA 4E26A 4D0WA 1REJA 2YDKA 4QQCA 5B2KA 1S9IA 4M0YA 3I0OA 3PVWA 4RSSA 4YGAA 4BICA 1OM1A 3SRVB 4ERKA 3UZTA 4DFBA 5JFXA 2R3GA 4XRJA 3DXPA 3OZ6A 3Q6UA 3HLLA 5D7VA 3DXQA 1UV5A 2JIUA 2QOLA 1B6CB 3G51A 2YZAA
chains in the Genus database with same CATH superfamily
2XKCA 5D10A 3S0OA 3ANQA 1V1KA 3G5DA 4IB0A 3RP9A 1Z9XA 2W7XA 1OB3A 3R1QA 3QQLA 4A9SA 3P78A 5L4QA 1KOBA 3TKIA 4G1WA 2JDTA 4ZTNA 2XJ2A 2VAGA 3DJ7A 5BUEA 3EFJA 3PRIA 4HOKA 4EC8A 4ASZA 4C4EA 3UG1A 4IH8A 3LFEA 5DI1A 1JWHA 3QHRA 3SOAA 3KFAA 4RX9A 3FPQA 2VTIA 1S9JA 4O0VA 3TYKA 4IX4A 5E8SA 4MEDA 3I4BA 4PPCA 4EUUA 2WMXA 4I6FA 5FLFA 3C4EA 2C1AA 2XIXA 3Q96A 4AXEA 1KE5A 4IZ5A 4P90A 4F1MA 4EK8A 2P2IA 3LMHA 1RE8A 2R9SA 3MFSA 3TDWA 2FO0A 2ITYA 4LL5A 4CZUA 1PKDA 4EH8A 4WG4A 1IA9A 1OITA 5HX8A 3UOHA 4Y83A 3G9NA 3PYYA 4TWOA 4X2GA 4GSBA 4XBRA 3N4TA 3DNDA 4QTBA 4ZTLA 4G3GA 4YTIA 4FYOA 4MF1A 4AE6A 1DAWA 1KV1A 3BKBA 3FKNA 4IWQA 4AZTA 4QDVA 2Z7LA 3W10A 1NVSA 2YM8A 3VS4A 4QEBA 4OBQA 3UO5A 3CBLA 2C6LA 4LM5A 2WEIA 4AT5A 3A8WA 3AXWA 4CMUA 3AC8A 3BLRA 3IQ7A 4NEUA 4JDHA 1KE9A 4PTCA 3DKFA 4R5SA 3L8XA 3HV7A 1U4DA 3SD0A 1XR1A 4ACHA 2W05A 2IF8A 5KX8A 5IMXA 4JG6A 3K5VA 2R3MA 5CSXA 1AD5A 3NW5A 1Q8UA 3R7OA 3CD8A 4BIDA 1H1WA 4RIXA 1OBGA 3NW7A 4FZAB 3UOKA 4RJ6A 5FWKK 3BX5A 3ZU7A 1G3NA 1YXSA 3LFAA 2B9FA 4FK3A 1XO2B 1RDQE 2IO6A 4KSPA 4YLLA 2YIRA 2QOHA 2WO6A 2P3GX 4KUJA 4AA0A 3AC1A 3UYTA 3HMPA 1VYZA 4G3FA 1H25A 1ZMVA 3DBFA 4YZCA 1PMNA 3Q3BA 3TNHA 5KMKA 2JD5A 3EQCA 1NVQA 3LHJA 4RIOA 4X7QA 3KKVA 3R7YA 3ZUTA 4D28A 2DYLA 3W1FA 2VTHA 5CSWA 3DKOA 4IJPA 4JBPA 4DN5A 4L3LA 3S1HA 1XMLA 2VWIA 4RIXB 2IZRA 4I93A 3TI1A 4DH8A 3RWQA 2FYSA 5M55A 3PXYA 4J8MA 5LVNA 4DTBA 4NK9A 2IN6A 4ZXTA 4EJNA 2J0KA 2C5OA 5FTGA 4DHJA 1K9AA 2P33A 2CKPA 