3EQHA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a ternary complex with u0126, adp and mg2p
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
343
structure length
314
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 314
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqhA01
3DJ5A 2W4OA 1O6KA 4GEOA 5J1VA 4XCUA 4G6OA 4FBXA 3CD8A 5HO6A 4IBMA 2PK9A 4FTNA 3RP9A 2V5QA 5L6OA 2BRMA 2BUJA 5I5ZA 4TYIA 3SXFA 3CKWA 4FL1A 2R3HA 4BICA 2F57A 4EHVA 3VQHA 3GXLA 5HTCA 3PJ3A 2BDFA 5GJGA 4FE2A 3WE8A 3ZONA 2UZBA 2WTKC 4AAAA 5CWZA 1UU7A 1YXXA 2ITUA 4U9AA 2VTOA 3GCSA 5E90A 5C03A 4Z7HA 3T8OA 3HV6A 4FKLA 2XK3A 2XNBA 1Q3DA 4CKIA 4DFBA 4DF3A 5IEXA 1KSWA 1WBOA 2RGPA 3BBWA 1NW1A 4FG8A 2GHGA 3V8SA 4IB0A 3LQ5A 3N4TA 1PMVA 3NEWA 4KBAA 4YLLA 5FM2A 5K0XA 1P14A 4UV0A 5BYZA 5HBEA 1XKKA 3VBQA 2VZ6A 4USEA 4FIJA 3ZXZA 2UW6A 4BHZA 4S31A 4F63A 3UOJA 4ZJJA 3KXNA 4G3EA 2VNWA 3M1SA 5FXRA 4C34A 4YHFA 4DFZE 4FGRA 3PXQA 3T9IA 3D5XA 4FZAB 1URCA 2G2IA 5EM8A 4C2VA 2ITYA 3JYAA 2A27A 4DTBA 3L9MA 4QTCA 5HHWA 4GVJA 3VUDA 4YU2A 3QHRA 3MV5A 4C4EA 5HVYA 4NFNA 3DPKA 4YNEA 4AFEA 5AP7A 3MFTA 3QKLA 3U6JA 2J90A 3IK3A 3GT8A 3ORNA 4U79A 3E64A 1VJYA 5KMIA 3K5UA 4ORKA 4JT3A 3TZMA 1LR4A 2I0HA 1BLXA 2FVDA 1L3RE 4QOXA 4RWLA 4D9TA 2YZLA 5JH6A 2CCHA 4RPVA 3WF5A 4XNEA 2UZNA 4B8LA 4HVDA 4PF4A 4QMZA 4BCNA 3R9NA 1KOBA 4CZYB 3FQEA 3QUEA 3HV3A 4Y46A 2V62A 3BEGA 4TZRA 5FQDC 3PE2A 4BKZA 4ANNA 4TRLA 5EOLA 3MGYA 5ANDA 3ZUUA 4WIHA 2E2BA 3BX5A 3OUNB 2VTIA 3RPYA 4PTGA 1H28A 5ETIA 3KF4A 3QX2A 4BWXA 2HWOA 2VO0A 5AUTA 2ZV2A 1YWNA 4EYJA 3FL5A 4M12A 5HG5A 3L9LA 2UZVA 4CCUA 2I0EA 2QURA 3O8PA 3ZSIA 3P7CA 4O7SA 5HESA 3DQXA 5KCVA 3UIUA 4GRBA 4O7RA 3OVVA 4R3RA 4QNYA 2FB8A 4D4SA 4HVHA 4O0SA 2HWPA 4DHFA 3W32A 4GG5A 4LUDA 5H2UA 4YC6A 4D1XA 1WBVA 4DGNA 2X6EA 4BKJA 3TJDA 4IWPA 4NW5A 4U3YA 2XUUA 3HGKA 3WIGA 3VUMA 3BPRA 4NM7A 1JKTA 4I4FA 2GPHA 3KXGA 3D15A 5A4EA 4IX3A 4R77A 2AUHA 4L52A 3QQLA 4GIIA 3PIXA 1KUTA 3I6WA 3CJGA 5H9BA 4K77A 5L6PA 4JDHA 5D11A 3QC9A 4RFZA 3VUGA 2PUNA 2W06A 3KU2A 1ZYLA 3M42A 2Z7RA 2QD9A 4NH1A 2QO2A 4GH2A 3A62A 3VS4A 5AR7A 3VW8A 1PF8A 5A9UA 2WTIA 5DT4A 3NCZA 4L67A 2VGPA 3K5VA 4QD6A 3EB0A 3DCVA 2X8DA 3EHAA 1GY3A 5C8MA 1YWRA 4ASXA 2GQSA 4MF1A 2RFSA 3DDQA 4PTEA 1IA8A 3SGCA 4I92A 1DM2A 1PXJA 2CKEA 5AA9A 3KMMA 2VGOA 1PKDA 2XYNA 3OWPA 5CSWA 4GK2A 5FD2A 3TKHA 4AN2A 3HRBA 4IW0A 4NM3A 5A4CA 5J9LA 2C6MA 3R2YA 4WD5A 5FUTA 3FBVA 4IB5A 4U81A 4ZZNA 3OF0A 5IQAA 1M14A 2PVJA 5EM5A 4BWPA 5JGAA 3D5UA 4RZVA 3KREA 1MQBA 3TZ9A 4ERKA 3BGZA 3HKOA 1YOJA 2NRUA 4J52A 3G6HA 3DKOA 3HA8A 5CF6A 1SVGA 4EH9A 4FV7A 5B2MA 1Q3WA 3NYNA 4HYUA 2XH5A 3GCVA 4WG4A 5E8YA 4F6WA 1BI8A 4I21A 3RWQA 2YIQA 4ONAA 4ZTRA 4F64A 3ZC5A 2V22A 4YUQA 2PWLA 3D7TA 4C4IA 3HL7A 4U80A 3GNIB 3ITZA 3PYYA 3VS5A 3ORPA 3VQUA 3COKA 4WNPA 2ZM3A 3KMWA 2X0GA 4AZEA 2X39A 4H58A 4F7JA 3NMUF 3E88A 4AS0A 5CEOA 3P08A 5F1ZA 3MY0A 4YHTA 3NUAA 3I60A 4MF0A 2I40A 2WMXA 4FT9A 1W83A 4GU9A 5GHVA 4G6NA 4KKEA 2R3QA 4YZDA 4CMTA 3O2MA 4LG4A 3DY7A 5KMOA 2ZAZA 2J51A 3OOMA 4D4VA 1OI9A 4FICA 5DR6A 2BFXA 3NS9A 2OXDA 2OZOA 5T6KA 2OK1A 3DFCB 4DGMA 5EM7A 4PP7A 4ZS4A 2C6EA 2CGXA 3OXTA 3N4VA 2W1EA 4U45A 5EM6A 3E8NA 4L3LA 2ZV7A 4I1ZA 4UX9A 2C6TA 3AD5A 3OWLA 5FXSA 5HU9A 5HVJA 3MDYA 3IECA 3NW5A 4BCFA 4FIIA 4NTTA 4BDFA 3GQLA 2J0LA 2YIXA 3UVQA 1AD5A 4ANBA 3KFAA 4P2KA 4D1SA 1G8AA 2B7AA 2BMCA 2IO6A 3AGLA 5A4TA 3SAYA 2DS1A 2WMTA 3PJ2A 5JT2A 4E5BA 4IVCA 5LJJA 3P4KA 4FNWA 3K54A 4M69A 3RCJA 3F9NA 3MN3A 2QI8A 5L8JA 4FKOA 4RX7A 4AZTA 4FEVA 4EKLA 2XB7A 4FEUA 4TYEA 1CMKE 4KINA 1OKWA 2Q83A 1J7IA 3H9RA 3R9HA 3A7HA 4HNFA 1H00A 2C6DA 2WMAA 3HUCA 3JUHA 5CI6A 2GHMA 3W33A 3L9PA 2PMLX 2JDVA 1H1QA 1PXMA 2XS0A 3F7WA 3TV6A 1ZY4A 3ZO2A 5BUEA 2GNFA 4AWIA 2H34A 3RPSA 3QUPA 4BHNA 4YJVA 2WMWA 2J7TA 2JAMA 4EYMA 4XV9A 4RIYB 4DFUA 2W1ZA 2YJSA 3LFBA 4ENYA 5IU2A 1OBGA 1TKIA 4EJ7A 4HCVA 3FMLA 4YLKA 3SOCA 4H36A 1NVRA 2F2CB 4FKJA 3OEZA 4YC8A 3ZFXA 3VBXA 4R7HA 4BN1A 5ACKA 1XH9A 3TKUA 3NIEA 4FKRA 2C3KA 2CNUA 3GBZA 4AP7A 2R4BA 1APME 4BBMA 3NGAA 4ZSAA 5JQ5A 1SM2A 2J50A 4AX8A 3NX8A 3O71A 2OU7A 3HDMA 3AMBA 4R8QA 4ZIMA 3C7QA 5HVKA 4KS8A 4PV0A 4UMPA 4O96A 1JAMA 2PMIA 4M97A 4QP2A 4PDPA 4CTCA 1JQHA 4FTIA 2R0IA 2CLQA 4ZSJA 3VUTA 2BZIB 5G6VA 3Q9WA 2YDIA 4O6LA 1TVOA 4FMQA 3CTJA 4X21A 4KIKA 2WNTA 2NPQA 4O1PA 5DI1A 3UYSA 2UZWE 4A9YA 2BZHB 2IW9A 4PPCA 3FI3A 4QQCA 5JMSA 4TWCA 3MVMA 2PVYA 3PLAE 3LFCA 3R8VA 1GIIA 2OIQA 5LWMA 3C4CA 2ZB1A 4X3JA 3EZVA 1IASA 4TW9A 4U40A 4BIEA 5IQFA 2W1IA 3CPBA 3PIYA 3V5QA 4D2PA 2PVHA 3LQ8A 4W9XA 5HZNA 3VBVA 3KGAA 3LFQA 3TL8A 1PY5A 3LXNA 4RQVA 4XH6A 5IA3A 1P5EA 2QG7A 1XH6A 4DITA 3EQGA 3FI4A 3O17A 4LL0A 3Q4UA 2YISA 2YDKA 3OWJA 2VTSA 2P4IA 1H1PA 5J8IA 4KIQA 3QQJA 3DLZA 5IA1A 4CMOA 4WT6A 5M44A 4BCPA 5TR6A 3AC2A 4CFNA 2IPXA 4MBLA 3MTLA 1J3HA 4EK6A 3R7IA 3QCXA 2R0UA 5J5SA 1W8CA 3E7OA 2C1BA 3MTFA 3QBNA 2R3GA 4FZDB 4NM5A 3KULB 3DDPA 4E4XA 2ZB0A 1IRKA 1R39A 2WTKB 2XKEA 4G3DA 3EWHA 3BHHA 4FV5A 4G17A 4XG9A 3PLSA 2BHHA 1YKRA 2XKFA 4N70A 4DFNA 2XIZA 4RMZA 4F65A 4GT4A 3WF8A 5ANGA 4FTKA 2PYWA 