4FUYA

Crystal structure of the erk2 complexed with ek2
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
329
Chain Sequence
PEMVVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKIDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ERK2 complexed with EK2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 105
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fuyA01
4G9CA 5HG8A 4JBVA 4D2RA 4DLJA 4MCVA 3VS5A 4DFNA 4XMOA 5KNJA 2Y8OA 4L01A 1LUFA 4J98A 4M66A 4TWNA 1QPJA 2PZPA 3EJ1A 4ZSGA 3FUPA 3UG1A 1IG1A 2XEYA 4HVIA 1O6KA 3PPKA 3TN8A 2QO2A 4I23A 2WXVA 2ZAZA 3R8MA 2VUWA 4CFNA 3RWPA 4WA9A 5KUPA 2X6EA 4O84A 1TQMA 3Q4UA 4A4XA 2E9PA 4HGLA 5AV3A 1DI8A 4D4VA 3KXMA 4MTAA 3NNUA 4UWCA 3KEXA 4Q5HA 1OIUA 4IB1A 1ZYDA 4PX6A 3TDWA 4DGGA 2VTPA 4QQ5A 4YPDA 2Z60A 2CLQA 5IUIA 3A61A 5AR3A 3C51A 3VHEA 5J5TA 1YDRE 3SA0A 2WTWA 4BDIA 4IM0A 4M84A 4KIKA 5HTCA 3UG2A 1YQJA 2GS6A 2PUIA 5CVHA 3LE6A 3RJCA 1K9AA 5IG1A 3P7BA 2V55A 4FKSA 3QWKA 4QP1A 3VVHA 2OF2A 3HV5A 3LXPA 2OFUA 5CASA 5FUTA 1YHWA 3R02A 5HICA 3CLYA 2GNJA 3CD8A 3PA4A 4MWIA 3SHEA 3V04A 5JFVA 4ZZMA 5HQ0A 2YWVA 4FK3A 3MFTA 3EL7A 5CEQA 4AA4A 4O7NA 4LYNA 3R9HA 4BGQA 2OJGA 4HYIA 3SV0A 3RMFA 4TW9A 1VR2A 3MFRA 4IX3A 2OG8A 3IDCA 2CGWA 3VIDA 2UVXA 3H4JA 1Q97A 2UVZA 2BAKA 5GIOE 4NTSA 4GYGA 3RNIA 2HOGA 4ERKA 1NXKA 2VGOA 2XNMA 4LOQA 4KSPA 4ANMA 3CTJA 4FKQA 1JLUE 4IX6A 4QMVA 4WSYA 4X3JA 3TWJA 4C4IA 4F09A 4K1BA 3TKIA 2JIIA 3PG1A 2OJFE 5AX3A 1BI7A 3QD0A 3R7UA 5AEPA 1ZOEA 3VWAA 1H0WA 1UA2A 2FSLX 3H10A 4K0YA 4U40A 5HG7A 3VW6A 1Q24A 4CKJA 4I6FA 3UQGA 3D83A 3LFQA 3PIZA 4FTJA 4OTHA 3TV4A 1LR4A 5CWZA 5TF9A 4JX7A 3GCQA 4FEVA 2C6OA 3D9VA 4FVQA 4FSNA 4APCA 3QWJA 2QHNA 4GUBA 4IZYA 1YI6A 2VTMA 2C6DA 3QYZA 3RBWA 4FEWA 3ZSHA 3F5UA 3FAAA 3NPCA 4WG4A 2AC5A 4JR3A 4XJ0A 4EORA 3V5LA 1KUTA 5EH0A 5DR6A 3WARA 2DQ7X 4WSQA 5F9EA 4PV0A 4ASDA 4OTWA 3ZDUA 3DXPA 4FL3A 5EQPA 3AT4A 3PXZA 3OW4A 3TV6A 4FSRA 1BL7A 4MXAA 4ZK5A 3RAIA 3PP0A 1YWRA 1ZLTA 5CLPA 5A4EA 1QMZA 3LJ2A 4XP3A 4YBKA 4AFJA 4DEEA 3V8TA 5AP1A 3ZM4A 3HA6A 5JH6A 2G2HA 4O6LA 2WEVA 2XRUA 4NWMA 4FTOA 3U4WA 5HIEA 3SGCA 4IJPA 2XNNA 5GZ8A 1REJA 3SG8A 4GU6A 1OL1A 2PVKA 3NUYA 3UYTA 4E6DA 3BQRA 4FTKA 2RG6A 2JAMA 3HRCA 3F2AA 3NEWA 5ETAA 3MFUA 3TJDA 4AU8A 4YJNA 3R7GA 1F3MC 2IVVA 4O1PA 4AE6A 4PWNA 1UKIA 4MKCA 4JQEA 2KULA 1OL5A 3OT8A 2FGIA 4U8ZA 4ARKA 4F7SA 2CCHA 4HCTA 2ZV2A 5LWNA 4Y83A 2VZ6A 5CT7A 4EH3A 5CSXA 3RCJA 5L2QA 4MQ1A 2QOFA 4FNWA 1RE8A 1FGIA 4L3PA 4MF1A 4YNOA 4RX5A 1PMNA 2HENA 3W32A 4HYUA 4KRCA 3QZFA 3RK7A 4RIXB 3FI3A 4YTHA 3EFKA 3VS1A 3ZSIA 4TY1A 2E9NA 1OUYA 5IQDA 2GQGA 2X9FA 5ACBC 3E62A 4YSJA 3KN6A 2P55A 4TYEA 3AD4A 3G9NA 4I6QA 5HNBA 4XOYA 4EH5A 3EQCA 2ITTA 5IQCA 3P0MA 2V22A 2YIYA 2GNFA 2BROA 1WFCA 3LCOA 3LFCA 3P79A 4B0GA 3CE3A 2BFXA 3CPCA 4ACDA 3HL7A 3P23A 3MIAA 4JLCA 3LMGA 4EJ7A 3QQHA 3UOHA 4YZCA 3MPAA 2OJIA 3OXZA 2QD9A 4W4XA 1KV2A 4IZAA 4BCPA 5HIBA 2UZWE 4TYHA 5EKOA 3PE1A 5JMSA 2QG5A 3Q6UA 4X3FB 3PXFA 5LMKA 3TUCA 2VWUA 3R8VA 2YCFA 1YOJA 2R64A 1XH8A 3G6GA 4EC8A 2HYYA 5JZNA 4AW2A 5CAUA 4W9XA 4RX9A 4F64A 2WMTA 4FOBA 1G8SA 3IK3A 3PPJA 4XV3A 4QMXA 1H1SA 2OLCA 1I09A 4D9UA 2IPXA 3A99A 4HYHA 4YJQA 3Q32A 2VNWA 4M0YA 3S3IA 4I5PA 3NMUF 3AC4A 4UMPA 5JT2A 4PY1A 3HX4A 4OTIA 4F6WA 4XV2A 4I1ZA 4RIYB 4XG6A 5AAGA 3FLYA 3LFFA 4FK6A 5HVJA 4G1WA 3G51A 5DHJA 1Z57A 2BRGA 3RNYA 1MUOA 2EB2A 5HG9A 4E6AA 4I4EA 3OCTA 4M0ZA 4KINA 5AV2A 4IAZA 2O5KA 3CJGA 4KIOA 5IF1A 4JBQA 4O7YA 1SVHA 2B0QA 5IU2A 4TTHB 4OBPA 4EK5A 3BU6A 3BEGA 2HZIA 2X9EA 4KSQA 2UZDA 4X0MA 2VWWA 4HNFA 3HDNA 3VF9A 4BR3A 2DUVA 3ODYX 2BZIB 1PW2A 3I6WA 2F7XE 2HW7A 1ZOHA 2OF4A 3C4WA 3HDMA 5IQAA 3BIZA 3D94A 3VRZA 5M56A 4JVGA 4MXXA 3VW8A 4KIPA 3L9LA 2QVSE 4IAYA 4LL5A 2UW0A 4FEXA 3MH1A 4YLJA 1OZ1A 5DWRA 3DBDA 3I7CA 2QOHA 2F4JA 4FKRA 4NCTA 3W8QA 4CMTA 2YACA 3B2WA 5K3YA 3KU2A 2YLFA 2VX1A 3G0EA 4P7EA 5H2UA 3S0OA 4C3FA 1J1BA 1U4DA 4KA3A 4ZLYA 5A46A 4FVRA 3PXQA 4XBUA 4EEVA 1OL6A 3LCKA 3GGFA 3LLTA 4O7SA 5EHYA 4W4VA 2R4BA 2C1AA 2H96A 4NW5A 1UWHA 4LM5A 4BN1A 2VTIA 4Q5EA 5DH3A 3W55A 4FSMA 4E4NA 4XG8A 3JY0A 4RFYA 3BLHA 4NM7A 5BYZA 4PDSA 4UYAA 1JKKA 3NZ0A 5HCZA 1B6CB 2W1GA 4O22A 3TT0A 3RP9A 1FMKA 2W1DA 2R2PA 2VTHA 4IFCA 5AP4A 1Y57A 4QO9A 4RFZA 4U79A 4CQGA 4LGHA 4BDCA 4E5BA 4RA4A 4EBWA 2YIWA 4DG3E 5HU3A 2NRUA 5HX6A 2W06A 5CTPA 4FKGA 4FT0A 4BDBA 4PNIA 4AT4A 3TNWA 3IW5A 4WUNA 5CU2A 1Z9XA 5EQYA 4IDTA 4PMMA 4UN0C 5M44A 4BB4A 3LMIA 2OZAA 2UW8A 3RCDA 3KRJA 3NVMB 3RPVA 5ETIA 2QOQA 4H58A 4U7ZA 2QLQA 5E8VA 3K54A 4G2FA 4MXCA 4DFXE 4KRDA 3NUUA 3FDNA 4I93A 2PYWA 3EYHA 1W98A 5G6VA 3QRIA 3DK7A 3BQCA 4RIYA 4I92A 1XWSA 3KXNA 4FT3A 4RJ8A 3L1SA 3SRVB 3UOJA 3P1AA 3EL8A 3OWJA 4TL0A 2XK4A 3MY1A 4GCJA 3ZBXA 5E92A 4FV1A 4BBMA 1PXPA 4QMMA 5IA0A 2C5YA 4H39A 1JKLA 2CGUA 2OXDA 3AT2A 3MY5A 5ANDA 4F7NA 1WBVA 4FIFA 3KXZA 4JS8A 2WTJA 2YZLA 3FYKX 3RWQA 4NM5A 2BZKB 3R63A 1YHSA 2X1NA 3PTGA 2QO9A 5AFVA 1U59A 3WYXA 3UZTA 1ZMVA 2BALA 5E8ZA 3C50A 2G9XA 2OH0E 2QOIA 2ZV9A 3HUCA 4ACHA 1R1WA 3N9XA 3D5XA 3JVSA 2VWIA 1UVRA 2YFXA 3CTQA 5DLSA 3UQCA 2ETMA 5LMAA 3HMIA 4AUAA 4MXOA 