3EQHA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a ternary complex with u0126, adp and mg2p
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
343
structure length
314
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 314
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqhA01
2WU6A 5CEQA 3IPHA 4MEDA 5E8YA 5EI6A 4QMOA 5AV1A 5J1WA 4AZTA 4FTNA 4XG2A 2NRUA 2OI4X 3WZKA 4PDYA 1NVRA 1DM2A 1Q99A 4RFYA 2PY3A 1XH8A 2R3OA 4FV6A 4FI1A 4IADA 5FEDA 4UMUA 1MRYA 2GNIA 3HP2A 1S9IA 4FTOA 4NIFA 1PMUA 2G2IA 1TQIA 3GB2A 3R8MA 5LXMA 4HGSA 4FODA 3ALOA 2XMYA 1YI6A 5IQIA 3QA8A 4XNEA 2DYLA 4I5HA 5GJFA 4EOQA 4CYIA 4GT5A 4IFCA 4F9CA 3BBTB 3O0GA 1P2AA 2WTDA 2J0JA 2P3GX 4F9YA 4H1JA 1CKPA 5JQ5A 1APME 1KE9A 3SG8A 3C4ZA 4EZ5A 4AZFA 4LOQA 4M14A 4PTGA 2WEVA 3HNGA 3GCUA 4LV8A 3RI1A 4L8MA 1J7UA 4I5CA 3CBLA 4QP9A 4R6VA 2QU6A 1FQ1B 2C1BA 3KULA 3GFWA 3Q04A 3V6SA 5JH6A 3EN4A 5B7VA 1JKTA 4MF1A 4IWOA 4E93A 2JEDA 2YIWA 3K3IA 3QTWA 3ZONA 4UV0A 4FTAA 1PRYA 3ODYX 3W8QA 3RAHA 1MUOA 1UA2A 5KMIA 1OI9A 2Z60A 4JIKA 4WSYA 4CRSA 4ZS4A 4C4JA 2JAMA 4IVBA 2UZDA 4EZ7A 4C4HA 2Y4PA 3TI1A 1XQZA 4FV4A 4O0TA 4XEYA 4EH8A 2XRWA 4UZHA 4ALUA 5HG8A 5IQHA 4WBOA 4OT6A 4CCBA 3BX5A 4I0SA 4NKSA 5J9YA 4C3FA 3UOHA 3DK6A 4FGBA 3HMIA 4S31A 2XNGA 4XV9A 4A9RA 4ZMFA 2YDJA 5A4EA 5GJDA 2GMXA 3DK7A 4GKHA 2CLXA 2Z02A 3MPAA 4E6CA 4PDSA 3DQXA 2PUNA 4HCUA 3D7ZA 4ASXA 5K0XA 1NT2A 3PJ8A 2EXMA 2GNHA 4O7TA 4YBKA 3PIXA 5LVPA 4NTTA 4FT0A 5M55A 4U7ZA 4QMZA 1JKKA 3RWQA 3ZHPC 3ZBXA 4YC8A 5HU9A 5LMKA 4X6QC 5FXRA 4KKEA 1BLXA 1YW2A 4PL5A 4XV3A 2W96B 4C57A 1PXNA 2OKRA 2WTWA 2UW0A 3AMBA 5JFWA 4ZK5A 5HNGA 2PTKA 2OZAB 5LVNA 3N51A 2J0KA 1SMHA 4JXFA 2R0UA 3NRMA 1XWSA 4MD7E 3D5VA 4XP2A 5A14A 5DFPA 4YTIA 3ZMMA 2GQRA 4RJ8A 3G5DA 4IDTA 4LI5A 4X2JA 4IAKA 5LVOA 4NKAA 1W7HA 5LVLA 4HPTE 4XX9A 5KKRC 4BTFA 4MNFA 1BKXA 4G31A 1STCE 3SGCA 4II5A 4L44A 4L3JA 3DQWA 4XH6A 4BTKA 2GQSA 4EORA 4FKQA 3NMUF 2QLUA 2OWBA 4EC9A 3PXYA 3FZSA 3PJ1A 3QUDA 3LOKA 4KS7A 3PVGA 3ZH8A 2JKMA 3O7LB 4C3RA 3QQLA 3ZSGA 5A4LA 2Q0NA 1W0XC 2GQGA 2ZM4A 2ZM3A 4K18A 4AT5A 5CX9A 3K54A 4O21A 3W10A 4FTQA 4ZMEA 5LOHA 4IQ6A 4XLVA 3QD4A 3KFAA 4BCNA 5JFSA 3RK5A 5C4KA 3R28A 3DAEA 3IW7A 4PMPA 4XYFA 3R0TA 5AX3A 1YXVA 1V0PA 3AC1A 3HDMA 5TKDA 5IISA 5KMOA 3EMGA 2BAQA 1ZY4A 2QHNA 4ANQA 5J79A 4UWYA 5L6WL 4BGHA 2WTIA 4BWPA 2UZEA 3LHJA 3HMNA 3F7ZA 3NW5A 4YO4A 4H36A 5HESA 3QD0A 3OEZA 3TIZA 3V8WA 3CY3A 3GOKA 4DEHA 3UQFA 3PP1A 3QYWA 2W1ZA 5H2UA 5HG7A 2PE2A 3OY1A 3FMLA 2OK1A 3QL8A 4I21A 4ZP5A 3R8LA 4EH6A 5FTOA 1LEWA 2V7AA 4DINA 4ZZOA 2YIRA 3DBQA 2YDKA 3BV3A 4L7SA 4R1YA 4BZOA 4NK9A 4CZYB 3KKVA 5HLWA 4NM0A 1DI9A 1URCA 3QX2A 3F2NA 4IAIA 4Q2AA 1WMKA 2W5BA 4DG0E 1YHSA 4Q9ZA 3NWWA 1GZ8A 3QAME 3OXIA 4WNKA 1WFCA 1YOJA 2RFSA 3TG1A 2UVYA 3VAPA 3OG7A 2OBJA 3BGZA 4EH3A 2IN6A 4FKWA 3ID6C 4W9WA 3NEWA 5HCZA 3VNTA 1O9UA 3QZHA 4OBPA 4FTKA 1Q3DA 4O7VA 2F2CB 1PYEA 2ITXA 2YAKA 2XJ0A 4IE9A 4O96A 5DT3A 3RZBA 4BTJA 4BIEA 2UZNA 4E5WA 5M4CA 2WTKB 3DJ5A 3RAIA 2WMAA 3E3PA 4JBPA 4O0XA 2X4FA 3FY2A 3OHTA 4RFMA 3PG3A 5EW9A 4XRLA 5BVEA 4IB0A 4AW0A 4U97A 3R9RA 3ZFMA 3BI6A 3VW6A 3FYKX 3QXPA 3CS9A 3P0MA 4E4MA 1QPJA 3PA3A 3R7EA 3DAKA 3VUDA 1Q8WA 2JKQA 3F6XA 2QOHA 2DS1A 4YSJA 2GS2A 3EQCA 1WBPA 1IG1A 3KRWA 5CZHA 4F9AA 4C4IA 2CLQA 4FL1A 5HIDA 3VUKA 2YCQA 3IQ7A 3BKBA 3D2IA 5L2IA 3D15A 2XK4A 4JT3A 3G90X 4XP0A 1WCCA 3KMWA 2WMQA 5L6OA 5D1JA 4E6DA 2W05A 4CNHA 4MF0A 1XH4A 3IS5A 1UKIA 2R3FA 4JRVA 4KABA 1JKLA 4OTRA 4E26A 1W8CA 4X2FA 4IVDA 2OH0E 5IDNA 5L3AA 3CQUA 4K2RA 3L9PA 3QRUA 2OZAA 3F2AA 4YHTA 3TNPC 2ITWA 4GT3A 4LGDA 4CT1A 2JIIA 4E73A 5BVWA 4Q9SA 3FUPA 1K9AA 4EWQA 3R7GA 4DH5A 4PMTA 4FEUA 3LQ8A 2Q0BA 2XYUA 4NT4A 5FTQA 4HYSA 5DPVA 3OMVA 4FTIA 5L2QA 3DLZA 3L9NA 3DBFA 3NAYA 3LMHA 4ZJVA 3QC9A 4H3PA 5BVKA 5CSVA 4CFXA 3U6JA 4BWKA 1JBPE 4BDHA 4RIXB 3MTFA 4AE6A 4C38A 5BPYA 5CAUA 4IANA 4YJPA 1Q8ZA 2YM7A 4J52A 3GCQA 3RAWA 4YZCA 2C3KA 3ZU7A 3I7BA 4R7BA 4TXCA 5EDRA 3ZBFA 1W82A 5JRQA 3PXKA 4RVKA 4O0UA 1PXKA 2UZBA 2XB7A 4AA0A 5FEEA 4AP7A 4IVAA 1NW1A 2W9ZB 3MWUA 4EYMA 2BZJA 4F1MA 4C34A 2OG8A 4E3CA 4HJOA 1H28A 3DXPA 3FMMA 4J8MA 3PPZA 3DDQA 4BI1A 3F61A 5BYYA 5E92A 4ZTQA 2F9GA 4F08A 1YDTE 4L53A 4PMMA 4R5SA 4S2ZA 2ITZA 2JDOA 2W5AA 3HX4A 3FMKA 4GW8A 3BHVA 5GZ8A 5L4QA 2ACXA 2NNWB 4NL0A 1ZYJA 3IONA 3VF9A 4JBVA 3F5XA 2VAGA 3OW3A 5CVGA 1ZOGA 2QD9A 1GZNA 3DS6A 1CDKA 3EH9A 3ORNA 2VNWA 2G1TA 4F7LA 4XG4A 4KRCA 4BDAA 3WF7A 3KRLA 3UQCA 1UV5A 3LM0A 2JDRA 4OBOA 4FSZA 3ANRA 5FWKK 3ZOSA 3D9VA 4FKOA 2WFYA 3T9TA 2XS0A 5HCYA 2BZIB 4MBIA 4BCOA 5JT2A 3C0HA 5AAFA 3LQ3A 4B8LA 2X7FA 1Q3WA 3OT3A 4JOAA 1OB3A 4O81A 3ACKA 1KOBA 2R4BA 3CLYA 4I24A 4O22A 3GP0A 3OCSA 4DFXE 4CKJA 4HVDA 3QWJA 2HW7A 2RFNA 2XVDA 4QMWA 3PJCA 3KRXA 4G16A 4GYGA 3ZDUA 4L42A 4TYIA 3T3UA 3TT0A 1XH6A 3V3VA 4WKQA 4CFFA 4NTSA 4O0YA 2JGZA 3AD6A 3TTJA 4CG8A 5B2LA 4M66A 4IX3A 4AGUA 1GZOA 2RKUA 1IASA 5EW3A 5CF6A 4KSQA 4FKGA 1WBNA 5LWNA 3BHYA 4QNAA 5CSHA 1KE8A 3I7CA 5IG1A 4CMOA 4C4EA 4DH7A 3OS3A 3CQWA 2PL0A 2A0CX 4FTCA 4UZDA 2C0OA 4F70A 4GMYA 1T45A 4J53A 3GCPA 3CIKA 4XOZA 