4FUYA

Crystal structure of the erk2 complexed with ek2
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
329
Chain Sequence
PEMVVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKIDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fuyA01
2YJRA 3G33A 3EL8A 1J1CA 4YHFA 4TYEA 5KCVA 3F3WA 2I0YA 3LJ1A 3VQUA 3IGOA 3PP0A 3ORTA 2H9VA 2IZRA 4FKTA 3QQJA 5A4CA 3E7OA 2WXVA 3LIJA 4FSMA 4IC8A 3TDWA 5DR6A 3NRMA 5I3OA 3T3VA 3LFFA 2I40A 4D1ZA 4HJOA 2FGIA 4RJ3A 3R7VA 4AAAA 4FSQA 3DKOA 3TEIA 4HNFA 3ZH8A 2PVRA 1LEZA 4HVSA 4B9DA 4QT1A 4FG7A 5EW9A 2OZAB 4K2RA 2Y6OA 3QALE 5D1JA 2WIHA 3B2WA 5KMMA 5A54A 5I4NA 3TKHA 4RX7A 3TNHA 4G3DA 3D7TA 1P4OA 2IJMA 3GU8A 3AQVA 3IOKA 1BI7A 3V5WA 4EQUA 1GIHA 3F3ZA 4G3GA 4BR3A 2ACXA 1OECA 5AMNA 3NYNA 4RVTA 4ACCA 4CZTA 4KKEA 5HVKA 2EXMA 4KKGA 4RIYA 3G15A 4A9TA 3PFQA 3HAVA 4AOTA 1OKYA 5LMBA 3BYOA 5JGAA 3GU5A 4DFYA 4B99A 3UC4A 4ZY5A 2W05A 5AV1A 4O0XA 3QXPA 2BAJA 5JQ5A 5A3XA 1U59A 2UW5A 3QD0A 4WBOA 3R7UA 2BHEA 3DBFA 3FUPA 3UC3A 4FEXA 4YJPA 3A7IA 1KE6A 3DBEA 4E1ZA 4WUNA 3MV5A 4IBMA 5M51A 3LFEA 3QRIA 3ACKA 4K0YA 5EM6A 1UKIA 3KVWA 4RMZA 2B4SB 4XG6A 3QGWA 2JLDA 4EK8A 2R2PA 1UU9A 4YTHA 3RAHA 2I1MA 4QP6A 4BGQA 3PXFA 3UNZA 2R3JA 3WIGA 5JFVA 4NTSA 2BZIB 3DKFA 2GNGA 3EQFA 2EXCX 2B52A 2R5TA 1LUFA 2UW4A 4Q5EA 2OW3A 2XNBA 4M66A 3UIMA 3LJ2A 4QMOA 2YJSA 4FTTA 2F4JA 4I20A 2IZUA 3G90X 4F0GA 3KRRA 3TUDA 3ZSHA 3DTCA 2Y6MA 4FSWA 1BLXA 2C6EA 5CU0A 3CTJA 3GFWA 5CNNA 3UIBA 3LQ5A 4I4FA 5IA2A 3NR9A 5LCJA 4TKSA 4IFCA 3TKIA 2OJJA 5CXHA 2XIKA 5FQDC 3RM7A 5LJJA 3BV3A 4CFMA 4GCJA 1DI9A 2ONLC 4FNYA 4I24A 4HPTE 2Z7RA 3BLHA 3LCOA 4KWPA 2CDZA 4RQKA 4KAOA 5E1EA 1FGIA 4B8MA 2YAKA 3MFSA 4GFGA 1Y8YA 3SOCA 3G9NA 4K33A 4UEUA 3V5PA 4A4LA 2IW9A 1TQMA 3NCZA 5AIRA 5K0KA 5IQDA 1ZRZA 4FICA 4F99A 1Q3DA 3C9WA 2VO0A 3BZ3A 4JIAA 3EQDA 1WMKA 3UE4A 4C59A 4NM7A 4YP8A 5CANA 4V0GB 4YBJA 4YC8A 2R7BA 2OJIA 5DLSA 3FEGA 3R73A 3ZONA 3F5GA 2QKWB 4FZ7A 5HVYA 5IA0A 4D2TA 2WTCA 3C0HA 3P08A 4IM3A 3CY3A 4QQTA 5I9UA 5KZIA 2E9PA 3RALA 4FTJA 3ZLWA 3P5KA 4DTKA 1ZARA 3VUGA 2RFNA 3BI6A 5J1VA 2E9OA 2YCFA 2QC6A 4XRJA 2Y4IC 4F09A 4MXYA 4IAAA 4C4HA 4XEYA 3VF9A 4CFUA 4F7NA 4ANSA 2I7QA 3QLGA 4X2JA 1UU8A 5DI1A 1FVRA 3KXNA 3OCGA 4RLKA 1H0VA 4IC7A 3WARA 5ITAA 2YWPA 4UXQA 3ROYA 4IAKA 5HO7A 2OJGA 4ZSAA 4X0MA 3HLLA 5AUYA 2YLFA 1ZMWA 2QOOA 4L44A 1I09A 4QTBA 4DH1A 4EOQA 1RE8A 4N0SA 1PHKA 3QQKA 4TPTA 5D9HA 4V05A 2QOIA 4RIXB 1UNHA 2HY0A 4FI1A 4B8LA 2BHHA 2JIVA 3PJ1A 4G3EA 3T9IA 2XVDA 3D14A 3DZQA 4EBWA 2W1IA 4Y73A 3R1SA 2C6LA 4BGHA 3Q60A 4KIPA 1OI9A 3R28A 3COHA 2WMQA 1W7HA 1BMKA 4I6QA 3VS4A 4J53A 3DNDA 3UJGA 2C3IB 4RFMA 4USDA 3MFTA 3K5UA 4J8MA 2J6MA 3D94A 3OD6X 4QD6A 5JSMA 3A61A 2VTAA 4YUQA 3DK6A 4YZNA 4F63A 2X0GA 4FKGA 4O0UA 4UN0C 2OXDA 3U4WA 3PPKA 3VS0A 1JSUA 3BGPA 3F3VA 4HZSA 4U3YA 4W4VA 5AFVA 1GIIA 4YJTA 3A8XA 2F2UA 4ACMA 3EJ1A 4HVGA 2VX0A 2W1GA 2QD9A 1Q3WA 2Y4PA 3FJQE 2G01A 5A46A 4G2FA 5L8LA 3S00A 1NVQA 4D4YA 1WBWA 1DM2A 3NYOA 4OUCA 3D2IA 3MESA 4L42A 1JNKA 2WTWA 3QTUA 4L6QA 3DKCA 5CSWA 3SVVA 4PTCA 4FNZA 4IWPA 2J90A 2JKQA 3G0EA 4XP3A 2BDFA 2BRNA 5LMAA 5KUPA 2BVAA 2OG8A 2GFSA 4C3FA 3QF9A 2IW6A 3Q32A 1OIRA 3C0GA 3TNWA 4F6WA 2CKOA 2XNPA 4WIHA 4EJ7A 4OTWA 2A2AA 4G9CA 4J7BA 3E8NA 2O65A 2PVNA 2V62A 2VTOA 2W5AA 3CBLA 4GIIA 4XV3A 5BVOA 4HPUE 2VGOA 5I9XA 5IA5A 3GC0A 4FKWA 5KZ0A 3TNPC 5DRBA 4AF3A 3JR1A 1Q97A 2XIXA 4EUUA 4BYIA 4UMRA 2C3KA 2IN6A 2VTPA 3OCTA 5IA3A 3ATTA 4ZTMA 4FL3A 3TIYA 5FDPA 2QOHA 4XBUA 1ZAOA 3OMVA 3W33A 2X7GA 3MTFA 3OF0A 4MD7E 4X3JA 3TZ8A 1STCE 2OFVA 5ANKA 5HNGA 4HW7A 4I23A 1OKVA 5L8JA 2CKEA 5I5ZA 3MIAA 3O17A 1PMEA 3F82A 4J8NA 2B7AA 3O0GA 4JQEA 2WZJA 4K1BA 5TT7A 3ANQA 3SXFA 3TTJA 1H24A 5CALA 5M08A 4FKUA 4YLKA 3UOJA 3NUAA 4A06A 3GC8A 4AOIA 3EL7A 3N4TA 3C4FA 1JOWB 4PPCA 2R3IA 2ZV8A 4W4YA 2W96B 4F9YA 2XIRA 5E91A 2PWLA 4KS7A 1GOLA 4QMZA 3R9NA 4B4LA 3BQCA 4EH8A 1W0XC 2XJ2A 3I79A 3QCXA 4DEIA 4EZ3A 2WKMA 5I9YA 2CGVA 2NPQA 4GV1A 4H3PA 5HCZA 3RZBA 3NS9A 2GTNA 4QP9A 2J0JA 4OTHA 4NZWB 3RJCA 3RK7A 2C6KA 4ENXA 1BL7A 5F20A 3TI1A 4G3FA 3DLSA 3V04A 5TO8A 2J5FA 1HCKA 4G3CA 4E6CA 5E7RA 4ASEA 1CDKA 2CKPA 3LFAA 5AP3A 3ORIA 4QOXA 3UNJA 4BDEA 5GZ9A 2C6IA 2R3KA 3AC3A 3FMJA 4F9AA 4E4NA 1XR1A 4FX3A 4BBMA 3SV0A 4JBPA 4IZ7A 4XMOA 5ACBC 1YXXA 5IQEA 3F2AA 5FBOA 2GNHA 3SQQA 4FTRA 3G0FA 3UVQA 2XEYA 3ELJA 4UB7A 3PE1A 5M4UA 1VYWA 1PW2A 4X3FC 3RHXA 4TWNA 3ALOA 3OWLA 3OHTA 4CZYB 5IG1A 5EQPA 4DFZE 4LG4A 3WF9A 5B0XA 2B55A 1TVOA 5IKWA 4HVHA 4EBVA 2B54A 4HGTA 4X2KA 2WIPA 3FQHA 4FSYA 4NW6A 3KK9A 5ANJA 5AAFA 3ZC6A 4DN5A 4AZSA 5IQFA 4DH8A 1JPAA 5IMXA 4AN3A 3I6WA 1OITA 3QRJA 4BIEA 4D5KA 4F08A 2BAKA 2CMWA 5FP6A 4EWHA 4FIJA 5AV2A 3LCTA 3NAYA 3VUHA 4WA9A 4FTCA 3EN6A 3B8QA 4KRDA 4CZUA 4OTRA 3BYUA 3RAWA 3BLQA 5AUUA 2R9SA 4AT3A 3ZBFA 4O86A 4UMUA 4U9AA 2WTVA 2BRGA 3DK7A 5FTQA 4R7HA 1E1XA 3MIYA 4DH3A 5M4IA 1ZOHA 4IWQA 1E9HA 2VWIA 4IZAA 5BVFA 3V5JA 2C5NA 3OROA 4C36A 4J97A 4YURA 4JBQA 5F95A 4D2WA 3QCYA 3L9MA 5JGBA 4IAIA 4DINA 3OWKA 5AX9A 5CAQA 5AP4A 4I6FA 3PJ2A 3PPJA 3FPQA 3RZFA 5CF4A 4FKOA 4CSVA 3QGYA 