3EQHA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a ternary complex with u0126, adp and mg2p
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
343
structure length
314
Chain Sequence
b'ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 314
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqhA01
4CZUA 4IWQA 1AD5A 4I24A 5EHLA 3G2FA 2HZIA 3MN3A 2G15A 1UKHA 3R7VA 3TZMA 4BDEA 3D2IA 3R2YA 3L9MA 4IX4A 4O0RA 5DNRA 1BL6A 3SLSA 3W33A 4DBNA 3IW7A 4EHEA 4O7TA 4QP3A 4AACA 3S0OA 1ZOEA 4O38A 4S34A 3UDBA 4FEWA 2PULA 3PJCA 4IVBA 3VS3A 2Z7QA 3QKKA 4EZ3A 5IQGA 3N4TA 5AV3A 1OUKA 1FMKA 3P78A 3PY3A 4JBQA 3SW4A 3ELJA 4IAKA 3FPQA 3B2TA 2CMWA 4HVGA 3BX5A 2XK7A 4FIGA 3S00A 4FGRA 4RJ6A 4MBIA 3NEWA 3TXOA 2VO0A 5TO8A 3OWLA 2QKRA 4RWKA 2VTNA 3MFUA 4CKIA 3BZ3A 4QD6A 1OL5A 5DGZA 1URCA 1M7NA 4GT3A 4FA2A 3LFNA 3BPRA 5JQ5A 2J4ZA 4IW0A 3F88A 4JOAA 5L6OA 3SG9A 2XKEA 2Y6OA 3EQCA 3OMVA 4FNYA 4RRVA 5A4EA 3V3VA 1GZOA 4R3CA 2HWPA 4GW8A 4DFYA 1JBPE 5DLSA 5GJGA 4AZEA 4FKOA 5GJDA 5IG1A 3LAUA 1URWA 4C3FA 3MA6A 2UVZA 1OUYA 2O64A 2QLQA 3G33A 3F5PA 4N4SA 4RC2A 2JDOA 4X2JA 2XNBA 2XM8A 2C5XA 4FICA 3VJNA 3VUTA 3OCSA 3LMHA 4TT7A 1BI7A 3DOGA 2ZM1A 4CZTA 5DOSA 2YWVA 2W1DA 3TUCA 3JS2A 1B6CB 1GZKA 3FDNA 4FKTA 1Q8TA 2GFSA 2X0GA 4GL9A 3UPXA 3PY1A 4CYJA 4WD5A 4O0WA 3L9LA 3QCQA 4BDBA 3PA3A 4IE9A 3C0HA 3EN5A 4BTKA 5IUIA 5JMSA 3JR1A 5TE0A 3DFAA 5E90A 5E9EA 1Y91A 4V04A 1GIIA 4RLLA 4C58A 3FMMA 4GU9A 4JVGA 1YXSA 4G3DA 4I6HA 3EN7A 5HU9A 5IISA 4OGRA 2GHGA 5DR6A 5ANJA 4J71A 4E20A 5AMNA 3IDPA 4G3FA 4TNBA 4ANOA 4PMPA 5F4NA 4DCEA 3MVHA 2YCQA 4ANNA 3NUXA 2F57A 1XJDA 5HICA 4LRMA 4TYHB 2OJFE 4J7BA 1H4LA 1Q8YA 3QRKA 2RG6A 4I22A 2ITZA 2JDTA 3QC4A 4GT5A 3EOCA 5IH5A 4EOIA 2X7OA 3NPCA 4TYIA 4YJPA 3S4QA 1WCCA 3ALOA 2J0IA 4CMTA 1DI8A 3OS3A 4RJ4A 1ZYJA 2PMNX 3UZRA 3TKIA 2GS6A 5CNOA 5CASA 3CLYA 3R04A 3R02A 3QQJA 3P5KA 4U3ZA 2WTJA 3FI3A 2VWXA 4Y73A 3BV2A 1PY5A 1WBVA 3DA6A 4FZ6A 4ZLOA 3M11A 4FTKA 3FBVA 1U5RA 4AUAA 3FE3A 4PNIA 4UMTA 5FDXA 2UVXA 3R8LA 4MXAA 4JXFA 4U8ZA 1PXLA 5B2KA 2REIA 5CZHA 5BQ0A 1SZMA 3KXZA 3MTLA 3VS4A 2ZV8A 3C13A 2F4JA 4O21A 4TNDA 4NJDA 4HVHA 5M4IA 1LEWA 2I0YA 3QXOA 5LCKA 4FVRA 1OPJA 4X3FB 1ZMWA 2YCFA 3ZLYA 3BE2A 4R5SA 3R1SA 1GY3A 5DT3A 3UIBA 3ZS5A 5LOHA 4ZP5A 3BWJA 4D0XA 4YURA 1Y8YA 3GP0A 3VULA 1JAMA 4I5PA 3RPSA 5JKGA 2IN6A 4GIIA 3R28A 4G9CA 1XBAA 4C3RA 2XJ0A 5KHXA 3AXWA 3FXXA 4LL5A 4FZDB 4FSTA 3O50A 3PXKA 4K9YA 4USDA 3SX9A 2OJGA 3UP2A 1XH9A 1IA8A 3CD3A 5HE3A 2I1MA 1O6YA 4W4WA 1GAGA 1BKXA 3HYHA 2A27A 4C3PA 3R0TA 2WTKB 2B9JA 4W9XA 3UIMA 1P5EA 4RFMA 2XUUA 4JIKA 3DBCA 1OL2A 3V5PA 4BDCA 5KUPA 2WU6A 2ITVA 4FUYA 2XS0A 3AG9A 3QL8A 1ATPE 1OITA 3NUYA 2CCHA 4IAAA 4MWHA 4XYFA 4KAOA 3U51A 1XKKA 2OXYA 5AM6A 5C8MA 3IO7A 4N6ZA 4PPAA 4RIWA 3LXKA 4ACMA 3UG1A 4UZDA 4ZJVA 5IQBA 2QKWB 3KA0A 3PLSA 4M67A 3MA3A 1KE9A 2WMUA 4K6ZA 2ZJWA 1H0VA 3TNPC 3JYAA 4D2SA 2RFNA 2UW9A 3U55A 3ZFMA 4ZY6A 5DRBA 2WOUA 4AS0A 4RG0A 3ZYAA 1JNKA 2OH0E 2W4OA 3PSDA 2VWBA 2J7TA 4RQKA 3VNTA 4UMRA 3OEFX 4OR5A 2W5HA 5BVWA 5CNNA 5KKRB 4FIFA 2VTHA 2HY81 4GU6A 2H96A 5KBRA 4O0UA 4U42A 4UALA 1H1RA 3R9RA 1UA2A 5KZ0A 4BIEA 3FL4A 3OCTA 5G6VA 4YJSA 3E3BX 2CGXA 2QR8A 2G2HA 4FIJA 4FX3A 4JX3A 4NM3A 5AP5A 5I9ZA 3LFQA 3GCQA 3EQBA 4Y85A 3TT0A 3KRRA 1LEZA 5HG9A 3F3UA 4XRJA 5DT4A 4YTIA 4IB5A 3U6HA 3DBDA 5FDPA 2R0UA 3RPRA 3R63A 5FTGA 4XNEA 2IG7A 2JKKA 3EWHA 4G17A 1YXXA 2UW6A 3OCGA 4YO6A 2PZ5A 1U59A 1L8TA 4ZLYA 3BYVA 5BX0A 3G6HA 3UZPA 1OKWA 2Z2WA 1YOJA 4XUFA 1WBTA 4FOBA 3H30A 2C1AA 2J9MA 3CQUA 5E8VA 2YN8A 5FUTA 1JSTA 4IXPA 4QYFA 1YKRA 2RFDA 3V8SA 3E63A 4D0WA 3HEGA 3ZUVA 5FXRA 5ANKA 3F3VA 3WZEA 3K2LA 4CZYB 3RCDA 3UQGA 4KWPA 1NXKA 3D5VA 1ZZLA 2XMYA 4HZSA 3E8NA 2VWUA 2NRYA 4DTBA 3ORMA 3VWAA 3CE3A 3SOCA 4ZIMA 3DAJA 3U6JA 3HVCA 3QZFA 4CTBA 5AEPA 2V62A 4BCQA 2JKMA 3RHKA 4M68A 1FVTA 4UV0A 3DV3A 4O22A 2WQOA 2YM5A 1ZARA 4K33A 4EORA 4QNAA 3T3UA 3LMIA 3ZTXA 5J87A 4UN0C 1ZYCA 4M69A 3SQQA 4ASEA 4S33A 4ZAUA 2PVFA 3IONA 4KRDA 1E9HA 1UU3A 2BAQA 2ITUA 3RPYA 2PZIA 3R71A 5GINE 1OVEA 1I09A 1PMEA 3R8PA 4U44A 2C69A 4XX9A 5HO7A 2EXCX 1H27A 3WI6A 2OLCA 4EONA 4KBCA 4QYHA 2HIWA 2R3LA 4W8DA 1Y6AA 4Q9SA 2A4LA 2X9FA 3KRJA 2XIRA 1H26A 3Q53A 4GCJA 4MBJA 5JZJA 2YA9A 4IWOA 4BCGA 3MB6A 3DFCB 1NVRA 3DB8A 1P14A 3MI9A 3UOHA 1QPJA 2BAKA 3OBJA 2FSOX 2I40A 4LRKA 3GU6A 1ZYLA 3KF4A 5FD2A 3W10A 3VS5A 4QMQA 2PZRA 3WIKA 4KINA 2B9IA 4FEUA 4K1BA 5JRSA 4MVFA 3ZZEA 5J9YA 2UVYA 3HL7A 3HX4A 4ZOGA 3V04A 4AGUA 3ACKA 3OXTA 3BYUA 4IJ9A 3SW7A 3PE2A 4BCKA 4XOYA 4OTQA 4D2VA 4AN3A 3QF9A 5AP2A 3ORPA 3ZLWA 3UNZA 3ZOSA 3NX8A 3OY3A 4L3PA 4CEGA 4RVLA 5CYIA 3FKOA 4C2WA 4WG5A 5JGDA 3A8XA 3MYGA 4XBUA 3D5UA 5KCVA 3QCXA 5IPJA 1MRVA 1M14A 5KMJA 3K5UA 3ZM9A 2HZ4A 3V8TA 4PX6A 3I60A 2PVYA 4G3GA 4JNWA 3FMEA 4HGSA 4XLIA 2UW4A 1FGIA 2XIYA 4FK3A 3EN4A 2DQ7X 4OUCA 1ZY5A 2YEXA 5FQDC 3RM7A 4F70A 4RSSA 1OBGA 1KE7A 3DKFA 2W9ZB 2RGPA 4J52A 3PLAE 1NVQA 1W7HA 2AUHA 3QQGA 1FVVA 1QPDA 2OF2A 5FGKA 3IK3A 1OMWA 4O0YA 2VTOA 2YISA 4W4VA 3QUPA 1YOLA 2XCHA 3F2AA 4AZWA 3EFWA 4QTBA 3KMMA 3MPTA 5KHWA 3FLNC 