4FUYA

Crystal structure of the erk2 complexed with ek2
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
329
Chain Sequence
PEMVVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKIDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK2
rcsb
source organism Homo sapiens
total genus 105
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fuyA01
4XBRA 5C03A 4BBMA 2CKPA 3D5WA 3DXNA 3F3WA 2PVHA 1KWPA 2ITUA 2JAVA 2IZRA 2YZAA 3I6WA 1W8CA 4R77A 4PPBA 4O86A 4G6OA 4UB7A 4FEUA 1S9JA 2F57A 2UW8A 3EN9A 4P5QA 4BTMA 4ZSGA 1IA9A 3QA0A 4QQJA 4QMQA 4U6RA 3AC8A 2PVJA 1PW2A 1IAHA 1QPCA 3PP1A 4OTPA 3T3VA 3C13A 4IHPA 4UMQA 3AGLA 2CNUA 3D0EA 3N4UA 3CQUA 3GOPA 2VWVA 3QBNA 3F82A 1U59A 2HZ0A 2UZDA 4D2PA 1NW1A 3DXQA 4U0IA 3H10A 1GOLA 4UXQA 1YDSE 1PYXA 3HKOA 5E91A 5E8UA 4I4EA 5CQUA 2UZNA 3KRRA 1H26A 2QC6A 2VTJA 3R9RA 3V8TA 3F3ZA 5KMJA 4BDCA 4MXXA 5ANGA 5HG8A 4C3RA 4D1ZA 4ANBA 2BPMA 1MQ4A 4F0FA 2A27A 4GVJA 3ZFXA 2PUIA 3A99A 3MVLA 1IR3A 4AN9A 4S32A 5JN2A 4Y83A 2R3RA 4JNWA 4FBXA 4BCPA 4C0TA 2W0JA 2VD5A 2XRUA 1OIUA 4YU2A 3C0HA 2Y4IB 2HENA 3R7YA 3UG1A 4FSQA 3ALOA 4V0GA 4NL0A 4ZXTA 3RM7A 5BMMA 2P33A 4WUNA 4JQEA 5IA4A 3EL7A 5EW8A 4FSRA 5HD7A 4QMVA 3VUHA 4BDAA 1UU7A 4WRSA 4BKZA 2ETKA 3V5TA 5LXMA 3VO3A 1B39A 3D5VA 3GP0A 5J7HA 4FV4A 4XV2A 1KE7A 3ANQA 3CEKA 3FE3A 2F2UA 2CDZA 2QR7A 3II5A 1P5EA 2HY0A 2X1NA 1V0PA 3MY5A 3O8PA 3PFQA 4EK3A 1H1QA 5BYYA 3BBTB 4RVMA 4XLIA 4C58A 5M57A 2XRWA 3RWPA 4RG0A 4BCHA 2OFUA 2B1PA 3FC1X 4LUDA 4C4JA 2C47A 1SZMA 4F6SA 4Z7GA 1RQQA 5LJJA 1NA7A 1Q97A 1R0PA 1W7HA 3DK6A 3P08A 4ACGA 3R83A 2WMRA 2ZM3A 4B9DA 3CE3A 4D5HA 3RCDA 3UO4A 1G8AA 3C50A 3C9WA 4E4XA 4N4SA 3VS5A 3TV4A 4QP9A 3PJ8A 4U79A 4G5JA 4FODA 4AZFA 4K8AA 2UZBA 4L67A 5EW3A 4BCNA 3QKMA 2R3NA 4J8NA 4EQCA 4DG3E 3D2KA 5HESA 1R78A 2WMWA 3E7VA 1DAYA 4EZ3A 1ZRZA 2FH9A 2W1EA 3C4EA 5E9EA 4OTIA 1ZWSA 3QZGA 4L3LA 