3O51A 3DOGA 3TZ9A 2F7ZE 2WD1A 2J5FA 5HVYA 3MFUA 2XYNA 4FL2A 5K5XA 5KNJA 2PMOX 2QOOA 3BE9A 4J97A 3DK3A 3FI4A 2W1EA 4PTCA 4UYAA 3FKOA 4J8NA 3QCSA 3KC3A 4W4XA 2ITNA 4F09A 4BDKA 3AT2A 2JITA 3QRIA 4KINA 4OTHA 5EK7A 5BMMA 5KCVA 5EKOA 4AQCA 2ZV8A 2W1CA 2WTCA 1ZOEA 3R8PA 4H39A 4I41A 3QCYA 4AAAA 2E9PA 2BKZA 2XKCA 1G3NA 3OEFX 3VN9A 2YEXA 2WTJA 3U8WA 1OUYA 1VEBA 3ZFYA 5AUTA 5DLSA 3GU8A 4AN9A 3P7BA 3GU5A 5E8TA 4FV1A 4ANBA 4HGTA 3MFTA 3KQ7A 4CT2A 4D4VA 3RCDA 1SVHA 1NA7A 2GTMA 3RGFA 4NH1A 3VUTA 1L3RE 5KO1A 3SXSA 4O7NA 1AD5A 2I0EA 5EQPA 5HE0A 2ZJWA 4JX7A 4CXAA 4MWIA 1H1QA 4PV0A 3PDTA 3NYNA 4DF3A 1Q5KA 2X2LA 2Z7SA 1H07A 4GCJA 3CGOA 5IEYA 5CAQA 4RIXA 4C8BA 5EQEA 4X3FB 1XBCA 3PSDA 2J4ZA 3R71A 3RCJA 2I6LA 4EOOA 2I40A 2XKEA 4FSUA 3V5PA 1H8FA 2B54A 3C50A 2PZRA 4FEVA 3FHRA 2JFLA 2QOIA 4R3PA 4F9BA 1YHVA 3NUPA 2OXXA 4QMUA 4EQCA 3GT8A 5M51A 3KK9A 4MKCA 2O65A 3SC1A 4FUYA 4G5PA 4RA5A 4FV3A 1PKGA 2VWWA 3MY1A 3TWJA 4ZJJA 3JVSA 5E9EA 1IRKA 1ZY5A 5BNJA 2XNOA 4NW5A 2OH4A 1H1SA 4ERKA 2HIWA 4OTDA 4WRSA 3ZO2A 3TZ7A 4K33A 3LFCA 2I0VA 3DV3A 4W4VA 1XBAA 1YI3A 2PVRA 4BFMA 5C27A 3WYYA 4J7BA 4C59A 1JNKA 3QU0A 5CNOA 4GK4A 3A7IA 4RWLA 3SLSA 2CKQA 3FLSA 4NFNA 1R39A 5H8BA 3OBJA 4GK3A 1ATPE 4N70A 3FHIA 5HG9A 1BL6A 2XCHA 3AMYA 3FSKA 3SVVA 3VUIA 2OLCA 5C8NA 4RFZA 3I0OA 4GG7A 3FZRA 1FINA 5F95A 5FXQA 3A62A 1Y8YA 4C35A 3VHKA 4EJ7A 4XG7A 5GJGA 4I5MA 2CGUA 3ACJA 2HXQA 4H3BA 4WG4A 5LMAA 2YDIA 3F2RA 3B2TA 2QKWB 3PA4A 3OOGA 1NY3A 1PJKA 3BE2A 4MQ1A 5AP4A 3THBA 5A6NA 5AAGA 1U5QA 1WVWA 2BUJA 2J90A 4AFEA 2C5VA 1Z5MA 4DN5A 3QTZA 1YI4A 1T46A 2JLDA 5IZFA 3N4TA 3U4UA 3NLBA 3LFAA 2VTLA 5DR2A 5JQ8A 2R3QA 3HDNA 2VWVA 3W16A 5AR2A 4R5YA 4GJ3A 2O0UA 2OFUA 4W4YA 4FOCA 3V8SA 1KOAA 4YJSA 2C6OA 1WZYA 4AF3A 2WMWA 3KMMA 3HLLA 3IG7A 2ONLC 5K3YA 3G9LX 4QPAA 4PQNA 2PVYA 2VWZA 3U54A 3EZRA 2VTMA 4DCAA 2G01A 4QQCA 5D12A 3UMWA 4FG9A 2ERZE 1OPLA 5CVHA 3QCXA 2WMRA 3K5VA 4L3LA 5FQDC 2WNTA 3NNWA 5CVFA 3ALNA 3FKLA 2ITOA 1RQQA 1RJBA 2VGOA 3A7HA 3A8WA 3LMGA 4M8TA 4YSMA 1H01A 3WARA 4O7ZA 2F49A 4J71A 1BL7A 3H4JA 2CCIA 3CQEA 1RE8A 3VBQA 1OKYA 2BILB 3IW5A 2FSOX 3PTGA 5AMNA 3ZRMA 3E8CA 4JR3A 1ZYSA 3PSBA 4FNZA 1ND4A 3KA0A 4B4LA 3LZBA 3E88A 4QP3A 4F64A 3E7VA 3TUBA 3DFCB 5JFVA 4D55A 2ITTA 2PMNX 1CSNA 3Q2JA 2W1DA 3C4FA 3VBVA 3COMA 4EQMA 5FLFA 5KE0A 3UMXA 3HMOA 4GG5A 4X3FA 5H8GA 4LYNA 5CF5A 3LE6A 5AJQA 2PVJA 2WKMA 4QD6A 4QMTA 4FSYA 3NW7A 4RMZA 4BCMA 3VBXA 4OGRA 2VWYA 3ATTA 3EFJA 2QKRA 3FQEA 4UBAA 4U45A 3RK9A 2GTNA 3CY2A 2UW9A 4G9RA 3VJNA 1J7LA 4O7YA 4C58A 5AAEA 1REKA 4QMMA 2QODA 2JBPA 2Y7JA 2UZTA 3DTCA 4Y83A 2WO6A 4F63A 4WO5A 3EN6A 4FVRA 3QUPA 5AP1A 4HOKA 5CEIA 3WBLA 2CNVA 2ZM1A 4MWHA 4YC6A 5GINE 2XKFA 4XV1A 3U4WA 3CTJA 5ANIA 4FV5A 2C5YA 1IA8A 2VWIA 3FMEA 3KF7A 3KXZA 5HE2A 3RPVA 3W2SA 3ZXZA 4WUAA 4EHZA 4DTAA 2PUUA 4ASEA 4DE4A 4FICA 3MH1A 4BCGA 3QRJA 5DGZA 3IOPA 3UIMA 4BZNA 2EXEA 4FKVA 4TYHA 4EBVA 1ZARA 3R8UA 3PPJA 3R00A 2VWBA 5CSWA 3HAMA 3MVHA 3HV7A 4JNWA 3ZEPA 5CEPA 4DAWA 4YO6A 4CLJA 2CN5A 3DCVA 3IECA 4UYNA 1FMKA 1OL1A 2WMXA 3DJ6A 4IEBA 3FZ1A 3I0QA 3TM0A 3CJFA 4FSRA 5HVJA 3I6UA 4E1ZA 3UIUA 4F1OA 3R04A 1Y6BA 3K2LA 2R7IA 5I9YA 5KHXA 4YTCA 5HZNA 5M08A 4ACDA 4DEAA 2ITVA 4AXAA 3QYZA 2QVSE 3FI3A 3DB6A 1LP4A 1REJA 1VJYA 5FTGA 2QNJA 4S30A 4JDKA 1Y57A 3QFVA 3L1SA 5HVKA 4E7WA 3SG9A 4OAUC 2JDSA 2ITYA 3CSVA 1WVYA 2W1IA 3TIYA 5A46A 2R2PA 4PNKA 1UU8A 4IJPA 5I9VA 5IH4A 4NCTA 2G2FA 3T3VA 2PMIA 2YA9A 3RM7A 2O2UA 4QMYA 4A7CA 5CQWA 3CR0A 3TTIA 5HE1A 2C0TA 3KK8A 3BHUA 3PJ3A 1OKWA 3F5PA 3MSSA 3PWDA 3PVWA 4LG4A 4AOIA 4RIWB 3HV4A 4Z9LA 3OVVA 3ANQA 2GSFA 2J0MB 1SVGA 5FP6A 4QMNA 2B55A 4ZLOA 3SD0A 1GIHA 4X6RA 5CY3A 4TNDA 4AFJA 3OBGA 3VS6A 5L2TA 1F5QA 3IW6A 4FIFA 1B38A 2QO7A 4PPCA 1YWRA 1Q8TA 3FE3A 2OJJA 3OTUA 2CNUA 3HL7A 1H4LA 2OXDA 3VS1A 4N57A 3PWYA 3BU5A 3DA6A 4O6EA 3REPA 3GBZA 4DEEA 4N0SA 3P23A 4O84A 4TYGA 4ZZNA 3NUNA 4J95A 2QLQA 4ORKA 3R8VA 3PY1A 3A7JA 4BCIA 4WRGA 2NO3A 4CFWA 3QTQA 4DBXA 1OVEA 2FUMA 4V05A 5EM5A 5AUXA 5A4QA 2Z7RA 4NM7A 5CU3A 5DHJA 3S2PA 4IC8A 3VS7A 4FTLA 4QQTA 2UVXA 2XRUA 4A9YA 3WIKA 4C4GA 1JVPP 4PP9A 3HUCA 5LJJA 3TDWA 3UE4A 3FQHA 2EU9A 4M15A 2C5XA 3Q9ZA 2YM6A 2XK7A 5ITAA 5AIRA 2PVHA 3FYJX 3WF8A 5HI2A 3ORKA 5DE2A 4BWXA 4R7IA 1SM2A 3EIDA 4MNEB 4BVUA 3EQHA 4AU8A 4S32A 3C7QA 2X4ZA 2UW8A 2B4SB 4I94A 4F1TA 4EHEA 3A2CA 4K8AA 4QOXA 5IEXA 2R3KA 4RZVA 4BYJA 3I60A 2B0QA 3MVMA 5JN2A 2OSCA 3DBCA 4FL3A 4GSBA 3VW8A 4RX9A 1CM8A 4GUEA 4EOSA 5HBJA 4ZIMA 5K4IA 3WI6A 3MFSA 1SYKA 4QP8A 2I0YA 4TRLA 3POZA 3D83A 3FEGA 3UOKA 5CU2A 5M57A 3I4BA 4N4SA 3P7CA 4L7FA 4Q5EA 4P4CA 3KN5A 3BQRA 4AW1A 2R5TA 2XK3A 4FKJA 4FTTA 3SDJA 3WZUA 4E4NA 2RFDA 3UG2A 1U46A 4WNPA 2JIVA 3ULIA 5BUJA 4M84A 2GNJA 4ZS0A 3WZJA 3DNDA 5J8IA 2RG6A 2VTOA 4BR3A 4AW2A 3DKGA 2Y6OA 5HLNA 4EC8A 4K1BA 3F66A 4FOBA 3V5JA 1O6LA 4CV8A 2BCJA 2ZB1A 4XG6A 3TN8A 4B99A 2BROA 3BWFA 1MRVA 1OIUA 5K9IA 3R01A 3RPOA 4FKIA 4D9UA 1Y8GA 3KF4A 4E6QA 3QLGA 4WNOA 3O96A 4F99A 3FL5A 2BALA 5DNRA 3EZVA 2XNNA 3FI8A 1YVJA 5H9BA 4FEQA 3R7YA 5HX6A 5J5SA 4G6OA 5E7RA 5DRDA 3MESA 2WQOA 3MVLA 