2Z7SA 4FKWA 4RGJA 2C68A 5EK7A 3EZRA 4I5PA 4A06A 3RPYA 4FNXA 1LUFA 2WFYA 2YACA 3PWYA 2R3IA 2WGJA 4IM2A 4L7SA 4QMTA 3L8VA 1JBPE 1PF8A 3CIKA 3PY3A 5AA8A 2ZM1A 1GIJA 4I20A 5CZIA 4O1PA 5HE0A 5AP1A 4PF4A 4EH4A 3G9LX 4BI0A 3OXTA 2CN8A 4PNIA 3F3VA 5I5ZA 1F5QA 3HUCA 3F5PA 4YURA 5A14A 3AG9A 1H00A 5HGIA 1BKXA 3UPXA 3KGAA 5HLWA 4J7BA 2OLCA 4I4EA 4FIFA 2B1PA 2OJFE 2WB8A 4F9AA 4J8NA 4QMVA 4C3PA 1NVRA 4FIEA 3MA3A 4EZ3A 4BN1A 2GTMA 3OT8A 4WD5A 4LV7A 3IGGA 2XK7A 4UMQA 4YLKA 5HLPA 3FWQA 4FKSA 4GRBA 3DFCB 4HNFA 2B0QA 1OKYA 3IOKA 3RK7A 5K5NA 4DGOA 4AZEA 1P2AA 2V62A 3LM0A 2J50A 2DS1A 3QD2B 4BDJA 1PXPA 2VWVA 3A7JA 2UW5A 5CXHA 5DT0A 2WQEA 3TJDA 5LJJA 2QU6A 1ZYSA 2VTSA 3R7GA 4L43A 3NEWA 1Z5MA 5ANDA 1YQJA 4XHKB 3F88A 3G2FA 4QMMA 2VWYA 3R8ZA 4IEBA 1JLUE 4M0ZA 1R3CA 5JRSA 4IC8A 3Q6WA 5CAPA 4DE4A 4HYIA 4ZSAA 2GSFA 3ZZEA 3BYVA 3NNUA 4JMQA 1KOAA 2WIHA 4YJVA 4AN9A 4YO4A 4CCUA 3CY3A 3HV4A 3O23A 4CZTA 3HMMA 3V8WA 4QPMA 5L8LA 3EN4A 5G6VA 3R9NA 2J5EA 2VTQA 5EFQA 5CT7A 3G0EA 4QYFA 4NCTC 5CANA 3VO3A 2ZM3A 4FEWA 4O21A 3FXWA 5IDNA 3ZSHA 3FC1X 4BIEA 3DS6A 4D2WA 3GB2A 3R22A 4TKSA 3F82A 4ACMA 2UZOA 4BDDA 4RLKA 1UWJA 4Z7HA 3UQFA 3N4VA 5HU9A 4D2VA 5GJGA 3IW4A 2FSOX 4LQMA 5D7AA 3AQVA 5BUJA 2Y4PA 2NYAA 4CMOA 2YJSA 4Q5EA 3V3VA 3P4KA 2NRYA 1OUKA 3QUEA 2X2LA 3BPRA 4IAAA 2CNVA 2BILB 3HV3A 5TOZA 3UDZA 2RFDA 4JQ7A 3LIJA 1Q61A 2OF2A 1ATPE 1ZOHA 3QTZA 5E8YA 2Y9QA 4R3PA 4EKLA 2JBPA 4IXPA 4I4FA 4OGRA 3SC1A 3RVGA 4W4XA 1M2PA 2GNGA 1OZ1A 3GU6A 4FL2A 3T8OA 3V6SA 3VS2A 2XNEA 2IW9A 4AFJA 4W4VA 2F9GA 3GEQA 3VUKA 4F9CA 5CXZA 5AV3A 1XJDA 2VTNA 2XNNA 3OG7A 3KXXA 4FV1A 4C4JA 4FIHA 4RQVA 5EQPA 2Y8OA 3GOPA 5AV1A 2CN5A 4PWNA 4IAKA 3ZRLA 3MA6A 4OUCA 3RPOA 3ZO3A 3W16A 4MNFA 5IEXA 3BLAA 4PQNA 