1Y57A 5HG8A 4L52A 4YPSA 3GQLA 4ZTQA 5E1EA 5EDPA 4QMUA 2WEVA 4UWBA 2ITQA 4MH7A 1GZNA 4NKSA 4I1ZA 5GZ8A 1XO2B 1XBBA 4A06A 5HD7A 2IPXA 4DT9A 4C34A 2XNOA 4H3BA 4C4HA 3HV7A 5HBHA 4BZOA 1XQZA 3H0YA 2XKFA 4OT5A 4RWIA 5FLFA 1YVJA 1PMVA 3LLTA 5D10A 5IQEA 3HA6A 2J6MA 5AP3A 4BFMA 4E73A 2ZOQA 5ANDA 4BZDA 1J91A 3KB7A 5HG7A 3BGPA 3QU0A 2QO7A 3RVGA 5LVMA 4V01A 4D9TA 4B6LA 1M2QA 3HRCA 3NIZA 1IA9A 1J1BA 4IX5A 1OPLA 4AF3A 2F2CB 1U4DA 2VNWA 4HPUE 3ZO4A 5KMKA 4FKIA 4OTHA 2WTIA 3A60A 4AW2A 4ACGA 4DEEA 2WGJA 4OTPA 2PYWA 2JAMA 4NUSA 4PMSA 5AADA 3IW4A 5IH6A 2XK6A 5AV2A 4BWKA 2WEIA 5FRIA 5GNKA 4TY1A 3HA8A 2X4FA 3VVHA 3LXLA 3DLSA 3H3CA 4IAZA 2FH9A 3NYVA 3H9FA 3JXWA 2HWOA 5HG5A 4E4LA 4Q9ZA 3MW1A 5HNGA 4ASDA 5EKNA 5GZAA 4HGTA 2YDKA 2IVUA 1PMUA 3QD2B 4KD1A 1J3HA 4BGQA 5EDRA 4ZSJA 3FC2A 3GXLA 1ZWSA 5EKOA 5BYYA 3LM0A 3MIAA 2B4SB 3GB2A 3QA8A 1ZOHA 4LM5A 4F7JA 2VTRA 2VWIA 2VRXA 2YAKA 4TYGA 4FV3A 4CFVA 5I9XA 3ANQA 4JDJA 4AT5A 4I20A 4U45A 2ONLC 4FGBA 3RCJA 3BQRA 2YFXA 2GCDA 3TN8A 4BCMA 5ANOA 4I4FA 3QQKA 4Y5QA 4BKYA 4TWCA 4LMNA 3LKMA 2JFMA 2WQMA 3PXRA 3VS7A 2WMRA 2QU5A 4QQ5A 4MQ1A 4FKSA 4R7IA 3FMJA 5CXHA 3ZO2A 2HYYA 3I6WA 3O8PA 5JFVA 4JL9A 4F9BA 2F2UA 4P5ZA 4RWJA 4U40A 4ORKA 4KIQA 3CIKA 2VTAA 3MFSA 3OROA 2BPMA 2W7XA 2Z8CA 4NSTA 1UWHA 2C6LA 2WTKC 3F7ZA 4YC8A 5IF1A 4I6QA 1KV2A 1ERKA 2X6EA 3RGFA 3NWWA 1YWNA 2OZAB 4KIOA 4E3CA 5AR7A 3FPMA 3MV5A 3NSZA 1JSUA 4XG4A 4ZS4A 3TL8A 3KXXA 5FM2A 2UZUE 2IVVA 4KUJA 4K0YA 4ACHA 4DTKA 3QYZA 4K8AA 1J1CA 2IVSA 2C6TA 3KGAA 4IM2A 4FK6A 3ZSGA 1Q8ZA 1YRPA 3BGZA 4E5AX 5C26A 3FEGA 2VGOA 5DH3A 4CXAA 3NDMA 4UEUA 5ANIA 1WVWA 1YW2A 5C8NA 4V0GA 4QTDA 4BTFA 4YZMA 3CY2A 3REPA 2JIVA 4WUAA 2RG5A 4R78A 4U3YA 4GVJA 3FZPA 4BWPA 4CLJA 4AW0A 3FZSA 5FM3A 4XG7A 3DNDA 3POZA 1JSVA 4QTCA 3VUGA 4JS8A 1RE8A 2A2AA 4JRVA 5D9HA 1HOWA 2I6LA 4D9UA 3UNKA 2DS1A 4U6RA 3ACJA 1GIHA 3WE4A 3A7HA 3Q2JA 5FBNC 3S1HA 5JRQA 5EG3A 2PUNA 1ZMUA 3NYNA 3QUEA 4JG8A 4EWQA 2PU8A 4WSQA 5HIBA 3OFMA 4TRLA 3I5NA 3FKNA 3FI4A 5FXSA 1FOTA 3D2KA 3Q2MA 3ZCLA 3KVWA 1Q8UA 3U8WA 2ZMCA 3LXNA 4BB4A 1LPUA 5J5TA 4IAYA 2QHMA 2WD1A 4ANBA 4R3RA 5CT7A 3D83A 2XVDA 3ORNA 2B53A 2XP2A 4O0TA 5ANEA 4IACA 5DIAA 1PKGA 1RDQE 4B9DA 2WQBA 4O86A 5CAVA 4FMQA 3QZGA 4A9YA 4P5QA 5HVJA 3DPKA 3FLQA 4XEYA 4XJ0A 3EQHA 5DVRA 3TTIA 4C4EA 3OT3A 3BLHA 3IS5A 5HE0A 3CQWA 3FV8A 2Y6MA 4KIKA 4AE9A 5A46A 4U80A 4FIHA 4BC6A 2UZBA 3VS0A 3OTVA 3WILA 4QP2A 3PA4A 2P2IA 4OTGA 3ORKA 3GCUA 1O9UA 3LQ5A 2VZ6A 2Y9QA 3G6GA 3I79A 3IGGA 4PDSA 4V05A 4ZTSA 1CDKA 3U9CA 3VW6A 3EHAA 4P7EA 4ANQA 4BKJA 5DYJA 2AC3A 3PIZA 2PK9A 4YTHA 3CPCA 4OBOA 4U79A 5HKMA 4R7BA 5M4CA 3C51A 2YIRA 4DGOA 1VYWA 4EH9A 5C4LA 3A7JA 1BYGA 3EN6A 3R9HA 2BZKB 4C59A 2YITA 1KOBA 3UIUA 1OKYA 1A9UA 3R1NA 4EH6A 1QPCA 3QC9A 4E8AA 3I81A 3OHTA 4L42A 4J98A 3SXRA 4QOXA 4QYYA 3UOJA 1AQ1A 5LWMA 5HHWA 4L6QA 4ASXA 1YI6A 4DCAA 3Q52A 5GZ9A 5KNJA 4RIYB 2H9VA 4G2FA 1JPAA 2NPQA 1YXVA 4AQCA 1DI9A 4W4YA 2BTSA 2YDJA 4GUBA 4E6DA 3HMMA 3HAVA 5ETCA 4BCIA 5AR5A 5JGBA 5HX6A 4IVCA 2GHMA 3ZFXA 4MF0A 3ZBFA 4WUNA 4JX7A 4UWCA 5LMKC 3D94A 4BDIA 5IQDA 3H0ZA 4N57A 1K3AA 2XKCA 3ULIA 3VW8A 5M4UA 1H01A 3IQ7A 2C0TA 3MTFA 4FTTA 4JQEA 4NFNA 2HZNA 3BWFA 5M56A 4FZAB 4ZTHA 3F2NA 2C5YA 3FHIA 4Z9LA 2YIYA 2EVAA 2R3HA 3PP1A 4O1PA 4KKEA 4D4VA 4BCFA 4Q2AA 4O0VA 3KK8A 4JDIA 3Q60A 3CQEA 4FE2A 4TWPA 1XBCA 4O6EA 5LVPA 4OT6A 4Y46A 4C02A 5CF6A 5IDPA 5AR2A 1R0PA 1Q8WA 4MNEA 2BILB 1BL7A 2BFYA 3C4CA 5EM6A 4BY9E 3TUDA 4FZ7A 3A2CA 3RZFA 1GJOA 3PJ1A 3SDJA 3VBXA 2YZAA 5EYKA 3MS9A 2EB2A 5HGIA 3UMWA 4AFEA 4MD8E 4MXYA 4AG8A 3PVBA 2CPKE 1YHWA 2C6KA 3SKCA 1WAKA 3E92A 3FMKA 4FC0A 4I93A 3VBVA 3CTJA 4FUXA 4O7ZA 3O8UA 4NM7A 3C4XA 3VQUA 4I5CA 4B4LA 2J2IB 4IIRA 4WBBB 4ZSEA 2PVRA 2UZVA 4MQ2A 4ZXTA 5J8IA 4QP7A 5DG5A 4FNZA 4FTAA 3W8LA 5ETFA 5IA4A 3EKNA 4XV1A 4A7CA 5H8GA 4ACDA 2X8DA 3R8ZA 2PVJA 1SMHA 5CQUA 4R1YA 4WOVA 3O51A 1H1WA 4UWYA 2YM8A 3PSBA 3O96A 4PUZA 4I6FA 3HV3A 4ZJJA 4F99A 5F20A 1JWHA 3VHKA 5T6KA 3ZU7A 5K0XA 3M42A 4BCHA 1WBSA 2HAKA 4YZNA 4BRXA 4FKPA 4QRCA 3CJGA 1QPEA 3G5DA 1O6KA 2X2KA 2B54A 3TI1A 4IVAA 4F09A 4X2NA 3LHJA 2WHBA 4R3PA 5IA3A 3I6UA 4A9SA 2JBOA 2VNYA 3G0FA 3M2WA 3O71A 4G3EA 3V6SA 4EJNA 2CN8A 1OGUA 2FUMA 4FSUA 4EHGA 4FT9A 2R9SA 3LPBA 2VO3A 5A4QA 5ETIA 2OSCA 5IA5A 4FTMA 4LOQA 4NK9A 3DXPA 4XV2A 3R1QA 4PF4A 4EOJA 5KMMA 3QTWA 5CVGA 5LVNA 3UBDA 3KQ7A 4O7WA 2W05A 2OJIA 2JEDA 3PY0A 3PTGA 2ZVAA 4J1RA 3UC4A 4CV9A 4V0GB 4Z55A 4RBLA 3HMOA 3OUKA 2XK3A 4JLCA 4R6VA 4BDAA 4YMJA 4W9WA 4CT1A 1IAHA 2VTQA 5C01A 5FTOA 4DGNA 4GT4A 4KB8A 2OZOA 1Q99A 3N9XA 3FQSA 4GEOA 4Y83A 5C9CA 5CF8A 4YNEA 3T8OA 1UVRA 1Q61A 1TQPA 2V7OA 4K11A 4PL5A 5M09A 4ALVA 1CM8A 3EFKA 3GI3A 5E91A 2E9UA 3O17A 4OBPA 2ITNA 2VWYA 1MRUA 4NKAA 4X6RA 5EW9A 5HVKA 3NCGA 4TYEA 1IASA 4NCTC 5HE2A 4EI4A 4R77A 4DGGA 2YM7A 3V5WA 2J50A 4FSZA 2ETMA 2VWZA 3L8XA 4NIFA 5E8XA 3OOMA 4BTJA 1Q24A 4DA5A 4DG0E 4KS8A 2IZRA 4YSJA 3Q4ZA 4XV9A 5IA0A 3BIZA 3I0QA 4KKHA 3ZBXA 3P0MA 4OTWA 2HXQA 5I3OA 4LOPA 2X9EA 3COHA 1ZZ2A 2WMSA 3EQIA 4LGGA 4QMXA 4TWOA 3VQHA 3BQCA 3FMNA 3PP0A 5A3XA 4AT4A 4EZ5A 