2BRMA 5K9IA 3VRYA 4Z7GA 3UZPA 4ZJVA 3B2TA 2CJMA 2Y4IB 4YJUA 4TYGA 4QP3A 4X21A 2X4ZA 4MQ2A 2HCKA 2PE0A 4PP7A 4C3RA 3LVPA 3OCBA 4TNBA 4R78A 3CPBA 4JG7A 3L9NA 5BYLA 4AQCA 3QTWA 4CCUA 4O0VA 5DNRA 3WZJA 2CN8A 3ZEWA 2QG7A 1YI6A 2G2HA 5GINE 5EOBA 1Q8UA 3T9TA 4GJ3A 4C57A 5ANIA 4UX9A 2HENA 2PY3A 2QU5A 4UV0A 5CU6A 3FMNA 3WOWA 2XK9A 2C6TA 4FV9A 4O27B 3GUBA 4UY9A 4D2VA 2WPAA 2UZVA 3RINA 1L3RE 3GXLA 3UP2A 4D4SA 5C1QB 1ZYSA 1OKZA 2XNNA 4G16A 3VUDA 5AUTA 1JQHA 1XKKA 1DS5A 3E93A 2YIYA 2WELA 3AD4A 3W2OA 4RLLA 4E4LA 1YHSA 1URWA 4KD1A 2RGPA 4Q5HA 5HICA 3WYXA 5TKDA 4QPAA 3TCPA 2X9EA 2H8HA 3OOGA 1FBNA 4M15A 5BPYA 4IJ9A 5A4QA 4U8ZA 5EI2A 5G6VA 4TT7A 2BDJA 4MBIA 3RKBA 3JY9A 1Y6AA 4YSMA 3OOMA 4BZOA 3Q53A 4EH2A 5CZHA 4YJQA 3CY2A 4FTOA 4XG9A 5ANGA 3KRJA 4K18A 4ZLOA 5CAUA 3KXGA 2ZOQA 3FI2A 1T46A 3ZZWA 2PUPA 5EKNA 4CG8A 4JNWA 4R1YA 5GZ8A 4KUJA 2Y8OA 3VBXA 2J9MA 3BHYA 3NUYA 5J8IA 3DDQA 4WO5A 2JAMA 5C01A 3RPOA 2IZTA 3I1AA 4KBCA 1XH4A 3C0IA 1PY5A 2QHNA 1YI3A 4YC3A 3M11A 4O1PA 5HIBA 3AG9A 5GJFA 3R7EA 3JVSA 2RFDA 4DEEA 3PXQA 4LUEA 4BTMA 1QPEA 3JPVA 4IH8A 1V0BA 5F1ZA 3ZDUA 5CNOA 4XG7A 4P7EA 4PPBA 2PE1A 4JOAA 4FSUA 4C4FA 5CWZA 4RIOA 3RP9A 2OBJA 3FZSA 4J98A 2P2HA 4KIOA 4OTIA 4ANMA 4GK2A 4JG6A 3DAEA 4A9UA 3UZTA 4PPAA 1XO2B 4WG4A 2OKRA 4QYEA 3ZFXA 3Q4ZA 3VS5A 4G34A 5ACKA 3VS7A 4O6LA 5GZAA 3EFLA 4LM5A 2W5BA 2B9IA 3TJDA 5A9UA 4MVFA 3SGCA 4JS8A 3WI6A 3R71A 3NW7A 3CCNA 3ZC5A 1J91A 2XNMA 5JEBA 1IEPA 4FUXA 4R3RA 4YZ9A 4AP7A 3Q9YA 2YERA 3PA3A 3UNKA 4L3PA 3IKAA 4YC6A 5JRSA 2XS0A 3E8CA 2O5KA 2UVYA 2BFYA 1JKKA 1H26A 5AUWA 2F9GA 2QNJA 3VBQA 2ETKA 2C1BA 3PRFA 3S95A 3OXIA 2C6OA 4CCBA 5IQGA 4AZEA 3BQRA 2GDOA 2GNFA 1M2QA 2IWIA 5HG8A 1VZOA 5JFXA 3O50A 1G8SA 3QL8A 4X2NA 3RNYA 3OTUA 1H00A 3QD2B 1FINA 4YTIA 3ZO1A 1OZ1A 2QLUA 4L7SA 5J5SA 1RQQA 3MDYA 5D41A 3FHIA 3V5TA 5C8KA 5AP2A 1OVEA 3ZHPC 3K3JA 5HEZA 2QOKA 4KSQA 5H3QA 2XP2A 3NYXA 3ID6C 2GCDA 4B7TA 4U41A 1OL1A 2OJFE 2C5VA 4I0RA 2ZB0A 3R8VA 3QUDA 4JAIA 2W9ZB 5C9CA 3QTQA 4PTEA 2UZOA 2XH5A 4TY1A 2HWPA 2BZHB 4X3FB 3VBVA 3DU8A 3Q2JA 4MTAA 2YHVA 2WOUA 4NM0A 2W4KA 5EI8A 4AU8A 3S4QA 3UBDA 3G51A 4I92A 4FNXA 4PDSA 4I6BA 1ND4A 5C8MA 4ANQA 4ITJA 4FYNA 3DTWA 4FKPA 4HZRA 2VWVA 3HV3A 2CN5A 5KKRC 4ZLZA 4EK5A 2BROA 3FLSA 4K77A 1V0OA 3DB8A 3F69A 3OUKA 4QTAA 4KA3A 3VAPA 4ASZA 1JAMA 3O8PA 3KGAA 3TG1A 3W2SA 2ERKA 4R5SA 4BI2A 5J79A 3V5QA 5DGZA 5J9YA 4RIXA 4Y83A 3MN3A 2JAVA 4LGHA 5EYMA 1BKXA 5DRDA 4FTAA 3ZU7A 4MEDA 2A27A 3DPKA 3P1AA 4CKRA 1MUOA 4APCA 3IPHA 3KMWA 3FLYA 4MXCA 4PMTA 5J7HA 3NX8A 2QODA 4QMYA 5AUVA 4EHZA 1Q41A 3FMKA 4QTEA 4ZSGA 5ANDA 5IUIA 3C5IA 4GYIA 4RSSA 1Q24A 3OC1A 2FO0A 4EHGA 5LWMA 1R0PA 3ZUTA 3GNIB 3V8SA 4RQVA 4O7NA 3FLWA 5IH6A 4ZSEA 4IVAA 1U5QA 2VZ6A 3OEZA 3VUKA 4WHZA 4XP2A 4YPDA 3NUSA 3EQRA 3S0OA 1UNGA 5CU4A 4EI4A 4USFA 3LM5A 3MFUA 4FR4A 2CNUA 2C68A 4FV3A 4YJRA 3GCPA 3Q9WA 3RPYA 3ZYAA 3Q3BA 3BU6A 4MAOA 3COMA 1Z57A 4O0TA 3VS1A 3EWHA 2XMYA 4FOBA 4MH7A 5CU2A 4C38A 5KMIA 4F65A 4ZLYA 4HGEA 3A7FA 2WEVA 4U40A 2W1ZA 3O8TA 4TNDA 4R8QA 3O23A 4ZZMA 2O0UA 5IMEA 4EOMA 4C58A 4C2VA 1O9UA 3F9NA 3PA4A 3QUEA 3E64A 3GOKA 3TL8A 4AX8A 3UZRA 3ZFMA 1YHWA 2OH4A 1JLUE 4MF1A 4PTGA 3GC9A 5HKMA 4K11A 3PXKA 3DXPA 4DYMA 3AXWA 1Q62A 4A9SA 4CYJA 4FTUA 2DS1A 5AAEA 4KIQA 4YZCA 2C6MA 3KK8A 3PVGA 5EHOA 4F1TA 4FVPA 5LVNA 3POOA 4R3CA 1UU3A 4XP0A 5D10A 1IG1A 4QMUA 4F9WA 1PRYA 5IQCA 2ZMDA 3OFMA 3I0OA 4PL5A 4BCHA 2YIRA 4WNPA 1H4LA 3GCSA 5HE2A 2W4OA 3H4JA 4C4JA 1H0WA 4QMWA 3NUNA 3BWJA 3BYMA 4FIIA 3BWFA 4YO4A 4ALUA 5CEMA 1SMHA 3G2FA 3PJCA 4CGAA 3FKLA 5C4LA 2QO7A 3NIEA 4EOPA 2HZNA 3KN6A 4DGNA 3U9CA 3LFCA 2C1AA 5HVJA 4FGRA 2BKKA 4YPSA 2X9FA 3PY0A 3QFVA 5AP7A 4EK6A 1ATPE 2RSVA 3JY0A 4AWIA 3GGFA 4DGGA 4N6ZA 5J9LA 3ZBXA 4RWKA 3D5VA 4J99A 4RA5A 3FQSA 1K9AA 5T6KA 3SDJA 4EH5A 1KE7A 3VJOA 5L8KA 3O7LD 4TRLA 3RVGA 5CYIA 3BE2A 4V04A 4YZBA 3LMGA 2BIKB 3FI4A 3H3CA 4BWKA 1PXKA 3CXWA 3GU7A 4TN6A 5CLPA 2RKUA 3KQ7A 1L8TA 4EONA 4ASDA 5CSPA 3IOPA 4TWPA 1CMKE 4DC2A 2FH9A 4E5WA 3QRUA 2VWYA 4J95A 1YI4A 1RDQE 4XG3A 3LMHA 2I6LA 4X2GA 2WAJA 5JQ8A 4NK9A 5A4EA 3M2WA 4RX9A 1P5EA 3TT0A 4ANOA 5JMSA 3FPMA 1TKIA 5K4IA 5DR2A 3TNQB 3NUUA 5EYCA 3BHVA 4QMVA 4UMPA 2VTLA 4IAFA 1QPCA 3UQGA 4E73A 1XBCA 2WB8A 3MY5A 4AZTA 3THBA 5EFQA 3F88A 3E88A 1B6CB 1SNXA 5LCKA 1J3HA 3IW8A 4BTFA 1CTPE 1QPDA 3I60A 3FSFA 2WD1A 3DV3A 3G6GA 4M0YA 4CRLA 2HW7A 5DOSA 1V0PA 5DHJA 3A62A 1MRUA 5E8YA 4GT4A 4CQGA 3NVKI 3UOKA 4ANNA 2WMVA 4DE4A 2BTSA 1YXUA 2XK3A 1PYEA 4DITA 4F1MA 3U6HA 2RIOA 4IIRA 2ONLA 4ID7A 3P79A 4A9YA 4K6ZA 3QA0A 4XX9A 5AIKA 4GU9A 3P9JA 5IH4A 2X1NA 2UW7A 3UTOA 5LVMA 3R2YA 2CGXA 4ANLA 1H01A 1HOWA 3P7AA 4LV5A 2YM3A 2YZAA 4XS2A 3OY3A 1OIQA 4YLLA 3AMYA 3DAKA 4ZMFA 1W83A 3QBNA 4L43A 3MPTA 4R6VA 2VV9A 3CLYA 1RJBA 1P4FA 3A7GA 3TIZA 3ZDIA 3U87A 3FMLA 1M2PA 2BPMA 4E5AX 1F0QA 5HNIX 3UOLA 2PVYA 3FWQA 4QO9A 4RJ8A 4FIEA 3AMBA 1Y6BA 1GNGA 3P7BA 3VW6A 3R1QA 3PXYA 4NFNA 3QZGA 3POZA 4L00A 2VU3A 3BBWA 3W1FA 3EMGA 4H3BA 3SD0A 3NCGA 2R3OA 1W84A 4BN1A 4IVCA 4E4MA 5HG7A 4UMTA 1XH5A 3MTLA 3R0TA 3I6UA 1YKRA 4O7SA 1OL2A 