2VN9A 4MVFA 3F7WA 5GHVA 5HE2A 4MEDA 4EWQA 4FV9A 3COIA 2RIOA 4U3ZA 3A7HA 2ZV7A 1M2PA 4TYHB 5L6WL 5AR2A 5M09A 2HAKA 2UZUE 3A62A 2E2BA 2OJJA 1Q5KA 3T9TA 1Q8YA 2C30A 2JC6A 4FMQA 3RK9A 1CSNA 3ZLWA 3OWLA 5ANGA 4KBCA 5AR4A 4BHNA 3EH9A 2PVYA 3PSDA 4MWHA 3ORMA 3D2IA 4PDPA 5A4LA 4O81A 2ZB0A 2GHGA 3F5GA 4J8NA 4CCBA 4O0XA 1VZOA 3M2WA 4JDJA 4FGBA 3UIUA 1JSUA 5DPVA 4MHAA 4GKHA 3Q9ZA 5ACKA 2H8HA 3FE3A 2B1PA 3LFEA 4ZSEA 2GNHA 3FXXA 4JR7A 5FTQA 2OICA 4C02A 5AAFA 2AUHA 3OUKA 4AX8A 4V01A 4XV9A 4MK0A 2UUEA 4FKUA 4N4SA 5ANKA 3V51A 2R3HA 2W7XA 3OVVA 4QD6A 4W9WA 3D7TB 3ZDIA 5FTOA 2YM8A 4OR5A 5HESA 2W5AA 3W2OA 3IW6A 2W99B 4K8AA 5EI6A 1QL6A 3A8WA 2X0GA 4MBJA 2YM5A 3VS6A 3A60A 4J96A 5A9UA 4FIEA 3U54A 1YHVA 4GS6A 3JYAA 3D5VA 1FPUA 3NNXA 4L52A 4RLKA 1PF8A 2CN5A 2ITUA 4EH2A 2WPAA 4GT5A 2HCKA 4YZDA 4CTBA 1OITA 2IO6A 2IVSA 4M15A 5CAPA 2ITPA 2Y4IC 2ZDTA 4J53A 4YO4A 1E9HA 2YDIA 5IA3A 1YDSE 5CU3A 4IXPA 4EH8A 2IN6A 3GB2A 3HMNA 4O0UA 2OGVA 4AP7A 3V5TA 3D7ZA 3OEFX 4FZFB 3G33A 3K3IA 3Q60A 4TPTA 4AGCA 4CV8A 4YSMA 3HYHA 2BR1A 4ZMEA 3VJNA 1OKWA 3AMYA 3CIKA 3LCTA 2VTRA 3BHHA 4QPAA 4ZEGA 4RA5A 2EXMA 3EN5A 2B52A 2YERA 1W84A 4E93A 3RPYA 4KAOA 4A9SA 3EZRA 4CTCA 2CPKE 5C4KA 3TZ9A 4V0GA 4JNWA 1Y91A 2Z8CA 4NUSA 5FXSA 2C6MA 1GY3A 4V0GB 5GZ9A 5KE0A 3I5NA 4QP8A 3R7IA 4D58A 4F9BA 4FG9A 1H1RA 4O96A 3D5UA 1UU3A 2J6MA 3KXXA 3EN4A 3QUDA 4J7BA 4ENXA 4S2ZA 2OSCA 3IOPA 4GJ3A 1OVEA 4ERWA 4IBMA 2NO3A 3LFDA 2GU8A 3W18A 5I9XA 2GQSA 5IQIA 3F9NA 3MS9A 3II5A 4CKRA 3FC2A 5DIAA 3RM6A 3DA6A 4QP3A 4XOZA 4C2WA 3QXOA 3QCXA 3ORIA 3DPKA 3E7OA 2G01A 1TKIA 5IA2A 2WMWA 4IVBA 3ZOSA 2VTAA 2C0OA 3SC1A 3UMXA 3THBA 3OT3A 3BE9A 5FWKK 3QTWA 4O21A 5AP3A 4ACCA 4D5HA 4DEAA 5LXMA 3QCQA 4YU2A 4F6SA 3BV2A 5AUTA 2I1MA 2YABA 5J1VA 2Y4IB 4D1ZA 2YCSA 3LZBA 3BV3A 3MWUA 4Y46A 3UPXA 5C9CA 5HCXA 1GAGA 2ZM3A 4FV8A 4O38A 3VS2A 4RMZA 1REKA 4I24A 2O3PA 4NJDA 4WG3A 3R7YA 5DN3A 1JQHA 3HNGA 3F2RA 2C5XA 2WTDA 5I0BA 2HXQA 3ZUVA 1SMHA 5GJGA 3AC8A 5GJFA 4O27B 5EW9A 4LUEA 4BL1A 3TZMA 3R8LA 3QGWA 3DZQA 4UALA 4LQMA 5CZIA 3D2KA 4CG9A 3BX5A 4GG5A 4DAWA 1FVVA 2RKUA 3GFWA 3QZGA 2X2MA 3FEGA 3NCZA 2OXXA 4FTIA 4X7QA 4EH9A 3MW1A 2R7BA 5HIDA 4JDKA 5BUEA 3U8WA 1AD5A 4O0VA 4ZZNA 4UBAA 3BHUA 4C8BA 4A4OA 4DEBA 4NKSA 2Y7JA 1Y8YA 4KKEA 3ZMMA 3G15A 2BZHB 2ITWA 1U46A 4E6QA 2VTTA 4LRKA 5AA9A 5H8EA 4CZUA 4JBOA 2X2KA 4XBRA 1GZOA 1SVGA 4MBLA 3AT3A 3C4CA 2W1IA 3DTCA 5D7VA 4ZTHA 2JLDA 5JEBA 2JDTA 3EKKA 3P7AA 1R0EA 2WZJA 3MSSA 3WE4A 4HW7A 2BAQA 5ANIA 3FV8A 3R71A 3BBTB 4GVAA 4DFYA 4OAUC 4FZ7A 5BMSA 1KE7A 4IB0A 4EQCA 2BTRA 5L8JA 5LMKC 2W1EA 1XBBA 1OMWA 2YITA 3FPQA 3S1HA 3HMPA 3KMWA 4HZSA 4L42A 4UV0A 1YI4A 5BVFA 4G5JA 4QYYA 2XK9A 4G6LA 4F65A 4FT7A 3DQWA 3ORKA 3ERKA 2BIYA 4JAIA 3S4QA 3TTIA 2WD1A 1IASA 4FBXA 3GXLA 4HCVA 4M8TA 3U6HA 3OW3A 3NGAA 4JAJA 4S31A 4TXCA 4QMQA 3H9RA 2XF0A 3BRBA 4CFXA 4FICA 5BYYA 4GT3A 3TJCA 2JAVA 3PYYA 3OWPA 1IA9A 2F7EE 2WQNA 2CN8A 3FQEA 3MN3A 2GNGA 4YJSA 3RZBA 3ZU7A 4C62A 4O7WA 4NJ3A 2PL0A 4I5CA 5HD7A 2C68A 3B2TA 3IO7A 1FQ1B 5CEPA 2PVLA 2VTJA 1YXTA 4DN5A 5AA8A 2ITYA 1OPLA 3PVWA 2JFMA 4FIJA 5EDQA 5HVYA 2PE1A 5EHLA 3A7IA 3NDMA 3OXTA 5AMNA 3UVQA 4EH7A 4AGDA 5J5SA 4BCGA 3BE2A 5AUYA 4HGTA 4IM2A 2F2CB 2WNTA 2O65A 4RWLA 3E7VA 4CV9A 5BVEA 2X81A 3AG9A 4NFNA 3CC6A 3EQFA 4PP9A 4D1XA 4BTKA 4KWPA 3IW7A 4C34A 5IUGA 4DLIA 2YDKA 5LVNA 1VYWA 1G5SA 3ORTA 2XMYA 4BDFA 4S32A 3NS9A 4RC2A 2PE0A 1V0BA 1OKYA 2JIVA 2PWLA 3JPVA 1Q3DA 4I0RA 4YC3A 4O7ZA 2HELA 4C7TA 2UW7A 3L8VA 1G3NA 3Q2MA 3HVCA 5DOSA 3W1FA 5DEYA 3HLLA 4FG8A 4FR4A 4FODA 2OIBA 5DT0A 4JQ7A 5LCKA 4X3FA 4E4LA 3FKNA 2J50A 1YXSA 2GFSA 4R1YA 2XBJA 5AP2A 5A54A 1ND4A 4QMZA 3WZUA 3AQVA 5AIKA 3LJ0A 3TNIA 3FMLA 1ZWSA 2Z2WA 4C4JA 3TKUA 5CEOA 4IM3A 3UZRA 4BWKA 1LP4A 2BDFA 1XH4A 4QPMA 4DFLA 1LEZA 5EDPA 4FTUA 4O86A 3RM7A 2Z7LA 4UMUA 4PMSA 5T68A 1E1XA 3HRFA 3LLAA 4FSWA 1NVQA 4BCFA 2IJMA 3FZPA 4ZZOA 4YP8A 3V5JA 4AN9A 1PYEA 4W8EA 4OLIA 1ZRZA 3OCBA 4FTLA 3TUDA 1YDTE 3N4UA 2JDRA 2C5VA 2QCSA 3EN7A 3TTJA 1BLXA 3EQIA 5D11A 3UC4A 4KBAA 4FIHA 4ACMA 4PRJA 5E8YA 4FTQA 3HKOA 4BDJA 4PTCA 4L45A 5HOAA 1H0VA 3OHTA 1WBWA 4H36A 4N6YA 5B0XA 4B99A 1T45A 5CYIA 3RTPA 4FKJA 3SVVA 4L3LA 3AC5A 4AOJA 1P5EA 3CPBA 3QQJA 3R1YA 3ZZEA 4FYOA 4ACGA 4BBEA 4IB5A 3MVHA 3ALNA 3H30A 3OZ6A 5KKRC 1RJBA 3UOKA 3E87A 3T3VA 4R3RA 3RPOA 1XR1A 2ITVA 3VAPA 4ALWA 3WF6A 5M4CA 3ZRLA 4A06A 3FMJA 2WO6A 3F2NA 5L6OA 5AV1A 4B6LA 3UMWA 2Z02A 3NRMA 5EYDA 3SKCA 4S30A 4C61A 1QPEA 2C69A 4QMLA 2BRBA 3RINA 5HBHA 3GC9A 4YUQA 3F69A 4L8MA 2JDOA 3KQ7A 5E4HA 3GCPA 1OBDA 3JUHA 1MRUA 1JSTA 2ZYBA 3GU7A 3VF8A 5ANJA 1DAYA 5AV4A 4EH4A 5AR5A 4B9DA 2Q0NA 3R83A 3I79A 3DLZA 4YPSA 2BTSA 4I20A 4BZDA 3QQUA 3LHJA 5M53A 5CVGA 4AF3A 5CXZA 3UBDA 4O7TA 5M57A 2GHMA 1U54B 4FTCA 3VUGA 3OEZA 4D55A 4AT3A 1FINA 2A19B 3LIJA 2BKZA 3KRWA 4FF8A 5ANEA 4EHZA 4MAOA 4P2KA 4G3DA 3QU0A 3I0OA 4FC0A 3ZUTA 3DU8A 3QRUA 4CZYB 4GU9A 4QMTA 3F3ZA 2EXEA 4X2JA 3BYMA 4P4CA 3TIZA 2WTIA 3L8SA 3LXNA 2F2UA 4WNKA 5CXHA 4YHJA 3PIYA 4EONA 4PP7A 4DHFA 4L3JA 1JKSA 1SNXA 3PWYA 2GDOA 4JBPA 4ZTRA 2ZMDA 3TM0A 5E8XA 4Y85A 