3ULIA 4IAZA 3A8WA 2F7EE 1H08A 2E9PA 1M14A 3L9NA 4TTHB 4K6ZA 5KNJA 5EHYA 3DK7A 2DS1A 4IX4A 4BZNA 5J9LA 1SYKA 3UPZA 4EC9A 3MSSA 5ETFA 1P4FA 3KMMA 5AX3A 4JBQA 3LM5A 4NM3A 4Y95A 4YTFA 5F1ZA 4YR8A 3U6JA 4RA4A 2C68A 4I22A 3JVRA 4FTIA 4HW7A 3QZFA 4YZMA 4BHNA 3PWYA 4GUEA 4MF1A 4FKSA 5I9WA 3FSFA 4BBEA 4QYGA 5AP6A 5TOZA 3K3JA 2P55A 3NYVA 3ZM9A 2IVUA 3TZ7A 4BICA 2PVRA 4RA5A 2XBAA 4DG2E 4Y73A 1XH9A 3UZTA 3Q2MA 3DFAA 4H3PA 2OO8X 3COIA 5AAFA 2Y4IC 3ZFMA 4BWKA 1XH4A 2J0MB 3MB6A 3MN3A 3I7BA 3VS4A 2QO7A 5AP3A 3I60A 4F6WA 2VU3A 4I94A 5FRIA 3FKLA 1P2AA 3BIZA 2VWWA 1FQ1B 4NKAA 4E26A 1OIRA 5CX9A 4TYHA 3WI6A 5M4CA 3KCKA 1WBSA 2VTTA 2ITQA 3E8NA 3IG7A 4K2RA 4E1ZA 4CMTA 4AE6A 3EL8A 3F5PA 4F7LA 3QD3A 2OF4A 3F2NA 5EM6A 1GZOA 5CNNA 4L53A 3S0OA 3KVXA 3RZFA 2OXDA 3KXNA 4BIBA 5HG9A 2OJFE 2C6LA 4EH4A 4RX8A 4JOAA 4QTAA 4YO4A 4APPA 4K33A 3A62A 4KSPA 4BYJA 3OCGA 3LW0A 4RIOA 3U9NA 1IAJA 4AQCA 3VIDA 3K3IA 1LP4A 4FT5A 2J0KA 3ZUTA 4CV8A 1F3MC 3BBWA 5EHOA 3DLZA 4EK6A 4GU9A 2YLEA 1JBPE 2XNGA 4AU8A 4RVLA 2W1CA 4UBAA 4FG7A 3SG8A 4AX8A 3HA6A 4ZJVA 3OCTA 2VTMA 4X7QA 3COKA 4TWPA 2H34A 4OTGA 3EKNA 3MBLA 3NW5A 3TNIA 5IISA 5AR2A 4AZVA 3RAHA 3WE4A 2GNGA 4QMZA 2BRHA 4I1ZA 2VWIA 3EYHA 4GRBA 4CYIA 1H0VA 3U9CA 3TUDA 4W4VA 2UVZA 2V22A 5CEPA 3QTQA 3TNWA 3VUGA 4RRVA 5HKMA 3HECA 3PVUA 2R5TA 4FV1A 1Q8WA 2EU9A 3RINA 3UTOA 3BE2A 2VGOA 5FEEA 4MAOA 5I9YA 4E7WA 3TCPA 1OUYA 3QTIA 5JGAA 4XG7A 4RIWB 2F9GA 4HVDA 1E1VA 3R1SA 4UX9A 1PKGA 1W84A 2BAJA 2XK9A 3GOKA 4GV1A 4FE2A 2JBPA 4AAAA 5ANKA 4J52A 5HNIX 3EQDA 4IANA 5M4FA 2YA9A 1ZARA 4F08A 3DAJA 4E73A 5I3RA 5BVKA 4XG4A 3PVGA 5DMZA 5IH5A 5J9ZA 1OKWA 4IW0A 3SRVA 4O7YA 3OW4A 1YI3A 2PZYA 4KINA 2P4IA 4M15A 4O38A 4YPSA 4KBKA 4RWLA 4CFNA 3QALE 3DV3A 4GU6A 4RGJA 5D9HA 3Q2JA 2E9VA 4JIAA 5CENA 1WBTA 4NW6A 4BCMA 4GK4A 5IEYA 3R9HA 4V01A 1PMVA 3NX8A 3VRZA 3AQVA 4M66A 4WG3A 3LFDA 3AC4A 5CVHA 