4E6QA 3KCFA 5FP5A 4CKJA 2HIWA 5H8GA 4NJ3A 5JGDA 1SNUA 5HBEA 4Z3VA 3HKOA 4U45A 4GG7A 3FL5A 3OG7A 4ZIMA 3LMIA 3V6SA 5KKRB 2YM5A 3LLTA 3PIXA 4ARKA 3QKMA 3IQ7A 4R7IA 4FE2A 4AA0A 3LCSA 1H1SA 4QP4A 1OL6A 4AT5A 2C4GA 4FT7A 2BR1A 3U51A 2PYWA 3R7GA 3EN4A 1XH6A 3TWJA 1NVSA 2ITTA 5CTPA 2VTHA 1PXIA 4ZJIA 2UVXA 3OW3A 1H8FA 2VTSA 3BGZA 4R1VA 3GCQA 1QMZA 5FDXA 3LFQA 4L45A 3OWJA 2Z60A 2LGCA 4I94A 1UV5A 2GTMA 4FVQA 5ANOA 4CKIA 3S1HA 2HY81 2HK5A 5DN3A 3NZ0A 3VHEA 3HV6A 1FMOE 4OR5A 5IEVA 3MVHA 3NNWA 2X7FA 1APME 2ITUA 2JFMA 3IW6A 3IS5A 2F7ZE 5FXQA 2VTJA 3GOPA 5BYYA 3ZO2A 4C61A 4S33A 3L9LA 3RNIA 3VF8A 4PDOA 4DF3A 2XK8A 3QWJA 2P33A 3UOHA 4GVAA 4BCNA 2W4JA 2JKMA 2WQMA 2BMCA 4EOJA 3U6JA 2O64A 4G31A 5CAVA 2ITQA 1RW8A 3PSDA 5EKOA 3RK5A 1KSWA 5M4FA 3CGOA 5IISA 1YOMA 2CNVA 2B9JA 3P0MA 2UW0A 2G2FA 3ZOSA 4LUDA 3R9OA 3FKNA 5I9ZA 4MHAA 5HCXA 4QMTA 1R39A 2X7OA 2XYNA 2CGWA 4FL2A 4FSTA 5HESA 2WTDA 3FY0A 3OWPA 3T3UA 4AGUA 3RTPA 2R64A 4MYGA 5CF8A 2J51A 3UQFA 2GNIA 4ZTHA 5GIPE 4WRGA 2WU6A 5D7VA 5HU9A 4DGOA 5HD4A 4YNEA 4YJNA 4EH6A 2YIWA 1J7IA 4DA5A 4RG0A 3ENMA 3LAUA 3VUMA 4C2WA 2C0TA 2YWVA 4AXAA 4JQ7A 3REPA 1PXLA 3VC4A 5I3RA 3FY2A 2UW6A 5HBJA 5JZNA 2YIXA 3VULA 3C50A 2ETMA 3NWWA 5JFWA 1YXTA 3L8PA 3Q9XA 5D7AA 4EHEA 4F6UA 2YM8A 3UO6A 1DAYA 4BCKA 2ETRA 2ZV2A 4GFMA 3E3BX 2NO3A 4QNYA 1T45A 4DG0E 4MXOA 1GZKA 3TZMA 3KKVA 3A7HA 4QTDA 3ZCLA 2HWOA 4F7SA 5AA9A 1OB3A 5TF9A 1JKLA 5FLFA 4ZJJA 3BELA 4LMNA 3R7YA 5K5NA 5M44A 4HVDA 4Z16A 5CEOA 5AV4A 2GFCA 3Q5IA 3C4XA 4GSBA 4CFWA 3DJ7A 2BZJA 3PPZA 4PNIA 2W0JA 1BYGA 2OO8X 2XEZA 3NSZA 4HNIA 4HYIA 5CSXA 3UYSA 2VAGA 4HCVA 4EQCA 3AT3A 2A4LA 1IAJA 5CAOA 4AGCA 1Q4LA 2XYUA 2OGVA 5EOLA 5IA1A 3KN5A 2X6DA 1GY3A 3JYAA 4QP7A 4O81A 3HECA 3PZEA 3U55A 5EQYA 2C6DA 4DT9A 5F9EA 1ZY5A 1OBGA 1CM8A 2XNOA 4N70A 2HOGA 4IJPA 3MPMA 5ANEA 2GNJA 2XRUA 4FZ6A 3AD5A 4IWOA 4F7LA 2WTKC 4M84A 2AYPA 2Q83A 5DEWA 1KE9A 2HYYA 2WQOA 1WBTA 2PE2A 1H25A 5AR8A 4Y5QA 5AR3A 5DE2A 4G5PA 4D4RA 4LV8A 4ENYA 4WSYA 4G6LA 3QZHA 3MJ2A 3KXHA 4ERWA 5DBXA 4CFNA 4RBLA 3MW1A 3ZS5A 4X3FA 4DLJA 4EYMA 3VNTA 4QP2A 2IVSA 4C8BA 4XBRA 4BCQA 4GK4A 1YOJA 3ET7A 2CLQA 4JXFA 4XH6A 5J87A 4GFOA 4X6QC 2BRHA 4AZVA 5AR5A 4FEUA 4YBKA 2YM7A 3ORLA 2BDWA 3HGKA 5FM2A 2WMRA 3CD3A 4FV6A 2ZM1A 4RC2A 3NW5A 4N6YA 1W8CA 4RC4A 3R9DA 4S31A 3QYZA 1FGKA 1XBAA 3NGAA 4XV1A 3R21A 3CR0A 4QQJA 2R4BA 1OPKA 2UZLA 4O7RA 3AC4A 2VX3A 5J7BA 4IACA 2NP8A 4Q9SA 3W2QA 3BE9A 4XV2A 5JH6A 2EUFB 3KVXA 1H1RA 4FG8A 4WG3A 5HORA 3RPSA 3NPCA 4AGDA 1A9UA 4NFMA 3ZTXA 1U4DA 1CKIA 4BZNA 2BUJA 3D0EA 1OUYA 2BCJA 2UW9A 1NW1A 3P23A 3BRBA 3AMAA 2PL0A 1H1PA 2BTRA 3UG2A 1JSVA 5AP1A 4AZFA 2W1EA 2YCRA 1BI8A 1PMNA 5M07A 4UYAA 3AGLA 4FT9A 3ZO4A 2B9HA 4O82A 3KC3A 4U43A 5CSHA 4F0IA 3FC1X 5KE0A 1GIJA 4BBEA 2QOBA 4GKIA 4XRLA 2R3LA 2IVVA 3Q4UA 4C33A 1VYZA 2PVMA 1XH7A 2Z7SA 3LW0A 4PRJA 4QMNA 4GW8A 3SOAA 1CSNA 5JT2A 1M17A 2YISA 3W16A 4BWPA 1YW2A 2WMBA 3FYKX 2XA4A 4NT4A 5BMSA 4FTNA 1GZNA 3A4PA 3AT4A 4OAUC 1LPUA 1PMUA 3FXZA 3KMUA 4EC9A 2GHLA 3R7IA 4V01A 4F64A 5FM3A 3SW7A 1XH8A 2XBJA 5E8ZA 4W8EA 4MWHA 3PIYA 2JEDA 4P5QA 4GEOA 4KBKA 4KRCA 1ERKA 4BYJA 4JJRA 2Z7QA 5AJQA 5L6WL 5FTOA 4BY9E 4ZEGA 2I0VA 2YAAA 3C7QA 2EU9A 2ITVA 4IDVA 3QHWA 2B9FA 3DB6A 5BVEA 2WTIA 1MP8A 3BEGA 1SYKA 3PY1A 2WMAA 2UW3A 2C5YA 1XWSA 3MY1A 3MB7A 1PXMA 2KTYA 2F49A 2PZ5A 3OZ6A 5CXZA 3CJFA 2ZVAA 3PYYA 4C37A 4EEVA 4Y72A 4YTCA 3H0ZA 4XOZA 3D5XA 1KOAA 4E93A 4NYEA 4O0WA 4BGGA 2RG6A 5LOHA 2ITPA 5CVFA 4U3ZA 3UODA 5KMJA 4QQCA 3MH0A 3OW4A 4F9CA 2JC6A 1VEBA 5H2UA 3KXMA 5I9VA 5HIDA 1ZY4A 1R78A 3PTGA 5HTBA 5C03A 4DEHA 4CG9A 4CMOA 2KULA 4OLIA 5CSVA 1YDRE 2WMSA 5CF5A 4ACDA 1J7UA 2A1AB 4QRCA 3RBWA 2PULA 3LQ3A 1YDSE 4W9XA 4WNOA 3D4QA 1WVXA 4OBQA 1KE8A 3O2MA 4FV7A 1UWHA 4O7YA 4L68A 3OT3A 4Q9ZA 3RI1A 2EWAA 2YM4A 3BKBA 4O2PA 3VS2A 2O3PA 4BCMA 2ITXA 3DZOA 5CEQA 4P4CA 3F5PA 4BIBA 3GI3A 5LARA 2J4ZA 5GIOE 3KU2A 5AAGA 2X81A 3KF7A 3NNXA 4CV9A 5EI6A 5FGKA 4O22A 4L7FA 1NXKA 2RF9A 4G5JA 2R3MA 3A8WA 5HE3A 1IA8A 3QD4A 1OUKA 2YEXA 3HDMA 4IB5A 3H0YA 4NCTA 4WOVA 4D0XA 4A9RA 4G6NA 3UVRA 1WVYA 3NLBA 2C5OA 3TKUA 5AEPA 4RZWA 5L2IA 4H1JA 5HLWA 4I6HA 3C4ZA 4O0SA 3A99A 1ZXEA 3MB6A 2V7AA 2GHGA 3EOCA 5HD7A 4U42A 3BHHA 4EH7A 1KV1A 3I7BA 5CEIA 3OY1A 4IVBA 4NWMA 4DH7A 4RA4A 1LR4A 2W7XA 3QTRA 5M4CA 3W2PA 4DBNA 2X8DA 3LXPA 4YR8A 1H28A 2WNTA 3D5WA 4YZDA 4I1ZA 4L53A 4AW2A 2BIYA 3UP7A 4FODA 4NUSA 4OT6A 4O0YA 3LFDA 4LOOA 4MKCA 4WBBB 1G8AA 4IXPA 1PJKA 4K8AA 5JZJA 2IZSA 4L9IA 4FIGA 2WMWA 2OIQA 3QTXA 4NIFB 4D1SA 3E5AA 4BKZA 2PVFA 1JKTA 4FVRA 1AQ1A 4FK3A 2DUVA 4MBLA 2JKKA 3NVMB 4I21A 5AV3A 3VBWA 3TUBA 2I0HA 3HMMA 3TUCA 1PKDA 4OAVB 4U5JA 4RWLA 2Q0NA 3DFAA 2J5EA 4TL0A 4NCTC 2QOQA 1YRPA 4FKRA 4APPA 4QPSA 4UBAA 3CE3A 2YDKA 5HOAA 5FXSA 5BNJA 1LP4A 1WFCA 3KCKA 2OLCA 1H1WA 4G6OA 3ODZX 4M69A 3RWPA 4D1XA 2UV2A 3OT8A 4WKQA 1BL6A 3ZLXA 3V3VA 4FV5A 2QU6A 4Y5HA 4U0IA 3QQGA 4BCJA 2GS2A 3AC5A 4TZRA 3LXKA 4MBJA 4N57A 3AC2A 3R22A 4OBOA 4XLIA 5EH0A 5ETCA 4DEGA 4I0TA 5EDQA 4YNOA 4P2KA 5HTCA 4FZAB 3F3UA 1R0EA 1U46A 2VD5A 2WTKB 5J1WA 4U7ZA 4PV0A 