2B4SB 3BU3A 4O82A 5EM6A 4X2KA 5LARA 2OU7A 4AA0A 4O91A 3D15A 3FZSA 1GJOA 4C58A 4YMJA 5FG8A 3O17A 3OF0A 5CEKA 4XP0A 2E9VA 5L2SA 1AGWA 5CEIA 3WI6A 1PY5A 1S9JA 1UNGA 2R3PA 1XBAA 2BHEA 2FB8A 2XIXA 4GK3A 4IAFA 4EOLA 5BVWA 4O7VA 3FKOA 4QYHA 2DWBA 4PL5A 2GFCA 4ZY6A 2JGZA 2YCQA 3QCSA 3VBQA 5TKDA 5L8KA 4WNPA 5E8UA 3ACJA 2JITA 3ZLSA 3HP2A 3G2FA 4FNYA 4EK6A 2XIZA 5E9EA 3DAJA 5F20A 4P5ZA 2R3OA 2YN8A 3A7FA 3FZOA 2YJRA 4C4EA 4FKLA 4EOJA 2OIQA 3MB7A 3FWQA 3OCGA 2OW3A 4YJUA 1GNGA 5F4NA 5A4TA 5HNIX 4DG2E 2FVDA 2WOTA 4BYIA 4D2PA 1ZZ2A 4YR8A 4RQKA 2XYNA 2ITNA 4XP2A 4AAAA 4MD8E 3SXSA 3ZXZA 5IQHA 3D5WA 5GINE 2QLUA 3AMAA 5AUZA 3CXWA 5I9UA 3GOKA 4MQ2A 4I22A 5AP7A 3ZBFA 2J9MA 2I0EA 4LFIA 5K0KA 3WF5A 5HKMA 3BWJA 4EK3A 4L00A 2XCKA 4IZ5A 2ZJWA 3OTVA 2QKWB 2VU3A 3SRVA 1OPJA 3BYOA 2QKRA 4AGWA 4DGLC 2QI8A 3VUMA 4F9CA 4BCHA 5M4FA 1DI9A 5CSWA 4Q9SA 3FSFA 3GC8A 2XKEA 2XJ0A 3KVWA 3OWKA 5DEWA 3GU8A 3DXNA 1ZY4A 3I6UA 2PSQA 1CMKE 3P08A 4NU1A 4BKJA 4DT8A 3IKAA 1DS5A 2KTYA 3O8PA 3Q5ZA 4TYIA 3QZHA 3ACKA 3DGKA 3HECA 2PZ5A 1CKPA 3NWWA 4J95A 4CSVA 4FZDB 5DE2A 4BTJA 5KMMA 2VWBA 2FYSA 3KFAA 2XUUA 2G15A 2BDJA 5DI1A 4ZJJA 3SG9A 3MVLA 3CEKA 1O9UA 4EQUA 4KIQA 4DEDA 2OBJA 4QTEA 2IWIA 2X7GA 4ZTSA 1V0OA 2H6DA 3V6SA 3AC3A 4XRJA 5I5ZA 1ZYCA 1H26A 2ESMA 2OH4A 3EQRA 2JBOA 2VD5A 4Z3VA 1YXUA 4KS8A 3H0ZA 3KCFA 5CALA 2RFNA 4BCJA 1BL6A 3Q96A 5IPJA 4OTDA 2UZEA 3F82A 4X3FC 3KB7A 3SD0A 2IZTA 4XG9A 4CG8A 4GFMA 1WCCA 4JQ8A 4K77A 4M67A 2YM7A 5DA3A 3ORXA 1IA8A 4GMYA 3GU6A 4BWPA 2ERKA 1KE8A 2HY0A 4I21A 2WB8A 2IG7A 3MYGA 1OIQA 5A4QA 3HGKA 4O0RA 5DRBA 2IZRA 3W2RA 2VTSA 4LMNA 4QOXA 3ORNA 3MB6A 2R3JA 2XNBA 1PMEA 4IAKA 3E88A 3DFAA 2V5QA 3KRXA 5AP5A 5HEZA 4E7WA 4K9YA 3QA0A 3O51A 3AOXA 4ASZA 2QO7A 5HX8A 3FY2A 3KK8A 2CMWA 4ZTLA 1RQQA 3IG7A 4D5KA 3PZEA 4EZ7A 3ZFMA 2WIHA 3GUBA 3C0IA 4F7LA 4DBXA 2PE2A 4NK9A 2JDVA 3LCSA 4FSYA 4Z7HA 2BCJA 3FL4A 4YC8A 4CT2A 1A9UA 4FE2A 1PXLA 4GSBA 4ZJIA 3M1SA 3V5WA 4R3CA 3R7VA 2QURA 3LM5A 1OUKA 1XH9A 2ONLA 4YJOA 4EZ3A 5DYJA 5J9YA 5CY3A 3EIDA 3QRTA 2PMLX 3WBLA 2Y4PA 4EZ5A 2XIKA 3R04A 5FBOA 4DH7A 3O71A 2UVYA 5K9IA 3SAYA 3CBLA 3F3UA 1URWA 3WIKA 1ZARA 2BRNA 5BVDA 4QT1A 3UP2A 4G6OA 2WFYA 2A2AA 4EI4A 4QP9A 3BGZA 4QYFA 3W2PA 4ANLA 3H3CA 4EHGA 3A7GA 5HCYA 4FOCA 5FGKA 2XK3A 4XLVA 3PDTA 5DG5A 5JRSA 3GC7A 3VJOA 2XJ1A 3DZOA 5I4NA 3ID6C 3ANQA 4WBOA 5DR9A 3EZVA 4OBQA 3PG3A 3UO4A 5J8IA 3WF9A 4DGMA 2YAKA 4U44A 4CQEA 3PJ2A 4DH5A 2W1ZA 5J79A 2PTKA 5HLPA 1O6YA 2XM9A 4DTAA 4B8MA 1F0QA 1SNUA 2P2HA 1J1CA 2I40A 5DBXA 5CAOA 2IVTA 3UTOA 2R0UA 3S95A 2J5FA 4RIXA 3CGOA 3TEIA 3UDBA 3U51A 4H1MA 3HMOA 4C0TA 1PRYA 2XVDA 4ZTQA 3EQGA 4YZMA 2QONA 4B4LA 4RBLA 4QQJA 4YJRA 5CU4A 3P4KA 4CLIA 3DBCA 3AGMA 3BZ3A 4N57A 4EOSA 3AMBA 3ULZA 3ZEWA 3TG1A 3KRRA 4YTCA 3DY7A 2J0JA 3GP0A 5TR6A 5KO1A 2ZM4A 3TL8A 1T46A 1UV5A 3SXFA 3QQKA 3R30A 4U6RA 1GIJA 5CAQA 3NVKI 4GT4A 3ZO3A 5KZ0A 4USEA 4F4PA 2XYUA 4ITHA 4GIIA 4RIOA 3FL5A 2I7QA 3FHRA 3NIEA 4DCEA 5FXQA 3L8XA 4BI2A 3QZIA 4AGUA 4K33A 3WZJA 3QX4A 3DK3A 4C4GA 3LCDA 4C2VA 4PDOA 3CTHA 4G5PA 3HUBA 3R6XA 3DV3A 4CKIA 4DINA 4UX9A 1PKGA 5DNRA 2WIPA 3VO3A 4BHZA 4LRMA 3QLFA 1A48A 1H08A 2GS7A 5FDXA 4BWXA 2R3KA 3W8LA 5M06A 3BWFA 4IE9A 3NR9A 1ZYSA 4BFMA 4OT6A 4R1VA 3FMEA 3WF8A 3DLSA 5HO6A 2F9GA 1HCKA 3C4ZA 5FM3A 4FNZA 4XCUA 4PNKA 1XQZA 4D0XA 3EN9A 1ZXEA 4E5WA 5H3QA 5ICPA 3DB6A 5K5XA 3UP7A 2GNLA 3I81A 2C47A 3QAME 1WVYA 3DKCA 3PVBA 3RPSA 3ZFXA 5CU0A 5B2KA 1JVPP 4NH1A 1DAWA 5CANA 4WNOA 3H9OA 3QBNA 1BKXA 4IWDA 2GNIA 3PRIA 3ATTA 5LMBA 1Y8GA 5A4CA 5AADA 1L8TA 2CNQA 3R9RA 4KKGA 3ZC5A 4BZOA 4CFMA 5CENA 4L53A 4BDDA 3ZFYA 4BY9E 1IAJA 4JXFA 4AZWA 4BCIA 4C4HA 1J3HA 4C59A 4EWHA 5HLWA 4XV1A 2IZUA 3MV5A 4FKOA 5J7HA 3G9LX 2WELA 3PSBA 1JSVA 3WZEA 3P5KA 4TT7A 4UYNA 1M17A 4ZTNA 3DDQA 2HXLA 3VUIA 2OO8X 2VX3A 2OXYA 2CSNA 3AD6A 1Q61A 2WGJA 3DAEA 5EM5A 4EUTA 4DEIA 2QG7A 4IMYA 2WQMA 4P5QA 2EB3A 1R0PA 3EQDA 4FT5A 4AQCA 4GJ2A 4H05A 2CNVA 3HV3A 3F3VA 3KXGA 3PJ8A 3DT1A 3MTFA 4AA5A 4CXAA 4S34A 3PJ1A 4G3CA 4PL3A 4CFUA 1CDKA 3E93A 3ITZA 4A7CA 3CJFA 4D28A 4QP4A 3O50A 4RVTA 5FP5A 5FEDA 1UU9A 3GCVA 2XIYA 3D0EA 3PVGA 4R78A 4FNXA 3H0YA 5HTIA 3HEGA 3MPMA 5AUUA 3OOMA 2OIDA 3NUXA 4IC7A 4AOIA 1OI9A 2WU6A 1H1WA 5M4IA 1PXJA 1K3AA 1WVWA 3DJ6A 3I1AA 4EL9A 4OAVB 1GIIA 4ZS0A 3R2BA 4MBIA 4L68A 4C4FA 4EOKA 1M2QA 2VGPA 4WG5A 5D1JA 3VRYA 1I44A 2W1FA 4I5HA 3LFSA 3CP9A 2XKCA 2AYPA 2BDWA 3BLRA 3ETAA 3PE2A 4S33A 2PZRA 4RVKA 1PMUA 3LFAA 3VC4A 5JFSA 3QC4A 3QLGA 4FTAA 3HV7A 4DEHA 3LM0A 5ITAA 2OZOA 4RC4A 3UJGA 3FC1X 4CRLA 4DFZE 4E8AA 4FGRA 1XBCA 2HY81 4AZSA 3UQFA 3Q4ZA 3EQHA 5J7BA 3VQUA 2V0DA 4FUYA 5A14A 3SQQA 5BPYA 4L46A 4J1RA 4JRVA 4UB7A 1NW1A 4PPBA 4V05A 3DK6A 3U87A 5HO7A 5CAVA 3EB0A 4QQCA 1AQ1A 5BUIA 4G3FA 5E91A 2QR7A 2BUJA 2UZNA 5BNJA 4D9TA 3F5PA 4BCNA 3IDBA 1JAMA 4RJ3A 5CSHA 3VUHA 4I3ZA 4CNHA 3FZ1A 4XS2A 2BZJA 3KVXA 2WMUA 1M7NA 5JGAA 4LOOA 4DH8A 3PXKA 1NVSA 1L3RE 1ZYLA 3KCKA 3M11A 4AZTA 4D2SA 2C3IB 1WBNA 3RVGA 3UIMA 5EFQA 2X39A 3FXZA 4E4MA 1WMKA 4N70A 3RAHA 1WBTA 1Y6BA 2FSOX 2RGPA 4FUXA 3I0QA 4YBJA 3AGLA 2YWPA 2CJMA 3P9JA 4L7SA 