1OKVA 2OXXA 4FZDB 4EH7A 3F61A 3VUMA 3FI3A 4RQKA 2X9FA 3C4XA 1ZOEA 2QOIA 1GIJA 4L44A 4AT3A 1Q8YA 3DTCA 3QKLA 4YZNA 4P7EA 1QL6A 2JGZA 5EDPA 4MF0A 3RM6A 3QA8A 1Q3WA 1XBBA 1ZXEA 3BELA 3RPRA 3S3IA 4FF8A 4CFFA 4FTMA 5DEYA 4MK0A 5C9CA 4DA5A 2GNLA 3ZRMA 4ENYA 3A8XA 4R5YA 4R7IA 3L1SA 2AC5A 1CTPE 3FWQA 3ZBFA 3P1AA 3WE8A 1YI4A 2XNMA 5ANDA 4L45A 2QO9A 5BYZA 4QD6A 2W4OA 1JOWB 2XJ2A 4EH6A 2PZ5A 3HMNA 3R2YA 4ZSJA 4YLJA 1YXUA 2ZM1A 1XJDA 3WBLA 4QMSA 3VW8A 5FXRA 4I23A 2V7OA 4H1JA 1SNUA 3NVMB 5JQ5A 3ET7A 4YJNA 4BYIA 3RHXA 2VWYA 3EQHA 4EYJA 5G6VA 2GMXA 3DKOA 4AS0A 2PMLX 5IQHA 1U4DA 2UW4A 2YM6A 4IIRA 4WSQA 2Z7SA 4D58A 2C3JA 3QFVA 2BMCA 3LFBA 2VO6A 4DLIA 2QU5A 3DY7A 3ZH8A 3MVJA 3MA3A 4U81A 1JSVA 4GMYA 4C4HA 1FVVA 2B55A 4EOMA 4Y5HA 5BQ0A 1FMKA 3E8CA 3V51A 2UW5A 4BI2A 5AADA 4F70A 2OK1A 4ZTQA 3S1HA 4BTKA 1KE6A 2XNPA 4GKIA 4I5CA 5EM8A 3RK7A 4IE9A 5K3YA 3M2WA 3NZ0A 4IEBA 3VBWA 2X2MA 4AW2A 4ZTSA 4FT0A 1H28A 3HV7A 4W8DA 2E9NA 4JL9A 3ZDIA 3WIKA 4JBPA 4MBIA 1ZY4A 2R3PA 4I24A 3UYTA 1OB3A 2WOTA 1OUKA 1SVEA 1HCKA 4IFGA 3TNPC 3WYYA 4C61A 3DKCA 3A61A 3QHRA 2XH5A 4FKRA 2G2IA 2JIIA 4ANNA 3FZOA 2JBOA 4MTAA 5DH3A 3D83A 4E5WA 3HAMA 2C6KA 4Z3VA 4ALWA 4QMMA 5FP6A 3BEAA 3QYWA 4LRKA 4X3FB 3O71A 3VBYA 4IZ5A 3GCQA 2G2HA 3FKNA 3MFSA 2XUUA 3KEXA 4L3PA 3A2CA 3SW7A 1YDRE 3EWHA 4FTKA 1J7UA 3DTWA 3GC0A 3NYOA 2UV2A 1Y8YA 2IW6A 3JPVA 5JFVA 1G8SA 3EFWA 3I6UA 4I4FA 4MXAA 2OJJA 4NTTA 1JNKA 3E5AA 1KV2A 4JDJA 3ROCA 4EOIA 3NUXA 4YHTA 2YDKA 3GBZA 4XG3A 2OW3A 4I5PA 5M06A 2A2AA 2HAKA 2YERA 4ZTHA 1ZOGA 2HIWA 4J96A 1UNGA 2WQOA 4KS7A 5CF6A 4QPAA 4DF3A 3AOXA 3TTJA 3EN5A 4JG7A 4LL0A 1JKLA 2RG5A 3MIYA 3QHWA 4ANSA 2YCSA 3OFMA 5IF1A 3E63A 4C4EA 4EBVA 2VRXA 2IZSA 4MNEB 3VNTA 3HV5A 5EQYA 2UZOA 3OWLA 4Q9ZA 4DAWA 2XCHA 3A4OX 4FV3A 3ZEPA 3DKGA 3NLBA 1ERKA 5J1WA 2ZAZA 3MW1A 1BMKA 1NVQA 3DS6A 3R00A 4IAKA 4KIPA 3HUCA 1H07A 4NIFA 4QYHA 