3IO7A 4FBXA 3EKNA 4FKVA 5J5TA 5LQFA 5F94A 4CT2A 3KY2A 2X8EA 5CX9A 2R3RA 3C4WA 2J50A 4F9BA 3R30A 4NL0A 4UZDA 1ZZ2A 1OL7A 5E8SA 5FEEA 3UPZA 4EOOA 2HELA 2VTQA 4MX9A 2VWXA 4EOSA 5FUTA 2FSLX 2WQEA 3KXXA 2E9UA 3VBYA 1M7QA 4AW0A 5J9ZA 4PQNA 4OTDA 5DT4A 4L46A 3UGCA 3D7ZA 1Y91A 3FLZA 2Z7LA 3R1NA 3ITZA 3ZFYA 4O7WA 4FV2A 1XQZA 3VWAA 4DTBA 3CTQA 2J0LA 4FT5A 1P14A 5HGIA 4BCOA 4JL9A 3H30A 4RZVA 2C30A 4KBAA 5CT7A 1IASA 4PMMA 1GZOA 5HG9A 2XK7A 5BVKA 3HP5A 3O7LB 4ACHA 4O7ZA 3ZM9A 4DFBA 2QURA 4BF2A 3UYTA 3QZIA 4IADA 4OTPA 4FL1A 2J7TA 1DI8A 4YZMA 4J71A 4Z9LA 4BZDA 4DEDA 4Y8DA 5FEDA 4BKYA 4C4IA 3GENA 4FT0A 3ETAA 2PMIA 4ZXTA 1ZYCA 2OIDA 5G1XA 2PSQA 1K3AA 4PL4A 1JSTA 2Y9QA 5CS6A 3QTIA 5TE0A 5AX3A 2VWUA 1UVRA 4RJ4A 3TNIA 1E1VA 3P4KA 3N4UA 4RWIA 4QP8A 1JVPP 1FOTA 1ZYLA 5EHLA 4H1MA 2YABA 3QQHA 4D2PA 2EB2A 3ZM4A 4ALVA 3U54A 1QPJA 3AGMA 3CC6A 3H9RA 2R3FA 2UZUE 3NUXA 3HMIA 3OXTA 3RCDA 4IB0A 3R1YA 3UO5A 2DWBA 3F7WA 3E7VA 2ITWA 3MJ1A 4WNMA 5I9WA 1Q99A 2B1PA 2GNLA 3V8WA 4NKSA 3DKGA 3KRWA 4RJ7A 3BIZA 3ZLSA 5C26A 1IAHA 4FEVA 1OMWA 3LPBA 4U79A 3W55A 4ZTSA 5CT0A 3TACA 3BHTA 3JVRA 1H08A 4E6DA 5CENA 2OXXA 1YXVA 3HRCA 1IR3A 4OW8A 4TYIA 4D2SA 3K54A 4HCUA 2F2CB 5CI6A 3GT8A 2PMLX 3A60A 4EK4A 2GMXA 4TYJA 3LE6A 3Q9ZA 1XH9A 2ZJWA 3GP0A 4EQMA 3PDTA 1VR2A 2R3HA 5DPVA 5E8WA 3C5UA 3DBQA 4ZS0A 2VWWA 3D5UA 4IEBA 3RAIA 4C35A 4BI1A 3AT2A 3QA8A 3LXLA 4PDPA 4OTQA 4I93A 5ETIA 4FMQA 2YITA 3KULB 5AP0A 2OXYA 4BHZA 2OSCA 4AA5A 1A48A 5ICPA 1J7LA 2W1FA 4E8AA 2J0MB 3DA6A 3PRIA 3WZEA 1WBVA 4XOYA 1W98A 2G9XA 1UNLA 3CP9A 2JDSA 3V6RA 2CGUA 4WD5A 3HNGA 3FQEA 4M8TA 4FYOA 5FD2A 1ZZLA 2AC5A 3UO4A 2WFYA 1U5RA 2CPKE 1SM2A 1WCCA 3FZPA 3R02A 2X4FA 4PY1A 4R5YA 5HX8A 5K4JA 2PK9A 4ZTRA 3GFEA 3ZRKA 5DEYA 4EZ5A 3QLFA 3ALNA 5HZNA 2JGZA 5L3AA 3FZOA 5EHYA 4BDJA 5M56A 4QMSA 3RGFA 3HDNA 3GVUA 2IO6A 4QYYA 4DFUA 2HW6A 1Q8YA 4HYHA 3KF4A 4S2ZA 2YM6A 4YSJA 5LWNA 2P55A 1S9IA 4A4XA 4H3QA 1M2RA 2RFSA 2WOTA 4FIFA 2WEIA 4O91A 5CY3A 2PU8A 4ZK5A 4NM3A 2ESMA 4Y85A 2UW8A 4E6AA 2ZV7A 3KREA 2XIYA 5T3QA 4NSTA 2WMTA 3EQBA 3R9HA 5I0BA 3BV2A 2O8YA 3R00A 2WTJA 3PJ8A 2BRBA 3DNEA 2R3QA 4MXZA 4DG2E 3DFCB 3O71A 5CQUA 5DIAA 2O2UA 4WG5A 3HV5A 2VTNA 2JBOA 4UXLA 4UWYA 3E87A 1F5QA 3RK9A 3HRFA 3EKKA 3FMDA 5CVHA 3FYJX 4PWNA 3ZZEA 3PJ3A 4BB4A 1IRKA 4ZTQA 2EXEA 2XCHA 4BDHA 1REJA 2J2IB 3ZO3A 4MNEB 4E26A 3DDPA 2DQ7X 2XZSA 3II5A 3NNUA 4XG8A 4RWJA 4RFZA 4KABA 1H1QA 3BYSA 2IW8A 3SXRA 4UZHA 2SRCA 5B7VA 2BAQA 4GRBA 3DJ5A 5HIEA 3EQGA 3ZMMA 3AC8A 3HMOA 4JIKA 4AW1A 4EJNA 5BUEA 4EH3A 3QU0A 4NJDA 3B8RA 3UMWA 3IDPA 5HO8A 3DT1A 2YCQA 4QYGA 2XKEA 3PG1A 5EG3A 2OJ9A 4OBPA 2GU8A 2JD5A 3SRVA 5KX8A 3FI8A 3E8EA 2V55A 1B38A 5HLNA 5DR9A 3LQ8A 1IA9A 4O7LA 3I5NA 5K5XA 3H9OA 3Q6WA 4ITHA 1JKSA 3COIA 2QO9A 4X2FA 5FEQA 4BDAA 4O83A 1M52A 5EW8A 4I5HA 3QRTA 2XCKA 3BBTB 5M09A 3I4BA 3PSBA 4HOKA 5DH3A 1KV2A 4FV4A 4BCFA 3KA0A 4QMXA 2YLEA 3I5ZA 4BL1A 3SG9A 4GYGA 3AOXA 3FXXA 3IG7A 3FZ1A 5LMKC 1MQ4A 2OZOA 4CLIA 3PP1A 5EM7A 2OH0E 4A7CA 3Q4TA 4YJVA 2ZDTA 2CHLA 3KB7A 2C0IA 3QC9A 4A07A 5L4QA 4GG5A 3SXSA 4HVIA 2QKRA 3MPAA 4XCUA 4ZSJA 5CAPA 3WF5A 4M69B 3RHKA 5E1SA 3IW5A 4OGRA 2B0QA 1Q8ZA 4I22A 3TN8A 4P90A 3WYYA 2EB3A 5K0XA 3L8VA 4LI5A 1OL5A 4ALWA 5KMNA 2YA9A 1OGUA 2BILB 3CKWA 3JUHA 2E9VA 3QYWA 4HYUA 4NM5A 5B2KA 3S2PA 1FVTA 2IVUA 3EFKA 5CI7A 3CTHA 4LGGA 3DK3A 5CEPA 2XNEA 2ZV9A 4ZAUA 3ZRLA 2VWZA 2CNQA 5IQBA 3C4EA 3N51A 4IX4A 4IM2A 4Y46A 3F66A 4ANBA 4EKLA 1TQPA 4DGLC 4S32A 3EQCA 4FGBA 5IUGA 4LGDA 1X8BA 2XK6A 3W18A 3D83A 4OTFA 3SA0A 5FBNC 5H8BA 2VTTA 4LQMA 3MYGA 3QKKA 2ERZE 4YJSA 1H27A 4WSQA 1K2PA 3FKOA 4IE9A 3FXWA 3FSKA 4O38A 3ULIA 3VO3A 4J52A 2E2BA 4RX5A 4IAZA 5IA4A 2GQSA 3EQHA 3PG3A 5M06A 3IDCA 3R7OA 5IZFA 4RJ5A 3EFJA 3MH2A 3VQHA 2P2IA 4FKIA 2CCHA 2UVZA 3FE3A 2E9NA 3W2RA 3SAYA 1PXJA 2QVSE 2XBAA 4DFLA 3HV4A 4NU1A 4AZWA 3ODYX 2BZKB 3HUBA 5LVPA 4KINA 5BVWA 1UA2A 3UPXA 4G17A 4BCPA 2C3LA 4W8DA 3FMMA 3DBDA 4AE6A 2ZMCA 4JBVA 2ITYA 2X2MA 4RIWA 2BALA 4DFNA 3MGYA 4AS0A 4IQ6A 4F6SA 3ULZA 2VUWA 4CMTA 4BFMA 4YGAA 2HZ0A 4EOKA 5L6PA 3QQFA 5DWRA 4FEWA 4AACA 4JR7A 3FV8A 4BHNA 2UZWE 2P4IA 3DCVA 4XNEA 4PDYA 1ZOEA 3O8UA 3BU5A 2RG5A 5AR2A 4F4PA 4LYNA 4PF4A 3TZ9A 2UZEA 4E4XA 5IQIA 1JBPE 4XLVA 4JDHA 5D11A 2UZNA 3CJGA 2EVAA 4UMQA 4R77A 3V51A 2PVHA 4BTKA 4KB8A 5HCYA 4AE9A 4FSZA 3CIKA 4NIFA 3NEWA 2UZBA 4BDKA 4CYIA 4E5BA 3ANRA 2ZB1A 3Q6UA 4TWCA 5E8XA 1MRYA 4ZTLA 4AG8A 3R9RA 3WZUA 4GKHA 4BVUA 5EM8A 4GMYA 4M97A 1YVJA 5AUZA 2OK1A 3HVCA 5HX6A 3D15A 2QR7A 3MI9A 2R3GA 3MSSA 3M42A 4JG8A 3EQIA 4AFEA 3DLZA 2C3JA 3EYGA 5E90A 3TV7A 4EHVA 2R3NA 4J96A 2QQ7A 1OBDA 4L67A 4BRXA 4IMYA 2GS6A 2PVLA 4DEAA 5AP6A 3BX5A 4F0FA 5A14A 4M0ZA 2XKDA 4I4EA 3BEAA 2X2LA 4MQ1A 4QMPA 3U4UA 2PMOX 4RPVA 2QO2A 2YACA 4PNKA 5L2SA 4WT6A 4C3PA 3R6XA 5IH5A 2V5QA 4Z55A 1CKJA 1WAKA 4BCGA 3OVVA 3OXZA 2R3PA 1PXPA 3MWUA 2WQBA 3MVLA 3WF6A 4LMUA 3F5XA 4DLIA 4FSRA 1QL6A 4KIKB 4RVMA 3G5DA 4CD0A 2PTKA 2ZDUA 4M3QA 1REKA 2REIA 3RM6A 2BKZA 1W82A 4AN9A 3GQLA 4FOCA 2G1TA 5AR4A 3C13A 3ATSA 3SG8A 3HA6A 3W32A 3LJ0A 5EDRA 1JWHA 3NYVA 