3O50A 4RQVA 1PXIA 3QRKA 2KTYA 2YFXA 4FMQA 4KAOA 2XIRA 3BCEA 3BU6A 3UDBA 3UNJA 5AWMA 3DGKA 2R3MA 5T6KA 3G9NA 1GZKA 3F5UA 5A9UA 3NCGA 2YITA 2X6DA 4Y8DA 2C69A 3Q4ZA 3Q4TA 3OD6X 1ZXEA 4FK3A 4D2RA 4IMYA 4RIWA 4F0IA 4ZY4A 4USEA 5K5NA 4F6SA 4EJNA 2VU3A 5CXHA 3W18A 4ZJIA 3MPMA 3VRYA 1SVEA 3P7AA 5AP0A 4EH5A 3A99A 3CPBA 4QTBA 5DIAA 2CKOA 3QC4A 3FLWA 4GFMA 3N4UA 4QQJA 5EI8A 4BGGA 1E1XA 2X9EA 2R0IA 3A4PA 4FKRA 3P5KA 3R1NA 4WNMA 4HNIA 4ALWA 4ZAUA 3V6RA 4DFBA 4BL1A 2YM4A 4U41A 5HORA 1KV1A 3KXGA 4R1VA 4BCKA 4BHZA 4JG6A 3HRCA 2OJFE 4E4LA 2XNEA 3L9LA 2V0DA 4QMSA 3SX9A 4YMJA 5L8LA 4IACA 4X2GA 5CAOA 5LARA 4FNYA 2G2HA 2SRCA 3BEGA 4FX3A 4I4EA 2FVDA 4U40A 1OBGA 3V5TA 3KY2A 4GT4A 4RRVA 1Q41A 3TKHA 1P14A 2WIPA 1FGKA 4U6RA 1LR4A 5ANOA 4FV0A 4B9DA 4J98A 3VHEA 2RL5A 4IM3A 2QO9A 4RX8A 4FV8A 3VULA 2VX0A 3BIZA 4TZRA 3PYYA 3FI2A 4QMLA 3QGYA 4BCHA 2GNFA 1VYWA 2Z7LA 1AGWA 2HELA 3E3BX 4UALA 4XBRA 4CTBA 4D2SA 4EOIA 5JK3A 1G8AA 4MNEA 5I9WA 5M53A 4OLIA 3A7GA 4EK5A 4QMPA 1X8BA 5JRSA 5M56A 2UW4A 2IZUA 2XA4A 3QKKA 2BRBA 2ETKA 4GS6A 4NUSA 5AR7A 2NPQA 1DAYA 4C4FA 2CDZA 5HOAA 2V7OA 3MH0A 2F7XE 2JKKA 3MYGA 2BFYA 5FM2A 1S9JA 4XRJA 5KMLA 4YLLA 4DCEA 3MFRA 2QOBA 4YTHA 5C4LA 4ITJA 2FO0A 3ZM4A 4F7SA 1PY5A 5EYMA 2C0IA 4EONA 5I9ZA 3E92A 2YZAA 4EOJA 1H24A 4TYJA 4CMTA 5CENA 4DH1A 4S33A 4AW5A 5ANJA 2HOGA 3VJOA 4AZWA 1KV2A 2WPAA 5ACBC 3LLAA 2JKOA 4ZSJA 2FGIA 3VS2A 4IAZA 2R64A 4M69B 4AE9A 2HZ4A 3P9JA 2P2IA 3C4EA 2OIQA 4RC4A 1RW8A 1FMOE 1KWPA 2YJSA 2R3JA 4MD8E 3NUAA 1H25A 3QTSA 2YHVA 5JZNA 5HD4A 4M67A 4ZTSA 4LMUA 4ZEGA 2F7EE 1LPUA 2F2UA 4FZ7A 4HYHA 5CU0A 2J51A 4A4LA 4D4RA 3FL4A 2F57A 3ODZX 3P79A 3GGFA 3R7VA 3TCPA 2PYWA 3LAUA 5IQBA 3UYSA 4XBUA 4F6WA 3R1SA 1QPEA 1YOMA 3EKKA 1O6KA 5FP5A 3AG9A 1UWJA 3PRIA 2QQ7A 3VF8A 5M44A 3O71A 3MB6A 4D2WA 2BZHB 5L2WA 1NVQA 4OTIA 3LFBA 5HTIA 3AD4A 3G6GA 4TKSA 4FKLA 1URWA 3F5GA 4FSWA 5TF9A 4H58A 5AP2A 4D2VA 5DOSA 4ENXA 4YJUA 2H96A 3M11A 4QP6A 1Y91A 3PLSA 3BPRA 2BIKB 2PE1A 2XIYA 3LM5A 3QUEA 3A7FA 4AOJA 3E5AA 4A4OA 3FBVA 2FH9A 3LCDA 3EL8A 4G34A 2BIYA 2A19B 2XEZA 2WELA 5IA4A 5IPJA 4DH8A 2VWXA 5ETCA 3O7LD 3QQFA 3E64A 5LVMA 5EYCA 5AV0A 2OGVA 2X2KA 3OFMA 1BYGA 3D14A 4I6BA 4CZUA 3EL7A 5BVNA 5I5ZA 1JAMA 1CMKE 4EI4A 5E91A 4NEUA 4DG2E 5CEKA 3UVQA 4PP7A 3QTUA 2CGXA 3PZEA 1J3HA 5E8UA 5JSMA 3L8VA 3A4OX 3M1SA 2XM9A 3NNXA 4WUNA 3EKNA 4JR7A 2OIBA 3ENHA 3U87A 1XJDA 3DDPA 3LXPA 1JSUA 4RA4A 2Y9QA 3LQ5A 4PWNA 3U9NA 1Q97A 1R1WA 2ZAZA 4YPDA 3L8PA 2HYYA 4KUJA 2EUFB 3NYVA 5EKNA 2VTQA 3HUBA 4ANNA 4TNBA 3JPVA 4FVPA 3NUYA 2CKEA 5AV3A 3BEAA 2W5HA 2ZB0A 2PUIA 4FR4A 2UW7A 4BF2A 3O8TA 3ZDIA 1Q61A 4V01A 5FXSA 5AUWA 2UZWE 2ZV7A 1GOLA 4QMXA 5GIPE 2HENA 2REIA 4RIOA 3VQHA 4ID7A 1XBBA 2C5NA 2W4KA 3DFAA 1PXLA 3MGYA 4MCVA 4IZAA 3RJCA 4BBMA 1FVRA 4X2NA 4DGGA 3SW4A 1XR1A 1AQ1A 3ELJA 2VO0A 2PZ5A 4QNYA 4CFVA 5CANA 3PUPA 5DWRA 5IQGA 5HEZA 5HU3A 5KBRA 5AP3A 2VTPA 4EK3A 4E5AX 3W2QA 4ANOA 1L8TA 4GKIA 2BAJA 1ZAOA 4N6YA 5AR5A 3LJ0A 1PMVA 5EQYA 3QTXA 4PDPA 4AN3A 3S4QA 2X81A 3HZTA 3RNIA 2W1HA 4EKKA 5IUHA 4KBKA 4BICA 4B0GA 1LUFA 2B9HA 1RDQE 2P2HA 2XJ2A 1XO2B 1M17A 1YQJA 3KRRA 3NYXA 1PXJA 4IM0A 4M69A 2XK8A 5IQAA 2C68A 2IW9A 4QTEA 4CKIA 3CCNA 2X9FA 3V51A 1OUKA 4KKGA 3ZXTA 3Q9YA 2O5KA 4PX6A 4E5BA 4WD5A 3AT4A 2QG7A 1FVVA 1IA9A 5IA0A 3QQJA 2CCHA 4MBJA 5E90A 1JWHA 1BI7A 2RFEA 2VTRA 2WEIA 2WQNA 2ZYBA 3VBTA 2GHLA 4L3PA 4S34A 4YLJA 4L52A 1TKIA 2XP2A 5F9EA 3L9MA 4G9CA 1OL7A 5HQ0A 2W1FA 3CTHA 4EK8A 4W9XA 3SAYA 3GU4A 1FOTA 3UZPA 4BDGA 5AV4A 3UOJA 3FKNA 4R8QA 2RGPA 1SNXA 2YJRA 3G0EA 1FVTA 4G6LA 3KCKA 4JS8A 1XH5A 5HNIX 5E8ZA 2DQ7X 3FZPA 2EXCX 3ZYAA 5CAVA 4O86A 2J9MA 3MA3A 4FBXA 2YCFA 4GFOA 1U59A 5JZJA 3LCKA 3OCGA 3VBWA 3MJ1A 4J96A 2UVZA 3OT8A 3CPCA 2PE0A 3EQFA 4PMSA 1P4FA 3LFNA 2HCKA 5D7VA 3RWPA 3D7TB 3UNKA 4CG9A 3HRBA 3H0ZA 5AM7A 2O63A 4A9UA 4JL9A 3BYMA 1I09A 1QMZA 2B53A 4FK6A 4RVLA 5IMXA 4KBAA 5DH3A 3H9FA 4AGDA 3W33A 4LV5A 4WG3A 1E1VA 2GHMA 4I23A 3KL8A 3R02A 1M7QA 3TNQB 3H10A 3ZFXA 4ZTMA 5JGBA 3DT1A 2QOKA 4BKJA 4GYIA 4BKYA 3EYHA 5J1VA 2CKPA 5AR4A 2QU5A 2J5EA 2W17A 3QZGA 4HNFA 4I22A 5I4NA 3DKCA 4GVJA 1H1WA 1U5RA 5LWMA 4EL9A 3Q6WA 3U6IA 2GDOA 4RPVA 4AZVA 3SOCA 1LEZA 3Q2MA 3EHAA 4BIDA 3A60A 3JUHA 3LFEA 2IVUA 2OF2A 4CCUA 2OFVA 5DRBA 4XUFA 4YR8A 3PXFA 5EDQA 3TKIA 4I20A 3C0GA 5C26A 4BDBA 3WILA 2YM5A 4EK4A 3WZEA 3KCFA 3NNVA 2HK5A 1F0QA 4I92A 3UIBA 2VX3A 4IB3A 3A8XA 4FV9A 4KWPA 2W1GA 5F94A 5EOBA 4CD0A 4DT8A 4FG7A 2R3GA 1KE6A 3LLTA 5EM8A 5ACKA 4QMVA 3PA5A 2RG5A 3RVGA 3CEKA 3M2WA 4AZSA 3KRJA 5BVFA 4LGGA 2BMCA 4UY9A 4HZRA 4Y5HA 1UNLA 5ETFA 1M14A 5M4UA 2B9FA 3F3UA 4IB5A 3ZO3A 3HECA 1FBNA 3C5IA 4YJTA 3VS4A 1PXPA 3JS2A 3NIEA 4EZ3A 3MH3A 4IC7A 4FGRA 3OCBA 3KU2A 4MXZA 4YJRA 5CEMA 3RNYA 3RPRA 2PVFA 2I1MA 3FLQA 4YUQA 4AZEA 4IIRA 4X0MA 4PRJA 3W55A 3F82A 2IZSA 3ORIA 4LOOA 4TTHB 4KIPA 4DITA 4ARKA 4O27B 5LCKA 3NGAA 5AA9A 3OUKA 5ANKA 4G3EA 4JQ7A 4BTMA 4A07A 4OTQA 5ETAA 1Z57A 2C6IA 3C51A 2WOTA 3GOPA 4P2KA 5M4FA 1H0VA 4FIHA 2B9IA 4I93A 3Q53A 4KKHA 3FLYA 2O64A 3P08A 2ETRA 2VO3A 4YZNA 3RHXA 4Y73A 2JAVA 2OJ9A 