2HW6A 4U41A 4EOPA 1H27A 2VO7A 3HP5A 4IB3A 5I9ZA 3W16A 3FY0A 4YHTA 4DFUA 3R1QA 3DDPA 3MGYA 4IHPA 4BDHA 4ZLOA 4CD0A 3CSVA 4ALVA 3MI9A 5TE0A 3DKOA 1FMOE 2WMXA 1OL7A 3PSCA 3ZO1A 4FA2A 4C57A 2C1BA 2P33A 3MDYA 2J0KA 2RF9A 1H8FA 2O8YA 2XCHA 4BI1A 2WHBA 5FRIA 1XHAA 4F1TA 2JBPA 1W7HA 1JBPE 4PDYA 3CKXA 4L7FA 4GH2A 2W4OA 4EYJA 2EUFB 3NX8A 4MXZA 3NUAA 5IEXA 2J4ZA 4ZOGA 4YJPA 5EI8A 4ZY5A 3EFWA 3RHKA 3SW7A 2I0YA 1BX6A 4H3PA 4O0TA 3HZTA 3OBJA 5IZFA 3CKWA 4BDAA 2GHLA 5JKGA 3PPZA 5AP6A 4M69A 4MNFA 2C5NA 3FMHA 5TO8A 4F70A 4O1OA 2VV9A 2ACXA 2YA9A 3PZHA 3SOAA 5KX8A 3UO6A 3IECA 4LRJA 1Q3WA 4RX8A 1H4LA 5EYMA 4BCMA 3W2CA 3FJQE 2C6LA 3U9CA 4FL1A 3A8XA 4XUFA 4D2WA 3C4XA 3PY3A 3Q2JA 3MA6A 2F57A 2NPQA 1JPAA 3QX2A 3Q52A 2W9FB 4G34A 3SW4A 4G3GA 4G17A 4BKYA 3DOGA 3FI8A 3V8WA 4FV7A 3FLNC 4G6NA 2VWZA 4R6VA 2FUMA 2R3RA 3MJ1A 3POZA 3V01A 4L44A 3WZDA 4IEBA 1E1VA 3E3BX 3R9OA 3SLSA 1GIHA 3OD6X 2JFLA 3R28A 2X8IA 3GFEA 4HYSA 2BAJA 4BCKA 4ZY4A 4TN6A 3I4BA 3IOKA 4PF4A 1WZYA 4BYJA 3QTUA 3EFJA 4JDIA 3D7TA 1U5QA 3C4FA 4N6ZA 3UIBA 4BF2A 3BHVA 3ZRMA 3PY1A 2LGCA 3CY2A 4PTEA 5JZJA 4DGOA 5ETCA 5EYKA 4G3EA 4XG2A 5AUWA 1R39A 2FH9A 3Q4CA 5EW8A 1YXXA 3F5XA 1UWJA 5A6NA 5IA1A 2GQRA 5CNOA 4MD9E 3A7JA 1TVOA 4ITJA 1Q8UA 3TKHA 5IA4A 4GUEA 4EOQA 4BKZA 1BMKA 2B53A 2H9VA 3CR0A 3DB8A 2I6LA 2JKQA 2F7ZE 3Q53A 4GK2A 5C8MA 3W2QA 5GIPE 4L67A 5FLFA 2B9FA 3PFQA 5LVMA 4LL0A 4NFMA 4U81A 5D9HA 4CVAA 4BVUA 2WQBA 4M14A 4DT9A 1RDQE 2HK5A 3DXQA 1OECA 5G1XA 2R0IA 1DM2A 4Q2AA 3EKNA 3LXKA 2RL5A 2X7FA 4L43A 4MX9A 4ZJVA 5CZHA 3MH0A 3TACA 4ONAA 3ANRA 4MXYA 4ANQA 3FZTA 5CS6A 3V3VA 5AM6A 3KGAA 4LUDA 3GI3A 4AACA 4U5JA 3LAUA 4R7IA 2UZBA 1KOBA 3OBGA 5KZIA 4G16A 3TNQB 3BGPA 4GEOA 3QA8A 4C36A 4EHEA 4QRCA 4LGGA 4II5A 4E6CA 2O2UA 2C4GA 2YZAA 1UNHA 5F94A 4KBKA 4DF3A 1ZMUA 4XG4A 5KBQA 2HIWA 1Q8ZA 3KKVA 3NSZA 4IJ9A 4O83A 3ZSGA 3G6HA 3ORPA 1ZYJA 2YM6A 4BTMA 3C1XA 3T8OA 4QTBA 4ITIA 3Q5IA 1ZAOA 2BKKA 2YM4A 2WEIA 3DNEA 5DGZA 4XRLA 3QALE 4HPTE 4JG6A 1GZKA 2C0TA 2J0MB 1ZZLA 3NAXA 1FVTA 2UZLA 4YJTA 3TIYA 2UW5A 5JSMA 4IACA 5DVRA 4RVLA 3VUKA 4YURA 5HI2A 3WILA 1GOLA 1P2AA 2X4ZA 3KULA 2VO3A 2GTNA 4K2RA 4RIWB 5T3QA 4MD7E 3E64A 3GQIA 2C6IA 4E26A 4O2ZA 4HVGA 5M51A 3DS6A 1GZ8A 3R73A 5FEQA 4FKVA 4NM3A 4ORKA 2VWXA 4HNIA 2QOOA 2XNEA 3QKMA 4FSTA 3AXWA 3NW5A 5BX0A 4HVSA 1KE9A 1NVRA 2CHLA 2XK7A 3NW7A 5EW3A 4RLLA 2GPHA 4JDHA 3IW4A 4AFEA 4MF0A 1ZY5A 3QHWA 2OWBA 5HD4A 4UEUA 3FLWA 5H8GA 4M68A 5JFWA 4FSQA 4F99A 4USDA 2XBAA 2YEXA 2V62A 2VWYA 1Q8WA 4HGEA 3ELJA 4RZWA 3R8UA 3RAWA 3ZLYA 3C5IA 4ZAUA 1J91A 4MNEA 2EU9A 4JG8A 4X2GA 3GNIB 2WAJA 4C38A 4D4SA 1PXKA 1TQIA 3VS7A 1H24A 1J7IA 3C0HA 3HAMA 5JGBA 1K2PA 5FM2A 4B8LA 5AAEA 4XHKB 1PMVA 4ZSLA 3PVUA 2PMIA 3FZRA 3UNKA 3IS5A 4FL2A 4KNBA 2OFVA 4L6QA 3F61A 3LW0A 4IAAA 3BYUA 3VBYA 4EQMA 5L3AA 4DGNA 4R7BA 2YM3A 2X4FA 2HZ4A 3QTZA 5KMNA 5L8LA 4OUCA 4R5SA 1XO2B 3NAYA 3QD4A 4LV8A 2RFDA 2A27A 2ITOA 2WMSA 5CU6A 3P86A 4OT5A 3V5QA 3KULB 4ENYA 5E1EA 3UPZA 4IWQA 4ID7A 3C0GA 3QC9A 4M13A 5BUJA 5CF5A 4FEUA 4LG4A 4IWOA 3K3JA 4F0GA 4FSUA 4FEQA 2A1AB 4AS0A 1BI8A 3MTLA 5IQEA 3U55A 2ITXA 1KE5A 5E8SA 3DBQA 3DTWA 5KBRA 1IEPA 4AG8A 5FXRA 2ITQA 5C4LA 1TQPA 4EOOA 5JRQA 5KHXA 2XA4A 4I0SA 4X21A 3NW6A 2XEZA 3HMMA 4I4FA 3BU5A 5AIRA 1CM8A 2PPQA 2JD5A 4EH6A 2X2LA 4QMSA 3BHYA 4GRBA 4IWPA 4YTFA 5IEVA 3NIZA 4NT4A 3E92A 4BDGA 3VBTA 4HVHA 3AC2A 4AWIA 4WOVA 2AC3A 3NUSA 1OB3A 4WIHA 5BMMA 4CMUA 1MQBA 2BRHA 3W10A 4ANNA 1U54A 3QD2B 5AX9A 4MH7A 4CT1A 1M2RA 3LFBA 4QNAA 1R78A 2YIXA 4FTNA 4GG7A 4U0IA 4EOIA 3IW8A 3HA8A 1UU7A 3DJ5A 2X7OA 4CEGA 3LKMA 2F49A 3POOA 4JL9A 5EOBA 3OFMA 2XH5A 5IQGA 3BYVA 1KE6A 3LJ1A 4CFFA 3T9IA 1MRYA 4YLLA 3PLSA 5IH5A 2G1TA 5I9VA 3OCSA 5GNKA 2PVNA 2IW8A 5JQ8A 2PU8A 4DYMA 3BGQA 5BVKA 4KS7A 3KF4A 3NNVA 3VBWA 3WIGA 4O2PA 3PLAE 3NYOA 4YJVA 5BQ0A 4CLJA 2W5BA 3IQ7A 4F1MA 4W4WA 4NTTA 2QR8A 4N0SA 5EI2A 1IR3A 5JN2A 2JKOA 4Y5QA 3F7ZA 4DITA 4UZDA 3VS3A 5KMOA 3QXPA 4NIFB 3TV7A 3MH3A 4FIIA 2R5TA 3PJ3A 4JRNA 4X2FA 1B38A 4NM0A 3ZYAA 4FV5A 4BC6A 4DBNA 2R3MA 4F63A 3U4UA 2XNOA 2YHVA 2CGVA 5AP0A 5EOLA 2V7AA 3O7LD 3KC3A 3NUPA 3NYXA 4RX7A 5D12A 3OUNB 4I0TA 4FZAB 4UWBA 3BEAA 5AM7A 3GVUA 4XH6A 3KF7A 4AW5A 1IRKA 3QQFA 4FSZA 4UMRA 4NSTA 5EM7A 3ORLA 2J90A 2W96B 3SXRA 2B7AA 2W1HA 4USFA 3FMNA 1CTPE 2PZIA 4UY9A 4O0YA 4L9IA 4WRGA 3RHXA 4EYMA 3VS0A 5D10A 5IUHA 1Q4LA 4YZNA 1YRPA 3HV6A 2ONLC 3Q4TA 3A4OX 4GIHA 4RVMA 4YGAA 1FGKA 1IAHA 1PXNA 4I41A 2CKOA 5IMXA 4HCUA 1KSWA 4LOPA 2BVAA 2BHHA 3ENHA 4YO6A 5EQEA 2BFYA 4OTGA 5CQUA 2WMBA 2Y6MA 1JOWB 1KWPA 2PHKA 3LPBA 3LQ5A 3LOKA 4PMTA 4XNEA 4D2VA 4RG0A 5FD2A 5HBEA 3UVPA 2JDSA 3FMKA 1H1QA 3EFLA 2R3IA 4UMTA 1W0XC 2O0UA 2C3KA 2W9ZB 4ZLZA 1PJKA 1UNLA 4AN3A 1Q8TA 1XH5A 3LQ8A 4U97A 3L9PA 4ZIMA 1P14A 3U6IA 3ENMA 3GBZA 4CCUA 5H8BA 3O23A 2Z7SA 5HVKA 4ZS4A 3M42A 4OTFA 2UW3A 3Q3BA 5CQWA 2W4KA 5KMKA 5D41A 3C5UA 4QPSA 3K5UA 5AUVA 3OS3A 3R7EA 1Q41A 1PXOA 3I5ZA 2PULA 4RWKA 4TZRA 3O0GA 3TZ7A 3CS9A 5LVLA 4OGRA 1YKRA 3UODA 3G90X 1PXIA 1UKHA 2VX0A 3FI2A 5IQFA 5HO8A 4FYNA 3NYNA 4B7TA 4R77A 1B39A 2VO0A 3QQLA 4DH3A 5CVFA 3Q04A 