4Z9LA 2X4ZA 5IUHA 3KQ7A 4JRNA 4UWYA 4N57A 4C02A 5A14A 3V5JA 1OL6A 2W1DA 3GU5A 3L9LA 3CTHA 2BZKB 2VO7A 1OBDA 3HNGA 5IH6A 2WQEA 1RDQE 3CC6A 3AMYA 4BR3A 4JAIA 2ERZE 1ZAOA 3QD4A 5C26A 4EOQA 5DPVA 4BI1A 4EOSA 4IZYA 4BRXA 5HLNA 3MI9A 5IMXA 3TI1A 4J8MA 4CZYB 3CCNA 3D5XA 4FKVA 3PIXA 2C1AA 3OY3A 2X4FA 2OG8A 4HNIA 4X3FC 5E8TA 2F2CB 3VRYA 4ZLZA 5HD4A 4KA3A 2DWBA 4YUQA 3F2RA 4IM0A 5DOSA 4U45A 4XP3A 3VUDA 4EJ7A 3PIZA 2YDJA 2GQSA 4L43A 3O23A 4A4XA 2H9VA 3ZLSA 4NZWB 4U97A 4DEGA 5IUGA 1LEZA 5AUZA 4J99A 4ZZMA 5GZ9A 4IVDA 4M84A 4MEDA 4IQ6A 2BHHA 3BLHA 3Q5IA 4M7IA 5L2WA 5J95A 4BB4A 3MYGA 2I0YA 2O5KA 2QURA 3H9FA 4IC8A 1I09A 5HTCA 3SOAA 4YZDA 1M52A 3LJ2A 4D28A 2ESMA 2VX3A 2WFYA 1M2RA 4KABA 4MKCA 4F9WA 4ID7A 4JDHA 3HL7A 4IM3A 3R7IA 1X8BA 2GPHA 2ONLC 3FDNA 4A06A 3R8LA 1W83A 4Y5QA 4ARKA 2ZV7A 5K9IA 4O0UA 4ZTMA 5KMKA 4OBQA 2R4BA 3BCEA 5CU3A 4DCAA 5AV1A 4KWPA 5ANJA 3IW4A 1PMUA 2NRYA 4ZJIA 3BU6A 4XLVA 2RL5A 4FKUA 3W33A 4TZRA 4PX6A 4G2FA 3G6HA 4KIQA 2RIOA 4HYUA 4BCGA 4FL3A 4QO9A 1OKYA 4AA5A 3ETAA 1ZMWA 4UY9A 1NT2A 4QQCA 3KULA 1YRPA 4X2KA 5AA8A 4FSUA 3DZOA 5JEBA 1APME 3BHYA 3OP5A 3LCTA 2VAGA 3D7ZA 2ZOQA 3HV4A 3QC9A 4GFGA 5D7VA 3A7IA 4QP6A 4L6QA 3KRXA 4KD1A 2E9UA 4F63A 3VJOA 4G17A 3ZSHA 4WHZA 3PZEA 3QTRA 4FL1A 1XKKA 4GVAA 2EWAA 3T3UA 1YKRA 4AWIA 2XP2A 4E5AX 2C30A 4K0YA 2HW7A 3LCSA 4WBOA 4EHVA 2C6EA 2BROA 5E7RA 4RZWA 5I9UA 5B2KA 3PLAE 3T8OA 4QMTA 3WZKA 2I1MA 3MPAA 1O6LA 2VUWA 1JLUE 5HBHA 4C59A 4AA0A 4EH8A 4CKRA 3EMGA 2GQRA 3THBA 4AE9A 2IG7A 4KSQA 3PJ2A 3SD0A 4F7NA 3P86A 1FVTA 2C3LA 4JG6A 4D4YA 3CPBA 5J87A 4PRJA 3M11A 4LRMA 3SQQA 2UZVA 4NTSA 3IK3A 2GNIA 1CM8A 4IX3A 5LVOA 3Q53A 4FNYA 3UGCA 2ZVAA 3PUPA 4CTBA 4KKGA 2JITA 4XG8A 4D9UA 3BV2A 3TL8A 4F0GA 2ZDUA 2Y9QA 3C7QA 4I6BA 4MCVA 1PXIA 1K3AA 5AUTA 4U9AA 3ZBXA 3ID6C 2I0HA 2XJ1A 5EKOA 5TKDA 4IDTA 3F5XA 1WVXA 4NYEA 4H39A 4P4CA 2ITVA 3ZS5A 