4FUXA 3EQDA 4XCUA 3C4CA 1OL2A 4M0YA 3NUSA 4U3YA 5TT7A 2UZVA 4I3ZA 3A61A 4IB1A 4KIOA 4YGAA 4O7SA 4CFNA 3QD2B 5I9UA 3CGFA 3EN7A 4L00A 4R3CA 4HW7A 2JDTA 2XBJA 4RWJA 1XH7A 3PZHA 3C13A 4JDJA 4RVTA 4E6AA 5JKGA 4BI2A 2R3NA 3JXWA 4DT9A 3R6XA 3OZ6A 3VBYA 4NWMA 2GU8A 2Y0AA 4BRXA 4JVGA 5JMSA 3ULZA 3Q4CA 4F7NA 2BHHA 1OL6A 1FGIA 3PXZA 3C0IA 4XLIA 3WF9A 2ERKA 3OC1A 4PDOA 4ENYA 5E1EA 2BTSA 4DEGA 4HVSA 4FA2A 4F65A 2QR7A 3QZIA 4NM5A 3ZLSA 3ZRLA 2UW5A 4L9IA 5C8MA 2OF4A 4BKZA 3JVRA 5HKMA 1U4DA 3ETAA 3IDBA 4ITHA 3NS9A 4PPAA 5AADA 4PTEA 3LFQA 2ZVAA 3VS5A 3COHA 3OF0A 2V22A 2AC3A 4OTPA 1YXSA 4O82A 3TKUA 4LRJA 4BGQA 1PW2A 3R1YA 3OWLA 4A9TA 3D7TA 3EJ1A 4O2PA 4XG9A 5ETIA 4EK6A 4DTBA 3NUUA 2BVAA 3EWHA 5FRIA 1U54B 3FMHA 1XHAA 1YDSE 4GEOA 4FIJA 4CZTA 4Y85A 4QP7A 3EQRA 4GIIA 3MW1A 1HOWA 5ICPA 3G15A 4LGHA 4E8AA 1YXUA 1OM1A 4NIFB 3TZMA 3ZUUA 5HO7A 1BMKA 4G5JA 3ZUTA 3R9NA 2E9OA 2C6EA 4ACGA 4JRNA 2GNGA 3BRBA 4FSNA 4FVQA 4WG5A 4JQEA 4XMOA 4EKLA 2WQEA 4BYIA 1P5EA 3LVPA 1M2RA 2Z7QA 4D2TA 3W2OA 4M3QA 4MQ2A 1ZWSA 2P4IA 5J9ZA 2ETMA 4RJ3A 4FKUA 3E8DA 4KNBA 4PNIA 4RLLA 4L68A 1Q62A 3VUMA 3PG1A 2WIHA 5C1QB 4BDEA 1WBOA 4P7EA 2YIYA 4D0WA 3TXOA 4C7TA 1A06A 1OKVA 5F4NA 3FPMA 2VTNA 4RWKA 1Q4LA 2W4JA 4G3DA 1M7NA 2J0IA 2YAAA 3V5WA 5T68A 4EEVA 3EQBA 4UEUA 3KREA 4BDCA 2G9XA 2PPQA 1Q24A 3ZCLA 3HRFA 2Z2WA 2QONA 4G2FA 3UC4A 2VO7A 3ZRKA 4BBFA 4C0TA 3HA6A 1FPUA 3QQGA 4GIHA 3WYXA 3DXNA 1B39A 4IAFA 4IWDA 1XKKA 3QWKA 5DVRA 5GNKA 3AC4A 3R2BA 2W7XA 4GV1A 1VR2A 5FBOA 2A1AB 4NFMA 1K3AA 4YHJA 4O83A 3UO5A 4DG3E 3QBNA 4D5KA 2NP8A 4O7LA 2EB3A 3W32A 4MTAA 4B8MA 4CYJA 3QLFA 3SHEA 3GQIA 2F4JA 3BELA 2FSTX 1H0WA 1PXMA 1YDRE 2Y4IB 3O8PA 4WIHA 1K2PA 4I1ZA 4XHKB 1QL6A 2OU7A 3AGLA 3DZQA 4D1XA 5IUIA 1JSTA 3VS3A 4C02A 3Q60A 3COKA 5AM6A 2I7QA 4O2ZA 4AWIA 3GUBA 5LMKC 2BKKA 5DI1A 4PUZA 3RINA 3LIJA 1BI8A 1WBSA 5F20A 5HG5A 4CVAA 4MX9A 5CQUA 4TYEA 4G17A 3RP9A 4RQKA 2CGVA 3PY3A 1ZMWA 2VN9A 3AOXA 4RT7A 2E9VA 4CTCA 4U43A 2IG7A 1W84A 1JKSA 3FV8A 4D2PA 3AQVA 2BAKA 3ORLA 1JSVA 3PFQA 3D4QA 3DJ7A 3NDMA 1ZYDA 5M07A 2OO8X 2UZLA 4O0WA 3LCSA 3RMFA 3ZZWA 4O1OA 3FJQE 2C3IB 5KBQA 2IZRA 3KN6A 4DYMA 4EOMA 4WBBB 4EH9A 4R7HA 2H6DA 2YN8A 3I79A 3TV6A 4CQGA 2YM3A 5HX8A 4QT1A 2IO6A 4D4YA 2E9UA 2JD5A 3FQSA 2WMVA 3T8OA 4IXPA 3LXLA 4Y95A 2ZOQA 4F4PA 2YABA 4C62A 3HV3A 4BDJA 2WHBA 3DAJA 5CALA 4ZTLA 3LFDA 3UGCA 3E7OA 2Y6MA 3R2YA 4XJ0A 4IX6A 2VRXA 3AD5A 4PF4A 5DG5A 4BBEA 1W98A 4U42A 3C1XA 3BYOA 2WQBA 3LCTA 5CEOA 1HCKA 2YZLA 3VC4A 2LGCA 4WSQA 2J7TA 3HV6A 3F9NA 4F7JA 2OJGA 3OOMA 4BY9E 1MQ4A 4AX8A 5ANEA 4FTJA 4XV2A 5EW8A 4GVAA 2R9SA 3CXWA 2XNBA 4J99A 1OZ1A 3U6HA 1Y6AA 2CGWA 2WQMA 4PL3A 5BYLA 3RTPA 4L6QA 4MXCA 5J7HA 4QYFA 3IK3A 3LPBA 4IAAA 4JDIA 4EH4A 4QPMA 4ALVA 3Q6UA 5KX8A 3WOWA 4ASDA 1U54A 3EFKA 4KS8A 2CN8A 5GZAA 5IU2A 5J7BA 4DA5A 3CKXA 4HGEA 3EOCA 4PPBA 4DGMA 3GC0A 4TWCA 2P0CA 4QP4A 3FWQA 4J1RA 1CTPE 2JFMA 1Q8UA 3ROYA 1YKRA 5J87A 2ZDTA 4HZSA 4AG8A 5IUGA 2YWVA 4ZSAA 4JLCA 5LQFA 5EM7A 3EQGA 3ZO4A 2PU8A 2DUVA 3R21A 3LJ1A 4XOYA 2PULA 2A2AA 2X8EA 4MXYA 1ZOHA 3FAAA 2OJIA 4O0RA 3NVKI 1ZMVA 2B9JA 4RX7A 3TNIA 4M0ZA 5JGDA 3HMPA 4UXQA 2GNLA 3ZTXA 4GRBA 4LOPA 4BIBA 3BLRA 3DBDA 2QI8A 3UBDA 3V01A 3W2RA 5DA3A 4QYHA 1GIIA 2KULA 5IKWA 2QCSA 2C6TA 2V5QA 3AC2A 3DNEA 3FDNA 3Q5IA 3TNHA 3PIZA 4D0XA 3KVXA 2J2IB 3GC9A 4FYNA 4O0SA 3C4XA 2XZSA 4I6FA 5EDPA 2VTAA 3KXXA 3GEQA 1A9UA 3DKOA 3R7UA 4AA5A 3LJ2A 3DKFA 4JAIA 2XEYA 5EOLA 3ZSIA 4KB8A 4D4SA 2PWLA 2VTJA 3L8XA 4F9WA 2X39A 3UG1A 3VS0A 3KXMA 3JR1A 5KMMA 2IZTA 4KSPA 3B2WA 2R3LA 2PVLA 2IPXA 4AOTA 4NYEA 3OWJA 1ZRZA 4GK2A 1W83A 4HYIA 4BDIA 3TEIA 2OW3A 2OZOA 3C9WA 4TY1A 4WOVA 5DT0A 4ZTRA 4OT5A 2YLFA 3PPKA 5BX0A 3TUDA 4WHZA 3ENMA 3LKMA 3GNIB 3K5UA 1OKZA 5I0BA 4CRLA 4LRMA 2UV2A 3LFFA 2C4GA 2YCRA 1ZZLA 3HKOA 4FIEA 4FKSA 4A9SA 2XM8A 5B0XA 3BLQA 2FA2A 4YBJA 4LUDA 4U79A 3C4WA 4CEGA 5LMBA 3NVMB 4IBMA 3UOLA 2Y8OA 2BPMA 4BN1A 3R8ZA 4FZAB 4Y72A 2RIOA 3S1HA 3SRVB 3CJGA 3BU3A 2GS6A 2BRGA 3F69A 4QQ5A 2VTIA 2XUUA 2UW6A 4PL4A 3W1FA 1WBVA 3PXRA 2HXLA 4APPA 4EUUA 5AR8A 3V5QA 3QD3A 3ZZEA 1KSWA 3P78A 4ITIA 3OROA 2YLEA 4FZ6A 2A27A 3U9CA 3P1AA 1VZOA 2W06A 4APCA 4EQUA 5FDXA 4Z16A 2YWPA 3O2MA 4RLKA 4Y5QA 5JGAA 5TO8A 4UMRA 1NXKA 4AUAA 2X8DA 3F3VA 4BHNA 1OBDA 4MXAA 5CS6A 4U81A 2QR8A 2B1PA 4D28A 1OL5A 1MQBA 4DTKA 5HIEA 3BV2A 2VTTA 5CI7A 5E8VA 1GJOA 4RZWA 4JBOA 3I5NA 3S95A 2Z8CA 1G5SA 4O0VA 1JLUE 4C2WA 3F3TA 4OUCA 3F3ZA 1H1RA 4RJ5A 2HWPA 5AUVA 1I44A 3Q96A 3RHKA 1UU3A 5KKRB 4MD9E 1YRPA 2PHKA 3MH2A 5KMJA 5IA2A 1DI8A 5FUTA 1M52A 2ITQA 1M2QA 3WE8A 4YZBA 2QOLA 4FV7A 4QTCA 4AT3A 3DTWA 2CJMA 3D2KA 4X2KA 4ONAA 3SV0A 3I81A 3BQCA 2O8YA 2X7OA 3EQPA 2IVTA 3NAXA 5AUZA 2IJMA 2BDFA 2GS7A 2GHGA 3FZOA 3PVUA 4H3QA 3PSCA 4YLKA 2ESMA 4EBWA 3FXWA 3G0FA 2PVKA 2C3JA 4IW0A 4RJ6A 5DYJA 1UU9A 1UVRA 4Z3VA 5FDPA 1GAGA 4BCFA 1PKDA 2JC6A 3MY0A 3UTOA 1M2PA 2V62A 5HBEA 4FT9A 3FXZA 5M06A 2WMSA 3MIAA 2NRYA 3RAKA 4GL9A 4K0YA 5D11A 4KA3A 2WZJA 3R7IA 3RM6A 3V8TA 4CQEA 5JEBA 3T9IA 4FEWA 5CXZA 4R3RA 2FYSA 3OXTA 3HV5A 2BTRA 2PVMA 3RPYA 1OIQA 2BFXA 3R9DA 3WF6A 