3Q6WA 3KRWA 2C30A 5K4IA 3ZZWA 2BZHB 3VS6A 4GYGA 5K5XA 3OVVA 4ACCA 5DEYA 4BYIA 3FY0A 4IM3A 2UZOA 4QMLA 2PMLX 2C3LA 3FLYA 4FV0A 3F61A 3C4FA 2ERZE 2VTIA 3QGYA 3WYXA 3DGKA 3E62A 5CU2A 2GFCA 4F0FA 3UO5A 3LFAA 5HBEA 3EL7A 2UZDA 3WZJA 3KRLA 4BCNA 5K4JA 4R5YA 3GEQA 2C0OA 4NH1A 3TKHA 5GIOE 4L9IA 5AAFA 4I0RA 3T9TA 4KSQA 4ZSGA 4P90A 4IZAA 5FTQA 1SVHA 2FA2A 3G0EA 5IZFA 4APPA 3FQHA 1M17A 1KSWA 4CQGA 5BNJA 4Z7GA 5AUWA 2XB7A 3GT8A 2XYUA 2AYPA 5IUGA 4L7SA 4KS7A 2OXXA 3ZDIA 3BLRA 5HQ0A 3IOPA 3DBEA 4WNOA 4CCBA 4LGHA 3MB7A 3EYGA 3NR9A 4O91A 4EBWA 4QO9A 1Q4LA 2CGVA 3QKMA 4RQVA 5IEXA 2GQGA 4GH2A 3FWQA 4FSQA 2O8YA 3QTXA 4RIOA 4G6LA 3V8WA 5CSHA 5A9UA 1HCKA 2ESMA 3A61A 4GIHA 4O6LA 1UNLA 3BKBA 4LG4A 4N70A 2XBJA 3HP5A 2I7QA 3R7UA 4QMTA 5I9YA 2O5KA 4GKIA 2B52A 2UW3A 3C7QA 4IAFA 4A4OA 3KMUA 1PMNA 4D4SA 3BU3A 2F7EE 1KV1A 3TIYA 3FAAA 2R5TA 4FTUA 1J7IA 1IEPA 3LM5A 4LUDA 4I6BA 2CKEA 4ENXA 4AN9A 2R7IA 2WOTA 1I44A 2Y4IB 4BYJA 4XRLA 4DTAA 2WFYA 3WYYA 1PXKA 4IZ7A 3VUHA 4MK0A 4AOIA 3DT1A 4RGJA 4TN6A 4BDKA 3JVRA 1YXUA 4JJRA 4WT6A 4AOTA 3R21A 1P4OA 1JKTA 5CX9A 3QA0A 5LARA 4IFCA 4EOPA 4MX9A 4D2PA 1OECA 2J0JA 1F0QA 2WIHA 2OBJA 3BHUA 3LCDA 4USEA 2WTDA 3PJ2A 2FSMX 1XHAA 2B7AA 3GFEA 4X2KA 3EQDA 3SOAA 4M7IA 4GV1A 4MBLA 4YHFA 3VBTA 3ZHPC 3VRZA 5HE1A 2QOQA 2OJJA 2UZWE 4FEQA 2WTWA 4R8QA 5AJQA 3IG7A 4BF2A 2KULA 4L01A 4NTTA 3CD8A 4AZTA 4DN5A 5L2TA 4ZMEA 1L3RE 3LZBA 3RZBA 1ND4A 2PE1A 4GVAA 3DXNA 5M55A 4KKGA 2UUEA 3T3VA 3OCBA 3QFVA 2X8IA 5EI8A 4BCOA 1GZ8A 3EFJA 4USFA 3CGOA 3ODYX 3NUNA 2CGUA 3O8TA 4CSVA 4GFOA 4QPSA 3WIGA 4DC2A 4Z3VA 5IQAA 3MVLA 3DAEA 4AW5A 2ITPA 5E4HA 3R30A 3JY9A 5A54A 1H1SA 4F1MA 3ROYA 4J99A 3ZLSA 1RW8A 4QPMA 3V01A 3AQVA 3JVSA 4IB3A 4YHJA 3R7GA 5IH4A 4JQ7A 2YIWA 4HCVA 5F95A 3KREA 5F9EA 3ZFYA 3L9PA 3QHWA 3SAYA 1W0XC 2NRUA 1VR2A 3CC6A 4BICA 3ZC5A 4EJ7A 1YWRA 3H9RA 3VUDA 4L45A 5H8EA 2PY3A 3UO4A 3A8WA 3DKOA 4H3PA 4C36A 2ZB1A 3HRFA 3R9OA 2QG5A 1XWSA 5L8JA 3UOKA 2WAJA 3AD4A 2BZJA 5E92A 3PVUA 5EI2A 1LUFA 5L2WA 4YC6A 2WXVA 1Q41A 3DS6A 5AM7A 2C5OA 3B8QA 3L8SA 5B0XA 4QPAA 4EOMA 4ZZNA 3G15A 4IM0A 5K3YA 2OU7A 4CFUA 1DAWA 1QL6A 5IEVA 1A48A 3KF7A 5M08A 3RPOA 4F08A 3C4ZA 5JK3A 4DFUA 4MNFA 2XNNA 4NIFB 1E1VA 3SV0A 4JDKA 2IZSA 2B9HA 2YJRA 2YM3A 4CYIA 5CY3A 3VAPA 5HO6A 2WQNA 4DFNA 2DYLA 1H1PA 2R3RA 5AWMA 3GUBA 5ICPA 4BHNA 3K3IA 3OWPA 2Z7RA 3FLWA 1XH8A 1G3NA 3R7IA 4PRJA 1WFCA 4HYSA 4U0IA 4XHKB 4QTAA 3R9NA 1YOMA 1CKPA 3NW5A 2OK1A 5CEOA 4TYJA 4GMYA 2UZLA 3D7TA 4X2FA 3UIXA 3CY3A 3DJ7A 3OY1A 4S32A 3ITZA 4W4XA 3GC9A 5JSMA 1PF8A 3C1XA 4E6QA 3QTIA 2QHNA 3R7YA 3ZRLA 2ZV9A 2UV2A 2ITXA 4CRSA 4BI1A 2XJ2A 4E26A 2WMQA 4CKJA 5I4NA 4MXXA 1JKLA 2B9FA 4HOKA 4YGAA 5TR6A 3ZLXA 3PA5A 4PL4A 5DT0A 2JGZA 5AR4A 4E93A 4I0SA 4IB1A 4AZFA 5FEDA 3FJQE 2YZLA 3DAKA 3LCTA 2GS7A 3LIJA 2PTKA 4J53A 3SHEA 3FI2A 2CJMA 2ACXA 4BVUA 1CMKE 3DK7A 3TIZA 4FTOA 3F3TA 3IKAA 4BBEA 3UQCA 5EHOA 3PRFA 4IAIA 2JFLA 2V7AA 4D5HA 4EK3A 4F9WA 5A14A 5AA8A 4QP1A 2QG7A 3RHXA 3GU7A 5HU3A 4YP8A 5FBOA 2OGVA 5EM5A 4WNMA 2YDIA 3BEGA 4LYNA 4EHVA 4MAOA 4XOZA 1G8AA 4GKHA 4NWMA 3NS9A 3QRIA 3FKLA 4FT3A 2WMBA 4XG6A 5F1ZA 2W06A 3ZUUA 5M51A 3P7CA 3QQLA 2RL5A 4BDGA 3DXQA 4ANLA 4WG4A 3E8DA 4C38A 4GS6A 1PYEA 2QOBA 3GBZA 4PMTA 2X2LA 4FTRA 2OH4A 3I5ZA 4GG5A 1W84A 1OIQA 4MHAA 1TKIA 3PVWA 4FG8A 4FI1A 3IDBA 2VTLA 3HDMA 2HCKA 3RBWA 5DHJA 2WTVA 3KCFA 3I7CA 4AFJA 2YM4A 3Q04A 2E9OA 4ERWA 1XH6A 5DMZA 1UU9A 1XR1A 3P08A 2R0IA 4FT5A 1H00A 2AC5A 4HNIA 3UOLA 2ETRA 4F6UA 4K18A 4EYJA 3PIYA 3BBWA 4MEDA 3VS1A 3RINA 4NTSA 5M57A 1U54A 4ITHA 2XK8A 3QYWA 4C2VA 2JDVA 4CD0A 1PYXA 4CFXA 2W0JA 3VBYA 1UNHA 4FKRA 4CQEA 3OZ6A 4ZTRA 4GSBA 4IMYA 4CGAA 1QMZA 4M15A 4RX7A 2RSVA 2Y8OA 3LLAA 5M4FA 3SXSA 3TNIA 3ZRMA 5C8KA 4OBQA 4RZVA 3OC1A 2ITYA 4BTMA 3HAMA 1PXOA 2VO7A 3A7FA 2BMCA 3R22A 4EUTA 3ID6C 2X7FA 2YCSA 3FZRA 1U5QA 4ZEGA 4EQCA 2C1BA 1LR4A 4LFIA 4TPTA 3Q4UA 3SRVA 3FI8A 4M3QA 2W99B 3ZEWA 4XS2A 3H10A 3EL8A 4NJ3A 2W1EA 4EH3A 2OF4A 2R3IA 3D14A 4C7TA 5EOBA 4XBRA 3RALA 3TZ9A 5L3AA 4NZWB 4RIWB 4XV3A 4M8TA 2JKQA 4CVAA 1KUTA 2XYNA 1M2RA 2OIQA 4G31A 5JQ8A 4L8MA 5AR8A 4RJ7A 4ZTNA 5AP1A 3THBA 3BBTB 4IBMA 4ZZMA 1REKA 3MH1A 4F7NA 5HORA 2YWPA 4HGEA 4FV6A 4JR3A 3I0OA 2O63A 4RIXA 2BIKB 4QQTA 3C50A 3SD0A 3BELA 3BYSA 5AIRA 4PY1A 3EZVA 3NAXA 3AC2A 3AT3A 4YSMA 3RAKA 3QX4A 4FIIA 3UJGA 4ENYA 3E64A 3UYSA 3DBFA 4FTQA 4FT0A 2QOIA 4I92A 4MCVA 3L9NA 1UKIA 5K9IA 2R3PA 5CEMA 5AV1A 4NW5A 1S9JA 5CTPA 3PXFA 3ZO1A 2V0DA 4AA4A 3LQ3A 4CKRA 5IMEA 4FG9A 3PUPA 3BV3A 2UW0A 1GIJA 2ITTA 2FSLX 4E4MA 2ZV2A 1DS5A 4YTCA 3PRIA 3Q9XA 3OP5A 2IO6A 4I94A 2WMWA 2IWIA 5EQEA 4BDFA 4BKZA 3NCZA 2QR7A 4ZSAA 2UW7A 4XH6A 4HNFA 2CLQA 3KKVA 4OLIA 4EHZA 4I21A 5DE2A 3LFCA 2OG8A 2ZM4A 2J0MB 3FXWA 4F9CA 4LRJA 3UPZA 4O2ZA 3DDQA 3UMXA 3Q9ZA 5IEYA 2WELA 4X3FC 5BVEA 5T68A 4QNYA 3RI1A 1FGKA 1PXPA 4D1ZA 4HPTE 1WBNA 4F0GA 1R3CA 3HP2A 3R8MA 4H3QA 2CNUA 3TZ8A 3D15A 4G16A 2FVDA 4CLIA 4O27B 5E8TA 5AUZA 2O65A 4IC7A 2Y4IC 3ORLA 3Q96A 3ATSA 2QVSE 2E9NA 4DITA 4AZSA 4RVKA 4UXQA 4YPDA 1Q3DA 2VX1A 2XH5A 2H8HA 2ZB0A 3DDPA 1AGWA 2V22A 3D4QA 