1WBSA 4C59A 2ZM1A 3QZHA 2WQMA 3SXSA 4KA3A 4MYGA 4D0WA 4ZAUA 3EQCA 3QTIA 5ACBC 3QALE 2X4ZA 3NVKI 3LJ0A 5DVRA 2Z02A 1QMZA 4FKUA 5EG3A 3MH2A 4K6ZA 2ESMA 2OKRA 2I1MA 3C9WA 3D94A 4LV8A 5HD7A 3R8PA 4F9WA 3QRKA 4KNBA 5F9EA 3MPAA 3RPOA 3H9OA 3B8QA 2GU8A 2W5AA 4DTKA 4EH8A 3G5DA 3S3IA 2GQRA 2OLCA 3TUDA 3E87A 3S1HA 5IQDA 3E92A 1Q8WA 2PUIA 3MFSA 3Q4CA 5JRSA 3AD6A 3U55A 4I20A 3UO5A 4K1BA 3OCBA 3A7GA 4XOZA 4UMQA 5M4CA 4XS2A 3OFMA 2XK9A 3QXOA 4AA0A 4GUBA 3LFSA 4C02A 1ZLTA 2QOOA 1YWVA 1H27A 3ZO1A 4F1OA 3AOXA 4QPMA 2J4ZA 3OBGA 4C35A 3FYJX 1H01A 4FTAA 4RWIA 3RAWA 1OB3A 2PMNX 4QQ5A 3VO3A 2R3LA 5B7VA 5HX6A 2GHLA 5DEWA 4OTQA 5AWMA 3D5VA 3AC1A 4FEXA 2PPQA 2BCJA 3V5TA 4BCMA 3OCGA 4O1OA 4U8ZA 4NSTA 4CFXA 4IHPA 3MI9A 2R3KA 3E93A 2W5HA 4C58A 3Q52A 1JKSA 2NP8A 2PZ5A 4GT5A 2BROA 3A4OX 3A7FA 3LM5A 3R83A 3WF9A 2GNGA 3N51A 1YHVA 2BPMA 4Y5QA 2C0OA 4JAIA 3UZRA 5CEIA 1VYZA 3DAJA 3MFRA 1PXKA 3K3JA 3NCGA 4X3FC 3R00A 2OJIA 1H08A 5AUXA 1RW8A 4F99A 3LXPA 2UW9A 3UIBA 2WO6A 4O0YA 4F1MA 4H05A 2VWWA 4AGDA 4BF2A 4CZTA 5I3OA 1OECA 2JIIA 1R0PA 2R9SA 4BY9E 4EK4A 3WF6A 3ZSGA 5HIEA 3BLQA 5BYYA 3ODYX 2YJRA 4P7EA 2J9MA 3BWFA 5CSVA 4D2VA 5BPYA 1Y91A 2UVXA 4PMMA 2IG7A 4FZFB 5JSMA 3IONA 4BCJA 5HNGA 5HO7A 4D1ZA 1H0VA 4XG7A 5M4FA 1JSVA 2ZM4A 3DNDA 4USDA 4UYNA 3UBDA 3VWAA 3ATSA 3NNWA 4PDSA 3BYUA 3ZUTA 3CEKA 4BKYA 4PTCA 2DWBA 4RVTA 3NUXA 5AADA 5IUIA 4TYHB 2W1GA 5CVGA 1SNXA 3FI2A 4KIOA 5ANOA 5T68A 3TG1A 3UOHA 2WKMA 3IW4A 4ANSA 4NIFA 4R5SA 2VO3A 4NM0A 4YLJA 4XG2A 2IZSA 5IPJA 1HOWA 3T9TA 3BI6A 1M52A 2OGVA 4C57A 4GSBA 4C3RA 3E8EA 2UUEA 5FXQA 4NJ3A 3R7GA 3WE4A 3CS9A 5K5NA 5BVEA 1BMKA 2QQ7A 3PY0A 2C5YA 2OWBA 4A06A 2YWVA 4UB7A 5HIBA 4RBLA 2RG5A 2X81A 1VR2A 3RCDA 3ULIA 4BCQA 4C33A 2GNLA 4EOOA 4OT5A 4DG2E 5B2LA 4I0RA 3T3UA 4PL3A 3GP0A 4IH8A 2XBJA 2JDSA 3GCUA 3MB7A 3EKNA 4R7IA 3TIZA 3UNZA 4HVIA 4Z9LA 3ZFYA 1MUOA 2HENA 4RSSA 3OTVA 4YC3A 5CU4A 3W2PA 4AXAA 3C0GA 3D2IA 3GOPA 1YXVA 3GGFA 4YO4A 2R3FA 3LVPA 4JRVA 4E26A 2X1NA 3LHJA 1PXIA 5IISA 5E8ZA 3ZUVA 3FMDA 1PYXA 3FKNA 3DBEA 4O2PA 3ZH8A 4YTFA 5E8VA 5GIOE 2FYSA 3THBA 5JRQA 4G1WA 3QQHA 4U6RA 4Y72A 3H10A 2CKQA 2PZIA 4ASEA 5CXHA 4ASDA 5K0KA 4JI9A 3UIXA 3SW4A 2QKRA 3KRWA 5DOSA 4UY9A 4ITHA 5LCJA 3N9XA 5H8EA 5C27A 3ZRMA 4O21A 2OXYA 3F5GA 2IZUA 4HPTE 4BDGA 2RF9A 1NA7A 2FH9A 2WB8A 2VTMA 5E8TA 3UPZA 4MK0A 5LVMA 5EI2A 4GK3A 4AZSA 4NIFB 3LM0A 5KE0A 3VS6A 1GAGA 2F7ZE 1Y8GA 2YITA 3BU6A 1UU8A 4U97A 5CVFA 4IB1A 3ZS5A 3C5IA 3VNTA 1M2PA 2WTWA 4OBPA 5EQEA 3FZOA 5HI2A 5H3QA 4EQMA 4E5WA 3U4WA 3WF7A 2UZLA 4P5QA 2W9FB 2QOHA 1O9UA 2NNWB 1B38A 4BCGA 5IQCA 2YCSA 3G6GA 1WCCA 1JVPP 2VWBA 4KBKA 4Q9SA 2GNIA 2VTQA 3R1NA 1CKJA 4WO5A 4CKRA 4Y5HA 1PXOA 1GIHA 2B9JA 3PXYA 3DT1A 2YERA 4HNIA 3NAXA 4RC4A 4WKQA 2EB3A 3QYZA 1ZXEA 4R6VA 1H26A 5BVDA 3ZSHA 5M09A 4V0GB 5L2WA 1MQ4A 5E8SA 5DT0A 3U6HA 3ORIA 3DBQA 4YJQA 3EQIA 2PE2A 2WELA 4DG0E 5IEVA 3Q2MA 3PSCA 4NKAA 1GZ8A 4M0YA 5AV4A 2JIVA 3CP9A 4XRJA 1WAKA 4BI0A 4D2WA 4J96A 3ROYA 2GS7A 4FSRA 3AD4A 3IO7A 3ALOA 4IVAA 3Q2JA 4YTCA 4BGHA 3FSFA 3HV4A 2AC3A 5HD4A 3QQGA 5AIKA 3O23A 3A99A 2C6IA 5B0XA 5J79A 1YQJA 5FEEA 4F08A 3FLNC 2BAKA 4X2JA 5DFPA 4IZ5A 2ERZE 3NUPA 4DINA 3O8UA 1OPKA 3VULA 4HW7A 4UWCA 1GNGA 3NIZA 4B6LA 4RX9A 4ALWA 3AQVA 1TQPA 2UZDA 4UEUA 2ITTA 5HCXA 3W8QA 3PA4A 4DFLA 1UNHA 5BMSA 3BEAA 3DAKA 3ANRA 3DBDA 3W2CA 5CU2A 3A8WA 1IAHA 4C4HA 4JDIA 3SRVA 3TKIA 4XUFA 2PE1A 2YIYA 2RFDA 4IZYA 2CLXA 4V05A 3JR1A 4O7WA 2JKMA 2ZMCA 2CN8A 3W8LA 4AU8A 2I7QA 3FZSA 1W0XC 4DH8A 4OT6A 4YR8A 3ENMA 1EH4A 1URWA 4L00A 5IQEA 3FWQA 3FKOA 3FHRA 4Y85A 3UNKA 2XIKA 4IVBA 4QMXA 1UWHA 4ZS0A 4BCIA 4PMPA 3OW4A 4V04A 5DA3A 4GV1A 2QOBA 4G16A 2HAKA 4YSMA 5GNKA 4LRJA 5I0BA 2GMXA 5AV2A 5D10A 3WZDA 4NT4A 4DH1A 2ITVA 2FA2A 3NUUA 1V0BA 3BV3A 1AGWA 4XP0A 3FPQA 4CG9A 2VX1A 1B6CB 5AM6A 2PU8A 4WNOA 4KKGA 4EL9A 3V6SA 2PVMA 2UZOA 5KMJA 1J7LA 3SXRA 3E7VA 3VW6A 5AV0A 3LMIA 2CDZA 3QA8A 3UO4A 1Z57A 4TY1A 3HVCA 5FP6A 2G15A 1YOMA 4FNXA 2XMYA 3DJ6A 3RM7A 1REKA 2R3IA 4BBEA 3WILA 3ZU7A 2X8EA 3JY9A 4RGJA 4D2SA 5C8NA 3SV0A 3ZEWA 1U4DA 5A54A 3HA6A 4G34A 3PTGA 5K4JA 4B99A 5L6WL 3TXOA 2ETRA 3PJCA 4RJ3A 4R1YA 4U5JA 4ALUA 4DEIA 5GIPE 4MNEB 1F0QA 5IDNA 3RZBA 1K2PA 3TV4A 2B54A 3U4UA 4K2RA 2OFVA 4OTWA 5I9ZA 3CTHA 4F4PA 2W1FA 5A14A 5A4LA 5I9XA 5KUPA 1BI7A 5IQBA 4N6YA 2A0CX 4EWHA 4BDBA 3IDBA 3F3ZA 3UDBA 2OSCA 2XJ0A 4X3FA 3DK6A 5AR4A 4FTLA 4FIEA 5M4IA 4YTIA 4QMVA 2PVKA 3RI1A 5CF8A 2VWXA 3DGKA 3U87A 4CYIA 5IMXA 3PDTA 1IEPA 4WNKA 3KRXA 2IVTA 3QWJA 3QCQA 4FODA 3EFKA 4E3CA 2V7AA 3Q60A 1JOWB 5AR5A 3LLTA 1ZWSA 2IVVA 3ENHA 4R5YA 2BKKA 5CYIA 3LXKA 4J95A 1V0PA 5AP2A 4GFMA 2QO9A 2XNPA 4RIWA 3NAYA 4S32A 5HE2A 2W17A 2KTYA 5EYCA 2YCQA 3DXQA 2ZVAA 4W8EA 1YDSE 1DS5A 4FSYA 4I23A 2HZNA 3LZBA 3REPA 5AP4A 5KZ0A 4FGBA 4J71A 2PVFA 1PXLA 5AMNA 4QTBA 4WG3A 3ORXA 5DMZA 5IEYA 2WPAA 1IA9A 4I5MA 3N4UA 2WZJA 3AGMA 3L8XA 4FNZA 3RPVA 2CJMA 4YGAA 4LGDA 3ZLYA 4U44A 2P2IA 5F95A 3R0TA 2P33A 2JKQA 3BQCA 2R3OA 3R30A 2ITNA 3OXIA 3VJOA 4E7WA 3E3PA 2CNQA 3MJ2A 3ET7A 4XG6A 2WEVA 3SG9A 2PTKA 5F4NA 1MP8A 3R7YA 4JX3A 