4XP3A 3QA0A 3QX4A 4C36A 3B8QA 3OW4A 3VUGA 3WE4A 3ET7A 2XIXA 3NNUA 4GUBA 4FG8A 4HCVA 5BUIA 2C47A 3UZTA 2EWAA 4RJ4A 4C61A 4EH7A 1J7IA 1V0BA 4G1WA 5CTPA 3UYTA 4P90A 5EHOA 1KE7A 4ZXTA 2ZV2A 3W2CA 2C5OA 2WAJA 3HAVA 2WTKC 3EFWA 3OWPA 2WMBA 3E63A 5AIKA 4DC2A 5A3XA 1YWNA 2VUWA 3MBLA 3NR9A 4IH8A 4DH3A 4A06A 5L6PA 1UU7A 3OUNB 5KHWA 2GCDA 1YXXA 3I5ZA 4EHVA 1JOWB 2GPHA 4DFZE 5IEVA 5CSXA 2HY0A 3QALE 3ORZA 3SXRA 3VWAA 5EYKA 5J5TA 4DFNA 5HE3A 4EOKA 4AGCA 2X1NA 1OPJA 2G15A 4LFIA 2YCSA 4U9AA 4E4XA 1OGUA 2W0JA 4RBLA 3U51A 5IQFA 3ZO1A 3QZFA 2W99B 3TUCA 5ANGA 2BDWA 1MRUA 3FMDA 3MTLA 5IH6A 4H1MA 3ORXA 5LCJA 2QC6A 4NU1A 4K9YA 1JPAA 2IW6A 4ZTHA 4ACMA 3II5A 4I0TA 3GVUA 4UXLA 3TACA 3TV4A 3UVRA 3IGGA 4E20A 3WF5A 1KUTA 5HHWA 4U44A 3SRVA 4IWPA 4ZSGA 3PY0A 3FSFA 2PZPA 3TZ8A 2R3HA 2BDJA 2JBOA 4YJVA 5D7AA 1UWHA 4LL5A 5IQCA 5DBXA 5DN3A 2EVAA 3IDCA 4N6ZA 1J91A 3H9OA 4H05A 3FZTA 5BQ0A 4I5PA 1VYZA 3BHHA 3MPTA 3AXWA 3ZC6A 2ITPA 3NYOA 3GI3A 4QRCA 3LXNA 4IZYA 3DU8A 4FV2A 3D94A 4W4WA 3ATSA 3GCVA 3HA8A 5G1XA 2XCKA 4HCTA 3S00A 2R3PA 4RC2A 3FPQA 4JX3A 4FKTA 3HMMA 3PIYA 2CHLA 3ZUVA 4D58A 4GJ2A 2GFSA 4USFA 3KXNA 3QTRA 3VUHA 5HD7A 4OR5A 3G6HA 4C2VA 4DLJA 4FTUA 4FNWA 2ZMDA 1ZZ2A 4BDFA 3GXLA 2R3IA 4KRDA 1H1PA 3F3WA 3G33A 5CYIA 4F6UA 3G2FA 3O8UA 2IVSA 4BCJA 1H08A 1CKIA 3BHTA 3CC6A 3M42A 4LMNA 3ZLWA 4Z7HA 2XF0A 4CGAA 5EG3A 4QTDA 4ZSLA 2PVNA 5H3QA 3MVJA 4WT6A 1UKHA 2CPKE 2XKDA 3E8NA 3QGWA 3ZS5A 3GU6A 3GU7A 4FYOA 3GENA 4YZMA 4EWHA 2UW3A 4YP8A 3JY0A 4CFMA 4GU6A 2H8HA 4BDDA 4RG0A 5DEWA 3RZFA 4L46A 1OIRA 2ZDUA 4ZZMA 3LCOA 4MBLA 4DEDA 4OTWA 2XH5A 4BC6A 2VTHA 4V0GB 3H9RA 4FTMA 4D9TA 2WMTA 4OAVB 4X3JA 2J50A 4RC3A 3SQQA 2WGJA 4IX5A 3QTIA 3V04A 3H30A 3LFSA 3SW7A 3IGOA 5HICA 4KBCA 5GIOE 4X7QA 3Q9XA 4CFUA 4YU2A 3UPXA 4RIYB 3SXFA 2WB8A 4FT3A 5C9CA 2R3RA 4JG8A 4XG3A 5BVDA 1DS5A 5B2KA 4MVFA 2YERA 5C03A 4TWPA 5E4HA 5DMZA 2X7GA 1PMEA 4M7IA 4U3ZA 2HWOA 3QCQA 4HYUA 5T3QA 5IA3A 3BYUA 4FC0A 2OICA 3GCSA 2QOQA 3NCZA 5EI2A 2IVVA 2XNMA 3HEGA 5CLPA 3TDVA 3OWKA 1QPCA 4CKRA 4FZFB 2J0LA 5FD2A 3ORPA 5KMNA 5IA1A 3IOKA 4HVHA 4C33A 1OECA 5J95A 1YHWA 3PVBA 4YZ9A 5EH0A 3R63A 4RWIA 3AC5A 4IAYA 3UP2A 3UVPA 4ANLA 2HAKA 4LRKA 4BI0A 3FLZA 1O6YA 1V1KA 2B52A 5I3RA 2W4OA 3PP0A 1WAKA 4NM3A 5HNBA 4A4XA 3U55A 5AP6A 3UO4A 3VVHA 3R9OA 4HVIA 1NVSA 3F88A 1HCLA 3OP5A 4IZ7A 2BHEA 5AA8A 4MXOA 4Y46A 1QPDA 5CT0A 4FEXA 3GFEA 2VWUA 1WBWA 2XIZA 3H3CA 3KVWA 4DGNA 3QKLA 1JQHA 4MH7A 5D9HA 3ROCA 3HP5A 2IWIA 3E87A 4FSMA 5CU4A 5BVOA 4QYGA 2C3LA 4XS2A 1BX6A 4FKPA 4RJ7A 5CU6A 1J1BA 2QG5A 5AUYA 3ZSHA 3Q3BA 3ERKA 3PRFA 4NSTA 3ZLXA 4FIGA 5TR6A 3MIYA 1PXOA 2UUEA 4IDVA 3R1QA 2EB2A 3BZ3A 3NIZA 2A4LA 4O7WA 1ZYCA 4BZDA 4FT7A 3RBWA 2W9FB 4O38A 4I0RA 4AT4A 1TQMA 4X3FC 2PK9A 4O6LA 4IZ5A 4BCPA 3KXHA 1E9HA 3E93A 4UB7A 2IW8A 4USDA 4MYGA 3AMAA 4TPTA 5EYDA 3FMJA 1GNGA 4UMQA 4U0IA 4HVGA 4IVCA 4NJDA 4YJNA 3D5XA 5HCXA 2YISA 5K4JA 4NW6A 4MAOA 4C37A 3MDYA 1SNUA 2VV9A 4FF8A 3COIA 2OXYA 5AFVA 2ITUA 5ANDA 3ORMA 3JY9A 4OTFA 4QO9A 5KZIA 2DWBA 4YHFA 3R7OA 3SOAA 3EB0A 2VD5A 4NZWB 1YXTA 3MS9A 3B8RA 3SA0A 4MHAA 3EN9A 1DAWA 5HIBA 2YIQA 2HZ0A 4X21A 5IA5A 3V5LA 5HTCA 4TN6A 4EOPA 4M68A 3SKCA 4EH2A 1ERKA 1GIJA 5CI6A 1IAHA 4DFLA 1Q8YA 3CD3A 2VGPA 3PE1A 5KZ0A 1Z9XA 3HVCA 4V04A 5A54A 2BR1A 5IDPA 4DEIA 4Z55A 3W8LA 1YOLA 3K3JA 1R0EA 1V0OA 4JJRA 3E8EA 4LL0A 4ZY5A 2QHMA 1OITA 3UZRA 3ZM9A 4V0GA 2C6LA 2X2MA 4LM5A 5BUEA 2FB8A 3MN3A 4GU9A 4I6QA 4L43A 5HBHA 4EUTA 4CLIA 5A4TA 1A48A 4L01A 2PZYA 4QTAA 3POOA 5I3OA 2CNQA 2FSLX 4G6NA 3MB7A 5BMSA 5CSPA 2WU7A 1F3MC 4RIYA 3Q4UA 4YPSA 3IW4A 3LXKA 1PYXA 2UZUE 2BRHA 1IAJA 1PMNA 5E1SA 2JDVA 2WTVA 3CTQA 1B6CB 4IHPA 5CASA 2I0HA 4DHFA 3UJGA 3TNWA 4QMQA 3DPKA 4I4FA 4O91A 5E8WA 1H00A 3QRTA 2QOCA 5IQEA 3LMIA 5AR3A 4TYHB 3MV5A 3BGQA 3MA6A 4AN2A 3G51A 4M12A 4ASZA 1R3CA 3TJCA 4F0FA 5AUUA 5TOZA 3VRZA 4RX5A 2C1AA 1UNHA 4KIKB 1OMWA 5FM3A 5CF4A 4TWNA 4B7TA 1PF8A 5CF8A 2B7AA 5HO8A 4NCTC 4I6HA 4UWBA 3PXQA 3FY0A 4YJOA 4Z7GA 3QQUA 1UNGA 4D1ZA 4BCQA 3EYGA 2WMUA 2BZKB 4DFUA 4L67A 5JFXA 3I6WA 4TW9A 5L8KA 4IX4A 4M13A 3EQIA 3RKBA 3VIDA 2C6KA 2PSQA 3R73A 4FNXA 5J9LA 5CWZA 2C6DA 2JIUA 3UODA 3AC8A 2LAVA 3FLNC 3WIGA 4WA9A 1PHKA 3ZC5A 3UO6A 2AYPA 1ZMUA 3RALA 5E8XA 3BYSA 5AP7A 3N4VA 1R78A 3MI9A 4ZY6A 4AA4A 4K77A 2AC5A 3JYAA 3FC2A 3L8SA 2P55A 3ORTA 1WBTA 5IF1A 3C5UA 2X0GA 5KMKA 4BB4A 4U8ZA 5AX9A 3TJDA 1EH4A 2Q83A 5CT7A 3HYHA 4Q5HA 4RSSA 3CE3A 3NPCA 4MXXA 2XJ1A 4M97A 4YC3A 4YNOA 4D1SA 4EHGA 2VO6A 4IM2A 5FBNC 2J6MA 3VQUA 4GFGA 4HGLA 5GZ9A 3R83A 3N9XA 2E9NA 4DGOA 4DGLC 4QP2A 4FE2A 1J1CA 4FSQA 5BYZA 1WVXA 2VNYA 2CMWA 2YACA 4B6LA 5A4CA 5A6OA 5CAPA 3AT3A 4W8EA 3NW6A 1IR3A 5FEQA 5IMEA 4DLIA 3IDPA 4UX9A 3PJ2A 5CNNA 3AC3A 3PLAE 3RPSA 5AV2A 3E62A 4RGJA 3RK7A 3BLHA 4FTRA 3QHWA 3GQLA 5EM6A 4IJ9A 3ZEWA 4F0GA 1GY3A 2ZMCA 3CD8A 3QHRA 2GFCA 5L8JA 4ERWA 3VO3A 2XIKA 2HW6A 4QP1A 4ZLZA 3D5UA 2FSMX 2OIDA 3TL8A 1CKJA 1SZMA 3QQKA 1KE5A 4U5JA 2BRNA 5E8SA 5HLPA 3UC3A 2VX1A 1R0PA 4G3FA 2HZNA 2X8IA 2QO2A 4FIIA 4JQ8A 3Q9WA 4YJQA 3R22A 1OPKA 5H8EA 3CKWA 5I9XA 3UQGA 4IWQA 