2OIDA 3AC1A 4UBAA 5HLNA 3W55A 4O96A 2A0CX 4IADA 4DFLA 1OBDA 2PE0A 5ACBC 4ZY4A 4AA0A 3SG8A 3NUSA 1WBOA 4QYEA 3L8PA 4ALUA 2FO0A 3C4EA 4GYIA 4RPVA 4O83A 5CAOA 3ZUTA 1SNXA 2XZSA 2PZPA 3MVJA 4CNHA 3BHHA 3A7IA 4KBAA 1UV5A 4FV7A 4F6WA 4UYNA 3TACA 4L53A 3UC3A 5CAQA 3AC8A 3MSSA 4EKKA 3KRXA 2VO6A 5H8BA 5M44A 3VS2A 2Z60A 2VWVA 4M69B 2R3JA 4G5JA 4Y5HA 2OJ9A 4MXCA 3ZSHA 3F69A 3CS9A 4R1VA 2BZIB 4UYAA 2CNVA 2GQRA 2JKOA 3NRMA 3GC0A 2GNGA 1M2PA 3ENHA 3Q4TA 2CCIA 3QRTA 4WIHA 4I4EA 3D7ZA 3EQGA 4G6NA 2YIXA 4TTHB 5CZIA 4FNXA 2XK9A 3VF8A 3MIYA 3PFQA 3BCEA 4Z7HA 5KMIA 5KKRC 3BEAA 1NY3A 3KXMA 2EXMA 4IQ6A 4X3JA 3PXYA 4JAJA 1XH7A 4X21A 3R8VA 4B7TA 4Y72A 2VWWA 5HCZA 3QWKA 4TL0A 4NW6A 4XP3A 4A4XA 4F65A 2CN5A 2JAVA 2J0LA 2C3JA 4UB7A 2W17A 4X0MA 4HYHA 2E9VA 2PVNA 2CGWA 2C3KA 3U4UA 3IOKA 4RVMA 3DBQA 4DAWA 3V51A 2CKOA 3NNVA 3C0GA 3ALNA 3NUPA 3S95A 2OI4X 5AP4A 3HDNA 2J0KA 4BI2A 5AFVA 4A4LA 5DPVA 2C68A 1Y6BA 3ODZX 5HVYA 4DGLC 1YDTE 3WF9A 3ZRKA 4LV5A 4OTRA 5ANGA 2CDZA 3NW6A 4F7LA 4WA9A 5EHYA 4QMOA 5CT0A 1MUOA 4DEDA 1KE8A 5GIPE 1IRKA 1UNGA 1STCE 4O1OA 3PPZA 5T3QA 4A07A 5CWZA 5BYLA 3FZOA 1CTPE 3FLZA 5IDNA 1U54B 5F94A 4EWHA 2PWLA 4QMYA 4FYNA 3A4OX 2BDJA 2VN9A 3BHVA 3M1SA 2PVKA 4ZS0A 5HBJA 3CPBA 2XK4A 5HZNA 5CU4A 4EL9A 4C57A 4FF8A 1WBWA 1FINA 3ORZA 3ZC6A 1OIUA 2V5QA 4DG3E 5JH6A 3N4VA 1WBPA 4O7LA 4EH7A 2ITOA 1NVSA 3LQ8A 3PSCA 4CT2A 1KWPA 4O0XA 4XG9A 3TNWA 2JLDA 3OXIA 4Z16A 4EK5A 4DEAA 3SRVB 4RJ5A 1F3MC 5AV0A 1Z57A 4TYHA 3ENMA 3C5IA 3NW7A 2J5FA 4YBJA 4FL3A 3ORXA 2BROA 3BLQA 1YQJA 5KMNA 3T9IA 4C61A 5AP7A 4II5A 4NL0A 4G3CA 1MP8A 1PW2A 1RQQA 2VTTA 3QD3A 5HIDA 4ZK5A 1FPUA 2P3GX 3PG1A 4AWIA 4AT3A 3BYOA 2Y7JA 3F5UA 3LMGA 2UZNA 4BN1A 3TEIA 2BUJA 4RIXB 4RX9A 3BHYA 3KEXA 4N0SA 4BI0A 5BUJA 3FSKA 2R64A 4WBOA 4YUQA 4RLKA 5IU2A 3NUAA 4XG2A 4J8MA 4DEHA 1NT2A 3QWJA 3HV5A 4JG6A 3W2SA 1VJYA 3BGQA 3E3PA 5FP5A 5IKWA 4KIPA 4DLJA 5CEIA 4FTIA 3DJ5A 5E8UA 5EM7A 4BZNA 5HTIA 4D4RA 4G5PA 4NEUA 1IAJA 4YNOA 3CKXA 4ERKA 4HJOA 4P4CA 2F7XE 5EYMA 5EOLA 3SXFA 5HTBA 4DEBA 3EB0A 3F6XA 4TWNA 4O84A 1YI3A 2ONLA 5E1SA 5A6OA 3NZ0A 4AOJA 2ZDTA 5AUXA 2R3OA 3KXHA 4FKVA 4FR4A 5AAGA 4QMWA 3ULZA 2C3IB 2W9FB 1PXMA 2QONA 3F82A 3G51A 3MFTA 3RJCA 5JFXA 3RAWA 3ZXTA 3E7VA 2WZJA 3FYKX 4LV8A 3WF6A 4EEVA 4EZ7A 3CR0A 4DH3A 3KL8A 4QMZA 3OTUA 5D12A 2QCSA 2J90A 1CKIA 1V0PA 2G01A 4FTNA 2O0UA 2JIIA 1JVPP 2BR1A 2WNTA 5J1WA 5B2LA 4PDPA 1K2PA 2QOOA 3B8RA 5EQYA 4O7RA 4IFGA 3CGFA 3HRBA 5HCYA 3S3IA 4QMSA 3HNGA 5C4KA 4PPCA 4PQNA 3F5XA 4GG7A 3MH2A 3KMWA 3Q9WA 4HVSA 3EZRA 4O82A 4MKCA 3WZKA 4ZZOA 1YHVA 4MXOA 5EFQA 1R1WA 3OOGA 1J7LA 2P2HA 4PTEA 4F9AA 2QI8A 3HKOA 2X6DA 2B1PA 3QALE 4GFGA 4JBVA 5CAUA 4EUUA 5HNBA 4APCA 3F9NA 4AA5A 3QXPA 2XF0A 4F64A 2GNJA 1SNUA 4YHTA 2XCKA 3JUHA 2VU3A 1JOWB 3II5A 4F63A 1H28A 3W2PA 3COMA 3UE4A 2XIXA 3FSFA 3PZHA 3WOWA 4YTFA 3EFLA 3FZTA 3VIDA 2QURA 3EJ1A 4FIEA 5DEWA 3E88A 3O0GA 3QRUA 4LL0A 5CU6A 3HUCA 4BDHA 4CFFA 5CQWA 3OXZA 3PWDA 2XM9A 4IEBA 4NM0A 4GFMA 4EH8A 4QP6A 1M7QA 4IJPA 3R9DA 4KA3A 3W8QA 4EOKA 4FNWA 5IA1A 5AUVA 4C8BA 2PSQA 1FQ1B 5A4LA 3KN5A 5EQPA 4B99A 5HX8A 4L43A 1W82A 4QYGA 4E6CA 1UWJA 4IH8A 5DI1A 4L3LA 2C6EA 4IDTA 3BI6A 5TF9A 3EQPA 3MY0A 2BKKA 4ZJIA 5AUYA 4E5WA 4M97A 3ETAA 4JBOA 5A4CA 1PHKA 3FMDA 3F2RA 4EC9A 4GRBA 3DZQA 4H05A 4CFNA 4JI9A 1Q62A 1SVGA 3G9LX 5AIKA 3UO6A 4CTCA 3CEKA 2GSFA 1G8SA 2JDRA 3GOKA 3TJCA 2GNHA 2A19B 4IHPA 3TUBA 3F7WA 3ZONA 4AAAA 4B8MA 4PTCA 3DQWA 2GQSA 2RF9A 2IVTA 2O3PA 3AGMA 2HXLA 4C33A 2YERA 3ERKA 2WU7A 3P86A 1BI8A 3IPHA 2EXEA 2E9PA 1OL1A 2UW5A 5J1VA 5LQFA 3E5AA 2P0CA 4KIKB 5CSPA 2I0EA 2GTMA 4F4PA 1H07A 2Y0AA 3DTCA 4H1JA 4XP0A 4AN2A 2ZDUA 5BUEA 2ETKA 2IW6A 2G2IA 3RPVA 4C4JA 5CEPA 3QQUA 2CNQA 3QUDA 1JLUE 4BIDA 3SC1A 4WRSA 2PMOX 3E87A 3IDCA 3LOKA 4TXCA 4H39A 2VD5A 3QKLA 1MRYA 2VV9A 4EK6A 2OKRA 1H08A 5TT7A 4HCTA 1BLXA 4UZHA 3RNYA 3AD5A 3RP9A 2CHLA 5J5SA 2PE2A 4FKLA 4LGDA 3FMLA 4UMPA 1R78A 1W98A 2P33A 4E6AA 3P7BA 4IB0A 5FWKK 3TZ7A 2UZEA 1ZYDA 1R0EA 4NYEA 1Q97A 3TV4A 3PG3A 2LAVA 4BBMA 5JT2A 1H25A 3R01A 5D7VA 5L8KA 2YCRA 3PDTA 3KXNA 3K54A 4YZBA 3ZSIA 3GQIA 5DRDA 2BDFA 3G9NA 4QTEA 3FQEA 2W96B 3AT2A 4OAVB 2QC6A 2WMAA 5IMXA 5LMKA 2W4JA 3LFDA 5HD4A 3BRBA 4YZ9A 3D9VA 4JBPA 1KE5A 3P7AA 4PL3A 2XEZA 3O23A 3RWPA 3IGOA 1PXJA 3EQRA 4UY9A 4HZRA 3UODA 2E2BA 3W2QA 2W1GA 3POOA 2HW7A 4H58A 4WNKA 4C4FA 2UW8A 3IW5A 1P2AA 4FSNA 4IDVA 5BMSA 4EH2A 3Q4CA 1YDSE 4RZWA 4FV1A 3FLSA 4L67A 3P79A 5D1JA 3WARA 5LVOA 2OICA 3OEZA 4LI5A 3MJ1A 4PV0A 1JKSA 2R4BA 3L1SA 5H9BA 5BVOA 3W1FA 2W1ZA 5AA9A 5I0BA 2YACA 5JZNA 1YXTA 1V0OA 3DJ6A 3KY2A 3NYOA 4F7SA 3W18A 4BHZA 5KE0A 3HUBA 3KN6A 3U54A 4JDHA 4HW7A 4S31A 5E8SA 4YLKA 2OXDA 5C1QB 4FSMA 5CAPA 4FSYA 3FUPA 4MNEB 4WO5A 3NNXA 5HI2A 4BGHA 4D4YA 5JN2A 4ANMA 3VJOA 5HEZA 2XNEA 1ZXEA 3MDYA 3CSVA 2GTNA 4FKUA 2JD5A 3DY7A 4NM5A 3GC7A 2XEYA 3VUMA 1FMOE 2XNPA 4C4GA 4FV2A 4DH7A 3NAYA 4EC8A 4RMZA 5D41A 3ZXZA 4ASZA 4DH1A 3LCOA 2PL0A 3GENA 4DLIA 4JG7A 2XIZA 3AT4A 2G2FA 4K2RA 5K0KA 2R3FA 4AZVA 4HVIA 4PP7A 1Z5MA 4PDOA 2C47A 3CCNA 4J95A 2BFXA 2ZAZA 4FVPA 2JDSA 