4EOMA 3KL8A 2UW3A 3TDVA 4ZTHA 4E8AA 2FSOX 3KF7A 3BYSA 2EVAA 2EXCX 4YJUA 3OOGA 2X8IA 2OJJA 1X8BA 5HTBA 1E9HA 4W4YA 4X3FB 1OVEA 1WBPA 3UQGA 4YMJA 3GC0A 3QD4A 2LGCA 3COHA 3PIZA 4J97A 3PE1A 2YM7A 4JBOA 3HLLA 4A4LA 3DBCA 3G0FA 3AC4A 4WBOA 3TNHA 5DRBA 3R9DA 2XRUA 3GU6A 5FBNC 3RWPA 3VHEA 2GS2A 2REIA 3PJ8A 3R28A 4FNYA 2VAGA 3HMIA 3VVHA 4DLIA 4RVKA 2YN8A 4IC8A 4NL0A 5C4KA 4CV9A 3HMNA 1Q61A 1XBBA 3KXMA 4APPA 1HCKA 4L45A 3DNEA 1YDTE 4J8NA 3I0QA 4MWHA 4ZJIA 3RBWA 3CJFA 5EQPA 4USFA 4I5PA 3Q96A 4FIFA 2YM5A 2WMQA 4W4WA 1U5QA 3EYGA 4GU6A 5CF4A 1Y6BA 2I0VA 4YJTA 3C4FA 1XH7A 4FTOA 2YCRA 1WVWA 3C4ZA 3F5PA 4DCEA 2BDJA 3HDNA 3G9LX 4IFGA 5FTGA 3L1SA 3MVHA 5CZHA 5BUJA 4QP3A 2GFSA 3NYOA 5CT7A 3G15A 3B2WA 3FMHA 3OMVA 5D9HA 4ZEGA 4JBQA 2PZPA 3RINA 4E20A 3O50A 3QTZA 1FMOE 1GZOA 3PXFA 4H3BA 2UW5A 4Z16A 5LVNA 2ETKA 2Z7QA 3GC7A 3F3WA 5C8KA 5EYDA 4YZ9A 5DLSA 1FGKA 5CVHA 4BGGA 3QKKA 5LVOA 4C4GA 2BKZA 4F9BA 3SW7A 3UO6A 4CV8A 4PRJA 2R3RA 4RA5A 5DN3A 4BDKA 1WMKA 3F3VA 2GTMA 5CTPA 4UZHA 4F70A 3DB8A 4L3JA 3EIDA 4J1RA 1Q5KA 2WU6A 4LM5A 2VWUA 2DQ7X 1XBAA 3DA6A 5HBHA 2YA9A 3FMNA 2W1DA 4EZ5A 4QMOA 3NPCA 5HU3A 1SZMA 3DK3A 4JG6A 4BYJA 4M7IA 3ZC6A 4PDYA 4A9TA 4FIHA 1NT2A 3QU0A 3H0YA 3BBTB 2XK4A 4BCOA 3WI6A 3ZXTA 3QF9A 3QTQA 4IDTA 3PA5A 3AC8A 4FTCA 2IW6A 4ACMA 2P3GX 4B8MA 3MJ1A 3I4BA 2UW8A 3C4WA 2VN9A 2VWVA 5DR2A 5D1JA 1LEZA 2LAVA 5GJDA 4BIBA 2HW6A 3NYVA 4NZWB 3MVJA 3VHKA 4TWNA 5EKNA 1SMHA 3KKVA 3PWYA 2H96A 3ACJA 5TOZA 1S9IA 3Q6WA 3GU4A 4IZAA 1FVVA 3LIJA 4NFMA 3PVBA 4IWDA 4HVSA 2C6KA 3FJQE 3ZBXA 4EOSA 4GK4A 5IF1A 3TNWA 3PSDA 4C38A 1Q97A 2C30A 4FYNA 5CQUA 4AT5A 4E6AA 4FG9A 4MH7A 4FKWA 2JKKA 4IWOA 2HCKA 1H1WA 2R2PA 3V04A 4JRNA 4PMSA 3BE2A 4QYEA 5AJQA 1OIRA 2ETMA 4JQ8A 2H6DA 3EFLA 4L42A 3BYOA 4DBXA 4XG3A 4D28A 3UC4A 3AT3A 4MKCA 4LOQA 3QTRA 3K3IA 1YI6A 2OW3A 5TKDA 5HQ0A 4AG8A 5HG8A 3TTJA 4FL2A 3R71A 5AP0A 4AT4A 1DI9A 4QT1A 4RG0A 4XEYA 5CSHA 3EQPA 5FTOA 5KMNA 5A3XA 4Y73A 4RFYA 5BVKA 3ZCLA 4CRLA 2J0IA 4XYFA 4M8TA 4PL5A 4QMNA 3FZTA 3SDJA 4EHEA 2XIXA 2P2HA 5KKRC 3SVVA 2C5NA 3D7TB 4MBJA 4KIPA 4N0SA 4Q9ZA 2R3PA 1YW2A 2OICA 4J53A 1PW2A 2QVSE 2J5FA 2Q0BA 2C69A 1G3NA 2H9VA 3BRBA 5AAFA 3I1AA 3R9RA 1RJBA 3G51A 4IIRA 3QGWA 4I24A 3C4EA 4UXQA 3MA3A 3G0EA 4HYIA 5ETFA 2B53A 2XJ2A 2QOKA 1DAWA 3DZQA 2UVYA 2ITPA 4OR5A 4FUYA 5LMAA 3QZGA 4YZMA 4D0XA 4OUCA 5HNBA 5F20A 4J99A 2B52A 3PA3A 1UKHA 4C0TA 3CBLA 4OTDA 4E6QA 4WRGA 3U9CA 5EI6A 4PP9A 2QLUA 4DCAA 2ITZA 1A9UA 4F7SA 4G5JA 4PNKA 5HLWA 4KKHA 4S34A 4I41A 3PVGA 5EI8A 3H4JA 2PUUA 5DBXA 1QPCA 4YP8A 4FVPA 3LKMA 2AC5A 3TDWA 2E9VA 3FMJA 3B8RA 1O6LA 3FQHA 3R8LA 5GZ8A 2FSTX 4EQUA 2O63A 4I93A 1YXUA 2QOFA 3K2LA 5EW3A 4FKTA 2XNMA 3VIDA 1SYKA 4F7LA 4M69B 3W16A 4ZSLA 1KE5A 2VNYA 4O27B 1CDKA 2J2IB 3KY2A 5E1SA 1WVXA 3ORKA 4PDOA 4CYJA 1OPJA 5JGDA 5E92A 5HBJA 4ACDA 4CT2A 5KHWA 1MRUA 1U5RA 3ZO3A 4ZTSA 3CGFA 3MY5A 3QL8A 4LMUA 5I4NA 3HUBA 4PPBA 3PP1A 3MB6A 4ZP5A 2YCFA 2C5XA 5CAQA 2ZDTA 3W2QA 3NDMA 1NXKA 3E3BX 4KSPA 4GJ3A 3FMKA 2X7GA 5JGBA 1PHKA 3S2PA 1H1SA 4XHKB 5CU6A 3SX9A 3OG7A 2FSLX 2Y8OA 4G2FA 5AIRA 4FKVA 4B7TA 3WBLA 3PY3A 1LP4A 3KEXA 4D4YA 2V55A 4O6EA 2CN5A 2UVZA 3GC8A 4L68A 3LCDA 2ERKA 4QTEA 4LRMA 2CSNA 3D9VA 4L7FA 2W96B 1XR1A 2F7EE 2VV9A 3HX4A 4DEGA 4FKQA 3LLAA 5LOHA 5EDQA 5LMBA 3TEIA 2PVRA 5CENA 5E8WA 4BTFA 4KBCA 4AUAA 4F0GA 3TI1A 4X7QA 4YNOA 4FV8A 4UWBA 4ZTQA 3WZEA 1H24A 4TNBA 3W1FA 3MFUA 3NSZA 2QR8A 5FEQA 4RJ4A 5DHJA 1R1WA 4KIKB 5KHXA 3VBYA 3WZKA 2W4KA 1OL2A 4BL1A 4FUXA 5GINE 4ZK5A 4A4OA 2C3JA 4EKKA 3SA0A 4R78A 3Q4ZA 3IGOA 3MY1A 3QRTA 4EBWA 1M7NA 3CE3A 3UVRA 2EXMA 5AEPA 5I9VA 4UBAA 3VUHA 3HRFA 4MHAA 4ZJVA 3W10A 2XNOA 1HCLA 2BRNA 2WIPA 4IDVA 4E4NA 5HNIX 2F2UA 2W05A 3ZZEA 4CLJA 4FEWA 2OJ9A 3GVUA 3SQQA 1GIJA 3SKCA 1YDRE 4DGOA 3ZM4A 2PMOX 4MXAA 2XKDA 5HGIA 4FVRA 4KS7A 5LCKA 4GFGA 3IQ7A 2ZJWA 5BNJA 4IAZA 4ALVA 4AOJA 3DB6A 3FY2A 3H9FA 3P0MA 4FTUA 5G1XA 1F3MC 5KMLA 2W5BA 4U41A 5K5XA 3RPRA 2PZRA 3KXZA 3LAUA 4QP8A 4EZ3A 3TCPA 5DGZA 2R3NA 4NEUA 1XH4A 3LW0A 3FEGA 4K0YA 3NW6A 3UJGA 4X6QC 4B9DA 2DUVA 2YLFA 3QAME 2IVSA 2OF4A 4L6QA 5HE1A 5LMKA 1CKPA 4OLIA 4RJ6A 1Y57A 1NVQA 2XBAA 5B2KA 4CVAA 3EJ1A 3EZRA 1UU3A 4I5CA 5IH5A 2RG6A 3MWUA 2C68A 2UZTA 4QTAA 3KN5A 4PMTA 4O2ZA 4JOAA 4YURA 5BVOA 5J7HA 4OW8A 3W55A 4EHZA 3KCKA 4M66A 4OBQA 1ZYSA 4BDAA 4EK8A 1OUKA 1ERKA 4M3QA 3FZ1A 3BZ3A 1GJOA 4I6HA 1P2AA 2XM9A 1G5SA 3NR9A 2EB2A 4IX5A 5DRDA 2ZV8A 4FT0A 4JG8A 5M53A 3OP5A 5ANKA 1WVYA 4ZZMA 3RK7A 1WFCA 2IJMA 3E8CA 3HRCA 1XH5A 3P1AA 2OH4A 1FGIA 4FEQA 3ZTXA 2WTVA 3UP7A 2B55A 2G2FA 4FX3A 3SHEA 4C4JA 4BDHA 3JVRA 3UQFA 4FT5A 5ITAA 4ZLYA 3V5LA 3H3CA 2XKCA 3DJ7A 4W9WA 2O5KA 1JWHA 2HXQA 3GENA 4I6BA 1OL7A 2WMUA 4RJ7A 3ZFMA 4ZLOA 2P55A 3CY3A 5FEDA 1GOLA 4O7NA 3GQIA 2EU9A 4E4MA 4PX6A 3QLGA 3F88A 2IWIA 3SOAA 4RLKA 3QA0A 3DAEA 1FMKA 3A7JA 3KA0A 3VN9A 3SC1A 4ANMA 5M4UA 3DLSA 2JEDA 4XLVA 4A7CA 3ZBFA 2VU3A 3V5JA 4I22A 3MBLA 1PJKA 3QGYA 4EOLA 5L2TA 1ZAOA 3UQCA 1ATPE 1FINA 2QNJA 4I6FA 2BRBA 5HG9A 4NTSA 1W82A 3C13A 2HYYA 3LPBA 5HTIA 4R1VA 3CXWA 5ANJA 4RVMA 3RAHA 4AW1A 4R7BA 