3DBEA 3R30A 3LW0A 4YTFA 1MP8A 3Q52A 4UMPA 2QOFA 4UN0C 3O23A 3ITZA 1IEPA 5L2SA 1TQPA 3KMUA 3R9HA 4AACA 3NZ0A 5GHVA 3EFLA 4EOLA 1H26A 4LQMA 3KULB 4JG7A 4JDHA 4NJ3A 5HTBA 2V55A 5DT4A 4ZSEA 1ZLTA 4TL0A 5EHYA 3HGKA 2XK9A 3KGAA 5M09A 4ZLYA 4ANMA 3OY3A 4QYEA 4YURA 3DXQA 3QKMA 1OIYA 3WZDA 4EYJA 3PE2A 1XH9A 4JAJA 4R78A 2RF9A 4UMTA 3MY5A 5IH5A 3H0YA 4DBNA 3QXOA 4DEBA 3DY7A 2XK6A 4QYYA 2X6EA 4K6ZA 3D0EA 4U80A 4AGWA 4D5HA 3Q32A 5AEPA 4P5ZA 5C8KA 3UPZA 2Y4IC 2PMLX 1QCFA 4O7RA 2PUPA 2VTSA 2RSVA 3D5WA 5FG8A 5TE0A 5HGIA 3FXXA 2UZOA 4FZDB 3IKAA 1TVOA 2H34A 4ZOGA 2HY81 2VZ6A 5EFQA 3BWJA 2QURA 5AP5A 3P4KA 2WOUA 5D41A 3W2PA 4HPUE 4KIKA 4UWCA 4DFYA 2ZV9A 3EN5A 3Q5ZA 4JBQA 5DEYA 5IQDA 3NX8A 3BGPA 3F7WA 4MK0A 4O1PA 5DR6A 5HO6A 3KB7A 4C3PA 3NSZA 3OXZA 3GC8A 3TV7A 4GH2A 4JI9A 4ACHA 4OBQA 3S3IA 3UIXA 4CMUA 4IFGA 3UP7A 3IW8A 4TWOA 3FMNA 4ACCA 2C30A 2H9VA 3QF9A 4FSTA 5F1ZA 2E2BA 4G3GA 2XNPA 3BBWA 3DLSA 5D10A 2PZIA 3S0OA 1G8SA 2XBAA 4OW8A 4YZDA 3UNZA 2YIXA 4ZTNA 4KD1A 3AGMA 4PY1A 4G3CA 4XG8A 4K11A 3MJ2A 1BUHA 3OCTA 4AS0A 5M4IA 1YWVA 2BRMA 2C6MA 3DB8A 2CSNA 3FC1X 3IO7A 4RVMA 4YNEA 3O17A 5B2MA 3QQHA 1ZYLA 3KEXA 2HZIA 2ONLA 5EHLA 4R77A 2AUHA 2YM8A 3I1AA 4P5QA 5KUPA 4L45A 5G6VA 1P4OA 2R7BA 3OTVA 4ANSA 3GC7A 4OTGA 3ZLYA 4CSVA 5DR9A 3DZOA 3BYVA 5CZIA 5C01A 3P86A 4LUEA 2P33A 1H27A 4W8DA 4KIQA 4QPSA 5FGKA 2WXVA 3NUXA 4CV9A 4JIAA 4FT5A 3CP9A 2O3PA 5K0KA 4TT7A
chains in the Genus database with same CATH superfamily
2WU6A 5CEQA 3IPHA 4MEDA 5E8YA 5EI6A 4QMOA 5AV1A 5J1WA 4AZTA 4FTNA 4XG2A 2NRUA 2OI4X 3WZKA 4PDYA 1TZDA 1NVRA 1DM2A 1Q99A 4RFYA 2PY3A 1XH8A 2R3OA 4FV6A 4FI1A 4IADA 5FEDA 4I6LA 4UMUA 1MRYA 2GNIA 3HP2A 1S9IA 4FTOA 4NIFA 1PMUA 2G2IA 1TQIA 3GB2A 3R8MA 5LXMA 4HGSA 4FODA 3ALOA 2XMYA 1YI6A 5IQIA 3QA8A 4XNEA 2DYLA 4I5HA 5GJFA 4EOQA 4CYIA 4GT5A 4IFCA 4F9CA 3BBTB 3O0GA 3W0RA 1P2AA 2WTDA 2J0JA 2P3GX 4F9YA 4H1JA 1CKPA 5JQ5A 1APME 1KE9A 3SG8A 3W0SA 3C4ZA 4EZ5A 4AZFA 4LOQA 4M14A 4PTGA 2WEVA 3HNGA 3GCUA 4LV8A 3RI1A 4L8MA 1J7UA 4I5CA 3CBLA 4QP9A 4R6VA 2QU6A 1FQ1B 2C1BA 3KULA 3GFWA 3Q04A 3V6SA 5JH6A 3EN4A 5B7VA 1JKTA 4MF1A 4IWOA 4E93A 2JEDA 2YIWA 3K3IA 3QTWA 3ZONA 3AKLA 4UV0A 4FTAA 1PRYA 3ODYX 3W8QA 3RAHA 1MUOA 1UA2A 5KMIA 1OI9A 2Z60A 4JIKA 4WSYA 4CRSA 4ZS4A 4C4JA 2JAMA 4IVBA 2UZDA 4EZ7A 4C4HA 2Y4PA 3TI1A 1XQZA 4FV4A 4O0TA 4XEYA 4EH8A 2XRWA 4UZHA 4ALUA 5HG8A 5IQHA 4WBOA 4OT6A 4CCBA 3BX5A 4I0SA 4NKSA 5J9YA 4C3FA 3UOHA 3DK6A 4FGBA 3HMIA 4S31A 2XNGA 4XV9A 4A9RA 4ZMFA 2YDJA 5A4EA 5GJDA 2GMXA 3DK7A 4GKHA 2CLXA 2Z02A 3MPAA 4E6CA 4PDSA 3DQXA 2PUNA 4HCUA 3D7ZA 4ASXA 5K0XA 1NT2A 3PJ8A 2EXMA 2GNHA 4O7TA 4YBKA 3PIXA 5LVPA 4NTTA 4FT0A 5M55A 4U7ZA 4QMZA 1JKKA 3RWQA 2IF8A 3ZHPC 3ZBXA 4YC8A 5HU9A 5LMKA 4X6QC 5FXRA 4KKEA 1BLXA 1YW2A 4PL5A 4XV3A 2W96B 4C57A 1PXNA 2OKRA 2WTWA 2UW0A 3AMBA 5JFWA 4ZK5A 5HNGA 2PTKA 2OZAB 5LVNA 3N51A 2J0KA 1SMHA 4JXFA 2R0UA 3NRMA 1XWSA 4MD7E 3D5VA 4XP2A 5A14A 5DFPA 4YTIA 3ZMMA 2GQRA 4RJ8A 3G5DA 4IDTA 4LI5A 4X2JA 4IAKA 5LVOA 4NKAA 1W7HA 5LVLA 4HPTE 4XX9A 5KKRC 4BTFA 4MNFA 1BKXA 4G31A 1STCE 3SGCA 4II5A 4L44A 4L3JA 3DQWA 4XH6A 4BTKA 2GQSA 4EORA 4FKQA 3NMUF 2QLUA 2OWBA 4EC9A 3PXYA 3FZSA 3PJ1A 3QUDA 3LOKA 4KS7A 3PVGA 3ZH8A 2JKMA 3O7LB 4C3RA 3QQLA 3ZSGA 5A4LA 2Q0NA 1W0XC 2GQGA 2ZM4A 2ZM3A 4K18A 4AT5A 5CX9A 3K54A 4O21A 3W10A 4FTQA 4ZMEA 5LOHA 4IQ6A 4XLVA 3QD4A 3KFAA 4BCNA 5JFSA 3RK5A 5C4KA 3R28A 3DAEA 3IW7A 4PMPA 4XYFA 3R0TA 5AX3A 1YXVA 1V0PA 3AC1A 3HDMA 5TKDA 5IISA 5KMOA 3EMGA 2BAQA 1ZY4A 2QHNA 4ANQA 5J79A 4UWYA 5L6WL 4BGHA 2WTIA 4BWPA 2UZEA 3LHJA 3HMNA 3F7ZA 3NW5A 4YO4A 4H36A 5HESA 3QD0A 3OEZA 3TIZA 3V8WA 3CY3A 3GOKA 4DEHA 3UQFA 3PP1A 3QYWA 2W1ZA 5H2UA 5HG7A 2PE2A 3OY1A 3FMLA 2OK1A 3QL8A 4I21A 4ZP5A 3R8LA 4EH6A 5FTOA 1LEWA 2V7AA 4DINA 4ZZOA 2YIRA 2X0PA 2YDKA 3BV3A 3DBQA 4L7SA 4R1YA 4BZOA 4NK9A 4CZYB 3KKVA 5HLWA 4NM0A 1DI9A 1URCA 3QX2A 3F2NA 4IAIA 4Q2AA 1WMKA 2W5BA 4DG0E 1YHSA 4Q9ZA 3NWWA 1GZ8A 3QAME 3OXIA 4WNKA 1WFCA 1YOJA 2RFSA 3TG1A 2UVYA 3VAPA 3OG7A 2OBJA 3BGZA 4EH3A 2IN6A 4FKWA 3ID6C 4W9WA 3NEWA 5HCZA 3VNTA 1O9UA 3QZHA 4OBPA 4FTKA 4AXDA 1Q3DA 4O7VA 2F2CB 1PYEA 2ITXA 2YAKA 2XJ0A 4IE9A 4O96A 5DT3A 3RZBA 4BTJA 4BIEA 2UZNA 4E5WA 5M4CA 2WTKB 3DJ5A 3RAIA 2WMAA 3E3PA 4JBPA 4O0XA 2X4FA 3FY2A 3OHTA 4RFMA 3PG3A 5EW9A 4XRLA 5BVEA 4IB0A 4AW0A 4U97A 3R9RA 3ZFMA 3BI6A 3VW6A 3FYKX 3QXPA 3CS9A 3P0MA 4E4MA 1QPJA 4LV7A 3PA3A 3R7EA 3DAKA 3VUDA 1Q8WA 2JKQA 3F6XA 2QOHA 2DS1A 4YSJA 2GS2A 3EQCA 1WBPA 1IG1A 3KRWA 5CZHA 4F9AA 4C4IA 2CLQA 4FL1A 5HIDA 3VUKA 2YCQA 3IQ7A 3BKBA 3D2IA 5L2IA 3D15A 2XK4A 4JT3A 3G90X 4XP0A 1WCCA 4AAYA 3KMWA 2WMQA 5L6OA 5D1JA 4E6DA 2W05A 4CNHA 4MF0A 1XH4A 3IS5A 1UKIA 2R3FA 4JRVA 4KABA 1JKLA 4OTRA 4E26A 1W8CA 4X2FA 4IVDA 2OH0E 5IDNA 5L3AA 3CQUA 4K2RA 3L9PA 3QRUA 2OZAA 3F2AA 4YHTA 3TNPC 2ITWA 4GT3A 4LGDA 4CT1A 2JIIA 4E73A 5BVWA 4Q9SA 1G8KA 3FUPA 1K9AA 4EWQA 3R7GA 4DH5A 4PMTA 4FEUA 3LQ8A 2Q0BA 2XYUA 4NT4A 5FTQA 4HYSA 5DPVA 3OMVA 4FTIA 5L2QA 3DLZA 3L9NA 3DBFA 3NAYA 3LMHA 4ZJVA 3QC9A 4H3PA 4JMQA 2X0QA 5BVKA 5CSVA 4CFXA 3U6JA 4BWKA 1JBPE 