4ZSLA 1YWVA 5LJJA 3BU5A 3NIEA 3RNIA 2GNLA 3LW0A 1IG1A 2PUPA 4PWNA 2DUVA 2GDOA 3QHRA 4E4NA 4O81A 2HY0A 2B0QA 3GOPA 3Q32A 3OW3A 4P2KA 4GK2A 2C4GA 5HO8A 4ZLZA 5FXQA 4K77A 4RA4A 5DFPA 5FEEA 4BDJA 4EBVA 4XMOA 2VX0A 5CENA 5IA2A 1JKKA 4EKLA 3ROCA 1NA7A 2QO9A 5HCXA 5J9ZA 5CU3A 4FV4A 4IVDA 4RC4A 4NFMA 3RMFA 3K5VA 3VRYA 4S30A 1ZRZA 4CFMA 5DWRA 4DGMA 3KVXA 1OM1A 1G5SA 1UU8A 3O7LD 5ACKA 4XP2A 4E1ZA 4WKQA 3R8UA 4M12A 4MTAA 3VC4A 2IW9A 3TG1A 4M13A 2PPQA 2C6IA 2XBAA 2OFVA 5C27A 2BRNA 5KBQA 4BGGA 2WMXA 4FG7A 4FL1A 4QMMA 4CV8A 4IWDA 2UZTA 4DFZE 4KBKA 2YHVA 3OBGA 4FYOA 1LP4A 2CLXA 4JAIA 4JR7A 4ARKA 5HTCA 3QTZA 3CKWA 2OIBA 1YI4A 2FSTX 5L2QA 4ANSA 3TNQB 2XJ1A 3QZHA 3EQFA 1DAYA 3PYYA 4NCTA 4DF3A 1BX6A 1P4FA 4FKJA 4I23A 4E4XA 4YO4A 3H4JA 2XRWA 3QTQA 4LUEA 4U7ZA 5L4QA 3NNUA 4PNKA 4GK4A 5EDQA 2X1NA 4ZTMA 3HV6A 2BRBA 3LE6A 2NP8A 3TWJA 3HZTA 1YHSA 3UYTA 3VF9A 5EM8A 1J7UA 1H0WA 3MBLA 2BRHA 4I41A 5L2SA 2W4KA 2HENA 3AC5A 2QLUA 3V6RA 5I9VA 4HYUA 1V0BA 4FKGA 4YJNA 2IW8A 2P55A 4QQCA 4RA5A 5LVLA 5BPYA 3LFFA 1FVRA 2G9XA 2JBPA 3P4KA 2R3MA 4BCJA 5M53A 3CXWA 4IC8A 3WBLA 4F0IA 4L00A 2F9GA 5JGAA 2BIYA 1B39A 2PZYA 4U97A 5HNIX 2C6DA 3NUUA 2A1AB 3COIA 3TV6A 3Q5ZA 3TM0A 2H34A 3A7GA 4YLJA 4FEVA 3C9WA 4PMMA 5AX9A 4DFXE 2RKUA 4YZCA 1OIRA 4BCPA 3OD6X 5E7RA 2PHKA 1F5QA 2HK5A 3OF0A 3QX2A 3VO3A 1GNGA 3GU8A 4IZ5A 2WPAA 5CI6A 3Q9YA 5LWNA 3AMBA 3QD4A 4I3ZA 3SA0A 3UG2A 3P1AA 4FOCA 3RK9A 4PPBA 4IZYA 3TNHA 3O2MA 2O2UA 2OZAA 3KXGA 4FODA 4O0SA 4M0YA 2VX3A 2XRUA 4ZMFA 3VBQA 4L68A 2V55A 1WMKA 1ZYSA 4MD7E 4BWXA 3FYJX 4H36A 3RTPA 2QOCA 3PXQA 2EUFB 1Z9XA 4JT3A 4D28A 5AUUA 3NYXA 4X7QA 1KOAA 4QMPA 4AGWA 5ITAA 3P23A 3MH0A 3MY5A 4M14A 2X4ZA 2J51A 3VUKA 4ZY5A 2XIKA 3DZOA 4WSYA 4TW9A 2ZV7A 3AC3A 3LXPA 3R7EA 2W5AA 3FL5A 2C0IA 3IW8A 3KULA 4U41A 5HLPA 4XG3A 5BVKA 4U5JA 3AMAA 3L8VA 3GVUA 4FL2A 3I7BA 5CSWA 2BTRA 3QZIA 1OKZA 4DT8A 2WQEA 3LCKA 5CSVA 4RX5A 3QRJA 3HGKA 2X7GA 3R1YA 2WMVA 1CKJA 4DE4A 2WB8A 5LMAA 3TDVA 3NVKI 3OG7A 4CCUA 3U4WA 5CVFA 3UVPA 5K5NA 4FKWA 3MFRA 4C37A 2XA4A 4D2WA 2W5BA 3OW4A 3H9OA 5C03A 5BUIA 2PUIA 4KRCA 3MVMA 4PP9A 1PXNA 1E1XA 2BKZA 2P4IA 4AGCA 2EU9A 1YDRE 4A9TA 5J95A 5B2MA 5I9WA 2R3QA 3AMYA 3MH3A 4IANA 5CLPA 5CSXA 5ETAA 3RAHA 3U87A 4YJVA 3Q3BA 1MQ4A 2PVHA 3GNIB 2VTPA 4F9YA 5EI6A 2BDWA 5J7HA 3UQFA 1Q5KA 3AOXA 4U43A 4RJ8A 3W2CA 1NW1A 2CKQA 4O7VA 4EH5A 1VEBA 2X8EA 3EN9A 3MGYA 3QQHA 4OTFA 4AW1A 5CI7A 4AE6A 3ZMMA 2HOGA 5A4TA 3NMUF 2ERKA 5HLWA 2OFUA 4G1WA 4BL1A 4QP8A 1APME 4FEXA 3NNWA 4DEGA 1PRYA 2BALA 3ZM4A 4WHZA 2FGIA 2OW3A 3HMNA 3S2PA 3U9NA 2WMTA 3F66A 4FV9A 3QD0A 4G6OA 4E7WA 2Q0NA 3E8CA 5KO1A 2I0HA 2Z02A 3ATTA 4C4IA 4PDYA 3BHTA 5JFSA 5D11A 3TJDA 3FZ1A 5L6PA 1SM2A 3DK3A 4EYMA 3QCSA 4OW8A 5BYZA 1U46A 3C5UA 3F3ZA 2HELA 2ITWA 2ZM3A 4LOOA 4UXLA 5AP6A 1VZOA 4Y8DA 4FTLA 4I0TA 5CS6A 4AP7A 3EH9A 1M52A 2YJSA 4IX6A 1MQBA 1UU7A 5LXMA 4QQJA 4W8EA 4ID7A 4KABA 4F1TA 4FSRA 4CRLA 1TQIA 2KTYA 2PVLA 4BR3A 3FMHA 2LGCA 2Z7LA 3QTUA 2QOHA 3DKGA 1H8FA 1WZYA 4UMQA 4YZDA 4NU1A 4RIYA 5H2UA 3MPAA 3F3WA 3MESA 1S9IA 5CF4A 5HIEA 4L46A 3C0IA 5EYDA 5L2IA 5DR9A 1ZLTA 3FC1X 1RJBA 3DCVA 4KNBA 2GS2A 5AR3A 3ZO3A 4QMNA 2G1TA 3HMIA 1FBNA 1OKVA 5TOZA 4ALWA 2R7BA 3CBLA 3O7LB 3COKA 4RT7A 3UNJA 4DYMA 3G90X 1TVOA 5HOAA 3QQFA 2VTMA 2WIPA 4D2RA 5CEKA 2QNJA 3V5TA 2F7ZE 3GU5A 3KCKA 5DA3A 2QODA 2R3KA 5I3RA 4GJ3A 4AU8A 4AGDA 4HYIA 3MJ2A 2X39A 3DTWA 4B8LA 4CG8A 4FTCA 4FV5A 1Q3WA 4G34A 1WVYA 3GCPA 4O2PA 5BVFA 3DKCA 5M06A 4YJUA 3FXZA 4L3JA 2OO8X 4YBKA 4RFZA 5BVDA 5AUTA 3K3JA 4RX8A 5JEBA 4U9AA 2VGPA 2QD9A 5KX8A 4I5HA 4OAUC 5EW8A 2RIOA 4MWIA 4ONAA 5AV4A 1H1QA 3A4PA 1W8CA 2QOKA 5G1XA 1X8BA 4PTGA 3FHRA 3IW6A 4C0TA 5I9UA 2FYSA 3LVPA 3RKBA 5BVNA 5E8WA 2R2PA 1OB3A 4N6YA 4BDDA 3HV4A 4QP4A 3SGCA 3VBWA 3VHEA 2RFSA 1OPKA 5CVHA 1ZY4A 3P9JA 3PJ3A 3E7OA 4M0ZA 3BU6A 4H1MA 4YC3A 4O7YA 3R00A 5IQCA 4GUEA 3QAME 3NLBA 3WE8A 3R2BA 3PE1A 3GGFA 3RK5A 3V5LA 4YJOA 2W1HA 4D1XA 2GU8A 4X6QC 3W2OA 4AXAA 1SVEA 3D7TB 3DK6A 4IWPA 4M84A 5IQFA 3WF8A 2BVAA 2Q83A 2RFEA 3PWYA 1SYKA 2YLEA 3QBNA 2QQ7A 1BUHA 4UX9A 3A62A 4GK3A 5FP6A 3PJ8A 4MYGA 5JFWA 3UZTA 5CANA 5A6NA 5DBXA 2ZMDA 5IQHA 4LMUA 4A9UA 1ZOGA 1REJA 3QCYA 2YM6A 4O7SA 4FSWA 1A06A 5J79A 4JRNA 3DLZA 4FBXA 3ET7A 2ZYBA 1IR3A 1WVXA 2HW6A 3DU8A 5GJFA 3MY1A 5J9LA 1ZMVA 2VAGA 2JITA 4HVDA 3JY0A 3E93A 2GPHA 5J7BA 3PIXA 2JC6A 4OTDA 3AD6A 1PKDA 4YU2A 2YLFA 2BAJA 2XNGA 3V5JA 2B55A 3LJ2A 4AX8A 3U6IA 3GFWA 4L44A 5I5ZA 3DNEA 5L6WL 1VYZA 3KC3A 2CSNA 3DB6A 3RAIA 4EQUA 1OZ1A 2WO6A 3B2WA 3RWQA 5L8LA 3KULB 3EIDA 5FG8A 4FV8A 4BBFA 5LMBA 4FT7A 4TZRA 4XG8A 2FB8A 3VUIA 4EK4A 3R7OA 4DINA 2GNFA 3WZUA 2GHLA 4MD9E 5LCJA 4QP9A 4ITJA 4ZTLA 4S2ZA 3Q6UA 5CEQA 3Q5IA 1Y8GA 3BYMA 2Y4PA 5DR2A 2R3GA 1EH4A 4M66A 4DH5A 2BRGA 5CXZA 1HCLA 2IJMA 2OWBA 4DG2E 4Q5EA 5KZIA 2YAAA 2IZTA 3W16A 2XKDA 5CF5A 5H3QA 1O6LA 4MXZA 4HGLA 4TKSA 4U81A 4R7HA 2WTCA 4YR8A 4DFBA 4CG9A 4NT4A 2PUUA 3R6XA 3RM6A 3LFSA 4FTJA 5GHVA 3CTQA 2BRMA 3R83A 1OL6A 2Z7SA 5AP0A 3UGCA 3QGWA 3ZH8A 3GCVA 3WF7A 1T46A 1K9AA 4WG3A 2X81A 4FVQA 3LJ0A 4CMUA 4YJTA 5EYCA 3SVVA 