5BPYA 2CKQA 3HV6A 4DCEA 5KE0A 4RA4A 4G3DA 4WBOA 5AUWA 3UO6A 2F7XE 3ZUVA 1WMKA 5JGAA 4QNYA 1R0PA 1MQ4A 1GZOA 3UDBA 4U7ZA 4DFXE 4QO9A 5JK3A 4ZSGA 5HCZA 4YJTA 5DPVA 2YAAA 3NUUA 3RHKA 4R3RA 3UODA 1XH6A 3FMLA 3DGKA 4UXQA 3QU0A 4RFYA 5E8UA 2PVKA 3R1SA 1L8TA 1X8BA 1QL6A 2VWBA 4O4DA 4FT3A 3BYSA 3QC4A 3QRTA 4FKLA 5CI6A 3RPRA 3JXWA 1H07A 1PMUA 3HECA 1V0BA 4N70A 3UE4A 2HWPA 2WQBA 3FBVA 3UNZA 4D5KA 3H0ZA 1MQBA 5L6WL 3FLZA 3SG9A 4TRLA 5J79A 2OBJA 4JVGA 1PXJA 4FMQA 3O7LB 2RG6A 2BZKB 5HVKA 2I7QA 3LLAA 1Z57A 3KC3A 5F4NA 3MB6A 2JDOA 3QQFA 3DLZA 4D58A 3QXOA 4EOKA 1U5QA 3FLNC 4AF3A 3BWJA 3OBGA 1ZARA 2UW7A 3AOXA 5DNRA 4EOLA 3B8RA 5T6KA 4RJ7A 4MXYA 4EZ7A 3QRIA 2J0MB 1OUYA 4MAOA 5FRIA 4RVMA 3FMEA 3QX2A 4H3BA 3C4ZA 3PJ2A 3TXOA 5FQDC 3LQ3A 3G90X 5IZFA 2HW7A 4RC2A 4AA5A 2XNGA 3F6XA 4R8QA 4L44A 4BTKA 3S3IA 3L8SA 2ZV8A 2P2HA 2X9FA 2HZ4A 4RWKA 4EI4A 3FMNA 4D1ZA 5IH5A 3BQRA 3MFTA 4GT4A 4U5JA 4LRJA 4XOZA 4B8MA 5JMSA 5K5XA 5GNKA 5E4HA 2HY81 4BDKA 2PZYA 3F69A 4ERWA 5H9BA 3QTRA 2IWIA 4GYGA 2VRXA 3M11A 1WCCA 1W2FA 2JBOA 4FVRA 2BIKB 3AD4A 3HA6A 1H1QA 4C4FA 5DR6A 4GVAA 3BCEA 3BI6A 3H9OA 2ACXA 4ITJA 3VQHA 4A9RA 4CYJA 5EI6A 2X8IA 5C01A 3R8MA 3S2PA 3FZOA 3CTJA 2R3LA 2IJMA 3JUHA 4B9DA 5IQDA 2J6MA 2H6DA 4DG0E 3VQUA 1JAMA 3VBWA 4NM5A 3NIZA 2XMYA 5DFPA 4BGGA 4Q9ZA 5LMKC 3U6JA 3OBJA 1WBSA 3HP2A 2R5TA 4FODA 2V0DA 4RC4A 4ZSLA 1HOWA 3ROCA 4BCFA 2QD9A 3TMOA 3GCUA 3JR1A 3QTQA 3NNVA 3QZHA 3COMA 4IB3A 3MN3A 4NFNA 4WNMA 1BLXA 3HDMA 4MYGA 5EM5A 3KRXA 3T9IA 1OI9A 2VWUA 4YU2A 4FV4A 4JDIA 5AWMA 4FEUA 3ATSA 5HD4A 2PMIA 2YM5A 2QOIA 4MD9E 1K3AA 3KU2A 2UZVA 3VULA 4O7SA 4ZY6A 3A4PA 2Y7JA 4HGLA 1Y91A 3ORXA 3C0GA 3ZDUA 4HVIA 3SW4A 1YWVA 4C37A 4USDA 4XG6A 2W5BA 5LVPA 5AADA 2XA4A 2X39A 3ORTA 