1NY3A 3GT8A 2P0CA 4IFGA 4J52A 4IC8A 2VO6A 3I60A 4HVDA 2C3LA 2PY3A 3IPHA 3ZXTA 3FHIA 5CSPA 2R3GA 3ZTXA 3K2LA 2SRCA 2IW9A 5J9LA 3HV4A 4FV3A 3TZ8A 4DTBA 3P7CA 4A07A 2PUUA 2W05A 4ZSJA 5FBNC 2E9UA 4FV0A 5EKNA 5IKWA 3R2YA 3MVJA 4DH1A 4OBOA 1WAKA 4EKKA 5CEMA 2W4JA 2DYLA 1PKDA 1WBPA 4BIEA 5HLNA 4TRLA 3CQEA 3U9NA 3ZZWA 1J7LA 4G9RA 4NKAA 4O0WA 3F3TA 3GCSA 5EHOA 4E73A 5B2MA 3U6JA 4ZMFA 3ZONA 1OBGA 4PMPA 5C26A 4IVCA 3LFNA 3C9WA 3UC3A 2XKDA 3DAKA 4GFGA 4C3PA 1MQ4A 2ZV8A 4R3PA 4A4LA 2J5EA 4JIKA 2B9JA 3OOGA 4UMQA 5DRDA 2PZYA 2G2IA 5LOHA 2ZVAA 4U9AA 5CNNA 4R8QA 4FKWA 1OPKA 3R9DA 2Q83A 2YDJA 4KUJA 2ETKA 2HZNA 2RSVA 3GQLA 3QYWA 1SYKA 4QMWA 4RPVA 5CI6A 3RI1A 5HE1A 4Y73A 2XNPA 5DMZA 3F88A 1OM1A 3FXWA 4M12A 4QMNA 3VULA 2CCIA 3TDVA 3OP5A 4FTMA 3R1NA 5HORA 4PPCA 4DA5A 4W8DA 3PUPA 4F1OA 4FKTA 3FMMA 3QCYA 2CNUA 4MNEB 1FVRA 4RJ5A 5D7AA 1H1PA 4F0IA 5B2LA 3FPMA 3I7BA 5K0XA 4F9AA 3C4EA 4M7IA 4FG7A 4KIKB 1QCFA 3QQGA 4KD1A 3V6RA 4WRSA 5KKRB 4C3RA 3LMHA 4YZBA 4JIAA 5TT7A 3COHA 1XH6A 4F7JA 4U3YA 5K4JA 4IZ7A 1P4OA 4DCAA 3ZO2A 4NL0A 4CYJA 3AD5A 3KL8A 5KHWA 1LPUA 2JKKA 2UV2A 3MJ2A 4FVPA 2Z7RA 4QQTA 2UW9A 2R3LA 4BDKA 2WTCA 2FO0A 3DBEA 4RC3A 5HE3A 3ZCLA 4O7RA 3Q9WA 1ZOGA 4FKIA 4QMOA 1VEBA 3MFSA 4QP2A 5CX9A 3FQSA 1OKZA 3HRBA 4JJRA 1UU8A 5BYLA 3FLSA 4DC2A 4OTQA 3V8SA 5C03A 3VBVA 5CI7A 4FV2A 4YHFA 5KMLA 3K5VA 3ZEPA 5IH4A 2W0JA 4QMUA 3WZKA 3GC0A 3ALOA 5JK3A 2YAAA 3MIYA 1R3CA 1YWVA 2WKMA 1Z5MA 2J0IA 2JKMA 5M07A 4AW0A 2QU5A 3GEQA 3KMMA 3QGYA 5CF8A 4M3QA 2B9IA 4C37A 4FT9A 3UO5A 4LMUA 4RWJA 4BIBA 3PA5A 4QTDA 4EJNA 1NT2A 4D0WA 4IIRA 2OI4X 3EWHA 3QF9A 4WO5A 4QP7A 5I3OA 4EC9A 4H1JA 2IVUA 2WQEA 3FKLA 3OC1A 4M97A 2OKRA 3BYSA 1KV1A 3QRKA 3R01A 4ASEA 3COMA 3R22A 4X6QC 4W4YA 2A4LA 3F66A 3MH2A 3PP1A 4E4XA 2ZB1A 1YVJA 4JX3A 4I6BA 3E63A 3L8PA 2QQ7A 5J1WA 3W33A 2NP8A 3EMGA 2PUNA 4DG0E 5EG3A 5DT4A 5JQ5A 5L6PA 4UXQA 2CKPA 4QP6A 4PUZA 4K11A 3EQPA 3QHRA 5FEEA 1P4FA 2VTOA 4Y8DA 3F6XA 5CT0A 5AWMA 4DEGA 3VHKA 1YXVA 4WT6A 4NW6A 2LAVA 2UZTA 2PVJA 4IANA 4BTFA 4AZVA 4A9RA 4QTAA 1XH7A 3E8DA 4Y72A 3PIXA 2NRYA 3OMVA 4O6EA 3F3WA 3DKFA 3PWDA 4EOMA 2XP2A 4YNEA 4FIGA 3ZHPC 5BVOA 5E90A 3IDPA 2B54A 2VWVA 2E9OA 4MYGA 1NA7A 4XG3A 5J87A 3WE8A 5M4UA 5F1ZA 3UGCA 3G5DA 3UYSA 5HU9A 3BI6A 3KMUA 2QODA 2I0HA 2VAGA 1APME 4TWCA 4UZHA 3WF7A 4Z9LA 3ZH8A 4AN2A 1EH4A 4AW1A 4TWPA 1W8CA 4NYEA 4BGGA 1QPCA 3TXOA 4ALUA 4EKLA 2Z7QA 3ODZX 2EWAA 4IAIA 3VS4A 3QD3A 4EBVA 1H00A 2YCRA 5AR8A 2UZOA 2R3NA 3E8CA 1H28A 3KA0A 3CD3A 1OIYA 2OJ9A 3ZO4A 2QOKA 2ZDUA 4UXLA 4GK4A 3R9NA 4D4YA 1A06A 3GENA 4RQVA 1YOLA 3FLZA 5CSVA 4QMYA 3E8EA 3LVPA 5C1QB 3BKBA 3COKA 3QTQA 4U80A 3ET7A 4K6ZA 4XG7A 2BIKB 4RJ4A 1OIRA 4IQ6A 2REIA 3UE4A 2QOLA 3IGGA 3TUBA 4AT5A 2XIRA 4F08A 5KMJA 3FYJX 5HG5A 3PY0A 5A3XA 4Y95A 2J7TA 2UW4A 5TOZA 5IISA 2PK9A 4IVAA 2XK8A 4OTRA 5K4IA 5I9YA 2IZSA 3E3PA 2UW6A 5EK7A 3FMDA 4QTCA 4WD5A 5CF6A 4GV1A 3RGFA 3QTRA 5AR7A 4BBFA 4R7HA 3GOPA 5J9ZA 2RFEA 3KRLA 2JIUA 4WKQA 5FQDC 2WTKB 5LWMA 4I94A 3REPA 2I0VA 3EHAA 1M52A 5IEYA 4HJOA 5KCVA 3BBWA 4TYJA 1VYZA 2QU6A 1SM2A 2R9SA 4BZNA 2V7OA 3R21A 5E8TA 3DCVA 2CKQA 4BDEA 2PMOX 4Z7GA 3OG7A 2WMAA 4H3BA 2YIQA 5H9BA 1Q62A 3VBXA 4X6RA 1Q99A 3G0FA 3OY3A 4CFWA 3PRFA 2XZSA 5T6KA 3CGFA 2J2IB 1MRVA 3KN5A 3OXIA 4EUUA 5B7VA 3ROYA 3AC1A 2PMNX 3JVRA 3KREA 2YLEA 1FBNA 3C7QA 4FTTA 3OROA 4HGSA 5ETFA 5C27A 4J99A 2YIRA 4KKHA 3H9FA 1PYXA 1LEWA 3BCEA 3D14A 4CGAA 4D1SA 3D4QA 2R7IA 2WQOA 3NNWA 3GCUA 3BLQA 2XK6A 4NIFA 3VQHA 1W82A 4AXAA 4RIWA 5C01A 5DR2A 1BYGA 3QTIA 3RZFA 3VUTA 3PJCA 2BMCA 3V5PA 3ZC6A 4BCOA 3CCNA 3CQWA 3NLBA 4A9UA 4Q9ZA 5C8KA 4O7LA 3JR1A 5CF4A 3VUDA 3MESA 2QOCA 3N51A 4BI0A 5L2WA 5F95A 4XEYA 4A9TA 4F9WA 3FBVA 4TYGA 2PUPA 1H01A 3TNHA 3B8QA 3DJ7A 2J0LA 3NYVA 3OY1A 2VTNA 3DQXA 3O8TA 4ZP5A 2QOBA 1YI3A 4FV4A 5HNGA 4U43A 3S2PA 4EK8A 5L2IA 2WOUA 4O0SA 4EHVA 2JEDA 5FTGA 5EM8A 5C8NA 3IGOA 2WU7A 4UWYA 2VTQA 5IDNA 4LI5A 3ULIA 2X8EA 2WMVA 4TWOA 2W5HA 5IQBA 2HWPA 4PQNA 3DKGA 2B9HA 3FSKA 3O2MA 4RGJA 3RAKA 5L2TA 4IX5A 2OK1A 2W17A 4DFBA 2PVMA 3UVRA 5ANOA 5AJQA 1SVEA 2ETRA 1STCE 2QC6A 5EDRA 4TNDA 3TI1A 4CYIA 4NEUA 5LVPA 3L9NA 4RJ7A 4WNMA 4QNYA 4YTIA 4KB8A 4I5MA 3BELA 4RRVA 3A2CA 3MPTA 4K18A 3BHTA 2PVHA 2ZOQA 4ASXA 2C5OA 3DNDA 4I6HA 2NNWB 4E20A 2XB7A 2XRWA 2C6EA 4IX4A 4YC6A 1OL2A 1YW2A 2GSFA 4Z55A 4LV5A 3QTSA 1WBSA 1BUHA 4PPAA 3JY9A 1JNKA 4J71A 4F6UA 1J7UA 4BRXA 4OW8A 4IADA 4D2TA 1ERKA 2GCDA 4QYGA 1WBOA 2B55A 2BRMA 2QHMA 1PXMA 3HAVA 2YISA 4WHZA 4XLIA 3WYYA 3KK9A 2HZ0A 3Q6WA 3MBLA 3TCPA 4ANSA 4G31A 4WUAA 4KABA 3R8PA 1V1KA 1URCA 2P2IA 1PHKA 2Y9QA 5LJJA 3O8UA 3QUEA 3Q9YA 1ZMWA 2WTVA 3QTXA 4V04A 3E8NA 1M7QA 2BPMA 1ATPE 2G2FA 4IW0A 2HWOA 4X2NA 3EQBA 2PVFA 3R00A 4GKIA 3R1SA 3WOWA 2CGXA 3ZLXA 4EK4A 4QMPA 5M08A 4CMOA 4CRSA 4F0FA 4Y5HA 2CKEA 4GL9A 4JG7A 1RW8A 4HPUE 4AE9A 4CFVA 2ITZA 4FX3A 4XYFA 5HE0A 5HGIA 4C35A 3TNPC 2P4IA 3JS2A 3PXYA 1SZMA 4H3QA 5HBJA 3MY0A 2VRXA 3QKKA 4ZXTA 1V0PA 2ZM1A 1Y6AA 2R3FA 4TKSA 5FP6A 4GW8A 2RFSA 5EYCA 1FOTA 1KOAA 3ORZA 1U5RA 4IVDA 4FKPA 1M14A 3KXHA 3R0TA 4QYEA 3RPRA 4RFMA 2A0CX 3VNTA 