1V1KA 3TDWA 3GCSA 2CKPA 5AX3A 1JQHA 3PPJA 3OUNB 4FKQA 2BHEA 4J8NA 3GU4A 4XCUA 3GC8A 1XH4A 3AC4A 2JIUA 3FY2A 4ITIA 3PVGA 2J5EA 2NNWB 2GNIA 2PMIA 2QOFA 2DWBA 5E8YA 2W1IA 4L7FA 2H6DA 2HZ0A 4XLVA 2C5VA 3UVQA 3A99A 3E8EA 4YJRA 5TKDA 4LQMA 4RWLA 3ZDUA 4EOQA 5BMMA 3W2RA 3D0EA 4D2TA 5E8ZA 3PXZA 4HCUA 2VTJA 4RFYA 2VUWA 4JQ8A 1BMKA 4Q5HA 3I1AA 3R73A 1TQMA 2VTSA 3RK7A 3NGAA 5CALA 3EMGA 3TTJA 3WZDA 3I4BA 4D1SA 3CTHA 3PZEA 4B0GA 4RVTA 3DQXA 3MWUA 3ORIA 4X2GA 2Q0BA 2QOLA 3TKUA 3KK9A 2GMXA 4DH8A 4UMUA 1GOLA 2BCJA 4Y95A 5EH0A 4E5BA 2QU6A 4F1OA 3C4WA 5AAEA 1T45A 2YIQA 4IX3A 4D55A 1B38A 4I5MA 3WF5A 1PJKA 1CSNA 3V5QA 3AGLA 1KE6A 3OWKA 2C5NA 5HESA 1DM2A 3D5XA 3UVRA 3ORTA 2I0VA 2C6MA 4EOLA 2XNMA 2BHHA 3VN9A 3HECA 4EQMA 5DN3A 3EKKA 3KU2A 3QTRA 4DBXA 3BE9A 2SRCA 1OL7A 3TCPA 4A9RA 3LFBA 4G9RA 2IZUA 3ZEPA 5IQIA 4X3FA 5M07A 3OT8A 4D5KA 4O7NA 5CU0A 5KMOA 1XH5A 2EB3A 2YABA 3QTSA 3PPKA 2W1FA 4RC3A 3UP7A 1W83A 1QCFA 4RJ3A 3CP9A 4FZFB 5KMLA 4WNPA 5EW3A 2F49A 1PXIA 2W1CA 2EWAA 3LJ1A 3N51A 4BIBA 4CMOA 4WRGA 3OWJA 2X2MA 3NVMB 1H24A 3QLGA 1OI9A 4JIAA 4D58A 3N4UA 4OTIA 3QLFA 3TV7A 4EK8A 3LFEA 5B7VA 4EH4A 3HMPA 2NO3A 3IECA 1R39A 4C35A 4DHFA 4F6SA 2C6OA 4KSPA 3F5GA 3JPVA 3KFAA 4C62A 4GJ2A 4J97A 3D5WA 4MF1A 3CJFA 3HLLA 3LCSA 4YLLA 5FEQA 4J96A 2WKMA 1OIYA 4QMVA 3UTOA 3W32A 4EOOA 2PVMA 3ANRA 4QT1A 5D7AA 2R3NA 4DEIA 5IUHA 4EOSA 1ZAOA 3EYHA 5EK7A 4YJQA 4CFWA 2QO2A 3MPMA
chains in the Genus database with same CATH superfamily
4CZUA 4IWQA 1AD5A 4I24A 5EHLA 3G2FA 2HZIA 3MN3A 2G15A 1UKHA 3R7VA 3TZMA 4BDEA 3D2IA 3R2YA 3L9MA 4IX4A 4O0RA 5DNRA 1BL6A 3SLSA 3W33A 4DBNA 3IW7A 4EHEA 4O7TA 4QP3A 4AACA 3S0OA 1ZOEA 4O38A 4S34A 3UDBA 4FEWA 4O4CA 2PULA 3PJCA 4IVBA 3VS3A 2Z7QA 3QKKA 4EZ3A 5IQGA 3N4TA 5AV3A 1OUKA 1FMKA 3P78A 3PY3A 4JBQA 3SW4A 1ST4A 3ELJA 4IAKA 3FPQA 3B2TA 2CMWA 4HVGA 3BX5A 2XK7A 4FIGA 3S00A 4FGRA 4RJ6A 4MBIA 3NEWA 3TXOA 2VO0A 5TO8A 3OWLA 2QKRA 4RWKA 2VTNA 3MFUA 4CKIA 3BZ3A 4QD6A 1OL5A 5DGZA 1URCA 1M7NA 4GT3A 4FA2A 3LFNA 3BPRA 5JQ5A 2J4ZA 4IW0A 3F88A 4JOAA 5L6OA 3SG9A 2XKEA 2Y6OA 3EQCA 3OMVA 4FNYA 4RRVA 5A4EA 3V3VA 1GZOA 4R3CA 2HWPA 4GW8A 4DFYA 1JBPE 5DLSA 5GJGA 4AZEA 4FKOA 5GJDA 5IG1A 3LAUA 1URWA 4C3FA 3MA6A 2UVZA 1OUYA 2O64A 2QLQA 3G33A 3F5PA 4N4SA 4RC2A 2XALA 2JDOA 4X2JA 2XNBA 2XM8A 2C5XA 4FICA 3VJNA 3VUTA 3OCSA 3LMHA 4TT7A 1BI7A 3DOGA 2ZM1A 4CZTA 5DOSA 2YWVA 2W1DA 3TUCA 3JS2A 1B6CB 1GZKA 3FDNA 4FKTA 1Q8TA 2GFSA 2X0GA 4GL9A 3UPXA 3PY1A 4CYJA 4WD5A 4O0WA 3L9LA 3QCQA 4BDBA 3PA3A 4IE9A 3C0HA 3EN5A 4BTKA 5IUIA 5JMSA 3JR1A 5TE0A 3DFAA 5E90A 5E9EA 1Y91A 4LDTA 4V04A 1GIIA 4RLLA 4C58A 3FMMA 4GU9A 4JVGA 1YXSA 4G3DA 4I6HA 3EN7A 5HU9A 5IISA 4OGRA 2GHGA 5DR6A 5ANJA 4J71A 4E20A 5AMNA 3IDPA 4G3FA 4TNBA 4ANOA 4PMPA 5F4NA 4DCEA 3MVHA 2YCQA 4ANNA 3NUXA 2F57A 1XJDA 5HICA 4LRMA 4TYHB 2OJFE 4J7BA 1H4LA 1Q8YA 3QRKA 2RG6A 4I22A 2ITZA 2JDTA 3QC4A 4GT5A 3EOCA 5IH5A 4EOIA 2X7OA 3NPCA 4TYIA 4YJPA 3S4QA 1WCCA 3ALOA 2J0IA 4CMTA 1DI8A 3OS3A 4RJ4A 1ZYJA 2PMNX 3UZRA 3TKIA 1ST0A 2GS6A 5CNOA 5CASA 3CLYA 4AXDA 3R04A 3R02A 3QQJA 3P5KA 4U3ZA 3BLAA 2WTJA 3FI3A 2VWXA 4Y73A 3BV2A 1PY5A 1WBVA 3DA6A 4FZ6A 4ZLOA 3M11A 3AKKA 4FTKA 3FBVA 1U5RA 4AUAA 3FE3A 4PNIA 4UMTA 5FDXA 2UVXA 3R8LA 4MXAA 4JXFA 4U8ZA 1PXLA 5B2KA 2REIA 5CZHA 5BQ0A 1SZMA 3KXZA 3MTLA 3VS4A 2ZV8A 3C13A 2F4JA 4O21A 4TNDA 4NJDA 4HVHA 5M4IA 1LEWA 2I0YA 3QXOA 5LCKA 4FVRA 1OPJA 4X3FB 1ZMWA 2YCFA 3ZLYA 3BE2A 4R5SA 3R1SA 1GY3A 5DT3A 3UIBA 3ZS5A 5LOHA 4DHZA 4ZP5A 3BWJA 4D0XA 4YURA 1Y8YA 3GP0A 3VULA 1JAMA 4I5PA 3RPSA 5JKGA 2IN6A 4GIIA 3R28A 4G9CA 1XBAA 4C3RA 2XJ0A 5KHXA 3AXWA 3FXXA 4LL5A 4FZDB 4FSTA 3O50A 3PXKA 4K9YA 4USDA 3SX9A 2OJGA 3UP2A 3ML1A 1XH9A 1IA8A 3CD3A 5HE3A 2I1MA 1O6YA 4W4WA 1GAGA 1BKXA 3HYHA 2A27A 4C3PA 1OGYA 3R0TA 2WTKB 2B9JA 4W9XA 3UIMA 1P5EA 4RFMA 2XUUA 4JIKA 3DBCA 1OL2A 3V5PA 4BDCA 5KUPA 2WU6A 2ITVA 4FUYA 2XS0A 3AG9A 3QL8A 1ATPE 1OITA 3NUYA 2CCHA 4IAAA 4MWHA 4XYFA 4KAOA 3U51A 1XKKA 2OXYA 5AM6A 5C8MA 3IO7A 4N6ZA 4PPAA 4RIWA 3LXKA 4ACMA 3UG1A 4UZDA 4ZJVA 5IQBA 2QKWB 3KA0A 3PLSA 4M67A 3MA3A 1KE9A 2WMUA 4K6ZA 2ZJWA 1H0VA 3TNPC 3JYAA 4D2SA 2RFNA 2UW9A 3U55A 3ZFMA 4LV7A 4ZY6A 5DRBA 2WOUA 4AS0A 4RG0A 3ZYAA 1JNKA 2OH0E 2W4OA 3PSDA 2VWBA 2J7TA 4RQKA 3VNTA 4UMRA 3OEFX 3UDSA 4OR5A 2W5HA 5BVWA 5CNNA 5KKRB 4DDIA 4FIFA 2VTHA 2HY81 4GU6A 2H96A 5KBRA 4O0UA 4U42A 4UALA 1H1RA 3R9RA 1UA2A 5KZ0A 4BIEA 3FL4A 3OCTA 5G6VA 4YJSA 3E3BX 2CGXA 2QR8A 2G2HA 4FIJA 4FX3A 4JX3A 4NM3A 5AP5A 5I9ZA 3LFQA 3GCQA 3EQBA 4Y85A 3TT0A 3KRRA 1LEZA 5HG9A 1XMLA 3F3UA 4XRJA 5DT4A 4YTIA 4IB5A 3U6HA 3DBDA 5FDPA 2R0UA 3RPRA 3R63A 5FTGA 4XNEA 2IG7A 2JKKA 3EWHA 4G17A 1YXXA 2UW6A 3OCGA 4YO6A 2PZ5A 1U59A 1L8TA 4ZLYA 3BYVA 5BX0A 3G6HA 3UZPA 1OKWA 2Z2WA 1YOJA 4XUFA 1WBTA 4FOBA 3H30A 2C1AA 2J9MA 3CQUA 5E8VA 2YN8A 5FUTA 1JSTA 4IXPA 4QYFA 1YKRA 2RFDA 3V8SA 3E63A 4D0WA 3HEGA 3ZUVA 5FXRA 5ANKA 3F3VA 3WZEA 3K2LA 4CZYB 3RCDA 3UQGA 4KWPA 1NXKA 3D5VA 1ZZLA 2XMYA 4HZSA 3E8NA 2VWUA 2X0OA 2NRYA 4DTBA 3ORMA 3VWAA 3CE3A 3SOCA 4ZIMA 3DAJA 3U6JA 3HVCA 3QZFA 3O5AA 4CTBA 5AEPA 