3PWDA 2PMNX 3V8SA 2P4IA 3LFSA 4DG3E 5CAUA 4O4BB 4EHZA 4PL4A 4F6WA 4FNZA 3D94A 5JEBA 3LFBA 5L6OA 3B2WA 2XK4A 4RZWA 3S95A 5CEMA 2E9UA 2I0EA 2V7AA 4BCOA 3I7CA 5KKRC 1BMKA 4ZIMA 3LFDA 3ZOSA 2YAKA 1GY3A 3ZLYA 4L46A 4J97A 4W8EA 1IA8A 3M42A 1YRPA 5I0BA 5EI2A 3BEGA 3DAJA 3TZ8A 2J0LA 5C03A 4BCQA 2BRMA 4M66A 4W4WA 4DEEA 5BMSA 2UVZA 3PP1A 3W2PA 5CSHA 4FKUA 4EK6A 1YOLA 4H3PA 2X0PA 2EUFB 4XP2A 2XKEA 1YDRE 5KZ0A 5DHJA 3SLSA 3W2CA 1TVOA 2QOQA 4Y95A 1YVJA 3VF9A 4J99A 3FI2A 3WF9A 5EQYA 4EQCA 2QC6A 4C7TA 4QOXA 3LXKA 3W8LA 2KTYA 3ORNA 4AT3A 2GHGA 2UW3A 3GNIB 2PE2A 5KBQA 3TIZA 3H9FA 5L2IA 4FKGA 1E1XA 2WMSA 4C57A 4QQJA 5HOAA 2Y4IC 3FDNA 1ZYDA 4FV5A 4G34A 5CF4A 3B2TA 3FV8A 4BDAA 4HVDA 4YJSA 5J87A 4EORA 1J1CA 4LV8A 2DWBA 3FSFA 4EUTA 1R78A 1SNUA 5AIRA 4BDIA 2XJ1A 1LEWA 2ZMCA 3DZOA 4GFMA 5E1SA 4YTCA 3FY0A 1L3RE 4FV0A 2R3QA 4FKOA 3O0GA 2BRGA 4EH5A 1U5RA 4C61A 3FPMA 5HD7A 1STCE 3MVHA 2WD1A 3QKLA 4JAIA 4TWPA 3QQGA 4PMTA 1SM2A 5CNNA 2X81A 3FMKA 5CTPA 5AP3A 5IUIA 4AXAA 4QQ5A 1DM2A 5AR2A 3FKLA 3ZC6A 5CT0A 1OL6A 3JVSA 3Q4TA 1FOTA 4FV3A 5DEWA 3VUIA 2BKKA 3UP7A 5E92A 3OROA 2PUPA 3BV3A 3DQWA 2CGWA 4FKQA 3U6HA 3LJ0A 3ZO2A 4N6ZA 4U6RA 3PIXA 4C4IA 2QO2A 4A9UA 5HO6A 3MFUA 4FJVA 4YBJA 4QP2A 5ACBC 3MIYA 5FBNC 4R7IA 4D4YA 3NNXA 1ZRZA 3QCYA 3UZPA 3A7FA 3P08A 5K3YA 3PRFA 3Q4CA 5ANGA 3HRBA 3ZLXA 5DA3A 3HAMA 4GCJA 2Q0BA 3R83A 4MCVA 4DINA 5FEQA 3GU5A 5JZJA 4U3ZA 3ORLA 5LARA 3W18A 3DLSA 2E2BA 1R0EA 2A1AB 2W96B 2R3OA 3ZXTA 4UYAA 3KMMA 3I6UA 3RPSA 5JFSA 5IU2A 5CWZA 2C6TA 3GC8A 2P55A 4K2RA 1J7IA 3VIDA 2VU3A 5E8WA 3QALE 4P2KA 3O71A 3BELA 4FZ7A 2WXVA 5IDPA 2FSLX 4NKSA 2WMBA 4QYEA 5BYLA 4ZTSA 3MDYA 4CLJA 2WQOA 2QOCA 4GUEA 4PDSA 4BWXA 4EOIA 3GP0A 4J95A 3WZJA 2UV2A 4LGGA 3QTUA 2UVXA 