2WQNA 3OBJA 3PA5A 4FK6A 4MXAA 3RWQA 4F70A 5A6NA 5IDPA 1CKPA 1WVWA 3QX2A 3MS9A 3R83A 4GH2A 1SVHA 3EH9A 4KSPA 5JKGA 2OF4A 4F1OA 2PUNA 5FRIA 2NNWB 4RVKA 2JITA 5BMMA 2XM8A 3P7CA 4FG9A 1BUHA 5HLPA 2HAKA 4IVDA 1H07A 3MA3A 3R8MA 1Z9XA 1HCLA 1NY3A 5AM7A 4M14A 2XKCA 3CQEA 3SLSA 3V5LA 4AOJA 4LL5A 4WRSA 1U54A 4FKSA 4DAWA 4DCAA 3FLNC 3TTIA 4LOQA 5LVLA 4O84A 4H05A 1UKHA 4UYNA 4BC6A 2NRYA 3IECA 4J1RA 3COKA 2NRUA 4IX3A 5C8NA 2AUHA 4TWOA 4GUEA 4JT3A 5BQ0A 2VTMA 3OUNB 5AV0A 4GIHA 4D58A 3QXOA 1YWVA 5T68A 2RFEA 5FXRA 3CEKA 2B53A 3BYVA 2X8IA 4U6RA 2C69A 4ZOGA 5IQHA 4G1WA 4S34A 4CTCA 4DBXA 4W4WA 4JVGA 3NDMA 1OKWA 4YHTA 3VUIA 4BTJA 2CSNA 2QI8A 3ORKA 2XJ1A 1YWNA 2PZIA 3ENHA 4FV0A 4GVJA 4JQ8A 1KOBA 4Q2AA 4UWBA 5L2QA 3PXRA 4LFIA 4LRJA 2YZLA 3DY7A 2UZDA 2WMUA 3EIDA 3FDNA 3FBVA 5A4TA 4JAJA 3R01A 3KMMA 3UIUA 5J95A 1FPUA 2OIBA 2VTIA 3FMEA 2R7IA 3GEQA 4M13A 5KMLA 3O51A 5KBQA 4C4GA 4AGWA 3GQIA 4ZP5A 2HXLA 4PX6A 4RX8A 3DXQA 5FG8A 2Y7JA 3SRVB 4BCIA 2YDIA 5AUXA 2I0EA 3ZSIA 2IG7A 4RGJA 3O96A 5JK3A 4XYFA 5GJGA 5C4KA 4RRVA 5A6OA 1EH4A 1YWRA 3RPVA 4RFYA 1I44A 3NIZA 5CVGA 1OIUA 3FL4A 3IW7A 3LZBA 5DT0A 5E8UA 5HQ0A 3DXNA 3F5UA 3C4CA 2WMXA 4OTGA 5EYDA 2XM9A 3KULA 4KS8A 4UWCA 2ITOA 3RAKA 4B6LA 3G6HA 3QTSA 3QCQA 4EC8A 3DQXA 4FTIA 3GBZA 2PMNX 3C51A 4FNWA 4X7QA 4IAYA 3VIDA 2Z2WA 3E92A 3ZSGA 4QMLA 2JDRA 2XK4A 4LRKA 4JDIA 3C1XA 5CEKA 5HE0A 1WBPA 2FSTX 4FKJA 4GT5A 4EORA 2PPQA 3NW6A 3BLRA 2A0CX 2FA2A 2UUEA 3HYHA 3HAMA 5CASA 4C34A 3GCVA 4C7TA 2H96A 3GCUA 4H58A 3F3TA 4JRNA 3OTVA 3ERKA 3HL7A 5IEXA 4ZSLA 2OI4X 3N9XA 3E63A 3RMFA 4DCEA 3ZXTA 1FMKA 5L2WA 4CT1A 3D7TB 4IANA 5HG5A 3WILA 4E20A 1QCFA 4GUBA 3QAME 3GU6A 2XB7A 3SKCA 3PWDA 5CU3A 3VHKA 2W1CA 5CZIA 3P78A 1PYXA 4BI0A 3WF7A 4RIYB 1SZMA 2F57A 4DHFA 4EH4A 3EQPA 5DG5A 5LVOA 2OU7A 5H8EA 5AP5A 3GB2A 3PY3A 4YLJA 4CRSA 3H10A 3KRXA 3F7ZA 5HNBA 5B2LA 4FF8A 1NA7A 2YCSA 3GC7A 4BDGA 1AD5A 2AC3A 3E62A 3FC2A 4LRMA 3UG1A 4D0WA 4E7WA 4MK0A 2PUIA 3MBLA 4O0RA 2HZIA 5E4HA 5KBRA 5D12A 4PMSA 3QD3A 4EL9A 2YDJA 4G9RA 4EOLA 3Q2MA 3FZTA 4FT3A 4BBFA 2J0IA 5AA8A 4Y95A 4IB3A 1Q8TA 5GHVA 4FTKA 3UMXA 2G2IA 2QOLA 4JDKA 4C62A 3WE4A 3VS6A 3LFBA 4FTMA 5JRQA 3Q4CA 4S30A 3IK3A 3MVJA 4M67A 4ZTNA 5HTIA 3FMHA 4FTLA 3VW8A 4MNEA 5H9BA 4MD9E 3UVPA 1P2AA 4PL3A 4PMPA 2JIIA 2F7XE 5HE1A 4CLJA 1WBNA 2RL5A 2WU7A 4LOPA 3TV4A 4IDTA 4BDFA 1PXNA 4LL0A 3W8LA 4U81A 3LHJA 3QRKA 3HMPA 4QMMA 2WO6A 4RJ6A 4EYJA 2X6EA 1OPJA 4TYHA 3WBLA 4IZYA 4ERKA 1ZMUA 1UU7A 2C0OA 4RIWB 4D55A 4YU2A 4DEBA 2ZM4A 5KMOA 3PVUA 4NKAA 1B39A 2F7EE 3JS2A 1KUTA 1F3MC 5AWMA 4UALA 2XUUA 3I7CA 4FSNA 4DG3E 4EH9A 2VO7A 3LM0A 4P5ZA 4XV9A 3HX4A 3JXWA 4DFXE 3OS3A 3PVBA 3EYHA 4NH1A 3UDBA 4IX6A 5KNJA 3HRBA 5F4NA 4D4VA 2G15A 4TXCA 4EWQA 1O6YA 2QOFA 3E8DA 1G5SA 2VTRA 2W5HA 2OFUA 3PE2A 3PLSA 3DQWA 4FTQA 4FZDB 4KNBA 4NEUA 1M7NA 1S9JA 4QTCA 3T8OA 3I81A 4O7TA 1FVVA 5IDNA 3LFNA 4WUAA 2XJ0A 4I3ZA 3TXOA 4IB1A 4D9TA 3KRLA 4I5CA 3UQCA 3K2LA 4IWDA 3DS6A 3MY0A 1O6KA 1XHAA 2P3GX 2JDOA 3ORNA 4FKLA 1NVRA 4CXAA 4O7VA 3HMNA 3MVMA 2Z02A 1VJYA 5GNKA 4Z7HA 3CSVA 1YDTE 3V01A 4AW5A 4JDJA 4EUTA 3HA8A 4JBOA 4JRVA 3LKMA 3L1SA 2YIQA 1YOLA 4DT8A 4U44A 3LXNA 4WNKA 3IONA 2J0KA 4ZZOA 2GS7A 2JKOA 3U9NA 2VRXA 3EZRA 3EZVA 2W99B 5BVDA 4YO6A 3BHUA 3PSCA 3U8WA 5EM5A 1V1KA 2H6DA 2CLXA 2VO3A 1O6LA 3ACJA 2VGPA 2PHKA 4NTTA 4XG2A 5EYKA 3PLAE 4M7IA 3IDBA 3ORMA 2OZAA 1GAGA 4CTBA 2W17A 3QUPA 5BX0A 4IFGA 1ZOGA 4L8MA 2Q0BA 5C27A 3SX9A 4BICA 2PZPA 3K5VA 3TJCA 3D9VA 3PWYA 5ETFA 5FWKK 4BWXA 3RCJA 1Z5MA 2W9FB 3W10A 5TR6A 4GJ2A 3NMUF 3AD6A 4QYFA 1ZWSA 4AA4A 5KMKA 3PIZA 3KL8A 4FZFB 1SVGA 1XJDA 5A4LA 4BIDA 3QQUA 3E3PA 5IPJA 1GZ8A 5B2MA 2X39A 4II5A 2CCIA 3ORXA 3QKLA 3QHRA 2VNYA 4O2ZA 2O63A 1GJOA 3PXZA 4M68A 4QMQA 4ZY4A 2BFXA 3H9FA 2QOCA 5M53A 3F2RA 5EDPA 4EOIA 1NT2A 4W9WA 4BKJA 5BVNA 2JFLA 2YFXA 4I5MA 4C4EA 5KHXA 4GU6A 4FV1A 1PXOA 2ITNA 5HI2A 5L6OA 2VN9A 3A4OX 3ORPA 5CQWA 3TM0A 3S3IA 3Q04A 4R3PA 3HUCA 4ZS4A 1ZYDA 5JFSA 1M14A 2XNGA 3M1SA 5M55A 3R8LA 5GJDA 5AM6A 4FUYA 3HEGA 4BDBA 4TTHB 3R2BA 5HU3A 2C47A 4O21A 3NUPA 2VWBA 4L01A 4YHJA 4C0TA 5E92A 1U54B 4IHPA 4MNFA 3EHAA 4GS6A 2JDTA 3I0QA 4FEQA 5ETAA 1ZLTA 2QCSA 3EN9A 3LCKA 3EN5A 4RC3A 1YHVA 3VS3A 5DYJA 3P86A 3FZRA 2YN8A 3VVHA 1WZYA 1ZYJA 2H34A 3F2NA 3HZTA 1DAWA 5EK7A 4XHKB 4QNAA 1FQ1B 2ITZA 1LEWA 4FC0A 1XBBA 4BDDA 3DBCA 2ZAZA 3ZRMA 3U6IA 3QQLA 2V22A 2OICA 1URCA 2VX1A 3RPRA 3MFRA 2Y0AA 1AGWA 2FB8A 3ORZA 3LLAA 2HZ4A 2XKFA 2X2KA 2FSMX 4EKKA 2GHMA 1Q5KA 3MH1A 4CMUA 2Z8CA 4QYHA 2P0CA 4AT4A 5KHWA 3SC1A 3CS9A 2XRWA 3A2CA 4V0GA 3CQWA 4X6RA 5DVRA 4BDCA 4EZ7A 3ZXZA 4U97A 5JN2A 1MQBA 4H36A 4DH5A 1Y8GA 3VRZA 4A4OA 3W2CA 3EB0A 3EN7A 2PZYA 4TW9A 3R8PA 5CF6A 3VUTA 4KKHA 2FUMA 2JDVA 4PP9A 4IW0A 1WBOA 4MXXA 4QQ5A 5KO1A 1OIYA 4GL9A 3A7JA 4IX5A 4O6EA 3FAAA 4CEGA 2PVJA 1PF8A 4CVAA 4USEA 4D5HA 4GT3A 1OPLA 4HGSA 3LCDA 5IF1A 2ZM3A 4MWIA 4FIHA 3ZUVA 1A06A 3F6XA 3KFAA 2R0IA 2WHBA 2FVDA 4O1OA 4CV8A 4IZ5A 3DOGA 1MRVA 4NW5A 5BYZA 3BPRA 2WGJA 5BUIA 1TQIA 2IVTA 2R0UA 3ZUUA 4OT5A 4C02A 2IPXA 1Q61A 4D9UA 3CD8A 2W06A 4KIKA 5LXMA 