4FG7A 2YDJA 4HGLA 4BI2A 4PWNA 1Q24A 3DU8A 3ATTA 1J1CA 3C1XA 4FI1A 4JL9A 4O7YA 3HV7A 4W8DA 4QP4A 4ACCA 4XG8A 1I44A 1OL6A 3GB2A 4M13A 4QYYA 3U8WA 4YTHA 4IX6A 2W0JA 1KOAA 3KVWA 4XMOA 2XZSA 4ASZA 3GEQA 4II5A 2G01A 4MWIA 4ITJA 4CRSA 1QPEA 5FDXA 1OZ1A 3CLYA 3IW5A 4UZDA 2J0KA 5JN2A 1UU9A 1ZOEA 3F5UA 1H07A 2Z2WA 3KRJA 2B9HA 2OO8X 3ACKA 3BYVA 2X7FA 4GYGA 4O38A 1YOLA 2JGZA 4YJPA 2IZTA 2QKWB 5JKGA 1J7UA 3FLWA 2RL5A 2BTRA 3MH3A 3TWJA 1CTPE 3Q6UA 3UGCA 2C47A 3IW8A 4FOCA 4IJPA 4WUAA 4YBKA 4YJRA 2J5EA 5EOBA 3RNIA 2Y0AA 4L9IA 2CKPA 1QPJA 2VTPA 4QYGA 2WOTA 4X6RA 2WTCA 3S4QA 4DGGA 4LV5A 3AT4A 4BCKA 1PMEA 2XM8A 3CR0A 3M11A 4HCUA 4L01A 5EKOA 3LJ1A 2Y4IC 2ZV9A 3E63A 4EH3A 1P4OA 4MCVA 4C4FA 1XJDA 4CQEA 4FSUA 4WSQA 2CPKE 4D55A 3BKBA 5CEKA 5DT3A 2C4GA 2E9NA 2E9UA 3EMGA 3Q9XA 2ITQA 2ZDUA 5DPVA 4S30A 4EBVA 5BX0A 3HMPA 2W9ZB 4KAOA 3QCSA 5A46A 1XWSA 3NZ0A 4DAWA 3VRYA 3A4PA 2UV2A 3DFAA 1O6YA 3TIYA 3L9NA 5CAVA 2BFYA 2PVNA 2I0YA 3W18A 2HELA 2P0CA 4Z3VA 3NNVA 4QMWA 5CU0A 2XP2A 4GCJA 3I81A 3Q3BA 3UE4A 2OI4X 3PZHA 2WEIA 4O22A 5A6NA 4GUEA 2XEZA 2O0UA 2BIYA 1ZZLA 3EFWA 4L7SA 2OZAA 4FK6A 4WRSA 4X2KA 4X0MA 4ZTNA 4AOIA 4DH7A 4OAUC 3RJCA 3OUKA 3EN7A 4L46A 4QMTA 3Q5ZA 5FGKA 4AZVA 2ZMDA 1U46A 3V5WA 1PMUA 3TNIA 4J8MA 2GCDA 4O0TA 3EL8A 3PXKA 5KKRB 4MNFA 2BDWA 4XBRA 2SRCA 4BIDA 1OIYA 5AP3A 5CSPA 5IUGA 4MQ1A 5AX3A 4FF8A 2G9XA 4BYIA 1E1XA 5IUHA 5CT0A 4RRVA 3VUIA 4G31A 2XK7A 4EH4A 5FRIA 4FR4A 3FY0A 2WMSA 5CANA 3R1SA 1M7QA 4YO6A 3FLZA 2FGIA 2ONLA 4RWJA 3QKMA 4BI1A 5J1WA 1KE8A 5KO1A 2F49A 3MYGA 4LGHA 4FV1A 4RT7A 3EYHA 3F61A 3TV7A 5L8KA 2PUPA 4E6DA 3OY1A 3NRMA 1Q41A 3AC5A 5DG5A 1JKKA 3FXZA 3FMMA 4X2FA 5AUWA 5HCYA 4DEAA 5LWNA 4C61A 1XQZA 3QTWA 4BCHA 4BGQA 3C0HA 2R3JA 5BVFA 3OCSA 3BE9A 5L8LA 4X2NA 4KABA 3UG2A 3DZOA 4CMUA 5IA4A 4OTGA 2CKOA 1MRVA 3VS3A 3Q04A 3UTOA 1UNLA 4TKSA 3HP2A 1VEBA 3DXPA 1JNKA 4EUUA 5CI7A 1PRYA 3HMMA 4G9RA 4FSQA 4QMQA 3P5KA 5DYJA 3COMA 4FIGA 5D7VA 5DH3A 5D12A 2X4FA 3Q4TA 1KE9A 2OZAB 3G90X 4HPUE 4F09A 1UNGA 1UWJA 1V1KA 4IEBA 3ZYAA 4ZY5A 4DT8A 2F7XE 3NWWA 4UMUA 5J87A 2CHLA 3AMYA 1PXNA 3BV2A 5FG8A 3VC4A 2C3IB 4G3FA 3E5AA 3QWKA 2R5TA 3R63A 5HLPA 4TT7A 4Y8DA 3UPXA 5IG1A 2X2MA 3ODZX 2HXLA 3R73A 2VWZA 5K9IA 2VTJA 5CNNA 2FSMX 3TM0A 1YRPA 3CC6A 2QHMA 3R02A 4HGEA 5EH0A 4BWKA 4GKHA 4U7ZA 4KD1A 2A1AB 4NCTA 4NW6A 4QP1A 3D2KA 3FC2A 4TL0A 3KN6A 3D5WA 4M0ZA 3AXWA 3BHUA 4JXFA 3C50A 3VS7A 1H0WA 3FQSA 5GJFA 2VTRA 4QQTA 1QPDA 2ACXA 2QG5A 1Q8UA 5LVPA 4ANOA 3PG3A 4D9UA 4ZXTA 3A7IA 4E73A 2YAAA 4NWMA 3DQWA 4BR3A 2FO0A 3KCFA 3TJCA 4A9RA 3PP0A 3SRVB 5ETCA 3BCEA 1BYGA 3IS5A 3LMGA 4DG3E 3EKKA 3C5UA 3COIA 5HICA 4CLIA 2G1TA 4ZMEA 1BX6A 4F7NA 5CZIA 2BALA 2JAVA 4CG8A 4A9SA 5IQIA 5M06A 1AQ1A 3GCPA 2B9FA 2BAJA 3KK8A 3ANQA 3I5NA 5FWKK 3W2OA 3FLYA 3JY0A 1ND4A 1OGUA 2W99B 5KNJA 5M08A 2GNHA 3PXZA 3QRIA 2OG8A 4U43A 3UODA 4FA2A 2X9EA 5EK7A 3ZMMA 1M2RA 4DFYA 3I6UA 3BLRA 1W7HA 2Z7LA 3GUBA 4FZ7A 4L3PA 4QYFA 5TO8A 3QHWA 3KB7A 3QD3A 4FSZA 4PY1A 4YZCA 4IM3A 3LFFA 3BLHA 3KMUA 4TYGA 4IM0A 3VBWA 5AAEA 3BIZA 4L8MA 1SVHA 3NUNA 2ZOQA 3UZTA 4QMLA 5AAGA 2J0MB 1U59A 2JFMA 4UN0C 3ZEPA 2VWYA 4FTMA 1S9JA 1LPUA 4CCBA 1PMNA 4XP3A 1FQ1B 5BVNA 4MD8E 3DBFA 4GYIA 2BRHA 4AQCA 3RZFA 1G8SA 3UNJA 1YXTA 5L4QA 3F2NA 4LI5A 3ZO4A 3LFNA 3PY1A 1JSUA 3VF9A 4CGAA 2HY81 2JDRA 3OT8A 4TWPA 4IAIA 2XK8A 2B1PA 4OTIA 3FI8A 1OKZA 4FKIA 1OUYA 4CZUA 3I79A 3TNPC 1NVSA 3B2TA 3PXRA 1CSNA 3FKLA 1GZNA 3I0OA 2YAKA 1OIQA 1XO2B 4M67A 5K3YA 2XNGA 3TZ7A 2VWIA 2YZAA 3SLSA 4B0GA 4QMSA 1FVRA 3MESA 3PPZA 4AW5A 1UV5A 3FLQA 4RFMA 1JPAA 5JK3A 3F82A 4BC6A 3CQWA 2A19B 3PG1A 5JQ8A 4D2RA 3D14A 3DTCA 4CFWA 3O8TA 4ANLA 4OTRA 4XRLA 3LFDA 4AE9A 3VJNA 4XBUA 2RKUA 1ZMVA 2Z60A 1ZOGA 3P86A 3R1YA 4FTTA 1RQQA 4JJRA 5DIAA 5EHLA 1REJA 4BVUA 3V6RA 2XNEA 2Y7JA 1A06A 3I7BA 4AZWA 2F9GA 4QRCA 5KBRA 3HP5A 4AACA 4I4EA 3POOA 2I6LA 4N6ZA 3I5ZA 4P90A 3ORMA 3R7UA 2YLEA 2WAJA 3DKCA 4F1TA 5CEMA 3RHXA 4EC9A 1TQMA 4RIWB 2J6MA 4MXYA 4QNAA 2G2HA 1ZMUA 2JBOA 3MS9A 3W2RA 5T3QA 4BTJA 3FPMA 4AT3A 4HZSA 3F2RA 4EOJA 3VAPA 4MX9A 1YHSA 4CD0A 5GZ9A 5HLNA 4I6QA 2VO7A 3NNUA 4IMYA 4O86A 4C3PA 4G5PA 3FAAA 4ERWA 4O81A 1I09A 3QYWA 4Q5HA 5TF9A 4FTJA 4ZMFA 4ACHA 3PUPA 4DBNA 2WXVA 2XYUA 3HNGA 4O7VA 1Q4LA 1B39A 3OT3A 4BBFA 4E6CA 5JEBA 3ZM9A 3TT0A 1XBCA 4EOIA 3LFEA 5BUIA 5KMMA 1W84A 4UYAA 3F3TA 5J9YA 5AUUA 5CASA 5LMKC 3RK5A 2V0DA 2YWPA 5CXZA 5EDPA 5A6OA 3D4QA 3BWJA 4RWKA 4C36A 4K8AA 2WQEA 2QOLA 4K18A 2IW8A 5IQGA 1M2QA 3BELA 2HZ0A 4WNMA 4CEGA 4AGWA 2H8HA 1DAYA 4AA4A 3WZJA 3RVGA 5M56A 4ID7A 3BU5A 3QX4A 5CLPA 2QU6A 1YVJA 3VUKA 4XG4A 5KMKA 2C0IA 2A2AA 4DT9A 4F6SA 2JC6A 1GZKA 3HEGA 2CGVA 4RIXA 5CQWA 2X9FA 4LRKA 3V8TA 3GOKA 4A4XA 1LEWA 4FT3A 4R3CA 5HOAA 1JBPE 5JFXA 4KSQA 1SNUA 4YJOA 3R7EA 2ITWA 4CNHA 1OMWA 2V7OA 4Y83A 4YBJA 3LJ2A 1E1VA 4QP7A 4YJNA 5AX9A 4AW0A 4DE4A 1BL6A 4R3PA 3KRRA 2C6OA 4L43A 5AR2A 3TNQB 3KQ7A 3FYKX 2WIHA 4EOKA 1JLUE 1NY3A 5BMMA 4G6LA 4IZ7A 5J7BA 3U9NA 3ZOSA 4AZFA 4EHGA 5IKWA 2BHEA 5L2QA 1J1BA 2CCIA 2WOUA 3R1QA 4IB3A 4BDCA 3LE6A 2Y4IB 4GKIA 3KVXA 5ANEA 2VTLA 2YHVA 2R7BA 