2X8DA 5FDPA 4BCQA 5I9WA 4FI1A 5J95A 3R8ZA 4BGHA 3O7LB 3PA3A 2P3GX 1H25A 4A9YA 4AOTA 1XJDA 2RG5A 5IDPA 4TNBA 2X6DA 3MA3A 4RSSA 3R7OA 2WMQA 4ZSAA 2GMXA 5DT3A 4LGDA 4C33A 5JFXA 5E8WA 4OTPA 3NCGA 2EVAA 4AZEA 3PXRA 1XKKA 3OTUA 1JKTA 3DFCB 4FZ6A 4NCTC 3N4VA 1F5QA 3QRJA 1GZNA 5K5NA 3GU5A 4HOKA 5M55A 2DS1A 2W1CA 2WMRA 4P90A 1JWHA 2O63A 2C6TA 2QNJA 3L9MA 3MVMA 5IH6A 3E5AA 5LVOA 3CY3A 4BIDA 4IH8A 4CZTA 5DFPA 3QKLA 2XM8A 3FLQA 4FTRA 3FQHA 4ZTMA 3GU4A 3NUNA 3ZUUA 4GFOA 2BILB 2ZMCA 3RKBA 4IDVA 4GVJA 2UZVA 2PVRA 4YLKA 3Q9XA 4WBBB 5HHWA 5IA5A 3ZRKA 4JI9A 4JT3A 4AZFA 5BVNA 5HTBA 5LCJA 2OZAB 4RT7A 3C13A 1MP8A 3ROCA 3N4TA 4M69B 3EOCA 3EYGA 3UIXA 3LQ3A 2FA2A 3UZPA 5L4QA 5JGDA 4DE4A 3UNJA 2XKFA 2J51A 1X8BA 2CLXA 5E1SA 4U42A 3B8RA 5I3RA 5IMEA 2YJSA 3ZS5A 4YZ9A 4ANBA 4Z16A 3CQUA 3SOCA 2CDZA 2XS0A 3ZM9A 1YOMA 3T3UA 3VN9A 2Y6OA 3UNZA 4E1ZA 2FSTX 3DBFA 5AV0A 2GTMA 4F9YA 5HZNA 3SX9A 2XJ2A 3KY2A 3SDJA 1CKIA 1HCLA 3A4PA 3O96A 4FV6A 4BICA 3UOLA 1CKJA 2C0IA 5GJDA 2XNGA 1OKVA 4E5AX 5GZAA 4U45A 4J8MA 5A6OA 4RJ6A 4R5YA 1S9IA 1OGUA 3RALA 2EXCX 1YWNA 2ERZE 2VNYA 3LXLA 4APPA 3BPRA 3ATSA 4JOAA 1WVXA 2H34A 4NZWB 4PL4A 4RWIA 2IW6A 4PTGA 1O6LA 1HOWA 4ANOA 3FI4A 3QL8A 2Y0AA 4HZRA 2C3JA 2C6KA 2WTKC 3QFVA 4XX9A 4D4RA 3W2SA 3EN6A 2VTLA 4DTKA 5E7RA 3P78A 5LQFA 1G8AA 2FSMX 4J97A 4E3CA 2GS2A 3IONA 1VJYA 2R3QA 3QUPA 4GYIA 3JXWA 3RK5A 5AUXA 3S00A 2O64A 2Q0BA 4RZVA 1QPDA 1W83A 1H07A 5KMIA
chains in the Genus database with same CATH superfamily
4G9CA 5HG8A 4JBVA 4D2RA 4DLJA 4MCVA 3VS5A 4DFNA 4XMOA 5KNJA 2Y8OA 4L01A 1LUFA 4J98A 4M66A 4TWNA 1QPJA 2PZPA 3EJ1A 4ZSGA 3FUPA 3UG1A 1IG1A 2XEYA 4HVIA 1O6KA 3PPKA 3TN8A 2QO2A 4I23A 2WXVA 2ZAZA 3R8MA 2VUWA 4CFNA 3RWPA 4WA9A 5KUPA 2X6EA 4O84A 1TQMA 3Q4UA 4A4XA 2E9PA 4HGLA 5AV3A 1DI8A 4D4VA 3KXMA 4MTAA 3NNUA 4UWCA 3KEXA 4Q5HA 1OIUA 4IB1A 1ZYDA 4PX6A 3TDWA 4DGGA 2VTPA 4QQ5A 4YPDA 2Z60A 2CLQA 5IUIA 3A61A 5AR3A 3C51A 3VHEA 5J5TA 1YDRE 3SA0A 2WTWA 4BDIA 4IM0A 4M84A 3W0PA 4KIKA 5HTCA 3UG2A 1YQJA 2GS6A 2PUIA 3P5JC 5CVHA 3LE6A 3RJCA 1K9AA 5IG1A 3P7BA 2V55A 4FKSA 3QWKA 4QP1A 3VVHA 2OF2A 3HV5A 3LXPA 2OFUA 5CASA 5FUTA 1YHWA 3R02A 5HICA 3CLYA 2GNJA 3CD8A 3PA4A 4MWIA 3SHEA 4AAYA 3V04A 5JFVA 4ZZMA 5HQ0A 2YWVA 4FK3A 3MFTA 3EL7A 5CEQA 4AA4A 4O7NA 4LYNA 3R9HA 4BGQA 2OJGA 4HYIA 3SV0A 3RMFA 4TW9A 1VR2A 3MFRA 4IX3A 2OG8A 3IDCA 2CGWA 3VIDA 2UVXA 3H4JA 1Q97A 2UVZA 2BAKA 5GIOE 4NTSA 4GYGA 3RNIA 2HOGA 4ERKA 1NXKA 2VGOA 2XNMA 4LOQA 4KSPA 4ANMA 3CTJA 2IF8A 4FKQA 1JLUE 4IX6A 4QMVA 4WSYA 4X3JA 3TWJA 4C4IA 4F09A 4K1BA 3TKIA 2JIIA 3PG1A 2OJFE 5AX3A 1BI7A 3QD0A 3R7UA 5AEPA 1ZOEA 3VWAA 1H0WA 1UA2A 2FSLX 3H10A 4K0YA 4U40A 5HG7A 3VW6A 1Q24A 4CKJA 4I6FA 3UQGA 3D83A 3LFQA 3PIZA 4FTJA 4OTHA 3TV4A 1LR4A 5CWZA 5TF9A 4JX7A 3GCQA 4FEVA 2C6OA 3D9VA 4FVQA 4FSNA 4APCA 3QWJA 2QHNA 4GUBA 4IZYA 1YI6A 2VTMA 2C6DA 3QYZA 3RBWA 4FEWA 4AXDA 4AXCA 3ZSHA 3F5UA 3FAAA 3NPCA 4O4CA 2AC5A 4JR3A 4WG4A 4XJ0A 3V5LA 4EORA 1KUTA 5EH0A 5DR6A 3WARA 2DQ7X 4WSQA 5F9EA 4PV0A 4ASDA 4OTWA 3ZDUA 3DXPA 4FL3A 5EQPA 3AT4A 3PXZA 3OW4A 3TV6A 4FSRA 1BL7A 4MXAA 4ZK5A 3RAIA 3PP0A 1YWRA 1ZLTA 5CLPA 5A4EA 1QMZA 3LJ2A 4XP3A 4YBKA 4AFJA 4DEEA 3V8TA 5AP1A 3ZM4A 3HA6A 5JH6A 2G2HA 4O6LA 2WEVA 2XRUA 4NWMA 4FTOA 1TZDA 3U4WA 5HIEA 3SGCA 4IJPA 2XNNA 5GZ8A 1REJA 3SG8A 4GU6A 1OL1A 2PVKA 3NUYA 3UYTA 4E6DA 3BQRA 4FTKA 2RG6A 2JAMA 3HRCA 3F2AA 3NEWA 5ETAA 3MFUA 3TJDA 4AU8A 4YJNA 3R7GA 1F3MC 2IVVA 4O1PA 4AE6A 4PWNA 1UKIA 4MKCA 4JQEA 2KULA 1OL5A 3OT8A 2FGIA 4U8ZA 4ARKA 4F7SA 2CCHA 4HCTA 2ZV2A 5LWNA 4Y83A 2VZ6A 5CT7A 4EH3A 5CSXA 3RCJA 5L2QA 4MQ1A 2QOFA 4FNWA 1RE8A 1FGIA 4L3PA 4MF1A 4YNOA 4RX5A 1PMNA 2HENA 3W32A 4HYUA 4KRCA 3QZFA 3RK7A 4RIXB 3FI3A 4YTHA 3EFKA 3VS1A 3ZSIA 4TY1A 2E9NA 1OUYA 5IQDA 2GQGA 2X9FA 5ACBC 3E62A 4YSJA 3KN6A 2P55A 4TYEA 3AD4A 3G9NA 4I6QA 5HNBA 4XOYA 4EH5A 3EQCA 2ITTA 5IQCA 3P0MA 2V22A 2YIYA 2GNFA 2BROA 1WFCA 3LCOA 3LFCA 3P79A 4B0GA 3CE3A 2BFXA 3CPCA 4ACDA 3HL7A 3P23A 3MIAA 4JLCA 3LMGA 4EJ7A 3QQHA 3UOHA 4YZCA 3MPAA 2OJIA 3UDSA 3OXZA 2QD9A 4W4XA 1KV2A 4IZAA 4BCPA 5HIBA 2UZWE 4TYHA 5EKOA 3AKKA 3PE1A 5JMSA 2QG5A 3Q6UA 4X3FB 3PXFA 5LMKA 3TUCA 2VWUA 3R8VA 4LDTA 2YCFA 1YOJA 1W2DA 2R64A 1XH8A 3G6GA 4EC8A 2HYYA 5JZNA 4AW2A 5CAUA 4W9XA 4RX9A 4F64A 2WMTA 4FOBA 1G8SA 3IK3A 3PPJA 4XV3A 4QMXA 1H1SA 2OLCA 1I09A 4D9UA 2IPXA 3A99A 4HYHA 4YJQA 3Q32A 2VNWA 4M0YA 3S3IA 4I5PA 3NMUF 3AC4A 4UMPA 5JT2A 4PY1A 3HX4A 4OTIA 4F6WA 4XV2A 4I1ZA 4RIYB 4XG6A 5AAGA 3FLYA 3LFFA 4FK6A 5HVJA 4G1WA 3G51A 5DHJA 4QEBA 1Z57A 2BRGA 3RNYA 1MUOA 2EB2A 5HG9A 4E6AA 4I4EA 3OCTA 4M0ZA 4KINA 5AV2A 4IAZA 2O5KA 3CJGA 4KIOA 5IF1A 4JBQA 4O7YA 1SVHA 2B0QA 5IU2A 4TTHB 4OBPA 4EK5A 4DDIA 3BU6A 3BEGA 2HZIA 2X9EA 4KSQA 2UZDA 4X0MA 2VWWA 4HNFA 3HDNA 3VF9A 4BR3A 2DUVA 3ODYX 2BZIB 1PW2A 3I6WA 2F7XE 2HW7A 1ZOHA 2OF4A 3C4WA 3HDMA 5IQAA 3BIZA 3D94A 3VRZA 5M56A 4JVGA 4MXXA 3VW8A 4KIPA 3L9LA 2QVSE 4IAYA 4LL5A 2UW0A 4FEXA 3MH1A 4YLJA 1OZ1A 5DWRA 3DBDA 3I7CA 2QOHA 2F4JA 4FKRA 4NCTA 3W8QA 4CMTA 2YACA 3B2WA 5K3YA 3KU2A 2YLFA 2VX1A 3G0EA 4P7EA 5H2UA 3S0OA 4C3FA 1J1BA 1U4DA 