4UMTA 4J98A 4KD1A 4BBFA 4LOPA 2C0TA 4S2ZA 5DVRA 4Z7GA 3R30A 5DT4A 2A27A 4XLIA 4BI1A 3TNPC 3KK9A 3BHYA 5HG5A 1DI8A 4CTCA 5HTIA 3W0PA 2HY0A 3G0FA 4FSMA 4O0YA 4FKJA 5ETFA 3VS0A 2B53A 3ZBXA 4BZOA 2ITPA 4IZYA 4HPTE 4PY1A 4XX9A 5M06A 4YTFA 3E63A 3EMGA 2J90A 2QNJA 4J52A 3W55A 1A9UA 4R5YA 3DKGA 4FGRA 3PFQA 4CKJA 5BV3A 2PMLX 1XH9A 2WTVA 2X7FA 3LCDA 3OWPA 3PUPA 4UWYA 5CAVA 3R8PA 4BHNA 2OJGA 3ATTA 2G15A 4FG9A 3E3PA 5CU4A 4O84A 1P5EA 2PHKA 5EYCA 3KY2A 2WTKC 5K0KA 1FQ1B 4YPSA 5E1EA 3UYSA 2F4JA 4IDTA 2OI4X 1G8SA 5IQCA 1UNHA 4F6SA 5M57A 5DYJA 4ANLA 4XOYA 3W2OA 4IX5A 3OVVA 1XH8A 1YXVA 4MQ1A 5IA3A 2XEYA 1PXOA 2Z60A 5DRBA 3EKNA 2EB2A 3NUYA 4FSQA 4OLIA 3T3VA 2F49A 5JGBA 4G5JA 5D1JA 1PY5A 1VZOA 3V01A 4BL1A 4FUXA 5AR5A 2IZTA 4OBOA 5J5SA 3F3WA 1U59A 4FTUA 2VTTA 3IW6A 4BTMA 5A6NA 2R3HA 3QF9A 4FNWA 4U41A 3ZUUA 4RZVA 3QQJA 4E4LA 5I3OA 2IEWA 3EQFA 2JDRA 3P7CA 4WG5A 2C3JA 2G01A 3FY2A 4YHJA 5J1VA 4I6LA 5BMMA 1UU8A 4HPUE 4LDTA 5IQAA 2F7EE 5LVLA 4EZ5A 2R7IA 3L9PA 3GCPA 2UZNA 3OEZA 4UV0A 4RJ8A 3ZLWA 4FSNA 1TQIA 3PPKA 2PVRA 5KMIA 2OH0E 3PPZA 4CFXA 4O82A 3VONA 4KBAA 4RMZA 5E8VA 2E9NA 3UIMA 4LGHA 3OWLA 2UZTA 4QYGA 2XALA 3ODYX 1UU9A 4O86A 3GC0A 3TZMA 3HAVA 4MQ2A 2ITQA 3ZFYA 2AQXA 3VS1A 1WBPA 2CLXA 2YWPA 3A61A 4I6QA 4JNWA 4PL5A 4ZLZA 3COKA 4O2ZA 5IQBA 3CY2A 3FZRA 1QMZA 2EXCX 5EDQA 2ZV2A 1HCLA 3KXGA 4R7HA 5H2UA 2C5XA 2YZLA 4ONAA 3EB0A 3KXZA 3KF4A 5IPJA 4TYHA 4KIOA 2QR8A 3LE6A 4FF8A 3ALNA 5AUZA 2C3LA 4YZ9A 4AOJA 5CALA 1CDKA 2RIOA 5C4LA 4FIGA 4FSRA 4K11A 4MNEA 4KB8A 1M17A 1YDSE 2OH4A 5L2QA 5HX6A 2VWZA 1UU7A 2XRUA 3NAYA 5J9ZA 1M7NA 3P7BA 3FL4A 3NX8A 4RWLA 1G8KA 4IACA 3U9NA 2QOBA 3QLFA 4AGWA 4U43A 1SVEA 2PZRA 4KAOA 4GYIA 4MD8E 5FP5A 2RSVA 3QCSA 1B38A 3NWWA 4TYHB 