3OY3A 5HIDA 3EQRA 2HY0A 1WBWA 4MAOA 4NU1A 3PVWA 2XIRA 5EHYA 3OD6X 4P4CA 5BYLA 3QRJA 2A4LA 3IKAA 3PJ1A 3QTSA 4O7TA 5AUVA 2YIWA 3MH1A 4G3CA 4HGTA 4I3ZA 3HAMA 3FHIA 3MIAA 3IW7A 3LCKA 3PPJA 2Y6OA 4O0VA 5HE0A 3RAKA 2YM8A 3NW7A 2AYPA 4GL9A 2NO3A 2VO6A 4JG7A 5CNOA 3UC3A 4RIOA 4NK9A 4WSYA 2QONA 4EORA 4DEBA 2O2UA 3EN6A 3HECA 4HYHA 5AR8A 3R01A 4QQJA 4RIYA 1SVEA 4FV2A 3ELJA 4IACA 5CAOA 5JZJA 3UZPA 5E8UA 2OH0E 2QCSA 1OL5A 2BTSA 3V5PA 3EQDA 4FYOA 3ZHPC 4F9AA 3LQ3A 2YM6A 4FK3A 2QOQA 1RDQE 3C0IA 4CFUA 3PRIA 2JBPA 4H3QA 4H3PA 4BZOA 4NJDA 4RIXB 3FLSA 4LMNA 5FTQA 5BQ0A 2Z7SA 3Q9ZA 3PSBA 3F5XA 4FOBA 1J91A 5E1EA 2CGWA 4YSJA 5CAPA 1BL7A 2HZIA 5EYMA 2VD5A 3UOKA 2VTAA 3IOPA 3POZA 4DH5A 4ENXA 4Z55A 4LOOA 1L8TA 4RLLA 2WMVA 1WBTA 4YHJA 5CEQA 4AN9A 1QCFA 5H8BA 4AGCA 2XA4A 2Y6MA 3VS2A 1M17A 1W98A 2EUFB 3MH0A 2E9PA 4GW8A 4YZNA 4B4LA 3DS6A 3QCYA 2W7XA 3T3VA 3ZLWA 3EN4A 3FE3A 4AFJA 5M55A 2CNVA 3O7LB 4FVQA 5IMEA 4RX5A 1K9AA 3Q32A 4IX4A 4RA4A 4EH6A 5C4LA 4ARKA 4TPTA 4QP6A 4C2WA 2QC6A 3RTPA 4ZTMA 2JITA 3F66A 3ZDUA 4H1MA 2QOIA 3TTIA 4DLJA 3I7CA 4AOTA 4BFMA 1T46A 5I9WA 2XNNA 4DC2A 5ICPA 3HZTA 3O96A 1PXPA 1WBNA 3V3VA 2HOGA 5FDPA 3ORTA 4EH7A 2W1CA 3RKBA 4OTPA 4F6UA 3S00A 4A07A 5HCZA 3R8UA 4CQGA 3RK9A 1TQIA 2QO7A 4PUZA 1OL1A 2VTNA 3FZPA 3KULA 4XV1A 5M51A 4IWQA 3QXPA 4PL4A 4DN5A 5IDPA 5FBOA 3EQBA 3P23A 4TWOA 4IQ6A 4HVGA 4E1ZA 4EONA 4GT3A 4MD7E 5GZAA 5CS6A 4X2GA 5EDRA 4D5KA 2YIRA 2Y4PA 2BILB 3OEFX 4XOYA 3O0GA 3CQEA 4PNIA 4Z7GA 1U54A 1T45A 3P78A 1QL6A 2W1HA 3WARA 3ZRLA 4EC8A 2WGJA 2XIYA 3V51A 3R7VA 4FC0A 2JDTA 1ZY5A 2BVAA 4Q2AA 3EFJA 4E4LA 3UYTA 2C5OA 4RQKA 3NUSA 4YZBA 3UIMA 1Q62A 2BZJA 2X6DA 2RFEA 4YPDA 3A60A 4JR3A 4FSNA 2ONLC 3R7OA 3U51A 2CMWA 4JIAA 4WG5A 3IDPA 4MQ2A 3IDCA 4WA9A 5L2IA 3FMEA 4TN6A 5LVLA 1IG1A 3H30A 4MEDA 3QTXA 5AP6A 4AGUA 5IH6A 4S33A 4IAYA 1RE8A 3P7AA 3DKGA 5AA8A 5L3AA 1UA2A 3A2CA 2JKOA 4JLCA 3KK9A 4GFOA 2UZUE 3F6XA 2WMBA 2XCHA 4O0WA 4IM2A 3R8MA 4AF3A 3LOKA 4EOQA 3MVLA 1STCE 4G3GA 1ZARA 2XRWA 3F69A 4GMYA 4I94A 5AUZA 4BZDA 5DEYA 4E5AX 4IAAA 5HE3A 5JFVA 3QQKA 4DA5A 3KRLA 4G9CA 4CFFA 4DYMA 5AUYA 1ZRZA 2RSVA 3PPKA 3LXLA 4UMTA 5C1QB 4IC7A 2QHNA 3G2FA 4IFCA 1WZYA 2ZYBA 5M07A 5AFVA 4OGRA 4DEEA 4EQCA 1R78A 3R04A 4PQNA 2QU5A 2IZRA 4KRDA 5C9CA 5M57A 4C3FA 3ERKA 3QQFA 4GG7A 5J5TA 1JSTA 5HEZA 2DYLA 2NRYA 4XX9A 1U54B 2WTDA 3ORLA 1YXSA 3BHTA 4WBBB 3UMXA 4HZRA 4JQEA 4L44A 3BGPA 3WYYA 4BB4A 3QTUA 5EFQA 5LQFA 4O7LA 5CEPA 4CFVA 2O65A 4TYJA 2CGUA 5AP1A 2X2LA 3ULZA 4NCTC 3OCTA 5D41A 4A9UA 4AW2A 4FL3A 5HO8A 3Q5IA 3ZLXA 1ZYDA 4FZ6A 2PY3A 5IA5A 3D7ZA 4O84A 4OTFA 3VF8A 5A4QA 5DR9A 3O51A 4BDIA 2Y9QA 3RAIA 2WFYA 3L8SA 5ETAA 5EQYA 4LQMA 1ZYJA 5DE2A 3UOLA 2GS6A 4CKJA 3JXWA 3QUDA 4XJ0A 4GVAA 2EXEA 3MW1A 1UVRA 3CY2A 4LUEA 4DGLC 1XHAA 1Q99A 4I0TA 3RNYA 4QPSA 3F7ZA 1ZZ2A 3MA6A 4JVGA 3Q9YA 2OF2A 2WU7A 3WYXA 4F9YA 3S0OA 5IH4A 3OZ6A 3RMFA 4FT7A 4TYHA 2GFCA 4BRXA 3BHVA 2VTHA 2WQBA 3NYXA 2GQGA 4QMPA 2OFUA 3CIKA 5TT7A 2X7OA 4HYSA 4JAJA 4DFXE 4E93A 4JBVA 3BGQA 4WHZA 3OHTA 5E91A 4CXAA 4D4RA 4I0SA 2WD1A 3DKFA 5J95A 2OJGA 2JDOA 2RIOA 3AMAA 3P7BA 3GFWA 4CSVA 1FVTA 5I9YA 2GTNA 2OJFE 3EN9A 4BTKA 2BR1A 3ZZWA 5EYKA 5CALA 4DTAA 3PRFA 4MXCA 3CPCA 1Y8YA 1YI4A 2VRXA 3DK7A 3H0ZA 5AM7A 1OITA 4RJ5A 2C5VA 3RGFA 4QPAA 3L8VA 4ZZOA 1R0EA 2B4SB 2QOCA 2EWAA 2VTTA 4QTDA 4ANQA 4TTHB 3LCOA 1KV2A 4RC2A 4FV3A 2GNJA 4D2TA 4QMMA 4RX8A 3ZLSA 4WOVA 3V8WA 2QLQA 3HYHA 2OBJA 3QD0A 5JFWA 4IE9A 4MXXA 3IPHA 3OWKA 3NNXA 3QLFA 4F0FA 5C26A 3R8ZA 4FSMA 4ZOGA 5TE0A 2HIWA 4FKPA 4U3ZA 5AP5A 4ZLZA 2WQNA 2YM3A 4H39A 2O3PA 4XV3A 2OXXA 3R6XA 4M68A 4EZ7A 3CSVA 4IANA 3VRZA 3P79A 2BRGA 4S2ZA 2IN6A 4C37A 4I5HA 4QMYA 5J9ZA 5I9UA 4FV6A 4O0RA 4FTRA 4C8BA 3NVMB 4OBOA 4EJNA 1CKIA 1YHWA 2OIDA 3KXXA 4XV2A 3C51A 4UALA 1H4LA 3KXHA 4GS6A 1OKYA 1VZOA 4Y95A 3LFAA 3MIYA 3HAVA 1F5QA 2WTJA 5L2SA 3FV8A 4LL5A 4GJ2A 3OS3A 2PZYA 5I3RA 1KV1A 2QR7A 3M2WA 3QRUA 2Q0NA 4KWPA 4AN3A 3HMOA 3JPVA 5CAUA 4FV9A 5AV3A 4ZSGA 3TUBA 2WHBA 2BIKB 3PZEA 3EL7A 3D83A 3AC3A 4LYNA 1IR3A 2O8YA 2XF0A 1OKVA 4ZTLA 2JFLA 1Z5MA 2R64A 4K9YA 4YPSA 3FDNA 4HCTA 3CCNA 5KBQA 3OC1A 2RFNA 2O64A 4RJ8A 2XJ1A 4UMRA 3P9JA 4MXOA 5CY3A 4JDJA 4W4VA 5FLFA 4V0GA 4EWQA 5K4IA 1P4FA 3EH9A 3OTUA 4NUSA 2BZKB 1CM8A 3SG8A 4QMUA 1ZYCA 3R22A 5LXMA 2BAQA 3LCSA 4JNWA 2UZEA 4Q5EA 4MVFA 4O0XA 2C6LA 2GDOA 4QYHA 4LGGA 5FM3A 2VX0A 4O82A 5DNRA 2YM4A 2C3LA 3W2SA 3LMHA 3NUYA 3G33A 4RZWA 4ZY4A 4FV4A 3GI3A 4TNDA 4O91A 4D58A 4K33A 2UW7A 5E9EA 3ROCA 3RHKA 3FC1X 2JIUA 4EK5A 4EK3A 2E9OA 4CTBA 4JX7A 2XK6A 2XCKA 3CGOA 2ITXA 1ZOHA 2R7IA 4IAFA 1R3CA 4IXPA 2VUWA 3UVPA 3FZRA 3ID6C 1VYWA 3QQUA 4C62A 2R3MA 5D7AA 2PSQA 1FBNA 1IAJA 3ALNA 3R2BA 5CSXA 1PYEA 5E7RA 4DEHA 3AT2A 3ETAA 4U0IA 4RC3A 1K3AA 3CQUA 3E62A 4JS8A 3OW3A 5HG7A 3RALA 3F2AA 2HW7A 4JQ7A 3JVSA 4IAKA 4JBPA 4LFIA 3ZDIA 4EH5A 3II5A 1ZMWA 3R9OA 1KE6A 4N4SA 1KE7A 3A8XA 3DXNA 3TACA 3GCQA 4H1JA 3VBTA 4NYEA 4P5ZA 1A48A 3QZFA 4JIKA 4QO9A 2C1AA 3VS0A 4OAVB 2B0QA 4FKGA 4BTMA 5JFSA 3PWDA 4HGSA 4FV0A 4L53A 4N57A 1OIUA 3EOCA 3DTWA 2JD5A 2KULA 2X2KA 4MXZA 