2V62A 4BCQA 2JKMA 3RHKA 4M68A 1FVTA 4UV0A 3DV3A 4O22A 2WQOA 2YM5A 1ZARA 4K33A 4EORA 4QNAA 3T3UA 3LMIA 3ZTXA 5J87A 4UN0C 1ZYCA 4M69A 3SQQA 4ASEA 4S33A 4ZAUA 2PVFA 3IONA 4KRDA 1E9HA 1UU3A 2BAQA 2ITUA 3RPYA 2PZIA 3R71A 5GINE 1OVEA 1I09A 3W0OA 1PMEA 3R8PA 4U44A 2C69A 4XX9A 5HO7A 2EXCX 4DHJA 1H27A 3WI6A 2OLCA 4EONA 4KBCA 4QYHA 2HIWA 2R3LA 4W8DA 1Y6AA 4Q9SA 2A4LA 2X9FA 3KRJA 2XIRA 1H26A 3Q53A 4GCJA 4MBJA 5JZJA 3BL7A 2YA9A 4IWOA 4BCGA 4AAYA 3MB6A 3DFCB 1NVRA 2XAOA 3DB8A 1P14A 3MI9A 3UOHA 1QPJA 2BAKA 3OBJA 2FSOX 2I40A 4LRKA 3GU6A 1ZYLA 3KF4A 5FD2A 3W10A 3VS5A 4QMQA 2PZRA 3WIKA 4KINA 2B9IA 4FEUA 4K1BA 5JRSA 4MVFA 3ZZEA 5J9YA 2UVYA 3HL7A 3HX4A 4ZOGA 3V04A 4AGUA 3ACKA 3OXTA 3BYUA 4IJ9A 3SW7A 3PE2A 4BCKA 4XOYA 4OTQA 4D2VA 4AN3A 3QF9A 5AP2A 3ORPA 3ZLWA 3UNZA 3ZOSA 3NX8A 3OY3A 4L3PA 4CEGA 4RVLA 5CYIA 3FKOA 4C2WA 2X0QA 4WG5A 5JGDA 3A8XA 3MYGA 4XBUA 3D5UA 5KCVA 3QCXA 5IPJA 1MRVA 1M14A 5KMJA 3K5UA 3ZM9A 2HZ4A 4AXCA 3V8TA 4PX6A 3I60A 2PVYA 4G3GA 4JNWA 3FMEA 4HGSA 4XLIA 2UW4A 1FGIA 2XIYA 4FK3A 3EN4A 2DQ7X 4OUCA 1ZY5A 2YEXA 5FQDC 3RM7A 4F70A 4RSSA 1OBGA 1KE7A 3DKFA 2W9ZB 2RGPA 4J52A 3PLAE 1NVQA 1W7HA 2AUHA 3QQGA 1FVVA 1QPDA 2OF2A 5FGKA 3IK3A 1OMWA 4O0YA 2VTOA 2YISA 4W4VA 3QUPA 1YOLA 2XCHA 3F2AA 4AZWA 3EFWA 4QTBA 3KMMA 3MPTA 5KHWA 3FLNC 1Y57A 5HG8A 4L52A 4YPSA 3GQLA 4ZTQA 5E1EA 5EDPA 4QMUA 2WEVA 4UWBA 2ITQA 4MH7A 1GZNA 4NKSA 4I1ZA 5GZ8A 1XO2B 1XBBA 3W0NA 4A06A 5HD7A 2IPXA 4DT9A 4C34A 2XNOA 4H3BA 4C4HA 3HV7A 5HBHA 4BZOA 1XQZA 3H0YA 2XKFA 4OT5A 4RWIA 5FLFA 1YVJA 1PMVA 3LLTA 5D10A 5IQEA 3HA6A 2J6MA 5AP3A 4BFMA 4E73A 2ZOQA 5ANDA 4BZDA 1J91A 3KB7A 5HG7A 3BGPA 3QU0A 2QO7A 3RVGA 5LVMA 4V01A 4D9TA 4B6LA 1M2QA 3HRCA 3NIZA 1IA9A 1J1BA 4IX5A 4MUQA 1OPLA 4AF3A 2F2CB 1U4DA 2VNWA 4HPUE 3ZO4A 5KMKA 4FKIA 4OTHA 2WTIA 3A60A 4AW2A 4ACGA 4DEEA 2WGJA 4OTPA 2PYWA 2JAMA 4NUSA 4PMSA 5AADA 3IW4A 5IH6A 2XK6A 5AV2A 4BWKA 2WEIA 5FRIA 3UDZA 5GNKA 4TY1A 3HA8A 2X4FA 3VVHA 3LXLA 3DLSA 3H3CA 4IAZA 2FH9A 3NYVA 3H9FA 3JXWA 2HWOA 5HG5A 4E4LA 4Q9ZA 3MW1A 5HNGA 4ASDA 5EKNA 5GZAA 4HGTA 2YDKA 2IVUA 1PMUA 3QD2B 1TFFA 4KD1A 1J3HA 4BGQA 5EDRA 4ZSJA 3FC2A 3GXLA 1ZWSA 5EKOA 5BYYA 3LM0A 3MIAA 2B4SB 3GB2A 3QA8A 1ZOHA 4LM5A 4F7JA 2VTRA 2VWIA 2VRXA 2YAKA 4TYGA 4FV3A 4CFVA 5I9XA 3ANQA 4JDJA 4AT5A 4I20A 4U45A 2ONLC 4FGBA 3RCJA 3BQRA 2YFXA 3PFYA 2GCDA 3TN8A 4BCMA 5ANOA 4I4FA 3QQKA 4Y5QA 4BKYA 4TWCA 4LMNA 3LKMA 2JFMA 2WQMA 3PXRA 3VS7A 2WMRA 2QU5A 4QQ5A 4MQ1A 4FKSA 4R7IA 3FMJA 5CXHA 3ZO2A 2HYYA 3I6WA 3O8PA 5JFVA 4JL9A 4F9BA 2F2UA 4P5ZA 4RWJA 4U40A 4ORKA 4KIQA 3CIKA 2VTAA 3MFSA 3OROA 2BPMA 2W7XA 2Z8CA 4NSTA 1UWHA 2C6LA 2WTKC 3F7ZA 4YC8A 5IF1A 4I6QA 1KV2A 1ERKA 2X6EA 3RGFA 3NWWA 1YWNA 2OZAB 4KIOA 4E3CA 5AR7A 3FPMA 3MV5A 3NSZA 1JSUA 4XG4A 4ZS4A 3TL8A 3KXXA 5FM2A 2UZUE 2IVVA 4KUJA 4K0YA 4ACHA 4DTKA 3QYZA 4K8AA 1J1CA 2IVSA 2C6TA 3KGAA 4IM2A 4FK6A 3ZSGA 1Q8ZA 1YRPA 3BGZA 4E5AX 5C26A 3FEGA 2VGOA 5DH3A 4CXAA 3NDMA 4UEUA 5ANIA 1WVWA 1YW2A 5C8NA 4V0GA 4QTDA 4BTFA 4YZMA 3CY2A 3REPA 2JIVA 4WUAA 2RG5A 4R78A 4U3YA 4GVJA 3FZPA 4BWPA 4CLJA 4AW0A 3FZSA 5FM3A 4XG7A 3DNDA 3POZA 1JSVA 4QTCA 3VUGA 4FJVA 4JS8A 1RE8A 2A2AA 4JRVA 5D9HA 1HOWA 2I6LA 4D9UA 3UNKA 2DS1A 4U6RA 3ACJA 1GIHA 3WE4A 3A7HA 3Q2JA 5FBNC 3S1HA 5JRQA 5EG3A 2PUNA 1ZMUA 3NYNA 3QUEA 4JG8A 4EWQA 2PU8A 4WSQA 5HIBA 3OFMA 4TRLA 3I5NA 3FKNA 3FI4A 5FXSA 1FOTA 3D2KA 3Q2MA 3ZCLA 3KVWA 1Q8UA 3U8WA 2ZMCA 3LXNA 4BB4A 1LPUA 5J5TA 4I6LA 4IAYA 2QHMA 2WD1A 4ANBA 4R3RA 5CT7A 3D83A 2XVDA 3ORNA 2B53A 2XP2A 4O0TA 5ANEA 4IACA 5DIAA 1PKGA 1RDQE 4B9DA 2WQBA 4O86A 5CAVA 4FMQA 3QZGA 4A9YA 4P5QA 5HVJA 3DPKA 3FLQA 4XEYA 4XJ0A 3EQHA 5DVRA 3TTIA 4C4EA 3OT3A 3BLHA 3IS5A 5HE0A 3CQWA 3FV8A 2Y6MA 4KIKA 4AE9A 5A46A 4U80A 4FIHA 4BC6A 2UZBA 3VS0A 3OTVA 3WILA 4QP2A 3PA4A 2P2IA 4OTGA 3ORKA 3GCUA 1O9UA 3LQ5A 2VZ6A 2Y9QA 3G6GA 3I79A 3IGGA 4PDSA 4V05A 4ZTSA 1CDKA 3U9CA 3VW6A 3EHAA 4P7EA 2IEWA 4ANQA 4BKJA 2AC3A 5DYJA 3PIZA 2PK9A 4YTHA 3CPCA 4OBOA 4U79A 5HKMA 4QDEA 5M4CA 3C51A 4R7BA 2YIRA 4DGOA 1VYWA 4EH9A 5C4LA 3A7JA 1BYGA 3EN6A 3R9HA 2BZKB 4C59A 2YITA 1KOBA 3UIUA 1OKYA 1A9UA 3R1NA 4EH6A 1QPCA 3QC9A 4E8AA 3I81A 3OHTA 4L42A 4J98A 3SXRA 4QOXA 4QYYA 3UOJA 1AQ1A 5LWMA 5HHWA 4L6QA 4ASXA 1YI6A 4DCAA 3Q52A 5GZ9A 5KNJA 4RIYB 2H9VA 4G2FA 1JPAA 2NPQA 1YXVA 4AQCA 1DI9A 4W4YA 2BTSA 2YDJA 4GUBA 4E6DA 3HMMA 3HAVA 5ETCA 4BCIA 5AR5A 5JGBA 5HX6A 4IVCA 2GHMA 3ZFXA 4MF0A 3ZBFA 4WUNA 4JX7A 4UWCA 5LMKC 2AEGA 3D94A 4BDIA 5IQDA 3H0ZA 4N57A 1K3AA 2XKCA 3ULIA 3VW8A 5M4UA 1H01A 3IQ7A 2C0TA 3MTFA 4FTTA 4JQEA 4NFNA 2HZNA 3BWFA 5M56A 4FZAB 4ZTHA 3F2NA 2C5YA 3FHIA 4Z9LA 2YIYA 2EVAA 2R3HA 3PP1A 4O1PA 4KKEA 4D4VA 4BCFA 4Q2AA 4O0VA 3KK8A 4JDIA 3Q60A 3CQEA 4FE2A 4TWPA 1XBCA 4O6EA 5LVPA 4OT6A 4Y46A 4C02A 5CF6A 5IDPA 5AR2A 1R0PA 1Q8WA 4MNEA 2BILB 1BL7A 2BFYA 3C4CA 5EM6A 4BY9E 3TUDA 4FZ7A 3A2CA 3RZFA 1GJOA 3PJ1A 3SDJA 3VBXA 2YZAA 5EYKA 3MS9A 2EB2A 5HGIA 3UMWA 4AFEA 4MD8E 4MXYA 4AG8A 3PVBA 2CPKE 1YHWA 2C6KA 3SKCA 1WAKA 3E92A 3FMKA 4FC0A 4I93A 3VBVA 3CTJA 4FUXA 4O7ZA 3O8UA 4NM7A 3C4XA 3VQUA 4I5CA 4B4LA 2J2IB 