4U80A 1R3CA 3CPCA 3OBGA 3ZLYA 4FA2A 3L8XA 3TZ7A 3OEFX 3V8TA 2V0DA 3D2KA 4CNHA 1UWJA 3IW4A 4I0SA 4CFVA 4EK3A 3FHRA 4K9YA 3HP2A 3SW4A 2OWBA 2GQRA 4XUFA 3VBTA 2JIUA 4HYSA 4M12A 4YMJA 3MH3A 2VNWA 5HBHA 1YXSA 2QG5A 2VO6A 4FV8A 3UIXA 3W8QA 5IEYA 3L8SA 3G9LX 4F7JA 3Q96A 1ZMVA 5IU2A 1BX6A 4JX3A 4N4SA 4O96A 3WZDA 4AUAA 4RVLA 5FTGA 3BCEA 4AFJA 2UZTA 4AN2A 3KXZA 3LOKA 3Q52A 3WE8A 3R04A 3QX4A 2QHMA 3WIKA 1G3NA 3CGFA 3QWKA 4JX7A 3SHEA 5DMZA 1SVEA 4ONAA 5HHWA 2PVKA 2HXQA 4HCTA 4D2RA 1PMVA 4H39A 4L3JA 3ZEPA 4ACGA 4ZMEA 3Q5ZA 5E8TA 4DGMA 3EFWA 4JLCA 4RT7A 5DT3A 3CKXA 3DJ6A 3QCSA 3N4VA 4JI9A 4DTAA 2A19B 3HV7A 4PUZA 3LFSA 4MD8E 5DA3A 2FYSA 3F61A 4ZZNA 3OP5A 2XF0A 4CQEA 2JBPA 3KEXA 3MA6A 1J1BA 2OF2A 3QZFA 4I5PA 1Y57A 5EQEA 5L2TA 4E3CA 2PUUA 3QTZA 2GQGA 3R8UA 5E9EA 4CFFA 5E8VA 1KE5A 1R1WA 2PZRA 4QP1A 3WF8A 5DFPA 2W1HA 4MCVA 2LAVA 5LMKA 4R7BA 5EW3A 3TDVA 4XJ0A 3IGGA 4QPMA 5BUJA 1OM1A 2ZYBA 3QC4A 3R8ZA 3PVWA 3BGQA 2QLQA 2W1DA 4IM0A 3L9PA 4I41A 4HGLA 4B0GA 5IQAA 4GK3A 4ASXA 3OCSA 4TYHB 4BDIA 3NNVA 1KWPA 3GU4A 2GPHA 4MF0A 3BU3A 3PZHA 1PKGA 4ITIA 4ZY6A 3TV6A 2QONA 3CQUA 3DGKA 4XG4A 5AR7A 3ROCA 3R63A 4L3LA 5TOZA 5M57A 3FI3A 3K3IA 4JR3A 5IUHA 4ORKA 1YQJA 4D28A 3AC1A 4YJOA 4L52A 2CKQA 2FSOX 4FKQA 2DYLA 4CFXA 2GSFA 1Q8WA 2V7OA 5HO6A 3WZKA 3PUPA 2XIZA 3FLQA 2C5XA 4W4XA 5AADA 3DAJA 3NAXA 4YTFA 3VN9A 1WBSA 3VJNA 5K3YA 2QR8A
chains in the Genus database with same CATH superfamily
2YJRA 3G33A 3EL8A 1J1CA 4YHFA 4TYEA 5KCVA 3F3WA 2I0YA 3LJ1A 3VQUA 3IGOA 3PP0A 3ORTA 2H9VA 2IZRA 4FKTA 3QQJA 5A4CA 3E7OA 2WXVA 3LIJA 4FSMA 4IC8A 3UDZA 3TDWA 5DR6A 3NRMA 5I3OA 3T3VA 3LFFA 2I40A 4D1ZA 4HJOA 2FGIA 4RJ3A 3R7VA 4AAAA 4FSQA 3DKOA 2ZFYA 3TEIA 4HNFA 3ZH8A 2PVRA 1LEZA 4HVSA 4B9DA 4QT1A 4FG7A 5EW9A 2OZAB 4K2RA 2Y6OA 3QALE 5D1JA 2WIHA 3B2WA 5KMMA 5A54A 5I4NA 3TKHA 4RX7A 3TNHA 4G3DA 3D7TA 1P4OA 2IJMA 3GU8A 3AQVA 3IOKA 1BI7A 3V5WA 4EQUA 1GIHA 3F3ZA 4G3GA 4BR3A 2ACXA 1OECA 5AMNA 3NYNA 4RVTA 4ACCA 4CZTA 4KKEA 5HVKA 2EXMA 4KKGA 4RIYA 3G15A 4A9TA 3PFQA 3HAVA 4AOTA 1OKYA 5LMBA 3BYOA 5JGAA 3GU5A 4DFYA 4B99A 3UC4A 4ZY5A 2W05A 5AV1A 4O0XA 3QXPA 2BAJA 5JQ5A 5A3XA 1U59A 2UW5A 3QD0A 4WBOA 3R7UA 2BHEA 3DBFA 3FUPA 3UC3A 4FEXA 4YJPA 3A7IA 1KE6A 3DBEA 4E1ZA 4WUNA 3MV5A 4IBMA 5M51A 3LFEA 3QRIA 3ACKA 4K0YA 5EM6A 1UKIA 3KVWA 4RMZA 2B4SB 4XG6A 3QGWA 2JLDA 4EK8A 2R2PA 1UU9A 4YTHA 3RAHA 2I1MA 4QP6A 4BGQA 3PXFA 3UNZA 2R3JA 3WIGA 5JFVA 4NTSA 2BZIB 3DKFA 2GNGA 3EQFA 2EXCX 2B52A 2R5TA 1LUFA 2UW4A 4Q5EA 2OW3A 2XNBA 4M66A 3UIMA 3LJ2A 4QMOA 2YJSA 4FTTA 2F4JA 4I20A 2IZUA 3AKLA 3G90X 4F0GA 3KRRA 3TUDA 3ZSHA 3DTCA 2Y6MA 4FSWA 1BLXA 2C6EA 5CU0A 3CTJA 3GFWA 5CNNA 3UIBA 3LQ5A 4I4FA 4AXDA 5IA2A 3NR9A 5LCJA 4TKSA 4IFCA 3TKIA 2OJJA 5CXHA 2XIKA 5FQDC 3RM7A 5LJJA 3BV3A 4CFMA 4GCJA 1DI9A 2ONLC 4FNYA 4I24A 4HPTE 2Z7RA 3BLHA 3LCOA 4KWPA 2CDZA 4RQKA 4KAOA 5E1EA 1FGIA 4B8MA 2YAKA 3MFSA 4GFGA 1Y8YA 3SOCA 3G9NA 4K33A 4UEUA 3V5PA 4A4LA 2IW9A 1TQMA 3NCZA 5AIRA 5K0KA 5IQDA 1ZRZA 4FICA 4F99A 1Q3DA 3C9WA 2VO0A 3BZ3A 4JIAA 3EQDA 1WMKA 3UE4A 4C59A 4NM7A 4YP8A 5CANA 4V0GB 4YBJA 4YC8A 2R7BA 2OJIA 5DLSA 3FEGA 3R73A 3ZONA 3F5GA 2QKWB 4FZ7A 5HVYA 5IA0A 4D2TA 2WTCA 3C0HA 3P08A 4IM3A 3CY3A 4QQTA 5I9UA 5KZIA 2E9PA 3RALA 4FTJA 3ZLWA 3P5KA 4DTKA 1ZARA 3VUGA 2RFNA 3BI6A 5J1VA 2E9OA 2YCFA 2QC6A 4XRJA 4BJJA 2Y4IC 4F09A 4MXYA 4IAAA 4C4HA 4XEYA 3VF9A 4CFUA 4F7NA 4ANSA 2I7QA 3QLGA 4X2JA 1UU8A 5DI1A 1FVRA 3KXNA 3OCGA 4RLKA 1H0VA 4IC7A 3WARA 5ITAA 2YWPA 4UXQA 3ROYA 4IAKA 5HO7A 2OJGA 4ZSAA 4X0MA 3HLLA 5AUYA 2YLFA 1ZMWA 2QOOA 4L44A 1I09A 4QTBA 4DH1A 4EOQA 1RE8A 4N0SA 1PHKA 3QQKA 4TPTA 5D9HA 4V05A 2QOIA 4RIXB 1UNHA 2HY0A 4FI1A 4B8LA 2BHHA 2JIVA 3PJ1A 4G3EA 3T9IA 2XVDA 3D14A 4QDEA 3DZQA 4EBWA 2W1IA 4Y73A 3R1SA 2C6LA 4BGHA 3Q60A 4KIPA 1OI9A 3R28A 3COHA 2WMQA 1W7HA 1BMKA 3AKJA 4I6QA 3VS4A 4J53A 3DNDA 3UJGA 2C3IB 4RFMA 4USDA 3MFTA 3K5UA 4J8MA 2J6MA 3D94A 3OD6X 4QD6A 5JSMA 3A61A 2VTAA 4YUQA 3DK6A 4YZNA 4F63A 2X0GA 4FKGA 4O0UA 4UN0C 2OXDA 3U4WA 3PPKA 3VS0A 1JSUA 3BGPA 3F3VA 4HZSA 4U3YA 4W4VA 5AFVA 1GIIA 4YJTA 3A8XA 2F2UA 4ACMA 3EJ1A 4HVGA 2VX0A 2W1GA 2QD9A 1Q3WA 2Y4PA 3FJQE 2G01A 5A46A 4G2FA 5L8LA 3S00A 3NFFB 1NVQA 4D4YA 1WBWA 1DM2A 3NYOA 4OUCA 3D2IA 3MESA 4L42A 1JNKA 2WTWA 3QTUA 4L6QA 3DKCA 2IEWA 5CSWA 4PTCA 4FNZA 4IWPA 2J90A 2JKQA 3G0EA 4XP3A 2BDFA 2BRNA 5LMAA 5KUPA 4O4FA 2BVAA 2OG8A 2GFSA 4C3FA 3QF9A 2IW6A 3Q32A 1OIRA 3C0GA 3TNWA 4F6WA 2CKOA 2XNPA 4WIHA 4EJ7A 4OTWA 2A2AA 4G9CA 4J7BA 3E8NA 2O65A 2PVNA 2V62A 2VTOA 2W5AA 3CBLA 4GIIA 4XV3A 5BVOA 4HPUE 2VGOA 5I9XA 5IA5A 3GC0A 4FKWA 5KZ0A 3TNPC 5DRBA 4AF3A 3JR1A 1Q97A 2XIXA 4EUUA 4BYIA 4UMRA 2C3KA 2IN6A 2VTPA 3OCTA 5IA3A 3ATTA 4ZTMA 4FL3A 3TIYA 5FDPA 2QOHA 4XBUA 1ZAOA 3OMVA 3W33A 2X7GA 3MTFA 3OF0A 4MD7E 4X3JA 3TZ8A 1STCE 2OFVA 5ANKA 5HNGA 4HW7A 4I23A 1OKVA 5L8JA 3VONA 1ST4A 2CKEA 5I5ZA 3MIAA 3O17A 1PMEA 3F82A 4J8NA 2B7AA 3O0GA 4JQEA 2WZJA 4K1BA 5TT7A 3ANQA 3SXFA 3TTJA 1H24A 5CALA 5M08A 4FKUA 4YLKA 3UOJA 3NUAA 4A06A 3GC8A 4AOIA 3EL7A 3N4TA 4F78A 3C4FA 1JOWB 4PPCA 2R3IA 2ZV8A 