4KA3A 4ZLYA 5A46A 4FVRA 3PXQA 4XBUA 4EEVA 1OL6A 3LCKA 3GGFA 3LLTA 4O7SA 5EHYA 4W4VA 2R4BA 2C1AA 2H96A 4NW5A 1UWHA 4LM5A 4BN1A 2VTIA 4Q5EA 5DH3A 3W55A 4FSMA 4E4NA 4XG8A 3JY0A 4RFYA 3BLHA 4NM7A 5BYZA 4PDSA 4UYAA 1JKKA 3NZ0A 5HCZA 1B6CB 2W1GA 4O22A 3TT0A 3RP9A 1FMKA 2W1DA 2R2PA 2VTHA 4IFCA 5AP4A 1Y57A 4QO9A 4RFZA 4U79A 4CQGA 4LGHA 4BDCA 4E5BA 4RA4A 4EBWA 2YIWA 4DG3E 5HU3A 2NRUA 5HX6A 2W06A 5CTPA 4FKGA 4FT0A 4BDBA 1VLRA 4PNIA 4AT4A 3TNWA 3IW5A 4WUNA 5CU2A 1Z9XA 5EQYA 4IDTA 4PMMA 4UN0C 5M44A 4BB4A 3LMIA 2OZAA 2UW8A 3RCDA 3KRJA 3NVMB 3RPVA 5ETIA 2QOQA 4H58A 4U7ZA 2QLQA 5E8VA 3K54A 4G2FA 4MXCA 4DFXE 4KRDA 3NUUA 3FDNA 4I93A 2PYWA 3EYHA 1W98A 5G6VA 3QRIA 3DK7A 3BQCA 4RIYA 4I92A 1XWSA 3KXNA 4FT3A 4RJ8A 3L1SA 3SRVB 3UOJA 3P1AA 3EL8A 3OWJA 4TL0A 2XK4A 3MY1A 4GCJA 3ZBXA 5E92A 4FV1A 4BBMA 1PXPA 4QMMA 5IA0A 2C5YA 4H39A 1JKLA 2CGUA 2OXDA 3AT2A 3MY5A 5ANDA 4F7NA 1WBVA 4FIFA 3KXZA 4JS8A 2WTJA 2YZLA 3FYKX 3RWQA 4NM5A 2BZKB 3R63A 1YHSA 2X1NA 3PTGA 2QO9A 5AFVA 1U59A 3WYXA 3UZTA 1ZMVA 2BALA 5E8ZA 3C50A 2G9XA 2OH0E 2QOIA 2ZV9A 3HUCA 4ACHA 1R1WA 3N9XA 3D5XA 3JVSA 2VWIA 1UVRA 2YFXA 3CTQA 5DLSA 3UQCA 2ETMA 5LMAA 3HMIA 4AUAA 4MXOA 2VN9A 4MVFA 3F7WA 5GHVA 5HE2A 4MEDA 4EWQA 4FV9A 3COIA 2RIOA 4U3ZA 3A7HA 2ZV7A 1M2PA 4TYHB 5L6WL 5AR2A 5M09A 2HAKA 2UZUE 3A62A 2E2BA 2OJJA 1Q5KA 3T9TA 1Q8YA 2C30A 2JC6A 4FMQA 3RK9A 1CSNA 3ZLWA 3OWLA 5ANGA 4KBCA 5AR4A 4BHNA 3EH9A 2PVYA 3PSDA 4MWHA 3ORMA 3D2IA 4PDPA 5A4LA 4O81A 2ZB0A 2GHGA 3F5GA 4J8NA 4CCBA 4O0XA 1VZOA 3M2WA 4JDJA 4FGBA 3UIUA 1JSUA 5DPVA 4MHAA 4GKHA 3Q9ZA 5ACKA 2H8HA 3FE3A 2B1PA 3LFEA 4ZSEA 2GNHA 3FXXA 4FRFA 4JR7A 5FTQA 2OICA 4C02A 5AAFA 2AUHA 3OUKA 4AX8A 4V01A 4XV9A 4MK0A 2UUEA 4FKUA 4N4SA 5ANKA 3V51A 2R3HA 2W7XA 3OVVA 4QD6A 4W9WA 3D7TB 3ZDIA 5FTOA 2YM8A 4OR5A 5HESA 2W5AA 3W2OA 3IW6A 2W99B 4K8AA 5EI6A 1QL6A 3A8WA 2X0GA 4MBJA 2YM5A 3VS6A 3A60A 4J96A 5A9UA 4FIEA 3U54A 1YHVA 4GS6A 3JYAA 3D5VA 1FPUA 3NNXA 4L52A 4RLKA 1PF8A 2CN5A 2ITUA 4EH2A 2AQXA 2WPAA 4GT5A 2HCKA 4YZDA 4CTBA 1OITA 2IO6A 2IVSA 4M15A 5CAPA 2ITPA 2Y4IC 2ZDTA 4J53A 4YO4A 1E9HA 2YDIA 5IA3A 1YDSE 5CU3A 4IXPA 4EH8A 2IN6A 3GB2A 3HMNA 4O0UA 2OGVA 4AP7A 3V5TA 3D7ZA 3OEFX 4FZFB 3G33A 3K3IA 3Q60A 4TPTA 4AGCA 4CV8A 4YSMA 4FJVA 3HYHA 2BR1A 4ZMEA 3VJNA 1OKWA 3AMYA 3CIKA 3LCTA 2VTRA 3BHHA 4QPAA 4ZEGA 4RA5A 2EXMA 3EN5A 2B52A 2YERA 1W84A 4E93A 3RPYA 4KAOA 4A9SA 3EZRA 4CTCA 2CPKE 5C4KA 3TZ9A 4V0GA 4JNWA 1Y91A 2Z8CA 4NUSA 5FXSA 2C6MA 1GY3A 4V0GB 5GZ9A 5KE0A 3I5NA 4QP8A 3R7IA 4D58A 4F9BA 4FG9A 3AKJA 1H1RA 4O96A 3D5UA 1UU3A 2J6MA 3KXXA 2IEWA 3EN4A 3QUDA 4J7BA 4S2ZA 4ENXA 2OSCA 3IOPA 4GJ3A 1OVEA 4ERWA 4IBMA 2NO3A 3LFDA 2GU8A 3W18A 5I9XA 2GQSA 5IQIA 3F9NA 3MS9A 3II5A 4CKRA 3FC2A 5DIAA 3RM6A 2XAOA 3DA6A 4QP3A 4XOZA 4C2WA 3QXOA 3QCXA 3ORIA 3DPKA 3E7OA 2G01A 1TKIA 5IA2A 2WMWA 4IVBA 3ZOSA 2VTAA 2C0OA 3SC1A 3UMXA 3THBA 3OT3A 3BE9A 5FWKK 3QTWA 4O21A 5AP3A 4ACCA 4D5HA 4DEAA 5LXMA 3QCQA 4YU2A 4F6SA 3BV2A 5AUTA 2I1MA 2YABA 5J1VA 2Y4IB 4D1ZA 2YCSA 3LZBA 3BV3A 3MWUA 4Y46A 3UPXA 5C9CA 5HCXA 1GAGA 2ZM3A 4FV8A 4O38A 3VS2A 4RMZA 1REKA 4I24A 2O3PA 4NJDA 4WG3A 3R7YA 5DN3A 1JQHA 3HNGA 3F2RA 2C5XA 2WTDA 5I0BA 2HXQA 3ZUVA 1SMHA 5GJGA 3AC8A 5GJFA 4O27B 5EW9A 4LUEA 4BL1A 3TZMA 3R8LA 3QGWA 3DZQA 4UALA 4LQMA 5CZIA 3D2KA 4CG9A 3BX5A 4GG5A 4DAWA 1FVVA 2RKUA 3GFWA 3QZGA 2X2MA 3FEGA 3NCZA 4DDGA 2OXXA 4FTIA 2XAMA 4X7QA 4EH9A 3MW1A 2R7BA 5HIDA 4JDKA 5BUEA 3U8WA 1AD5A 4O0VA 4ZZNA 4UBAA 3BHUA 4C8BA 4A4OA 4DEBA 4NKSA 2Y7JA 1Y8YA 4KKEA 3ZMMA 3G15A 2BZHB 2ITWA 1U46A 4E6QA 2VTTA 4LRKA 5AA9A 5H8EA 4CZUA 4JBOA 2X2KA 4XBRA 1GZOA 1SVGA 4MBLA 3AT3A 3C4CA 2W1IA 3DTCA 5D7VA 4ZTHA 2JLDA 5JEBA 2JDTA 3EKKA 3P7AA 1R0EA 2WZJA 3MSSA 3WE4A 4HW7A 2BAQA 5ANIA 3FV8A 3R71A 3BBTB 4GVAA 4DFYA 4OAUC 4FZ7A 5BMSA 1KE7A 4IB0A 4EQCA 2BTRA 5L8JA 5LMKC 2W1EA 1XBBA 1OMWA 2YITA 3FPQA 3S1HA 3HMPA 3KMWA 4HZSA 4L42A 4UV0A 1YI4A 5BVFA 4G5JA 4QYYA 2XK9A 4G6LA 4F65A 4FT7A 3DQWA 3ORKA 3ERKA 2BIYA 4JAIA 3S4QA 3TTIA 2WD1A 1IASA 4FBXA 3GXLA 4HCVA 4M8TA 3U6HA 3OW3A 3NGAA 4JAJA 4S31A 4TXCA 4QMQA 2XANA 3H9RA 2XF0A 3BRBA 4CFXA 4FICA 5BYYA 4GT3A 3TJCA 2JAVA 3PYYA 3OWPA 1IA9A 2F7EE 2WQNA 2CN8A 3FQEA 3MN3A 2GNGA 4YJSA 3RZBA 3ZU7A 4C62A 4O7WA 4NJ3A 2PL0A 4I5CA 5HD7A 2C68A 3B2TA 3IO7A 1FQ1B 3UDZA 5CEPA 2PVLA 2VTJA 1YXTA 4DN5A 5AA8A 4F78A 2ITYA 1OPLA 3PVWA 2JFMA 4FIJA 5EDQA 5HVYA 5BV3A 2PE1A 5EHLA 3A7IA 3NDMA 3OXTA 5AMNA 3UVQA 4EH7A 4AGDA 5J5SA 4BCGA 3BE2A 5AUYA 4HGTA 4IM2A 2F2CB 2WNTA 2O65A 4RWLA 3E7VA 4CV9A 5BVEA 2X81A 3AG9A 4NFNA 3CC6A 3EQFA 4PP9A 4D1XA 4BTKA 4KWPA 3IW7A 4C34A 5IUGA 4DLIA 2YDKA 5LVNA 1VYWA 1G5SA 3ORTA 2XMYA 4BDFA 4S32A 3NS9A 4RC2A 4AXEA 2PE0A 1V0BA 1OKYA 2JIVA 2PWLA 3JPVA 1Q3DA 4I0RA 4YC3A 4O7ZA 2HELA 4C7TA 2UW7A 3L8VA 1G3NA 3Q2MA 3HVCA 5DOSA 3W1FA 5DEYA 3HLLA 4FG8A 4FR4A 4FODA 2OIBA 5DT0A 4JQ7A 5LCKA 4X3FA 4E4LA 3FKNA 2J50A 1YXSA 2GFSA 4R1YA 2XBJA 5AP2A 5A54A 1ND4A 4QMZA 3WZUA 3AQVA 5AIKA 3LJ0A 3TNIA 3FMLA 1ZWSA 2Z2WA 4C4JA 3TKUA 5CEOA 4IM3A 3UZRA 4BWKA 1LP4A 2BDFA 1XH4A 4QPMA 4DFLA 1LEZA 5EDPA 4FTUA 4O86A 3RM7A 