4IIRA 4WBBB 4ZSEA 2PVRA 2UZVA 4MQ2A 4ZXTA 5J8IA 4QP7A 5DG5A 4FNZA 4FTAA 3W8LA 5ETFA 5IA4A 3EKNA 4XV1A 4A7CA 5H8GA 4ACDA 2X8DA 3R8ZA 2PVJA 1SMHA 5CQUA 4R1YA 4WOVA 3O51A 1H1WA 4UWYA 2YM8A 3PSBA 3O96A 4PUZA 4I6FA 3HV3A 4ZJJA 4F99A 5F20A 1JWHA 3VHKA 5T6KA 3ZU7A 5K0XA 3M42A 4BCHA 1WBSA 2HAKA 4YZNA 4BRXA 4FKPA 4QRCA 3CJGA 1QPEA 3G5DA 1O6KA 2X2KA 2B54A 3TI1A 4IVAA 4F09A 4X2NA 3LHJA 2WHBA 4R3PA 5IA3A 3I6UA 4A9SA 2JBOA 2VNYA 3G0FA 3M2WA 3O71A 4G3EA 3V6SA 4EJNA 2CN8A 1OGUA 2FUMA 4FSUA 4EHGA 4FT9A 2R9SA 3LPBA 2VO3A 5A4QA 3AKLA 5ETIA 2OSCA 5IA5A 4FTMA 4LOQA 4NK9A 3DXPA 4XV2A 3R1QA 4PF4A 4EOJA 5KMMA 3QTWA 5CVGA 5LVNA 3UBDA 3KQ7A 4O7WA 2W05A 2OJIA 2JEDA 3PY0A 3PTGA 2ZVAA 4J1RA 3UC4A 4CV9A 4V0GB 4Z55A 4RBLA 3HMOA 3OUKA 2XK3A 4JLCA 4R6VA 4BDAA 4YMJA 4W9WA 4CT1A 1IAHA 2VTQA 5C01A 5FTOA 4DGNA 4GT4A 4KB8A 2OZOA 1Q99A 3N9XA 3FQSA 4GEOA 4Y83A 5C9CA 5CF8A 4YNEA 3T8OA 1UVRA 1Q61A 1TQPA 2V7OA 4K11A 4PL5A 4JMQA 4ALVA 5M09A 1CM8A 3EFKA 3GI3A 5E91A 2E9UA 3O17A 4OBPA 2ITNA 2VWYA 5GIPE 1MRUA 4NKAA 4X6RA 5EW9A 5HVKA 3NCGA 4TYEA 1IASA 4NCTC 5HE2A 4EI4A 4R77A 4DGGA 2YM7A 3V5WA 2J50A 4FSZA 2ETMA 2VWZA 3L8XA 4NIFA 5E8XA 3OOMA 4BTJA 1Q24A 4DA5A 4DG0E 4KS8A 2IZRA 4YSJA 3Q4ZA 4XV9A 5IA0A 3BIZA 3I0QA 4KKHA 3ZBXA 3P0MA 4OTWA 2HXQA 5I3OA 4LOPA 2X9EA 3COHA 1ZZ2A 2WMSA 3EQIA 4LGGA 4QMXA 4TWOA 3VQHA 3BQCA 3FMNA 3PP0A 5A3XA 4AT4A 4EZ5A 3Q6WA 3KRWA 2C30A 5K4IA 3ZZWA 2BZHB 3VS6A 4GYGA 5K5XA 3OVVA 4ACCA 5DEYA 4BYIA 3FY0A 4IM3A 2UZOA 4QMLA 2PMLX 2C3LA 3FLYA 4FV0A 3F61A 3C4FA 2ERZE 2VTIA 3QGYA 3WYXA 2XANA 3DGKA 3E62A 5CU2A 2GFCA 4F0FA 3UO5A 3LFAA 5HBEA 3EL7A 2UZDA 3WZJA 3KRLA 4BCNA 5K4JA 4R5YA 3GEQA 2C0OA 4NH1A 3TKHA 5GIOE 4L9IA 5AAFA 4I0RA 3T9TA 4KSQA 4ZSGA 4P90A 4IZAA 5FTQA 1SVHA 2FA2A 3G0EA 5IZFA 4APPA 3FQHA 1M17A 1KSWA 4CQGA 5BNJA 4Z7GA 3W0MA 5AUWA 2XB7A 3GT8A 2XYUA 2AYPA 5IUGA 4L7SA 4KS7A 2OXXA 3ZDIA 3BLRA 5HQ0A 3IOPA 3DBEA 4WNOA 4CCBA 4LGHA 3MB7A 3EYGA 3NR9A 4O91A 2NYAA 4EBWA 4QO9A 1Q4LA 2CGVA 3QKMA 4RQVA 5IEXA 2GQGA 4GH2A 3FWQA 4FSQA 2O8YA 3QTXA 4RIOA 4G6LA 3V8WA 5CSHA 5A9UA 1HCKA 2ESMA 3A61A 4GIHA 4O6LA 1UNLA 3BKBA 4LG4A 4N70A 2XBJA 3HP5A 2I7QA 3R7UA 3W0SA 4QMTA 5I9YA 2O5KA 4GKIA 5BV3A 2B52A 2UW3A 3C7QA 4IAFA 4A4OA 3KMUA 1PMNA 4D4SA 2A98A 3BU3A 2F7EE 1KV1A 3TIYA 3FAAA 2R5TA 4FTUA 1J7IA 1IEPA 3LM5A 4LUDA 4I6BA 2CKEA 4ENXA 4AN9A 2R7IA 2WOTA 1I44A 2Y4IB 4BYJA 4XRLA 4DTAA 2WFYA 3WYYA 1PXKA 4IZ7A 2ZFYA 3VUHA 4MK0A 4AOIA 3DT1A 4RGJA 4TN6A 4BDKA 3JVRA 1YXUA 4JJRA 4WT6A 4AOTA 3R21A 1P4OA 1JKTA 5CX9A 3QA0A 5LARA 4IFCA 4EOPA 4MX9A 4D2PA 1OECA 2J0JA 1F0QA 2WIHA 2OBJA 3BHUA 3LCDA 4USEA 2WTDA 3PJ2A 2FSMX 1XHAA 2B7AA 3GFEA 4X2KA 3EQDA 3SOAA 4M7IA 4GV1A 4MBLA 4YHFA 3VBTA 3ZHPC 3VRZA 5HE1A 2QOQA 2OJJA 2UZWE 4FEQA 2WTWA 4R8QA 5AJQA 3IG7A 4BF2A 2KULA 4L01A 4NTTA 3CD8A 4AZTA 4DN5A 5L2TA 4ZMEA 1L3RE 3LZBA 3RZBA 1ND4A 2PE1A 4GVAA 3DXNA 5M55A 4KKGA 2UUEA 3T3VA 3OCBA 3QFVA 2X8IA 5EI8A 4BCOA 1GZ8A 3EFJA 4USFA 3CGOA 3ODYX 3NUNA 2CGUA 3O8TA 4CSVA 4GFOA 4QPSA 3WIGA 4DC2A 4Z3VA 5IQAA 3MVLA 3DAEA 4AW5A 2ITPA 5E4HA 3R30A 3JY9A 5A54A 1H1SA 4F1MA 3ROYA 4J99A 3ZLSA 1RW8A 4QPMA 3V01A 3AQVA 3JVSA 4IB3A 4YHJA 3R7GA 5IH4A 4JQ7A 2YIWA 4HCVA 5F95A 3KREA 5F9EA 3ZFYA 3L9PA 3QHWA 3SAYA 1W0XC 2NRUA 1VR2A 3CC6A 4BICA 3ZC5A 4EJ7A 1YWRA 3H9RA 3VUDA 4L45A 5H8EA 2PY3A 3UO4A 3A8WA 3DKOA 4H3PA 4C36A 2ZB1A 3HRFA 3R9OA 2QG5A 1XWSA 5L8JA 3UOKA 2WAJA 3AD4A 3W0RA 2BZJA 5E92A 3PVUA 5EI2A 1LUFA 5L2WA 4YC6A 2WXVA 1Q41A 3DS6A 5AM7A 2C5OA 3B8QA 3L8SA 5B0XA 4QPAA 4EOMA 4ZZNA 3G15A 4IM0A 5K3YA 2OU7A 4CFUA 1DAWA 1QL6A 5IEVA 1A48A 3KF7A 5M08A 3RPOA 4F08A 3C4ZA 5JK3A 4DFUA 4MNFA 2XNNA 4NIFB 1E1VA 3SV0A 4JDKA 2IZSA 2B9HA 2YJRA 2YM3A 4CYIA 5CY3A 3VAPA 5HO6A 2WQNA 4DFNA 2DYLA 1H1PA 2R3RA 5AWMA 3GUBA 5ICPA 4BHNA 3K3IA 3OWPA 2Z7RA 3FLWA 1XH8A 1G3NA 3R7IA 4PRJA 1WFCA 4HYSA 4U0IA 4XHKB 4QTAA 3R9NA 1YOMA 1CKPA 3NW5A 2OK1A 5CEOA 4TYJA 4GMYA 2UZLA 3D7TA 4X2FA 3UIXA 3CY3A 3DJ7A 3OY1A 4S32A 3ITZA 4W4XA 3GC9A 5JSMA 4DHIB 1PF8A 3C1XA 4E6QA 3QTIA 2QHNA 3R7YA 3ZRLA 2ZV9A 2UV2A 2ITXA 4CRSA 4BI1A 2XJ2A 4E26A 2WMQA 4CKJA 5I4NA 4MXXA 1JKLA 2B9FA 4HOKA 4YGAA 5TR6A 3ZLXA 3PA5A 4PL4A 5DT0A 2JGZA 5AR4A 4E93A 4I0SA 4IB1A 4AZFA 1G8KA 5FEDA 3FJQE 2YZLA 3DAKA 3LCTA 2GS7A 3LIJA 4F78A 2PTKA 4J53A 3SHEA 3FI2A 2CJMA 2ACXA 4BVUA 1CMKE 3DK7A 3TIZA 4FTOA 3F3TA 3IKAA 4BBEA 3UQCA 5EHOA 3PRFA 4IAIA 2JFLA 2V7AA 4D5HA 4EK3A 4F9WA 5A14A 5AA8A 4QP1A 2QG7A 3RHXA 3GU7A 5HU3A 4YP8A 5FBOA 2OGVA 5EM5A 4WNMA 2YDIA 3W0PA 3BEGA 4LYNA 4EHVA 4MAOA 4XOZA 1G8AA 4GKHA 4NWMA 3NS9A 3QRIA 3FKLA 4FT3A 2WMBA 4XG6A 5F1ZA 2W06A 3ZUUA 5M51A 3P7CA 3QQLA 2RL5A 4BDGA 3DXQA 4ANLA 4WG4A 3E8DA 4C38A 4GS6A 1PYEA 2QOBA 3GBZA 4PMTA 2X2LA 4FTRA 2OH4A 3I5ZA 4GG5A 1W84A 1OIQA 4MHAA 1TKIA 3PVWA 4FG8A 4FI1A 3IDBA 2VTLA 3HDMA 2HCKA 3RBWA 5DHJA 2WTVA 3KCFA 3I7CA 4AFJA 2YM4A 3Q04A 2E9OA 4ERWA 1XH6A 5DMZA 1UU9A 1XR1A 3P08A 2R0IA 4FT5A 1H00A 2AC5A 4HNIA 3UOLA 2ETRA 4F6UA 4K18A 4EYJA 3PIYA 3BBWA 4MEDA 3VS1A 3RINA 4NTSA 5M57A 1U54A 4ITHA 2XK8A 3QYWA 4C2VA 2JDVA 4CD0A 1PYXA 4CFXA 2W0JA