4BZNA 5C01A 3GU7A 2VX3A 5DWRA 4F0IA 3DV3A 4EUTA 2PHKA 5IQHA 1OM1A 4J7BA 4MD9E 1FOTA 3OXZA 4W4XA 1FPUA 1H25A 1H1RA 3GU8A 2XVDA 4EOPA 1DI8A 4FTQA 5F94A 3WOWA 2JLDA 3EN5A 3A61A 3S95A 3HV5A 4KUJA 2WQOA 4QP9A 2YABA 2IVUA 3CTQA 4O83A 2PL0A 2UW0A 3AG9A 1Z9XA 3L8PA 3PVUA 4ACGA 4APCA 5AV1A 1BUHA 3C4XA 5ANIA 4ZSEA 3GC9A 2HZ4A 5BVWA 4V01A 3IOKA 3WZUA 3ZRKA 1Q8TA 2XEYA 2B9IA 4O0UA 5E4HA 3QZIA 1UKIA 1PKGA 4DEDA 5EW8A 3IW6A 3OBJA 5CX9A 3DOGA 4XLIA 5IZFA 4F9CA 3NLBA 4BDDA 4J98A 4M84A 2QODA 5H8GA 3SD0A 4EH2A 3FSKA 3GFEA 4TXCA 2ITOA 4OTHA 3QFVA 4UXLA 3LCTA 3WIKA 1LUFA 4K11A 4CT1A 3BQRA 3BYMA 2GSFA 4BDJA 5IA0A 1OBDA 5CU3A 1KWPA 3MSSA 1H8FA 5E8XA 4EI4A 4CFMA 1JKLA 4MNEA 3F3UA 3MPMA 5EW9A 5FP5A 5JZNA 1BKXA 5EHOA 3EQHA 2YACA 5LARA 4UWYA 3D0EA 3TN8A 2W4JA 3IGGA 4M15A 4PPAA 4ZY6A 3VS1A 3U54A 5KX8A 4HJOA 4JR7A 3UMWA 3BHYA 3FXWA 4FKSA 4O7ZA 3QD2B 3IG7A 3V01A 4JDKA 3JS2A 3ORZA 4IADA 3U6IA 2PULA 3QC4A 4MBIA 4KRCA 3KC3A 4FSTA 1XH8A 2F4JA 4RVLA 3TUCA 4M14A 5HX8A 4DH3A 3O7LD 3FXXA 4KB8A 5CF5A 1OPLA 1MRYA 2UW4A 3FUPA 4YJSA 1Y6AA 2OIBA 4IJ9A 3RM6A 4C7TA 3UG1A 2YFXA 4U42A 4FSWA 4GIHA 2WMRA 2PVLA 4EEVA 3CKXA 2C0TA 2Z8CA 4MTAA 2YEXA 4NKSA 3UP2A 3MPTA 5HORA 4AE6A 2HK5A 2J0JA 3G9NA 4ITIA 4XP2A 3PFQA 4D5HA 1Q8YA 4BDEA 1YI3A 4LOPA 4IVDA 5KZIA 3TZ8A 5IA2A 3BU3A 3CD3A 3E8DA 1V0OA 3EQFA 3R21A 4HOKA 4WUNA 4AA5A 1Q8ZA 3FL4A 3OROA 3Q53A 5AR3A 5HKMA 3GU5A 2FUMA 2PE0A
chains in the Genus database with same CATH superfamily
4AXDA 3DJ5A 2W4OA 1O6KA 4GEOA 5J1VA 4XCUA 4G6OA 4FBXA 3CD8A 5HO6A 4IBMA 2PK9A 4FTNA 3RP9A 2V5QA 5L6OA 2BRMA 2BUJA 5I5ZA 4TYIA 3SXFA 3CKWA 4FL1A 2R3HA 2XALA 4BICA 2F57A 4EHVA 3VQHA 3GXLA 5HTCA 3PJ3A 3P5JC 2BDFA 5GJGA 4FE2A 3WE8A 3ZONA 2UZBA 2WTKC 4AAAA 5CWZA 1UU7A 1YXXA 2ITUA 4U9AA 3PUFC 2VTOA 3GCSA 5E90A 5C03A 4Z7HA 3T8OA 3HV6A 4FKLA 2XK3A 2XNBA 1Q3DA 4CKIA 4DFBA 4DF3A 5IEXA 1KSWA 1WBOA 2RGPA 3BBWA 1NW1A 4FG8A 2GHGA 3V8SA 4IB0A 3LQ5A 3N4TA 1PMVA 3NEWA 4KBAA 4YLLA 5FM2A 5K0XA 1P14A 4UV0A 5BYZA 5HBEA 1XKKA 3VBQA 2VZ6A 4USEA 4FIJA 3ZXZA 2UW6A 4BHZA 4S31A 4F63A 3UOJA 4ZJJA 3KXNA 4G3EA 2VNWA 3M1SA 5FXRA 4C34A 4YHFA 4DFZE 4FGRA 3PXQA 3T9IA 3D5XA 4FZAB 1URCA 2G2IA 5EM8A 4C2VA 2ITYA 4AAYA 3JYAA 2A27A 4DTBA 3L9MA 4QTCA 5HHWA 4GVJA 3VUDA 4YU2A 3QHRA 3MV5A 4C4EA 5HVYA 4NFNA 3DPKA 4YNEA 4AFEA 5AP7A 3MFTA 3QKLA 3U6JA 2J90A 3IK3A 3GT8A 3ORNA 4U79A 3E64A 1VJYA 5KMIA 3K5UA 4ORKA 4JT3A 3TZMA 1LR4A 2I0HA 1BLXA 2FVDA 1L3RE 4QOXA 4RWLA 4D9TA 2YZLA 5JH6A 2CCHA 4RPVA 3WF5A 4XNEA 2UZNA 4B8LA 4HVDA 4PF4A 4QMZA 4BCNA 3R9NA 1KOBA 4CZYB 3FQEA 3QUEA 3HV3A 4Y46A 2V62A 3BEGA 4TZRA 5FQDC 3PE2A 4BKZA 4ANNA 4TRLA 5EOLA 3MGYA 5ANDA 3ZUUA 4WIHA 2E2BA 3BX5A 3OUNB 2VTIA 3RPYA 4PTGA 1H28A 5ETIA 3KF4A 3QX2A 4BWXA 2HWOA 2VO0A 5AUTA 2ZV2A 1YWNA 4EYJA 3FL5A 4M12A 5HG5A 3L9LA 2UZVA 4CCUA 2I0EA 2QURA 3O8PA 3ZSIA 3P7CA 4O7SA 5HESA 3DQXA 5KCVA 3UIUA 4GRBA 4O7RA 3OVVA 4R3RA 4QNYA 2FB8A 4D4SA 4HVHA 4O0SA 2HWPA 4DHFA 3W32A 4GG5A 4LUDA 5H2UA 4YC6A 4D1XA 1WBVA 4DGNA 2X6EA 4BKJA 3TJDA 4IWPA 4NW5A 4U3YA 2XUUA 3HGKA 3WIGA 3VUMA 3BPRA 4NM7A 1JKTA 4I4FA 2GPHA 3KXGA 3D15A 5A4EA 4IX3A 4R77A 2AUHA 4L52A 3QQLA 4GIIA 1XMMA 3PIXA 1KUTA 3I6WA 3CJGA 5H9BA 4K77A 5L6PA 4JDHA 5D11A 3QC9A 4RFZA 3VUGA 2PUNA 2W06A 3KU2A 1ZYLA 3M42A 2Z7RA 2QD9A 4NH1A 2QO2A 4GH2A 3A62A 3VS4A 5AR7A 3VW8A 1PF8A 5A9UA 2WTIA 5DT4A 2ZFYA 3NCZA 4L67A 2VGPA 3K5VA 4QD6A 3EB0A 3DCVA 2X8DA 3EHAA 1GY3A 5C8MA 1YWRA 4ASXA 2GQSA 4MF1A 2RFSA 3DDQA 4PTEA 1IA8A 3SGCA 4I92A 1DM2A 1PXJA 2CKEA 5AA9A 3KMMA 2VGOA 1PKDA 2XYNA 3OWPA 5CSWA 4GK2A 5FD2A 3TKHA 4AN2A 3HRBA 4IW0A 4NM3A 5A4CA 5J9LA 2C6MA 3R2YA 4WD5A 5FUTA 3FBVA 4IB5A 4U81A 4ZZNA 3OF0A 5IQAA 2X0OA 1M14A 2PVJA 5EM5A 4BWPA 5JGAA 3D5UA 4RZVA 3KREA 1MQBA 3TZ9A 4ERKA 3BGZA 3HKOA 1YOJA 2NRUA 4J52A 3G6HA 3DKOA 3HA8A 5CF6A 1SVGA 4EH9A 4FV7A 5B2MA 1Q3WA 3NYNA 4HYUA 2XH5A 3GCVA 4WG4A 5E8YA 4F6WA 1BI8A 4I21A 3RWQA 2YIQA 4ONAA 4ZTRA 4F64A 3ZC5A 2V22A 4YUQA 2PWLA 3D7TA 4C4IA 3HL7A 4U80A 3GNIB 3ITZA 3PYYA 3VS5A 3ORPA 3VQUA 3COKA 4WNPA 2ZM3A 3KMWA 1W2DA 2X0GA 4AZEA 2X39A 4H58A 4F7JA 3NMUF 3E88A 4AS0A 5CEOA 3P08A 5F1ZA 3MY0A 4YHTA 3NUAA 3I60A 4MF0A 2I40A 2WMXA 4FT9A 1W83A 4GU9A 4O4CA 5GHVA 4G6NA 4KKEA 2R3QA 4YZDA 4CMTA 3O2MA 4LG4A 3DY7A 5KMOA 2ZAZA 2J51A 3OOMA 4D4VA 1OI9A 4FICA 5DR6A 2BFXA 3NS9A 2OXDA 2OZOA 5T6KA 2OK1A 3DFCB 4DGMA 5EM7A 4PP7A 4ZS4A 2C6EA 2CGXA 3OXTA 3N4VA 2W1EA 4U45A 5EM6A 3E8NA 4L3LA 3UDSA 2ZV7A 4I1ZA 4UX9A 2C6TA 3AD5A 3OWLA 5FXSA 5HU9A 5HVJA 3MDYA 3IECA 3NW5A 4BCFA 4FIIA 4NTTA 4BDFA 3GQLA 2J0LA 2YIXA 3UVQA 1AD5A 4ANBA 3KFAA 4P2KA 4D1SA 1G8AA 2B7AA 2BMCA 2IO6A 3AGLA 5A4TA 3SAYA 2DS1A 2WMTA 3PJ2A 5JT2A 4E5BA 4IVCA 5LJJA 3P4KA 4FNWA 3K54A 4M69A 3RCJA 3F9NA 3MN3A 2QI8A 5L8JA 4FKOA 4RX7A 4AZTA 4FEVA 4EKLA 2XB7A 4FEUA 4TYEA 1CMKE 4KINA 1OKWA 2Q83A 1J7IA 3H9RA 3R9HA 3A7HA 4HNFA 1H00A 2C6DA 2WMAA 3HUCA 3JUHA 5CI6A 2GHMA 3W33A 3L9PA 2PMLX 2JDVA 1H1QA 1PXMA 2XS0A 3F7WA 3TV6A 1ZY4A 3ZO2A 5BUEA 2GNFA 4AWIA 2H34A 3RPSA 3QUPA 4BHNA 4YJVA 2WMWA 2J7TA 2JAMA 4EYMA 4XV9A 4RIYB 4DFUA 2W1ZA 