2Z7LA 4UMUA 4PMSA 5T68A 1E1XA 3HRFA 3LLAA 4FSWA 1NVQA 4BCFA 2IJMA 3FZPA 4ZZOA 4YP8A 3V5JA 4AN9A 1PYEA 4W8EA 4OLIA 1ZRZA 3OCBA 4FTLA 3TUDA 1YDTE 3N4UA 2JDRA 2C5VA 2QCSA 3EN7A 3TTJA 1BLXA 3EQIA 5D11A 3UC4A 4KBAA 4FIHA 4ACMA 4PRJA 5E8YA 4FTQA 3HKOA 4BDJA 4PTCA 4L45A 5HOAA 1H0VA 3OHTA 1WBWA 4H36A 4N6YA 5B0XA 4B99A 1T45A 5CYIA 3RTPA 4FKJA 3SVVA 4L3LA 3AC5A 4AOJA 1P5EA 3CPBA 3QQJA 3R1YA 3ZZEA 4FYOA 4ACGA 4BBEA 4IB5A 3MVHA 3ALNA 3H30A 3OZ6A 5KKRC 1RJBA 3UOKA 3E87A 3T3VA 4R3RA 3RPOA 1XR1A 2ITVA 3VAPA 4ALWA 3WF6A 5M4CA 3ZRLA 4A06A 3FMJA 2WO6A 3F2NA 5L6OA 5AV1A 4B6LA 3UMWA 2Z02A 3NRMA 5EYDA 3SKCA 4S30A 4C61A 1QPEA 2C69A 4QMLA 2BRBA 3RINA 5HBHA 3GC9A 4YUQA 3F69A 4L8MA 2JDOA 3KQ7A 5E4HA 3GCPA 1OBDA 3JUHA 1MRUA 1JSTA 2ZYBA 3GU7A 3VF8A 5ANJA 1DAYA 5AV4A 4EH4A 5AR5A 4B9DA 2Q0NA 3R83A 3I79A 3DLZA 4YPSA 2BTSA 4I20A 4BZDA 3QQUA 3LHJA 5M53A 5CVGA 4AF3A 5CXZA 3UBDA 4O7TA 5M57A 2GHMA 1U54B 4FTCA 3VUGA 3OEZA 4D55A 4AT3A 1FINA 2ZFYA 2A19B 3LIJA 2BKZA 3KRWA 4FF8A 5ANEA 4EHZA 4MAOA 4P2KA 4G3DA 3QU0A 3I0OA 4FC0A 3ZUTA 3DU8A 3QRUA 4CZYB 4GU9A 4QMTA 3F3ZA 2EXEA 4X2JA 3BYMA 4P4CA 3TIZA 2WTIA 3L8SA 3LXNA 2F2UA 4WNKA 5CXHA 4YHJA 3PIYA 4EONA 4PP7A 4DHFA 4L3JA 1JKSA 1SNXA 3PWYA 2GDOA 4JBPA 4ZTRA 2ZMDA 3TM0A 5E8XA 4Y85A 2B4SB 3BU3A 4O82A 5EM6A 4X2KA 5LARA 2OU7A 4AA0A 4O91A 4O4EA 3D15A 3FZSA 1GJOA 4C58A 4YMJA 5FG8A 3O17A 3OF0A 5CEKA 4XP0A 2E9VA 5L2SA 3TYKA 1AGWA 5CEIA 3WI6A 1PY5A 1S9JA 1UNGA 2R3PA 1XBAA 2BHEA 2FB8A 2XIXA 4GK3A 4IAFA 4EOLA 5BVWA 4O7VA 3AKLA 3FKOA 4QYHA 2DWBA 4PL5A 2GFCA 3W0NA 4ZY6A 2JGZA 2YCQA 3QCSA 3VBQA 5TKDA 5L8KA 4WNPA 5E8UA 3ACJA 2JITA 3ZLSA 3HP2A 3G2FA 4FNYA 4EK6A 2XIZA 5E9EA 2XARA 3DAJA 5F20A 4P5ZA 2R3OA 2YN8A 3A7FA 3FZOA 2YJRA 4C4EA 4FKLA 4EOJA 2OIQA 3MB7A 3FWQA 3OCGA 2OW3A 4YJUA 1GNGA 5F4NA 5A4TA 5HNIX 4DG2E 2FVDA 2WOTA 4BYIA 4D2PA 1ZZ2A 4YR8A 4RQKA 2XYNA 2ITNA 4XP2A 4AAAA 4MD8E 3SXSA 3ZXZA 5IQHA 3BLAA 3D5WA 5GINE 2QLUA 3AMAA 5AUZA 3CXWA 5I9UA 3GOKA 4MQ2A 4I22A 5AP7A 3ZBFA 2J9MA 2I0EA 4LFIA 5K0KA 3WF5A 5HKMA 3BWJA 4EK3A 4L00A 2XCKA 4IZ5A 2ZJWA 3OTVA 2QKWB 2VU3A 3SRVA 1OPJA 3BYOA 2QKRA 4AGWA 4DGLC 2QI8A 3VUMA 4F9CA 4BCHA 5M4FA 1DI9A 5CSWA 4Q9SA 3FSFA 3GC8A 2XKEA 2XJ0A 3KVWA 3OWKA 5DEWA 3GU8A 3DXNA 1ZY4A 3I6UA 2PSQA 1CMKE 3P08A 4NU1A 4BKJA 1G8JA 3IKAA 1DS5A 2KTYA 3W0RA 4DT8A 3O8PA 3Q5ZA 4TYIA 3QZHA 3ACKA 3DGKA 3HECA 2PZ5A 1CKPA 3NWWA 4J95A 4CSVA 4FZDB 5DE2A 4BTJA 5KMMA 2VWBA 2FYSA 3KFAA 2XUUA 2G15A 2BDJA 5DI1A 4ZJJA 3SG9A 3MVLA 3CEKA 1O9UA 4EQUA 4KIQA 4DEDA 2OBJA 4QTEA 2IWIA 2X7GA 4ZTSA 1V0OA 2H6DA 3V6SA 3AC3A 4XRJA 5I5ZA 1ZYCA 1H26A 2ESMA 2OH4A 3EQRA 2JBOA 2VD5A 4Z3VA 1YXUA 4KS8A 3H0ZA 3KCFA 5CALA 2RFNA 4BCJA 1BL6A 3Q96A 5IPJA 4OTDA 2UZEA 3F82A 4X3FC 3KB7A 3SD0A 2IZTA 4XG9A 4CG8A 4GFMA 1WCCA 4JQ8A 4K77A 4M67A 2YM7A 5DA3A 3ORXA 1IA8A 4GMYA 3GU6A 4BWPA 2ERKA 1KE8A 2HY0A 4I21A 2WB8A 2IG7A 3MYGA 1OIQA 5A4QA 3HGKA 4O0RA 5DRBA 2IZRA 3W2RA 2VTSA 4LMNA 4QOXA 3ORNA 3MB6A 2R3JA 2XNBA 1PMEA 4IAKA 3E88A 3DFAA 2V5QA 3KRXA 5AP5A 5HEZA 4E7WA 4K9YA 3QA0A 3O51A 3AOXA 4ASZA 2QO7A 5HX8A 3FY2A 3KK8A 2CMWA 3BL7A 4ZTLA 1RQQA 3IG7A 4D5KA 3PZEA 4EZ7A 3ZFMA 2WIHA 3GUBA 3C0IA 4F7LA 4DBXA 2PE2A 4NK9A 2JDVA 3LCSA 4FSYA 4Z7HA 2BCJA 3FL4A 4YC8A 4CT2A 1A9UA 4FE2A 1PXLA 4GSBA 4ZJIA 3M1SA 3V5WA 4R3CA 3R7VA 2QURA 3LM5A 1OUKA 1XH9A 2ONLA 4YJOA 4EZ3A 5DYJA 5J9YA 5CY3A 3EIDA 3QRTA 2PMLX 3WBLA 2Y4PA 4EZ5A 2XIKA 3R04A 5FBOA 4DH7A 3O71A 2UVYA 5K9IA 3SAYA 3CBLA 3F3UA 1URWA 3WIKA 1ZARA 2BRNA 5BVDA 4QT1A 3UP2A 4G6OA 2WFYA 2A2AA 4EI4A 4QP9A 3BGZA 4QYFA 3W2PA 4ANLA 3H3CA 4EHGA 3A7GA 5HCYA 4FOCA 5FGKA 2XK3A 4XLVA 3PDTA 5DG5A 5JRSA 3GC7A 3VJOA 2XJ1A 3DZOA 5I4NA 3ID6C 3ANQA 4WBOA 5DR9A 3EZVA 4OBQA 3PG3A 3UO4A 5J8IA 3WF9A 4DGMA 2YAKA 4U44A 4CQEA 3PJ2A 4DH5A 2W1ZA 5J79A 2PTKA 5HLPA 1O6YA 2XM9A 4DTAA 4B8MA 1F0QA 1SNUA 2P2HA 1J1CA 2I40A 5DBXA 5CAOA 2IVTA 3UTOA 2R0UA 3S95A 2J5FA 4RIXA 3CGOA 3TEIA 3UDBA 3U51A 4H1MA 3HMOA 4C0TA 1PRYA 2XVDA 4ZTQA 3EQGA 4YZMA 2QONA 4B4LA 4RBLA 4QQJA 4YJRA 5CU4A 3P4KA 4CLIA 3DBCA 3BZ3A 3AGMA 4N57A 4EOSA 3AMBA 3ULZA 3ZEWA 3TG1A 3KRRA 4YTCA 3DY7A 2J0JA 3GP0A 5TR6A 5KO1A 2ZM4A 3TL8A 1T46A 1UV5A 3SXFA 3QQKA 3R30A 4U6RA 1GIJA 5CAQA 3NVKI 4GT4A 3ZO3A 5KZ0A 4USEA 4F4PA 2XYUA 4ITHA 4GIIA 4RIOA 3FL5A 2I7QA 3FHRA 3NIEA 4DCEA 5FXQA 3L8XA 4BI2A 3QZIA 4AGUA 4K33A 3WZJA 3QX4A 3DK3A 4C4GA 3LCDA 4C2VA 4PDOA 3CTHA 4QDVA 4G5PA 3HUBA 3R6XA 3DV3A 4CKIA 4DINA 4UX9A 1PKGA 5DNRA 2WIPA 3VO3A 4BHZA 4LRMA 3QLFA 1A48A 1H08A 2GS7A 5FDXA 4BWXA 2R3KA 3W8LA 5M06A 3BWFA 4IE9A 3NR9A 1ZYSA 4BFMA 3PUFC 4OT6A 4R1VA 3FMEA 3WF8A 3DLSA 5HO6A 2F9GA 1HCKA 3C4ZA 5FM3A 4FNZA 4XCUA 4PNKA 1XQZA 4D0XA 3EN9A 1ZXEA 4E5WA 5H3QA 5ICPA 3DB6A 5K5XA 3UP7A 2GNLA 3I81A 2C47A 3QAME 1WVYA 3DKCA 3PVBA 3RPSA 3ZFXA 5CU0A 5B2KA 4O4FA 3ML1A 4I6LA 1JVPP 4NH1A 1DAWA 5CANA 4WNOA 3H9OA 3QBNA 1BKXA 4IWDA 2GNIA 3PRIA 3ATTA 5LMBA 1Y8GA 5A4CA 5AADA 1L8TA 2CNQA 3R9RA 4KKGA 3ZC5A 4BZOA 4CFMA 5CENA 4L53A 4BDDA 3ZFYA 4BY9E 1IAJA 4JXFA 4AZWA 4BCIA 4C4HA 1J3HA 4C59A 4EWHA 5HLWA 4XV1A 2IZUA 3MV5A 4FKOA 5J7HA 3G9LX 2WELA