4W4YA 2W96B 4F9YA 2XIRA 5E91A 2PWLA 4KS7A 1GOLA 4QMZA 3R9NA 4B4LA 3BQCA 4EH8A 1W0XC 2XJ2A 3I79A 3QCXA 4DEIA 4EZ3A 2WKMA 5I9YA 2CGVA 2NPQA 4GV1A 4H3PA 5HCZA 3RZBA 3NS9A 2GTNA 4QP9A 2J0JA 4OTHA 4NZWB 4O4EA 3RJCA 3RK7A 2C6KA 4ENXA 1BL7A 5F20A 3TI1A 4G3FA 3DLSA 3V04A 5TO8A 2J5FA 1HCKA 4G3CA 4E6CA 5E7RA 4ASEA 1CDKA 4DDGA 2CKPA 3LFAA 5AP3A 3ORIA 4QOXA 3UNJA 4BDEA 5GZ9A 2C6IA 2R3KA 3AC3A 3FMJA 4F9AA 4E4NA 1XR1A 4FX3A 4BBMA 3SV0A 4JBPA 4IZ7A 4XMOA 5ACBC 1YXXA 5IQEA 3F2AA 5FBOA 2GNHA 3SQQA 4FTRA 3G0FA 3UVQA 2XEYA 3ELJA 4UB7A 3PE1A 5M4UA 1VYWA 1PW2A 4X3FC 3RHXA 4TWNA 3ALOA 3OWLA 3OHTA 4CZYB 5IG1A 5EQPA 4DFZE 4LG4A 3WF9A 5B0XA 2B55A 1TVOA 5IKWA 4HVHA 4EBVA 2B54A 4HGTA 4X2KA 2WIPA 3FQHA 4FSYA 4NW6A 3KK9A 5ANJA 5AAFA 3ZC6A 4DN5A 4AZSA 5IQFA 4DH8A 1JPAA 5IMXA 4AN3A 3I6WA 1OITA 3QRJA 4BIEA 4D5KA 4F08A 2BAKA 2CMWA 5FP6A 4EWHA 4FIJA 5AV2A 3LCTA 3NAYA 3VUHA 4WA9A 4FTCA 3EN6A 3B8QA 4KRDA 4CZUA 4OTRA 3BYUA 3RAWA 3BLQA 5AUUA 2R9SA 4AT3A 3ZBFA 3SVVA 4O86A 4UMUA 4U9AA 2WTVA 2BRGA 3DK7A 5FTQA 4R7HA 1E1XA 3MIYA 4DH3A 5M4IA 1ZOHA 4IWQA 1E9HA 2VWIA 4IZAA 5BVFA 3V5JA 2C5NA 3OROA 4C36A 4J97A 4YURA 4JBQA 5F95A 4D2WA 3QCYA 3L9MA 5JGBA 4IAIA 4DINA 3OWKA 5AX9A 5CAQA 5AP4A 4I6FA 3PJ2A 3PPJA 3FPQA 3RZFA 5CF4A 4FKOA 4CSVA 3QGYA 2BRMA 5K9IA 3VRYA 4Z7GA 3UZPA 4ZJVA 3B2TA 2CJMA 2Y4IB 4YJUA 4TYGA 4QP3A 4X21A 2X4ZA 4MQ2A 2HCKA 2PE0A 4PP7A 4C3RA 3LVPA 3OCBA 4TNBA 4R78A 3CPBA 4JG7A 3L9NA 5BYLA 4AQCA 3QTWA 4CCUA 4O0VA 5DNRA 3WZJA 2CN8A 3ZEWA 2QG7A 1YI6A 2G2HA 5GINE 5EOBA 1Q8UA 3T9TA 4GJ3A 4C57A 5ANIA 4UX9A 2HENA 2PY3A 2QU5A 4UV0A 5CU6A 3FMNA 3WOWA 2XK9A 2C6TA 4FV9A 4O27B 3GUBA 4UY9A 4D2VA 2WPAA 2UZVA 3RINA 1L3RE 3GXLA 3UP2A 4D4SA 5C1QB 1ZYSA 1OKZA 2XNNA 4G16A 3VUDA 5AUTA 1JQHA 1XKKA 1DS5A 3E93A 2YIYA 2WELA 3AD4A 3W2OA 4RLLA 4E4LA 1YHSA 1URWA 4KD1A 2RGPA 4Q5HA 5HICA 3WYXA 5TKDA 4QPAA 3TCPA 2X9EA 2H8HA 3OOGA 1FBNA 4M15A 5BPYA 4IJ9A 5A4QA 4U8ZA 5EI2A 5G6VA 4TT7A 2BDJA 4MBIA 3RKBA 3O5AA 3JY9A 1Y6AA 4YSMA 3OOMA 4BZOA 3Q53A 4EH2A 5CZHA 4YJQA 3UDSA 3CY2A 4FTOA 4XG9A 5ANGA 3KRJA 4K18A 4ZLOA 5CAUA 3KXGA 2ZOQA 3FI2A 1T46A 3ZZWA 2PUPA 5EKNA 4CG8A 4JNWA 4R1YA 5GZ8A 4KUJA 2Y8OA 2XAOA 3VBXA 2J9MA 3BHYA 3NUYA 5J8IA 3DDQA 4WO5A 2JAMA 5C01A 3RPOA 2IZTA 3I1AA 4KBCA 1XH4A 3C0IA 1PY5A 2QHNA 1YI3A 4YC3A 3M11A 4O1PA 5HIBA 3AG9A 5GJFA 3R7EA 3JVSA 2RFDA 4DEEA 3PXQA 4LUEA 4BTMA 1QPEA 3JPVA 4IH8A 1V0BA 5F1ZA 3ZDUA 5CNOA 4XG7A 4P7EA 4PPBA 2PE1A 4JOAA 4FSUA 4C4FA 5CWZA 4RIOA 3RP9A 2OBJA 3FZSA 4J98A 2P2HA 4KIOA 4OTIA 4ANMA 4GK2A 4JG6A 3DAEA 4A9UA 3UZTA 4PPAA 1XO2B 4WG4A 2OKRA 4QYEA 4DHJA 3ZFXA 3Q4ZA 3VS5A 4G34A 5ACKA 3VS7A 4O6LA 5GZAA 3EFLA 4LM5A 2W5BA 2B9IA 3TJDA 5A9UA 4MVFA 3SGCA 4JS8A 3WI6A 3R71A 3NW7A 3CCNA 3ZC5A 1J91A 2XNMA 5JEBA 1IEPA 4FUXA 4R3RA 4YZ9A 4AP7A 3Q9YA 2YERA 3PA3A 3UNKA 4L3PA 3IKAA 4YC6A 5JRSA 2XS0A 3E8CA 2O5KA 2UVYA 2BFYA 1JKKA 1H26A 5AUWA 2F9GA 2QNJA 3VBQA 2ETKA 2C1BA 3PRFA 3S95A 3OXIA 2C6OA 4CCBA 5IQGA 4AZEA 3BQRA 2GDOA 2GNFA 1M2QA 2IWIA 5HG8A 1VZOA 5JFXA 3O50A 1G8SA 3QL8A 1XMMA 4X2NA 3RNYA 3OTUA 1H00A 3QD2B 1FINA 4YTIA 3ZO1A 1OZ1A 1W2FA 2QLUA 4L7SA 5J5SA 1RQQA 3MDYA 5D41A 3FHIA 3V5TA 5C8KA 5AP2A 1OVEA 3ZHPC 3K3JA 5HEZA 2QOKA 4KSQA 5H3QA 2XP2A 3NYXA 3ID6C 2GCDA 4B7TA 4U41A 1OL1A 2OJFE 2C5VA 4I0RA 2ZB0A 3R8VA 3QUDA 4JAIA 2W9ZB 5C9CA 3QTQA 4PTEA 2UZOA 2XH5A 4TY1A 2HWPA 2BZHB 4X3FB 3VBVA 3DU8A 3Q2JA 4MTAA 2YHVA 2WOUA 4NM0A 2W4KA 5EI8A 1ST0A 4AU8A 3S4QA 3UBDA 3G51A 4I92A 4FNXA 4PDSA 4I6BA 1ND4A 5C8MA 4ANQA 4ITJA 4FYNA 3DTWA 4FKPA 4HZRA 2VWVA 3HV3A 2CN5A 5KKRC 3TYKA 2X0PA 4ZLZA 4EK5A 2BROA 3FLSA 4K77A 1V0OA 3DB8A 3F69A 3OUKA 4QTAA 4KA3A 3VAPA 4ASZA 1JAMA 3O8PA 3KGAA 3TG1A 3W2SA 2ERKA 4R5SA 4BI2A 5J79A 3V5QA 5DGZA 5J9YA 3W0OA 4RIXA 4Y83A 3MN3A 2JAVA 4LGHA 5EYMA 1BKXA 5DRDA 4FTAA 3ZU7A 4MEDA 2A27A 3DPKA 3P1AA 4CKRA 1MUOA 4APCA 3IPHA 3KMWA 3FLYA 4MXCA 4PMTA 5J7HA 3NX8A 2QODA 4QMYA 5AUVA 4EHZA 1Q41A 3FMKA 4QTEA 4ZSGA 5ANDA 5IUIA 3BL7A 3C5IA 4GYIA 4RSSA 1Q24A 3OC1A 2FO0A 4EHGA 5LWMA 1R0PA 3ZUTA 3GNIB 3V8SA 4RQVA 4O7NA 3FLWA 5IH6A 4ZSEA 4IVAA 1U5QA 2VZ6A 3OEZA 3VUKA 4WHZA 4XP2A 4YPDA 3NUSA 3EQRA 3S0OA 1UNGA 5CU4A 4EI4A 4USFA 3LM5A 3MFUA 4FR4A 2CNUA 2C68A 4FV3A 4YJRA 3GCPA 3Q9WA 3RPYA 3ZYAA 3Q3BA 3BU6A 4MAOA 3COMA 1Z57A 4O0TA 3VS1A 3EWHA 2XMYA 4FOBA 4MH7A 5CU2A 4C38A 5KMIA 4F65A 4ZLYA 4HGEA 3A7FA 2WEVA 4U40A 2W1ZA 3O8TA 4TNDA 4R8QA 3O23A 4ZZMA 2O0UA 5IMEA 4EOMA 4C58A 4C2VA 1O9UA 3F9NA 3PA4A 3QUEA 3E64A 3GOKA 3TL8A 4AX8A 3UZRA 3ZFMA 1YHWA 2OH4A 1JLUE 4MF1A 4PTGA 3GC9A 5HKMA 4K11A 3PXKA 3DXPA 4DYMA 3AXWA 1Q62A 4A9SA 4CYJA 4FTUA 2DS1A 5AAEA 4KIQA 4YZCA 2C6MA 3KK8A 3PVGA 5EHOA 4F1TA 4FVPA 5LVNA 2IF8A 3POOA 4R3CA 1UU3A 4XP0A 5D10A 1IG1A 4QMUA 4F9WA 1PRYA 5IQCA 2ZMDA 3OFMA 3I0OA 4PL5A 4BCHA 2YIRA 4WNPA 1H4LA 3GCSA 5HE2A 4FJVA 2W4OA 3H4JA 4C4JA 1H0WA 4QMWA 3NUNA 3BWJA 3BYMA 4FIIA 3BWFA 4YO4A 4ALUA 5CEMA 1SMHA 3G2FA 3PJCA 4CGAA 3FKLA 5C4LA 2QO7A 3NIEA 4EOPA 2HZNA 3KN6A 4DGNA 3U9CA 3LFCA 2C1AA 5HVJA 4FGRA 2BKKA 4YPSA 2X9FA 3PY0A 3QFVA 5AP7A 4EK6A 1ATPE 2RSVA 3JY0A 