2YJSA 3LFBA 4ENYA 5IU2A 1OBGA 1TKIA 4EJ7A 4HCVA 3FMLA 4YLKA 3SOCA 4H36A 1NVRA 2F2CB 4FKJA 3OEZA 4YC8A 3ZFXA 3VBXA 4R7HA 4BN1A 5ACKA 1XH9A 3TKUA 3NIEA 4FKRA 2C3KA 2CNUA 3GBZA 4AP7A 2R4BA 1APME 4BBMA 3NGAA 4ZSAA 5JQ5A 1SM2A 2J50A 4AX8A 3NX8A 3O71A 2OU7A 3HDMA 3AMBA 4R8QA 4ZIMA 3C7QA 5HVKA 4KS8A 4PV0A 4UMPA 4O96A 1JAMA 2PMIA 4M97A 4QP2A 4PDPA 4CTCA 1JQHA 4FTIA 2R0IA 2CLQA 4ZSJA 3VUTA 2BZIB 5G6VA 3Q9WA 3W0MA 2YDIA 4O6LA 1TVOA 4FMQA 3CTJA 4X21A 4KIKA 2WNTA 2NPQA 4O1PA 5DI1A 3UYSA 2UZWE 4A9YA 2BZHB 2IW9A 4PPCA 3FI3A 4QQCA 5JMSA 4TWCA 3MVMA 2PVYA 3PLAE 3LFCA 3R8VA 1GIIA 2OIQA 5LWMA 3C4CA 2ZB1A 4X3JA 3EZVA 1IASA 4TW9A 4U40A 4BIEA 5IQFA 2W1IA 3CPBA 3PIYA 3V5QA 4D2PA 2PVHA 3LQ8A 4W9XA 5HZNA 3VBVA 3KGAA 3LFQA 3TL8A 1PY5A 3LXNA 4RQVA 4XH6A 5IA3A 1P5EA 2QG7A 1XH6A 4DITA 3EQGA 3FI4A 3O17A 4LL0A 3Q4UA 2YISA 2YDKA 3OWJA 2VTSA 2P4IA 1H1PA 5J8IA 4KIQA 3QQJA 3DLZA 5IA1A 1G8JA 4CMOA 4WT6A 5M44A 4BCPA 5TR6A 3AC2A 4CFNA 2IPXA 4MBLA 3MTLA 1J3HA 4EK6A 3R7IA 3QCXA 2R0UA 5J5SA 1W8CA 3E7OA 2C1BA 3MTFA 3QBNA 2R3GA 4FZDB 4NM5A 3KULB 3DDPA 4E4XA 2ZB0A 1IRKA 1R39A 2WTKB 2XKEA 4G3DA 3EWHA 3BHHA 4FV5A 4G17A 4XG9A 3PLSA 2BHHA 1YKRA 2XKFA 4N70A 4DFNA 2XIZA 4RMZA 4F65A 4GT4A 3WF8A 5ANGA 4FTKA 2PYWA 1WBSA 4C59A 2ZM1A 3QZHA 2WQMA 3SXSA 4KA3A 4MYGA 4D0WA 4ZAUA 3EQCA 3QTIA 5ACBC 3QALE 2X4ZA 3NVKI 3LJ0A 5DVRA 2Z02A 1QMZA 4FKUA 5EG3A 3MH2A 4K6ZA 2ESMA 2OKRA 2I1MA 3C9WA 3D94A 4LV8A 5HD7A 3R8PA 4F9WA 3QRKA 4KNBA 5F9EA 3MPAA 3RPOA 3H9OA 3B8QA 2GU8A 2W5AA 4DTKA 4EH8A 2AQXA 3G5DA 3S3IA 2GQRA 2OLCA 3TUDA 3E87A 3S1HA 2XANA 5IQDA 3E92A 1Q8WA 2PUIA 3MFSA 3Q4CA 5JRSA 3AD6A 3U55A 4I20A 3UO5A 4K1BA 3OCBA 3A7GA 4XOZA 4UMQA 5M4CA 4XS2A 3OFMA 2XK9A 3QXOA 4AA0A 4GUBA 3LFSA 4C02A 1ZLTA 2QOOA 1YWVA 1H27A 3ZO1A 4F1OA 3AOXA 4QPMA 2J4ZA 3OBGA 4C35A 3FYJX 1H01A 4FTAA 4RWIA 3RAWA 1OB3A 2PMNX 4QQ5A 3VO3A 3W0SA 2R3LA 5B7VA 5HX6A 2GHLA 5DEWA 4OTQA 5AWMA 3D5VA 3AC1A 4FEXA 2PPQA 2BCJA 3V5TA 4BCMA 3OCGA 4O1OA 4U8ZA 4NSTA 4CFXA 4IHPA 3MI9A 2R3KA 3E93A 2W5HA 4C58A 3Q52A 1JKSA 2NP8A 2PZ5A 4GT5A 2BROA 3A4OX 3A7FA 3LM5A 3R83A 3WF9A 2GNGA 3N51A 1YHVA 2BPMA 4Y5QA 2C0OA 4JAIA 3UZRA 5CEIA 1VYZA 3DAJA 3MFRA 3UDZA 1PXKA 3K3JA 3NCGA 4X3FC 3R00A 2OJIA 1H08A 5AUXA 1RW8A 4F99A 3LXPA 2UW9A 3UIBA 2WO6A 4O0YA 4F1MA 4H05A 2VWWA 4AGDA 4BF2A 4CZTA 5I3OA 1OECA 2JIIA 1R0PA 2R9SA 4BY9E 4EK4A 3WF6A 3ZSGA 5HIEA 3BLQA 5BYYA 3ODYX 2YJRA 4P7EA 2J9MA 3BWFA 5CSVA 4D2VA 5BPYA 1Y91A 2UVXA 4PMMA 2IG7A 4FZFB 5JSMA 3IONA 4BCJA 5HNGA 5HO7A 4D1ZA 1H0VA 4XG7A 5M4FA 1JSVA 2ZM4A 3DNDA 4USDA 4UYNA 3UBDA 3VWAA 3ATSA 3NNWA 4PDSA 3BYUA 4DHIB 3ZUTA 3CEKA 4BKYA 4PTCA 2DWBA 4RVTA 3NUXA 5AADA 5IUIA 4TYHB 2W1GA 5CVGA 1SNXA 3FI2A 4KIOA 5ANOA 5T68A 3TG1A 3UOHA 2WKMA 3IW4A 4JMQA 4ANSA 4NIFA 4R5SA 2VO3A 4NM0A 4YLJA 4XG2A 2IZSA 5IPJA 1HOWA 3T9TA 3BI6A 1M52A 2OGVA 4C57A 4GSBA 4C3RA 3E8EA 2UUEA 5FXQA 4NJ3A 3R7GA 3WE4A 3CS9A 5K5NA 4MUQA 5BVEA 1BMKA 2QQ7A 3PY0A 4BJJB 2C5YA 2OWBA 4A06A 2YWVA 4UB7A 5HIBA 4RBLA 2RG5A 2X81A 1VR2A 3RCDA 3ULIA 4BCQA 4C33A 2GNLA 4EOOA 4OT5A 4O4BB 4DG2E 4I0RA 5B2LA 3T3UA 4PL3A 3GP0A 4IH8A 2XBJA 2JDSA 3GCUA 3MB7A 3EKNA 4R7IA 3TIZA 3UNZA 4HVIA 4Z9LA 3ZFYA 1MUOA 2HENA 4RSSA 3OTVA 4YC3A 5CU4A 3W2PA 4AXAA 3C0GA 3D2IA 3GOPA 1YXVA 3GGFA 4YO4A 2R3FA 3LVPA 4JRVA 4E26A 1XMLA 2X1NA 3LHJA 1PXIA 5IISA 5E8ZA 3ZUVA 3FMDA 1PYXA 3FKNA 3DBEA 4O2PA 3ZH8A 4YTFA 3BL9A 5E8VA 5GIOE 2FYSA 3THBA 5JRQA 4G1WA 3QQHA 4U6RA 4Y72A 3H10A 2CKQA 2PZIA 4ASEA 5CXHA 4ASDA 5K0KA 4JI9A 3UIXA 3SW4A 2QKRA 3KRWA 5DOSA 4UY9A 4ITHA 5LCJA 3N9XA 5H8EA 5C27A 3ZRMA 4O21A 2OXYA 3F5GA 2IZUA 4HPTE 4BDGA 2RF9A 1NA7A 2FH9A 2WB8A 2VTMA 5E8TA 3UPZA 4MK0A 5LVMA 2XAMA 5EI2A 4GK3A 4AZSA 4NIFB 3LM0A 5KE0A 3VS6A 1GAGA 2F7ZE 1Y8GA 2YITA 3BU6A 1UU8A 4U97A 5CVFA 4IB1A 3ZS5A 3C5IA 3VNTA 1M2PA 2WTWA 4OBPA 5EQEA 3FZOA 5HI2A 5H3QA 4EQMA 4E5WA 3U4WA 3WF7A 2UZLA 4P5QA 2W9FB 2QOHA 1O9UA 2NNWB 1B38A 4BCGA 5IQCA 2YCSA 3G6GA 1WCCA 1JVPP 2VWBA 4KBKA 4Q9SA 2GNIA 2VTQA 3R1NA 1CKJA 4WO5A 4CKRA 4Y5HA 1PXOA 1GIHA 2B9JA 3PXYA 3DT1A 2YERA 4HNIA 3NAXA 4RC4A 4WKQA 2EB3A 3QYZA 1ZXEA 4R6VA 1H26A 5BVDA 3ZSHA 5M09A 4V0GB 5L2WA 1MQ4A 5E8SA 5DT0A 3U6HA 3ORIA 3DBQA 4YJQA 4FRFA 3EQIA 2PE2A 2WELA 4DG0E 5IEVA 3Q2MA 3PSCA 4NKAA 1GZ8A 4M0YA 5AV4A 2JIVA 3CP9A 4XRJA 1WAKA 4BI0A 4D2WA 4J96A 3ROYA 2GS7A 4FSRA 3AD4A 3IO7A 3ALOA 4IVAA 3Q2JA 4YTCA 4BGHA 3FSFA 3HV4A 2AC3A 5HD4A 3QQGA 5AIKA 3O23A 3A99A 2C6IA 5B0XA 5J79A 1YQJA 5FEEA 4F08A 3FLNC 2BAKA 4X2JA 5DFPA 4IZ5A 2ERZE 3NUPA 4DINA 3O8UA 1OPKA 3VULA 4HW7A 4UWCA 1GNGA 3NIZA 4B6LA 4RX9A 4ALWA 3AQVA 1TQPA 2UZDA 4UEUA 2ITTA 5HCXA 3W8QA 3PA4A 4DFLA 1UNHA 5BMSA 3BEAA 3DAKA 3ANRA 3DBDA 3W2CA 5CU2A 3A8WA 1IAHA 4C4HA 4JDIA 3SRVA 3TKIA 4XUFA 2PE1A 2YIYA 2RFDA 4IZYA 2CLXA 4V05A 1G8KA 3JR1A 4O7WA 2JKMA 2ZMCA 2CN8A 3W8LA 4AU8A 2I7QA 3FZSA 1W0XC 2IF8A 4DH8A 4OT6A 4YR8A 3ENMA 1EH4A 1URWA 4L00A 3AKJA 5IQEA 3FWQA 3FKOA 3FHRA 4Y85A 3UNKA 2XIKA 4IVBA 4QMXA 1UWHA 4ZS0A 4BCIA 4PMPA 3OW4A 4V04A 5DA3A 4GV1A 2QOBA 4G16A 2HAKA 4YSMA 5GNKA 4LRJA 1W2CA 5I0BA 2GMXA 5AV2A 