4BDHA 4RIXB 3MTFA 4AE6A 4C38A 5BPYA 5CAUA 4IANA 4YJPA 1Q8ZA 2YM7A 4J52A 3GCQA 3RAWA 4YZCA 2C3KA 3ZU7A 3I7BA 4R7BA 4TXCA 5EDRA 3ZBFA 1W82A 5JRQA 3PXKA 4RVKA 4O0UA 1PXKA 2UZBA 2XB7A 4AA0A 5FEEA 4AP7A 4IVAA 1NW1A 2W9ZB 3MWUA 4EYMA 2BZJA 3TYKA 4F1MA 4C34A 2OG8A 4E3CA 4HJOA 1H28A 3BL9A 3FMMA 4J8MA 3DXPA 3PPZA 3DDQA 4BI1A 3F61A 5BYYA 5E92A 4ZTQA 2F9GA 4F08A 1YDTE 4L53A 4PMMA 4R5SA 4S2ZA 2ITZA 2JDOA 2W5AA 3HX4A 3FMKA 4GW8A 3BHVA 5GZ8A 5L4QA 2ACXA 2NNWB 4NL0A 1ZYJA 3IONA 3VF9A 4JBVA 3F5XA 2VAGA 3OW3A 5CVGA 1ZOGA 2QD9A 1GZNA 3DS6A 1CDKA 3EH9A 3ORNA 2VNWA 2G1TA 4F7LA 4XG4A 4KRCA 4BDAA 3WF7A 3KRLA 3UQCA 1UV5A 3LM0A 2JDRA 4OBOA 4FSZA 3ANRA 5FWKK 3ZOSA 3D9VA 4FKOA 2WFYA 3T9TA 2XS0A 5HCYA 2BZIB 4MBIA 4BCOA 5JT2A 3C0HA 5AAFA 2AEGA 3LQ3A 4B8LA 2X7FA 1Q3WA 3OT3A 4JOAA 1OB3A 4O81A 3ACKA 1KOBA 2R4BA 3CLYA 4I24A 4O22A 3GP0A 3OCSA 4DFXE 4CKJA 4HVDA 3QWJA 2HW7A 2RFNA 2XVDA 4QMWA 3PJCA 3W0OA 3KRXA 4G16A 4GYGA 3ZDUA 4L42A 4TYIA 3T3UA 3TT0A 1XH6A 3V3VA 4WKQA 4CFFA 4NTSA 4O0YA 2JGZA 3AD6A 3TTJA 4CG8A 5B2LA 4M66A 4IX3A 4AGUA 1GZOA 2RKUA 1IASA 5EW3A 5CF6A 4KSQA 4FKGA 1WBNA 5LWNA 3BHYA 4QNAA 5CSHA 1KE8A 3I7CA 5IG1A 4CMOA 4C4EA 4DH7A 3OS3A 3CQWA 2PL0A 2A0CX 4FTCA 4UZDA 2C0OA 4F70A 4GMYA 1T45A 4J53A 3GCPA 3CIKA 4XOZA 3O51A 3DOGA 3TZ9A 2F7ZE 2WD1A 2J5FA 5HVYA 3MFUA 2XYNA 4FL2A 5K5XA 2AQXA 2PMOX 5KNJA 2QOOA 3BE9A 4J97A 3DK3A 3FI4A 2W1EA 4PTCA 4UYAA 3FKOA 4J8NA 3QCSA 3KC3A 4W4XA 2ITNA 4F09A 4BDKA 3AT2A 2JITA 3QRIA 4KINA 4OTHA 5EK7A 5BMMA 5KCVA 5EKOA 4AQCA 2ZV8A 2W1CA 2WTCA 1ZOEA 3R8PA 4H39A 4I41A 3QCYA 4AAAA 4AXEA 2E9PA 2BKZA 2XKCA 1G3NA 3OEFX 3VN9A 2YEXA 2WTJA 3U8WA 1OUYA 1VEBA 3ZFYA 5AUTA 5DLSA 3GU8A 4AN9A 3P7BA 3GU5A 5E8TA 4FV1A 4ANBA 4HGTA 3MFTA 3KQ7A 4CT2A 4D4VA 3RCDA 1SVHA 1NA7A 2GTMA 3RGFA 4NH1A 3VUTA 1L3RE 5KO1A 3SXSA 4O7NA 1AD5A 2I0EA 5EQPA 5HE0A 2ZJWA 4JX7A 4CXAA 4MWIA 1H1QA 4PV0A 3PDTA 3NYNA 4DF3A 1Q5KA 2X2LA 2Z7SA 1H07A 4GCJA 3CGOA 5IEYA 5CAQA 4RIXA 4C8BA 5EQEA 4X3FB 1XBCA 3PSDA 2J4ZA 3R71A 3RCJA 2I6LA 4EOOA 2I40A 2XKEA 4FSUA 3V5PA 1H8FA 2B54A 3C50A 2PZRA 4FEVA 3FHRA 2JFLA 2QOIA 4R3PA 4F9BA 1YHVA 3NUPA 2OXXA 4QMUA 4EQCA 3GT8A 5M51A 3KK9A 4MKCA 2O65A 3SC1A 4FUYA 4G5PA 4RA5A 4FV3A 1PKGA 2VWWA 3MY1A 3TWJA 4ZJJA 3JVSA 5E9EA 1IRKA 1ZY5A 5BNJA 2XNOA 4NW5A 2OH4A 1H1SA 4ERKA 2HIWA 4OTDA 4WRSA 3ZO2A 3TZ7A 4K33A 3LFCA 2I0VA 3DV3A 4W4VA 1XBAA 1YI3A 2PVRA 4BFMA 5C27A 3WYYA 4J7BA 4C59A 1JNKA 3QU0A 5CNOA 4GK4A 3A7IA 4RWLA 3SLSA 2CKQA 3FLSA 4NFNA 1R39A 5H8BA 3OBJA 4GK3A 1ATPE 4N70A 3FHIA 5HG9A 1BL6A 2XCHA 3AMYA 3FSKA 4O4BB 3SVVA 3VUIA 2OLCA 5C8NA 4RFZA 3I0OA 4GG7A 3FZRA 1FINA 5F95A 5FXQA 3A62A 1Y8YA 4C35A 3VHKA 4EJ7A 4XG7A 5GJGA 4I5MA 2CGUA 3ACJA 2HXQA 4H3BA 4WG4A 5LMAA 2YDIA 1G8JA 3B2TA 2QKWB 3F2RA 3PA4A 3OOGA 1NY3A 1PJKA 3BE2A 4MQ1A 5AP4A 3THBA 5A6NA 5AAGA 1U5QA 4DHZA 1WVWA 2BUJA 2J90A 4AFEA 2C5VA 1Z5MA 4DN5A 3QTZA 1YI4A 1T46A 2JLDA 5IZFA 3N4TA 3U4UA 3NLBA 3LFAA 2VTLA 5DR2A 5JQ8A 2R3QA 3HDNA 2VWVA 3W16A 5AR2A 4R5YA 4GJ3A 2O0UA 2OFUA 4W4YA 4FOCA 3W0MA 3V8SA 1KOAA 4YJSA 2C6OA 1WZYA 4AF3A 2WMWA 3KMMA 3HLLA 3IG7A 2ONLC 5K3YA 3G9LX 4QPAA 4PQNA 2PVYA 2VWZA 3U54A 3EZRA 2VTMA 4DCAA 2G01A 4QQCA 5D12A 2A98A 3UMWA 4FG9A 2ERZE 1OPLA 5CVHA 3QCXA 2WMRA 3K5VA 4L3LA 5FQDC 2WNTA 3NNWA 5CVFA 3ALNA 3FKLA 2ITOA 1RQQA 1RJBA 2VGOA 3A7HA 3A8WA 3LMGA 4M8TA 4YSMA 1H01A 3WARA 4O7ZA 2F49A 4J71A 1BL7A 3H4JA 2CCIA 3CQEA 1RE8A 3VBQA 1OKYA 2BILB 3IW5A 2FSOX 3PTGA 5AMNA 3ZRMA 3E8CA 4JR3A 1ZYSA 3PSBA 4FNZA 1ND4A 3KA0A 4B4LA 3LZBA 3E88A 4QP3A 4F64A 3E7VA 3TUBA 3DFCB 5JFVA 4D55A 2ITTA 2PMNX 1CSNA 3Q2JA 2W1DA 3C4FA 3BL7A 3VBVA 3COMA 4EQMA 5FLFA 5KE0A 3UMXA 3HMOA 4GG5A 4X3FA 5H8GA 4LYNA 5CF5A 3LE6A 5AJQA 2PVJA 2WKMA 4QD6A 4QMTA 4FSYA 3NW7A 4RMZA 4BCMA 3VBXA 4OGRA 2VWYA 3ATTA 3EFJA 2QKRA 3FQEA 4UBAA 4U45A 3RK9A 2GTNA 3CY2A 2UW9A 4G9RA 3VJNA 1J7LA 4O7YA 4C58A 5AAEA 1REKA 4QMMA 4AXCA 2QODA 2JBPA 2Y7JA 2UZTA 3DTCA 4Y83A 2WO6A 4F63A 4WO5A 3EN6A 4FVRA 3QUPA 5AP1A 4HOKA 5CEIA 3WBLA 2CNVA 2ZM1A 4MWHA 4YC6A 5GINE 2XKFA 4XV1A 3U4WA 3CTJA 5ANIA 4FV5A 2C5YA 1IA8A 2VWIA 3FMEA 3KF7A 3KXZA 5HE2A 3RPVA 3W2SA 3ZXZA 4WUAA 4EHZA 4DTAA 2PUUA 4ASEA 4DE4A 4FICA 3MH1A 4BCGA 3QRJA 5DGZA 3IOPA 3UIMA 4BZNA 2EXEA 4FKVA 4TYHA 4EBVA 1ZARA 3R8UA 3PPJA 3R00A 2VWBA 5CSWA 3HAMA 3MVHA 3HV7A 4JNWA 3ZEPA 5CEPA 4DAWA 4YO6A 4CLJA 2CN5A 3DCVA 3IECA 4UYNA 1FMKA 1OL1A 2WMXA 3DJ6A 4IEBA 3FZ1A 3I0QA 3TM0A 3CJFA 4FSRA 5HVJA 3AKKA 3I6UA 4E1ZA 4BJJA 3UIUA 4F1OA 3R04A 1Y6BA 3K2LA 2R7IA 5I9YA 5KHXA 4YTCA 5HZNA 5M08A 4ACDA 4DEAA 2ITVA 4AXAA 3QYZA 2QVSE 3FI3A 3W0NA 3DB6A 1LP4A 1REJA 1VJYA 5FTGA 2QNJA 4S30A 4JDKA 1Y57A 3QFVA 3L1SA 5HVKA 4E7WA 3SG9A 4OAUC 1VLRA 2JDSA 2ITYA 3CSVA 1WVYA 2W1IA 3TIYA 5A46A 2R2PA 4PNKA 1UU8A 4IJPA 5I9VA 5IH4A 4NCTA 2G2FA 3T3VA 2PMIA 2YA9A 3RM7A 2O2UA 4QMYA 4A7CA 5CQWA 3CR0A 3TTIA 5HE1A 2C0TA 3KK8A 3BHUA 3PJ3A 1OKWA 3F5PA 3MSSA 3PWDA 3PVWA 4LG4A 4AOIA 4RIWB 3HV4A 4Z9LA 3OVVA 3ANQA 2GSFA 2J0MB 1SVGA 5FP6A 4QMNA 2B55A 4ZLOA 3SD0A 1GIHA 4X6RA 5CY3A 4TNDA 4AFJA 3OBGA 3VS6A 5L2TA 1F5QA 3IW6A 