4AWIA 3GGFA 4DGGA 4N6ZA 5J9LA 3ZBXA 4RWKA 3D5VA 4J99A 4RA5A 3FQSA 1K9AA 5T6KA 3SDJA 4EH5A 1KE7A 3VJOA 5L8KA 3O7LD 4TRLA 3RVGA 5CYIA 3BE2A 4V04A 4YZBA 3LMGA 2BIKB 3FI4A 3H3CA 4BWKA 1PXKA 3CXWA 3GU7A 4TN6A 5CLPA 2RKUA 3KQ7A 1L8TA 4EONA 4ASDA 5CSPA 3IOPA 4TWPA 1CMKE 4DC2A 2FH9A 4E5WA 3QRUA 2VWYA 4J95A 1YI4A 1RDQE 4XG3A 3LMHA 2I6LA 4X2GA 2WAJA 5JQ8A 4NK9A 5A4EA 3M2WA 4RX9A 1P5EA 3TT0A 4ANOA 5JMSA 3FPMA 1TKIA 5K4IA 5DR2A 3TNQB 3NUUA 5EYCA 3BHVA 4QMVA 4UMPA 2VTLA 4IAFA 1QPCA 3UQGA 4E73A 1XBCA 2WB8A 3MY5A 3W0NA 4AZTA 3THBA 5EFQA 3F88A 3E88A 1B6CB 1SNXA 5LCKA 1J3HA 3IW8A 4BTFA 1CTPE 1QPDA 3I60A 3FSFA 2WD1A 3DV3A 3G6GA 4M0YA 4CRLA 2HW7A 5DOSA 1V0PA 5DHJA 3A62A 1MRUA 5E8YA 4GT4A 4CQGA 3NVKI 3UOKA 4ANNA 2WMVA 4DE4A 2BTSA 1YXUA 2XK3A 1PYEA 4DITA 4F1MA 3U6HA 2RIOA 4IIRA 2ONLA 4ID7A 3P79A 4A9YA 4K6ZA 3QA0A 4XX9A 5AIKA 4GU9A 3P9JA 5IH4A 2X1NA 2UW7A 3UTOA 5LVMA 3R2YA 2CGXA 4ANLA 1H01A 1HOWA 3P7AA 4LV5A 2YM3A 2YZAA 4XS2A 3OY3A 1OIQA 4YLLA 3AMYA 3DAKA 4ZMFA 1W83A 3QBNA 4L43A 3MPTA 4R6VA 2VV9A 3CLYA 1RJBA 1P4FA 3A7GA 3TIZA 3ZDIA 3U87A 3FMLA 1M2PA 2BPMA 4E5AX 1F0QA 5HNIX 3UOLA 2PVYA 3FWQA 4QO9A 4RJ8A 4FIEA 3AMBA 1Y6BA 1GNGA 3P7BA 3VW6A 3R1QA 3PXYA 4NFNA 3QZGA 3POZA 4L00A 2VU3A 3BBWA 3W1FA 3EMGA 4H3BA 3SD0A 3NCGA 2R3OA 1W84A 4BN1A 4IVCA 4E4MA 5HG7A 4UMTA 1XH5A 3MTLA 3R0TA 3I6UA 1YKRA 4O7SA 1W2DA 1OL2A 4E6QA 3KCFA 5FP5A 4CKJA 2HIWA 5H8GA 4NJ3A 5JGDA 1SNUA 5HBEA 4Z3VA 3HKOA 4U45A 4GG7A 3FL5A 3OG7A 4ZIMA 3LMIA 3V6SA 5KKRB 2YM5A 3LLTA 3PIXA 4ARKA 3QKMA 3IQ7A 4R7IA 4FE2A 4AA0A 3LCSA 1H1SA 4QP4A 1OL6A 4AT5A 2C4GA 4FT7A 2BR1A 3U51A 2PYWA 3R7GA 3EN4A 1XH6A 3TWJA 1NVSA 2ITTA 5CTPA 2VTHA 1PXIA 4ZJIA 2UVXA 3OW3A 3W0SA 1H8FA 2VTSA 3BGZA 4R1VA 3GCQA 1QMZA 5FDXA 3LFQA 3AKKA 4L45A 3OWJA 2Z60A 2LGCA 4I94A 1UV5A 2GTMA 4FVQA 5ANOA 4CKIA 3S1HA 2HY81 2HK5A 5DN3A 3NZ0A 3VHEA 3HV6A 1FMOE 4OR5A 5IEVA 3MVHA 3NNWA 2XANA 4LDTA 2X7FA 1APME 2ITUA 2JFMA 3IW6A 3IS5A 2F7ZE 5FXQA 2VTJA 3GOPA 5BYYA 3ZO2A 4C61A 4S33A 3L9LA 3RNIA 3VF8A 4PDOA 4DF3A 2XK8A 3QWJA 2P33A 3UOHA 4GVAA 4BCNA 2W4JA 2JKMA 2WQMA 2BMCA 4EOJA 3U6JA 2O64A 4G31A 5CAVA 2ITQA 1RW8A 3PSDA 5EKOA 3RK5A 1KSWA 5M4FA 3CGOA 5IISA 1YOMA 2CNVA 2B9JA 3P0MA 2UW0A 2G2FA 3ZOSA 4LUDA 3R9OA 3FKNA 5I9ZA 4MHAA 5HCXA 4QMTA 1R39A 2X7OA 2XYNA 2CGWA 4FL2A 4FSTA 5HESA 2WTDA 3FY0A 3OWPA 3T3UA 4AGUA 3RTPA 2R64A 4MYGA 5CF8A 2J51A 3UQFA 2GNIA 4ZTHA 5GIPE 4WRGA 2WU6A 5D7VA 5HU9A 4DGOA 5HD4A 4YNEA 4YJNA 4EH6A 2YIWA 1J7IA 4DA5A 4RG0A 3ENMA 3LAUA 3VUMA 4C2WA 2C0TA 2YWVA 4AXAA 4JQ7A 3REPA 1PXLA 3VC4A 5I3RA 3FY2A 2UW6A 5HBJA 5JZNA 2YIXA 2AQXA 3C50A 2ETMA 3NWWA 3VULA 5JFWA 1YXTA 3L8PA 3Q9XA 5D7AA 4EHEA 4F6UA 2YM8A 3UO6A 1DAYA 4BCKA 2ETRA 2ZV2A 4GFMA 3E3BX 2NO3A 4QNYA 1T45A 4DG0E 4MXOA 1GZKA 3TZMA 3KKVA 3A7HA 4QTDA 3ZCLA 2HWOA 4F7SA 5AA9A 1OB3A 5TF9A 1JKLA 5FLFA 4ZJJA 3BELA 4LMNA 3R7YA 5K5NA 5M44A 2NYAA 4HVDA 4Z16A 5CEOA 5AV4A 2GFCA 3Q5IA 3C4XA 4GSBA 4CFWA 3DJ7A 2BZJA 3PPZA 4PNIA 2W0JA 1BYGA 2OO8X 2XEZA 3NSZA 4HNIA 4HYIA 5CSXA 3UYSA 2VAGA 4HCVA 4EQCA 3AT3A 2A4LA 1IAJA 5CAOA 4AGCA 1Q4LA 2XYUA 2OGVA 5EOLA 5IA1A 3KN5A 2X6DA 1GY3A 3JYAA 4QP7A 4O81A 3HECA 3PZEA 3U55A 5EQYA 2C6DA 4DT9A 5F9EA 1ZY5A 1OBGA 1CM8A 2XNOA 4N70A 2HOGA 4IJPA 3MPMA 5ANEA 2GNJA 2XRUA 4FZ6A 3AD5A 4IWOA 4F7LA 2WTKC 4M84A 2AYPA 2Q83A 5DEWA 1KE9A 2HYYA 2WQOA 1WBTA 2PE2A 1H25A 5AR8A 4Y5QA 5AR3A 5DE2A 4G5PA 4D4RA 4LV8A 4ENYA 4WSYA 4G6LA 3QZHA 3MJ2A 3KXHA 4ERWA 5DBXA 4CFNA 4RBLA 3MW1A 3ZS5A 4X3FA 4DLJA 4EYMA 3VNTA 3PFYA 4QP2A 2IVSA 4C8BA 4XBRA 4BCQA 4GK4A 1YOJA 3ET7A 2CLQA 4JXFA 4XH6A 5J87A 4GFOA 4X6QC 2BRHA 4AZVA 5AR5A 4FEUA 4YBKA 2YM7A 3ORLA 2BDWA 3HGKA 5FM2A 2WMRA 3CD3A 4FV6A 2ZM1A 4RC2A 3NW5A 4N6YA 1W8CA 4RC4A 3R9DA 4S31A 3QYZA 1FGKA 1XBAA 3NGAA 4XV1A 3R21A 3CR0A 4QQJA 2R4BA 1OPKA 2UZLA 4O7RA 3AC4A 2VX3A 5J7BA 4IACA 2NP8A 4Q9SA 3W2QA 3BE9A 4XV2A 5JH6A 2EUFB 3KVXA 1H1RA 4FG8A 4WG3A 5HORA 3RPSA 3NPCA 4AGDA 1A9UA 4NFMA 3ZTXA 1U4DA 1CKIA 4BZNA 2BUJA 3D0EA 1OUYA 2BCJA 2UW9A 1NW1A 3P23A 3BRBA 3AMAA 2PL0A 1H1PA 2BTRA 3UG2A 1JSVA 5AP1A 4AZFA 2W1EA 2YCRA 1BI8A 1PMNA 5M07A 4UYAA 3AGLA 4FT9A 3ZO4A 2B9HA 4O82A 3KC3A 4U43A 5CSHA 4F0IA 3FC1X 5KE0A 1GIJA 4BBEA 3PUFC 2QOBA 4GKIA 4XRLA 2R3LA 2IVVA 3Q4UA 4C33A 1VYZA 2PVMA 1XH7A 2Z7SA 3LW0A 4PRJA 4QMNA 4GW8A 3SOAA 1CSNA 5JT2A 1M17A 2YISA 3W16A 4BWPA 1YW2A 2WMBA 3FYKX 2XA4A 3BL9A 4NT4A 5BMSA 4FTNA 1GZNA 3A4PA 3AT4A 4OAUC 1LPUA 1PMUA 3FXZA 3KMUA 4EC9A 2GHLA 3R7IA 4V01A 4F64A 5FM3A 3SW7A 1XH8A 2XBJA 5E8ZA 4W8EA 4MWHA 3PIYA 2JEDA 4P5QA 4GEOA 4KBKA 4KRCA 1ERKA 4BYJA 4JJRA 2Z7QA 5AJQA 5L6WL 5FTOA 4BY9E 4ZEGA 2I0VA 2YAAA 3C7QA 2EU9A 2ITVA 4IDVA 3QHWA 2B9FA 3DB6A 5BVEA 2WTIA 1MP8A 3BEGA 1SYKA 3PY1A 2WMAA 2UW3A 2C5YA 1XWSA 3MY1A 3MB7A 1PXMA 2KTYA 2F49A 2PZ5A 3OZ6A 5CXZA 3CJFA 2ZVAA 3PYYA 4C37A 4EEVA 4Y72A 4YTCA 3H0ZA 4XOZA 3D5XA 1KOAA 4E93A 4NYEA 4O0WA 4BGGA 2RG6A 5LOHA 2ITPA 5CVFA 4U3ZA 3UODA 5KMJA 4QQCA 3MH0A 3OW4A 4F9CA 2JC6A 1VEBA 5H2UA 3KXMA 5I9VA 5HIDA 1ZY4A 1R78A 3PTGA 5HTBA 5C03A 4DEHA 4CG9A 4CMOA 2KULA 4OLIA 5CSVA 1YDRE