5D10A 3WZDA 4NT4A 4DH1A 2ITVA 2FA2A 3NUUA 1V0BA 3BV3A 1AGWA 4XP0A 3FPQA 4CG9A 2VX1A 1B6CB 5AM6A 2PU8A 4WNOA 4KKGA 4EL9A 3V6SA 2PVMA 2UZOA 5KMJA 1J7LA 3SXRA 3E7VA 3VW6A 5AV0A 3LMIA 2CDZA 3QA8A 3UO4A 1Z57A 4TY1A 3HVCA 5FP6A 2G15A 1YOMA 4FNXA 2XMYA 3DJ6A 3RM7A 1REKA 2R3IA 4BBEA 3WILA 3ZU7A 2X8EA 3AKLA 3JY9A 4RGJA 4D2SA 5C8NA 3SV0A 3ZEWA 1U4DA 5A54A 3HA6A 4G34A 3PTGA 5K4JA 4B99A 5L6WL 3TXOA 2ETRA 3PJCA 4RJ3A 4R1YA 4U5JA 4ALUA 4DEIA 5GIPE 4MNEB 1F0QA 5IDNA 3RZBA 1K2PA 3TV4A 2B54A 3U4UA 4F78A 4K2RA 2OFVA 4OTWA 5I9ZA 3CTHA 4F4PA 2W1FA 5A14A 5A4LA 5I9XA 5KUPA 1BI7A 5IQBA 4N6YA 2A0CX 4EWHA 4BDBA 3IDBA 3F3ZA 3UDBA 2OSCA 2XJ0A 4X3FA 3DK6A 5AR4A 4FTLA 4FIEA 5M4IA 4YTIA 4QMVA 2PVKA 3RI1A 5CF8A 2VWXA 3DGKA 3U87A 4CYIA 5IMXA 3PDTA 1IEPA 4WNKA 3KRXA 2IVTA 3QWJA 3QCQA 4FODA 3EFKA 4E3CA 2V7AA 3Q60A 1JOWB 5AR5A 3LLTA 1ZWSA 2IVVA 3ENHA 4R5YA 2BKKA 5CYIA 3LXKA 4J95A 1V0PA 5AP2A 4GFMA 2QO9A 2XNPA 4RIWA 3NAYA 4S32A 5HE2A 2W17A 2KTYA 5EYCA 2YCQA 3DXQA 2ZVAA 4W8EA 1YDSE 1DS5A 4FSYA 4I23A 2HZNA 3LZBA 3REPA 5AP4A 5KZ0A 4FGBA 4J71A 2PVFA 1PXLA 5AMNA 4QTBA 4WG3A 3ORXA 5DMZA 5IEYA 2WPAA 1IA9A 4I5MA 3N4UA 2WZJA 3AGMA 3L8XA 4FNZA 3RPVA 2CJMA 4YGAA 4LGDA 3ZLYA 4U44A 2P2IA 5F95A 3R0TA 2P33A 2JKQA 3BQCA 2R3OA 3R30A 2ITNA 3OXIA 3VJOA 4E7WA 3E3PA 2CNQA 3MJ2A 3ET7A 4XG6A 2WEVA 3SG9A 2PTKA 5F4NA 1MP8A 3R7YA 4JX3A 3TYKA 4EOMA 3KL8A 2UW3A 3TDVA 4ZTHA 4E8AA 1TZDA 2FSOX 3KF7A 3BYSA 2EVAA 2X0QA 2EXCX 4YJUA 3OOGA 2X8IA 2OJJA 1X8BA 5HTBA 1E9HA 4W4YA 4X3FB 1OVEA 1WBPA 3UQGA 1W2FA 4YMJA 3GC0A 3QD4A 2LGCA 3COHA 3PIZA 4J97A 3PE1A 2YM7A 4JBOA 3HLLA 4A4LA 3DBCA 3G0FA 3AC4A 4WBOA 3TNHA 5DRBA 3R9DA 2XRUA 3GU6A 5FBNC 3RWPA 3VHEA 4QEBA 2GS2A 2REIA 3PJ8A 3R28A 4FNYA 2VAGA 3HMIA 3VVHA 4DLIA 4RVKA 2YN8A 4IC8A 4NL0A 5C4KA 4CV9A 3HMNA 1Q61A 1XBBA 3KXMA 4APPA 1HCKA 4L45A 3DNEA 1YDTE 4J8NA 3I0QA 4MWHA 4ZJIA 3RBWA 3CJFA 5EQPA 3W0OA 4USFA 4I5PA 3Q96A 4FIFA 2YM5A 2WMQA 4W4WA 1U5QA 3EYGA 4GU6A 5CF4A 1Y6BA 2I0VA 4YJTA 3C4FA 1XH7A 4FTOA 2YCRA 1WVWA 3C4ZA 3F5PA 4DCEA 2BDJA 3HDNA 3G9LX 4IFGA 5FTGA 3L1SA 3MVHA 5CZHA 5BUJA 4QP3A 2GFSA 3NYOA 5CT7A 3G15A 3B2WA 3FMHA 3OMVA 5D9HA 4ZEGA 4JBQA 2PZPA 3RINA 4E20A 3O50A 3QTZA 1FMOE 1GZOA 3PXFA 4H3BA 2UW5A 4Z16A 5LVNA 2ETKA 2Z7QA 3GC7A 3F3WA 5C8KA 5EYDA 4YZ9A 5DLSA 1FGKA 5CVHA 4BGGA 3QKKA 5LVOA 4C4GA 2BKZA 4F9BA 3SW7A 3UO6A 4CV8A 4PRJA 2R3RA 4RA5A 5DN3A 4BDKA 1WMKA 3F3VA 2GTMA 5CTPA 4UZHA 4F70A 3DB8A 4L3JA 3EIDA 4J1RA 1Q5KA 2WU6A 4LM5A 2VWUA 2DQ7X 1XBAA 3DA6A 5HBHA 2YA9A 3FMNA 2W1DA 4EZ5A 4QMOA 3NPCA 4O4EA 5HU3A 1SZMA 3DK3A 4JG6A 4BYJA 4M7IA 3ZC6A 3PFYA 4PDYA 4A9TA 4FIHA 1NT2A 3QU0A 3H0YA 3BBTB 2XK4A 4BCOA 3WI6A 4DDGA 3ZXTA 3QF9A 3QTQA 4IDTA 3PA5A 3AC8A 4FTCA 2IW6A 4ACMA 2P3GX 4B8MA 3MJ1A 3I4BA 2UW8A 3C4WA 2VN9A 2VWVA 5DR2A 5D1JA 1LEZA 2LAVA 5GJDA 4BIBA 2HW6A 3NYVA 4NZWB 3MVJA 3VHKA 4TWNA 5EKNA 1SMHA 3KKVA 3PWYA 2H96A 3ACJA 5TOZA 1S9IA 3Q6WA 3GU4A 4IZAA 1FVVA 3LIJA 4NFMA 3PVBA 4IWDA 4HVSA 2C6KA 3FJQE 3ZBXA 4EOSA 4GK4A 5IF1A 3TNWA 3PSDA 4C38A 1Q97A 2C30A 4FYNA 5CQUA 4AT5A 4E6AA 4FG9A 4MH7A 4FKWA 2JKKA 4IWOA 2HCKA 1H1WA 2R2PA 3V04A 4JRNA 4PMSA 3BE2A 4QYEA 5AJQA 1OIRA 2ETMA 4JQ8A 2H6DA 3EFLA 4L42A 3BYOA 4DBXA 4XG3A 4D28A 3UC4A 3AT3A 4MKCA 4LOQA 3QTRA 3K3IA 1YI6A 2OW3A 5TKDA 5HQ0A 4AG8A 5HG8A 3TTJA 4FL2A 3R71A 5AP0A 4AT4A 1DI9A 4QT1A 4RG0A 4XEYA 3VONA 5CSHA 3EQPA 5FTOA 5KMNA 5A3XA 4Y73A 4RFYA 5BVKA 3ZCLA 4CRLA 2J0IA 4XYFA 4M8TA 4PL5A 4QMNA 3FZTA 3SDJA 4EHEA 2XIXA 2P2HA 5KKRC 3SVVA 2C5NA 3D7TB 4MBJA 4KIPA 4N0SA 4Q9ZA 2R3PA 1YW2A 2OICA 4J53A 1PW2A 2QVSE 2J5FA 2Q0BA 2C69A 1G3NA 2H9VA 3BRBA 5AAFA 3I1AA 4AXFA 3R9RA 1RJBA 1ST4A 4AXCA 3G51A 4IIRA 3QGWA 3AKKA 4I24A 3C4EA 4UXQA 3MA3A 3G0EA 4HYIA 5ETFA 2B53A 2XJ2A 2QOKA 1DAWA 3DZQA 2UVYA 2ITPA 4OR5A 4FUYA 5LMAA 3QZGA 4YZMA 4D0XA 4OUCA 5HNBA 5F20A 4J99A 2B52A 3PA3A 1UKHA 4C0TA 3CBLA 4OTDA 4E6QA 4DHJA 4WRGA 3U9CA 5EI6A 4PP9A 2QLUA 4DCAA 2ITZA 1A9UA 4F7SA 4G5JA 4PNKA 5HLWA 4KKHA 3NFFB 4S34A 4I41A 3PVGA 5EI8A 3H4JA 2PUUA 5DBXA 1QPCA 4YP8A 4FVPA 3LKMA 2AC5A 3TDWA 2E9VA 3FMJA 3B8RA 1O6LA 3FQHA 3R8LA 5GZ8A 2FSTX 4EQUA 2O63A 4I93A 1YXUA 2QOFA 3K2LA 5EW3A 4FKTA 2XNMA 3VIDA 1SYKA 4F7LA 4M69B 4QDEA 3W16A 4ZSLA 1KE5A 2VNYA 4O27B 1CDKA 2J2IB 3KY2A 5E1SA 1WVXA 3ORKA 4PDOA 4CYJA 1OPJA 5JGDA 5E92A 5HBJA 4ACDA 4CT2A 5KHWA 1MRUA 1U5RA 3ZO3A 4ZTSA 3CGFA 3MY5A 3QL8A 4LMUA 5I4NA 3HUBA 4PPBA 3PP1A 3MB6A 4ZP5A 2YCFA 2C5XA 5CAQA 2ZDTA 3W2QA 3NDMA 1NXKA 3E3BX 4KSPA 4GJ3A 3FMKA 2X7GA 5JGBA 1PHKA 3S2PA 1H1SA 4XHKB 5CU6A 3SX9A 3OG7A 2FSLX 2Y8OA 4G2FA 5AIRA 4FKVA 4B7TA 3WBLA 3PY3A 1LP4A 3KEXA 4D4YA 2V55A 4O6EA 2CN5A 2UVZA 3GC8A 4L68A 3LCDA 2ERKA 4QTEA 4LRMA 2CSNA 3D9VA 4L7FA 2W96B 1XR1A 2F7EE 2VV9A 3HX4A 4DEGA 4FKQA 3LLAA 5LOHA 5EDQA 3BLAA 5LMBA 3TEIA 2PVRA 5CENA 5E8WA 4BTFA 4KBCA 4AUAA 4F0GA 3TI1A 4X7QA 4YNOA 4FV8A 4UWBA 4ZTQA 3WZEA 1H24A 4TNBA 3W1FA 3MFUA 3NSZA 2QR8A 5FEQA 4RJ4A 5DHJA 1R1WA 4KIKB 5KHXA 3VBYA 3WZKA 2W4KA 1OL2A 4BL1A 4FUXA 5GINE 4ZK5A 4A4OA 2C3JA 4EKKA 3SA0A 4R78A 3Q4ZA 3IGOA 3MY1A 3QRTA 4EBWA 1M7NA 3CE3A