5CU6A 5IEVA 3VHEA 4FUYA 2BMCA 5IG1A 2O5KA 4IMYA 4R6VA 4PNKA 3BYOA 4MNEB 4NU1A 4IAIA 3SHEA 3ZC5A 2WTWA 5GIOE 4G6OA 2BDWA 5AM7A 3LQ8A 2ITUA 3CD3A 5LQFA 2B9JA 3OXIA 5DR2A 4E4XA 4DHIB 1WZYA 1PXMA 1YOMA 4YNEA 5HCXA 4RFZA 4BYIA 3QQKA 4P5QA 3CPBA 2QCSA 4D0XA 5CU0A 3G33A 1H27A 3KRLA 2PE0A 5FEEA 3QRUA 3P79A 1LEZA 4FTIA 1W0XC 2EXMA 4O4FA 2BCJA 1OPLA 1W8CA 5DEYA 5B0XA 2PZ5A 3LCOA 4KS7A 1FMOE 1GZNA 3VBXA 1JSTA 3UMWA 4I3ZA 5LCKA 2EVAA 5CEQA 3SOCA 2VUWA 4M69A 4DBXA 3G6GA 3ORPA 1FGIA 3OOMA 3QA8A 5CF5A 4CMTA 4AN3A 5HO8A 4R1YA 2FGIA 3NUAA 4UN0C 1KE6A 4R77A 1F0QA 2YDJA 5EW3A 3AMAA 1LR4A 3F9NA 4YNOA 3PVGA 4C02A 4C3FA 1OMWA 3V5JA 4O83A 1IASA 5AJQA 2ONLA 5BVWA 2UZLA 4NUSA 4DGMA 4EC9A 3Q04A 4LFIA 3CGOA 2VWWA 4IVDA 4DEBA 2VTRA 1UKHA 1JOWB 1FINA 2PVNA 3D4QA 3DZQA 3NNWA 3QCQA 4M69B 5AP7A 3R7IA 3SQQA 4AW0A 1WVXA 2QLUA 2V22A 1CTPE 3UVQA 1WVYA 1M14A 2HENA 4WSYA 4Y5HA 4EHVA 2OFVA 3MY0A 2WHBA 3PIZA 3R1NA 4UMPA 2BAJA 3RK9A 4UWBA 3WYXA 1QPJA 1M2RA 4QTAA 4ZTMA 4FKTA 1K2PA 4BTJA 4TPTA 2QG7A 3SXSA 4ANBA 1KE7A 1EH4A 4CYIA 4IM3A 3IDBA 3HUBA 2QODA 4L45A 2W9ZB 4BJJB 4JBOA 2F57A 2A98A 1IG1A 3ULIA 4TYGA 4UMRA 4YJNA 2X0GA 3GU4A 4FR4A 3PLAE 4G16A 2PTKA 3NUNA 5JQ8A 4G6NA 2XP2A 3LXNA 4TWNA 5CAOA 4E1ZA 3R04A 3TG1A 1MRYA 3Q53A 4GFGA 4ZSEA 4X6QC 3RALA 5LXMA 2VD5A 2DUVA 3FJQE 5AP4A 3QYWA 3UIBA 4QMYA 4KKGA 3MPAA 3BWFA 4BCJA 3BL9A 4PV0A 3HGKA 2YABA 3CKXA 3IONA 2WMWA 1YDTE 3ITZA 5M09A 3QHWA 2HOGA 3FZSA 4O7RA 2QR7A 2NP8A 2VNYA 4O0XA 3F5XA 1AGWA 3ELJA 4PL3A 5I3RA 2W5AA 5DRDA 4CFUA 3E93A 3UVRA 3TDVA 4G3EA 4QMZA 1WBNA 3JVRA 3OWJA 4AFEA 3F3ZA 4L7FA 5J7BA 2FB8A 2WNTA 4E3CA 4BJJA 3LCSA 4RJ5A 4Y5QA 4LOOA 2IVVA 5AUXA 3TV4A 1RW8A 3VS5A 5CF6A 5EI8A 3Q2JA 2XBJA 2BDFA 1OKVA 2R3JA 2R64A 2ITWA 