4FIFA 1B38A 2QO7A 4PPCA 1YWRA 1Q8TA 3FE3A 2OJJA 3OTUA 2CNUA 3HL7A 1H4LA 2OXDA 3VS1A 4N57A 3PWYA 3BU5A 3DA6A 4O6EA 3REPA 3GBZA 4DEEA 4N0SA 3P23A 4O84A 4TYGA 4ZZNA 3NUNA 4J95A 2QLQA 4ORKA 3R8VA 3PY1A 1W2FA 3A7JA 4BCIA 4WRGA 2NO3A 4O4EA 4CFWA 3QTQA 4MUQA 4DBXA 1OVEA 2FUMA 4V05A 5EM5A 5AUXA 5A4QA 2Z7RA 4NM7A 5CU3A 5DHJA 3S2PA 4IC8A 3VS7A 4FTLA 4QQTA 2UVXA 2XRUA 4A9YA 3WIKA 4C4GA 1JVPP 4PP9A 3HUCA 5LJJA 3TDWA 3UE4A 3FQHA 2EU9A 4M15A 2C5XA 3Q9ZA 2YM6A 2XK7A 5ITAA 5AIRA 2PVHA 3FYJX 3WF8A 5HI2A 3ORKA 5DE2A 4BWXA 4R7IA 1SM2A 3EIDA 4MNEB 4BVUA 3EQHA 4AU8A 4S32A 3C7QA 2X4ZA 2UW8A 2B4SB 4I94A 4F1TA 4EHEA 3A2CA 4K8AA 4QOXA 5IEXA 2R3KA 4RZVA 4BYJA 3I60A 2B0QA 3MVMA 5JN2A 2OSCA 3DBCA 4FL3A 4GSBA 3VW8A 4RX9A 1CM8A 4GUEA 4EOSA 5HBJA 4ZIMA 5K4IA 3WI6A 3MFSA 1SYKA 4QP8A 2I0YA 4TRLA 3POZA 3D83A 3FEGA 3UOKA 5CU2A 5M57A 3P5JC 3I4BA 4N4SA 3P7CA 4L7FA 4Q5EA 4P4CA 3KN5A 3BQRA 4AW1A 2R5TA 2XK3A 4FKJA 4FTTA 3SDJA 3WZUA 4E4NA 2RFDA 3UG2A 1U46A 4WNPA 2JIVA 3ULIA 5BUJA 4M84A 2GNJA 4ZS0A 3WZJA 3DNDA 5J8IA 2RG6A 2VTOA 4BR3A 4AW2A 3DKGA 2Y6OA 5HLNA 4EC8A 4K1BA 3F66A 4FOBA 3V5JA 1O6LA 4CV8A 2BCJA 2ZB1A 4XG6A 3TN8A 4B99A 2BROA 3BWFA 1MRVA 1OIUA 5K9IA 3R01A 3RPOA 4FKIA 4D9UA 1Y8GA 3KF4A 4E6QA 3QLGA 4WNOA 3O96A 4F99A 3FL5A 2BALA 5DNRA 3EZVA 2XNNA 3FI8A 1YVJA 5H9BA 4FEQA 3R7YA 5HX6A 5J5SA 4G6OA 5E7RA 5DRDA 3MESA 2WQOA 3MVLA 3O50A 4RQVA 1PXIA 3QRKA 2KTYA 2YFXA 4FMQA 4KAOA 2XIRA 3BCEA 3BU6A 3UDBA 3UNJA 5AWMA 3DGKA 2R3MA 5T6KA 3G9NA 1GZKA 3F5UA 5A9UA 3NCGA 2YITA 2X6DA 4Y8DA 2C69A 3Q4ZA 3Q4TA 3OD6X 1ZXEA 4FK3A 4D2RA 4IMYA 4RIWA 4F0IA 4ZY4A 4USEA 5K5NA 4F6SA 4EJNA 2VU3A 5CXHA 3W18A 1XMMA 4ZJIA 3MPMA 3VRYA 1SVEA 3P7AA 5AP0A 4EH5A 3A99A 3CPBA 4QTBA 5DIAA 2CKOA 3QC4A 3FLWA 4GFMA 3N4UA 4QQJA 5EI8A 4BGGA 1E1XA 2XAMA 2X9EA 2R0IA 3A4PA 4FKRA 3P5KA 3R1NA 4WNMA 4HNIA 4ALWA 4ZAUA 3V6RA 4DFBA 4BL1A 2YM4A 4U41A 5HORA 1KV1A 3KXGA 4R1VA 4BCKA 4BHZA 4JG6A 3HRCA 2OJFE 4E4LA 2XNEA 3L9LA 2V0DA 4QMSA 3SX9A 4YMJA 5L8LA 4IACA 4X2GA 5CAOA 5LARA 4FNYA 2G2HA 2SRCA 3BEGA 4FX3A 4I4EA 2FVDA 4U40A 3KIOC 1OBGA 3V5TA 3KY2A 4GT4A 4RRVA 1Q41A 3TKHA 1P14A 2WIPA 1FGKA 4U6RA 1LR4A 5ANOA 4FV0A 4B9DA 4J98A 3VHEA 2RL5A 4IM3A 2QO9A 4RX8A 4FV8A 3VULA 2VX0A 3BIZA 4TZRA 3PYYA 3FI2A 4QMLA 3QGYA 4BCHA 2GNFA 1VYWA 2Z7LA 1AGWA 2HELA 3E3BX 4UALA 4XBRA 4CTBA 4D2SA 4EOIA 5JK3A 1G8AA 3NFFB 4MNEA 5I9WA 5M53A 4OLIA 3A7GA 4EK5A 4QMPA 1X8BA 5JRSA 5M56A 2UW4A 4QDEA 2IZUA 2XA4A 3QKKA 3BLAA 2BRBA 2ETKA 4GS6A 4NUSA 5AR7A 2NPQA 1DAYA 4C4FA 2CDZA 5HOAA 2V7OA 3MH0A 2F7XE 2JKKA 3MYGA 2BFYA 5FM2A 2NYAA 1S9JA 4XRJA 5KMLA 4YLLA 4DCEA 3MFRA 2QOBA 4YTHA 5C4LA 4ITJA 2FO0A 3ZM4A 4F7SA 1PY5A 5EYMA 2C0IA 4EONA 5I9ZA 3E92A 2YZAA 4EOJA 1H24A 4TYJA 4CMTA 5CENA 4DH1A 4S33A 4AW5A 5ANJA 2HOGA 3VJOA 4AZWA 1KV2A 2WPAA 5ACBC 3LLAA 2JKOA 4ZSJA 2FGIA 3VS2A 4IAZA 2R64A 4M69B 4AE9A 2HZ4A 3P9JA 2P2IA 3C4EA 2OIQA 4RC4A 1RW8A 1FMOE 1KWPA 2YJSA 2R3JA 4MD8E 3NUAA 1H25A 3QTSA 2YHVA 5JZNA 5HD4A 4M67A 4ZTSA 4LMUA 4ZEGA 2F7EE 1LPUA 2F2UA 4FZ7A 4HYHA 5CU0A 2J51A 4A4LA 4D4RA 3FL4A 2F57A 3ODZX 3P79A 3GGFA 3R7VA 3TCPA 2PYWA 3LAUA 5IQBA 3UYSA 4XBUA 4F6WA 3R1SA 1QPEA 1YOMA 3EKKA 1O6KA 5FP5A 3AG9A 1UWJA 3PRIA 2QQ7A 3VF8A 5M44A 3O71A 3MB6A 4D2WA 2BZHB 5L2WA 1NVQA 4OTIA 3LFBA 5HTIA 3AD4A 3G6GA 1W2DA 4TKSA 4FKLA 1URWA 3F5GA 4FSWA 5TF9A 4H58A 5AP2A 4D2VA 5DOSA 4ENXA 4YJUA 2H96A 3M11A 4QP6A 1Y91A 3PLSA 3BPRA 2BIKB 2PE1A 2XIYA 3LM5A 3QUEA 3A7FA 4AOJA 3E5AA 4A4OA 3FBVA 2FH9A 3LCDA 3EL8A 4FRFA 4G34A 2BIYA 2A19B 2XEZA 2WELA 5IA4A 2IEWA 5IPJA 4DDIA 4DH8A 2VWXA 5ETCA 3O7LD 3QQFA 3E64A 5LVMA 5EYCA 5AV0A 2OGVA 2X2KA 3OFMA 1BYGA 3D14A 4I6BA 4CZUA 3EL7A 5BVNA 5I5ZA 1JAMA 4DHJA 1CMKE 4EI4A 5E91A 4NEUA 4DG2E 5CEKA 3UVQA 4PP7A 3QTUA 2CGXA 3PZEA 1J3HA 5E8UA 5JSMA 3L8VA 3A4OX 3M1SA 2XM9A 3NNXA 4WUNA 3EKNA 4JR7A 2OIBA 3ENHA 3U87A 1XJDA 3DDPA 3LXPA 1JSUA 4RA4A 2Y9QA 3LQ5A 4PWNA 3U9NA 1Q97A 1R1WA 2ZAZA 4YPDA 3L8PA 2HYYA 4KUJA 2EUFB 3NYVA 5EKNA 2VTQA 3HUBA 4ANNA 4TNBA 3JPVA 4FVPA 3NUYA 2CKEA 5AV3A 3BEAA 2W5HA 2ZB0A 2PUIA 4FR4A 2UW7A 4BF2A 3O8TA 3ZDIA 1Q61A 4V01A 5FXSA 5AUWA 2UZWE 2ZV7A 1GOLA 4QMXA 5GIPE 2HENA 2REIA 4RIOA 3VQHA 4ID7A 1XBBA 2C5NA 2W4KA 3DFAA 1PXLA 3MGYA 4MCVA 4IZAA 3RJCA 4BBMA 1FVRA 4X2NA 4DGGA 3SW4A 1XR1A 1AQ1A 3ELJA 2VO0A 2PZ5A 4QNYA 4CFVA 5CANA 3PUPA 5DWRA 5IQGA 5HEZA 5HU3A 5KBRA 5AP3A 2VTPA 4EK3A 4E5AX 3W2QA 4ANOA 1L8TA 4GKIA 2BAJA 1ZAOA 4N6YA 5AR5A 3LJ0A 1PMVA 5EQYA 3QTXA 4PDPA 4AN3A 3S4QA 2X81A 3HZTA 3RNIA 2W1HA 4EKKA 5IUHA 4KBKA 4BICA 4B0GA 1LUFA 2B9HA 1RDQE 2P2HA 2XJ2A 1XO2B 1M17A 1YQJA 3KRRA 3NYXA 1PXJA 4IM0A 4M69A 2XK8A 4QDVA 5IQAA 2C68A 2IW9A 4QTEA 4CKIA 3CCNA 2X9FA 3V51A 1OUKA 4KKGA 3ZXTA 3Q9YA 2O5KA 4PX6A 4E5BA 4WD5A 3AT4A 2QG7A 1FVVA 1IA9A 5IA0A 3QQJA 2CCHA 4MBJA 5E90A 1JWHA 1BI7A 2RFEA 2VTRA 2WEIA 2WQNA 2ZYBA 3VBTA 2GHLA 4L3PA 4S34A 4YLJA 4L52A 3UDTA 1TKIA 2XP2A 5F9EA 3L9MA 4G9CA 1OL7A 5HQ0A 2W1FA 3CTHA 4EK8A 4W9XA 3SAYA 3GU4A 1FOTA 3UZPA 4BDGA 5AV4A 3UOJA 3FKNA 4R8QA 2RGPA 4DT8A 1SNXA 2YJRA 3G0EA 1FVTA 4G6LA 3KCKA 4JS8A 1XH5A 5HNIX