3HVCA 4FTLA 3T9TA 5HBJA 2E9VA 4O7NA 2BHHA 3MV5A 4JIAA 4AW5A 4E7WA 1ZLTA 4L01A 2A19B 4RLLA 3VUDA 4M67A 1Q8YA 3VUMA 4A7CA 5IMEA 2XAOA 1YXUA 4DH5A 2W1GA 4YMJA 2OIQA 4U45A 4NL0A 5BVFA 2B52A 3FZ1A 1FBNA 1YWRA 4LMUA 3WF6A 4EH7A 4CRLA 1W83A 2OF4A 2QKWB 4HVSA 4FX3A 3HRCA 4HVGA 3U6IA 1F3MC 5EM8A 1QPEA 2ONLC 3OD6X 4RBLA 3ZEWA 4FZFB 3CTHA 5ICPA 3JY0A 4ITIA 4O0TA 5C27A 5BYYA 3EQBA 4L3PA 2HELA 4L68A 3PXZA 4GEOA 4TW9A 5GZ9A 3CSVA 3HYHA 3ZONA 2ZVAA 3PUFC 3QD0A 2BDJA 4DGLC 3LFQA 4MX9A 3B8QA 4D4RA 3GT8A 5A46A 2JITA 4AQCA 4FSUA 3EOCA 1GJOA 1Q41A 3HMNA 5I9XA 3BGQA 4D9UA 3DDQA 5I9YA 4ORKA 4M84A 4QMLA 1Q8ZA 4W9WA 5HKMA 4IX6A 3EQHA 2R7BA 4MKCA 4OTGA 1JVPP 4RRVA 4ACDA 3UZRA 3QC9A 5J5TA 2ETKA 3V8TA 5AUUA 1CSNA 1O6LA 5L3AA 3GCVA 5TKDA 5EW8A 2GDOA 3JY9A 3BHUA 3PXKA 5HBHA 5LOHA 1W7HA 3MJ2A 3QQUA 4IE9A 5CQUA 5HTBA 3TT0A 5A4LA 5DH3A 3U4UA 4WNKA 3SW7A 3S00A 5AP0A 2J5FA 4FG7A 4WA9A 4DFLA 3ENHA 4CSVA 4WHZA 2P0CA 1JQHA 5E9EA 4X3FA 4UBAA 3UGCA 3OY1A 2JKQA 1SVHA 2J2IB 3EH9A 5JKGA 4QMNA 1J7LA 2QG5A 3BGZA 5GJDA 3R8UA 4B99A 2A0CX 4GS6A 2ETMA 2VX1A 2YEXA 3ERKA 3MWUA 2AC5A 2JC6A 4Y73A 4PPAA 5IQIA 3KULA 3HL7A 4FYNA 4FTAA 5AMNA 4RA5A 4YZBA 5FP6A 2I0VA 4EK4A 3FQSA 5JZNA 2XK9A 3G6HA 2GQRA 3NLBA 3A7GA 4EH3A 3CXWA 4IZ7A 2BTSA 1ZZLA 2R0IA 3D83A 4EOJA 2IVSA 1H28A 2XK8A 3G15A 2W17A 2C6KA 2YISA 4K9YA 2I0HA 5AUYA 4NJ3A 2HAKA 4JRVA 5AX3A 3D7TA 3VJOA 4ALUA 3PA5A 4BCNA 3DKCA 1WFCA 2XUUA 2Y6OA 5AV4A 5IQEA 4X3FB 4HCTA 3DQXA 4NFMA 3O17A 3UP2A 3VBQA 4MWIA 3NIEA 3VS3A 4ANSA 3M2WA 2XIYA 4E4NA 4FVPA 2IVUA 3KULB 4A07A 1T46A 2O2UA 3EFKA 3FLQA 3W33A 3R9RA 3CPCA 4RX8A 4BRXA 2J0IA 4FA2A 2YA9A 3PA4A 2W1EA 2C30A 4QPAA 3KN6A 1ZYLA 4KIQA 3D7TB 4DFNA 4W8DA 3TACA 3E5AA 2G2HA 3MPTA 4XH6A 2Z8CA 4GVJA 4QT1A 4XG2A 5HQ0A 1FPUA 4L8MA 4XV1A 4BGQA 1Y57A 4C3RA 2PUUA 3MH0A 4XP0A 2FVDA 2AEGA 2BKZA 4D4SA 4MUQA 4DTKA 1ST4A 4F7JA 3V04A 4GK2A 5IA1A 2CKEA 4XUFA 3VVHA 3VUGA 2GNFA 2WELA 4I6BA 3C13A 3GI3A 3O7LD 2WMTA 3AC2A 5AIKA 4AU8A 3CP9A 5F9EA 1WAKA 3A60A 5KHXA 4HCUA 4ALWA 3ACKA 4J53A 2GTNA 4JX3A 4EWQA 5TT7A 4GMYA 3IDPA 4ZZMA 4GKHA 3LJ1A 1UVRA 4E6CA 4UMUA 3KCKA 5F95A 1OECA 5J8IA 5L2WA 4WUAA 2QVSE 2XYUA 4LGDA 2ZYBA 3NYOA 2PVLA 4AW2A 4E93A 4ZY5A 1E9HA 4B0GA 3O2MA 4AZFA 4DH1A 2GMXA 3NYVA 4APPA 3A7HA 3AT2A 2HZ0A 3CQEA 1M7QA 3NUPA 4BWPA 4BYJA 2QOKA 4TY1A 3HKOA 3RM7A 3I5NA 3PJ1A 4GK3A 4P5ZA 3FSKA 5AAFA 4AG8A 4JDJA 5HZNA 5KMMA 3QTIA 2F2UA 4WSQA 3EL7A 3ORKA 3R21A 5FDXA 3ID6C 4M8TA 4X3FC 4FL3A 5CQWA 4FV9A 4BVUA 2W5HA 3RCJA 1PW2A 3GFEA 4ZEGA 4GL9A 5AX9A 2ZFYA 4KS8A 1OKZA 3EN7A 2YHVA 4RX5A 2JGZA 4O0RA 3O8PA 4BDCA 4O22A 1IRKA 5EH0A 3TZ7A 4OTDA 4U97A 4GG5A 1FVRA 2YCSA 3OCSA 3E8DA 3QD3A 4CZYB 2VO0A 3V5WA 1OIRA 2OZAA 3II5A 4IX3A 5H8EA 1VR2A 2BROA 2OW3A 2IZSA 3U51A 4IJ9A 2SRCA 2BZJA 3AMBA 3R02A 3VBYA 4YUQA 2W4OA 4GIIA 4JQ8A 5KMOA 4D55A 5HNIX 5BX0A 5C9CA 4IVBA 3JPVA 4X2NA 3ZM4A 2XM8A 4G3CA 3KXNA 3O51A 2GNLA 3AD6A 4MD7E 4V01A 3MH2A 2VGOA 3QWJA 5I9UA 4EQMA 1Q8TA 1KE8A 1MRVA 2YM6A 3C4XA 3EJ1A 5I9WA 3QAME 5B7VA 2BVAA 2OZAB 3NGAA 4GU6A 4II5A 3R7VA 4F78A 5K4JA 3OT3A 1OKWA 5H8BA 3RWPA 4XYFA 3R01A 2WMAA 4FT9A 4AA4A 3FMHA 2HXLA 4IQ6A 2QOOA 4L6QA 2I1MA 3O5AA 4I24A 4IANA 2ZB0A 3E8EA 4IB1A 2Q83A 3EWHA 3L9LA 1U46A 5FTQA 2JIIA 3KRWA 3BGPA 3K5UA 5DLSA 4I0RA 3C4CA 4AZWA 4EEVA 5HVYA 3VNTA 2W1ZA 2C1BA 2GU8A 3BU5A 4N57A 2R3NA 4BDGA 4C2VA 3R8VA 3F5UA 4DG2E 2NO3A 3K3JA 2QHMA 1XHAA 1GZKA 3GU8A 3I7BA 3PFYA 3E64A 2JKMA 1NA7A 3D14A 3MIAA 3UDTA 1IR3A 2YCQA 3LJ2A 2Y0AA 4KABA