4UMUA 4JX7A 5DIAA 4XCUA 4J53A 1SMHA 1ZYLA 5HE1A 4C37A 4A7CA 4W4XA 4XH6A 2FYSA 5IA3A 3SV0A 2OZAA 5EI2A 3UYSA 2J0IA 2W06A 4O83A 5F95A 2C0OA 1WBVA 3L9PA 3CTJA 5CVFA 4O7RA 2IWIA 4EOJA 1RW8A 3DOGA 3HRCA 5HNBA 5AFVA 3Q5ZA 4AN2A 3PSBA 4CLJA 4BI0A 4UYNA 5FD2A 4EBWA 4OTFA 2WU6A 5IQBA 5EH0A 1PXJA 3I5NA 1HOWA 2QHNA 2ITOA 2WMTA 2X0GA 1VR2A 5J9YA 2X9EA 3QLGA 5LQFA 2VGPA 3TEIA 3CP9A 1VYZA 3KY2A 3PY1A 4MD8E 2ONLA 2QOBA 4IJ9A 4D0WA 2RSVA 4TYHB 2RFSA 4EH5A 4NFNA 2DUVA 4XX9A 3S95A 2BRNA 2W17A 4IVAA 4OTHA 3BYUA 5GJFA 3R9NA 4OTWA 3FMJA 4TWNA 4L00A 4O6EA 3FMLA 4YJUA 3EQPA 4YJVA 5AP1A 1DS5A 4I6QA 5FLFA 5K0KA 4I5HA 2BDJA 4FSWA 3ORXA 4FG8A 5CS6A 1JKSA 5M53A 3NGAA 4TW9A 3KN5A 4C4IA 4L7SA 2CGWA 3F88A 3W8LA 4GSBA 3KRJA 4DEIA 5LCJA 2E9OA 4ITJA 4MYGA 3ZLXA 5KHWA 4BL1A 1VZOA 3R01A 2C5VA 4GG7A 3Q60A 5DE2A 3QUDA 5BVDA 3CD8A 3NCGA 3FXXA 4EOPA 3KKVA 3R8PA 3UJGA 4D5KA 3BEGA 3ROYA 5HI2A 4BFMA 3TV6A 3UOLA 3DNEA 1TQPA 3BGPA 4MXCA 4AUAA 1OPJA 2GS7A 5AIRA 1TQMA 5DR9A 2G2FA 3Q04A 2GFSA 4EHZA 5HBJA 5M56A 5D7AA 2R3KA 5BX0A 1BI7A 3QQKA 2WTIA 1RJBA 4CFWA 4GUBA 5CVGA 3ORPA 4FIEA 1E9HA 3DB8A 3BX5A 3IOKA 4FKLA 5HNGA 5EW9A 3R22A 3QX2A 3EB0A 5IQEA 2WTDA 3QLFA 3NUSA 3O2MA 4UZHA 3SXFA 2XF0A 3H9OA 2HXLA 3QU0A 3FZTA 4X6RA 5IUIA 4BCOA 2WAJA 3MDYA 4MNFA 3BGQA 1QPEA 4C4GA 4JRVA 3EFLA 2IVSA 3FXWA 5KMOA 4IWQA 4F1OA 4GJ2A 2CCHA 5HIDA 5CT7A 3W10A 3F9NA 3PPKA 5KZIA 2R3JA 4FEXA 3FMMA 4AW5A 3SRVB 5HORA 3R8ZA 5AR3A 5E8SA 1OVEA 1Q4LA 5TO8A 1Y6AA 2R7IA 5I4NA 3UO5A 5EDRA 4CMOA 2XZSA 2X7FA 2OF2A 2W99B 2B7AA 3LM0A 5JRSA 5L8JA 3RJCA 3AT3A 3KC3A 1FGIA 4CT1A 4UV0A 5L2QA 3A7FA 1H00A 4QTDA 3OS3A 4BZOA 2PULA 5IKWA 3CTQA 2JDOA 3OG7A 4X21A 1XWSA 3WZUA 5IQAA 4EORA 2XMYA 4LQMA 3VBTA 3FPMA 3H0YA 3OCBA 2X8EA 1Q3DA 3GQLA 4ALVA 3OTUA 5FDXA 3V5LA 3WIGA 4RLLA 5KBQA 2WD1A 2O2UA 3B2WA 4EEVA 3I5ZA 4FV7A 4PDPA 4RFMA 1UKHA 3MH2A 3L8SA 3LOKA 4HJOA 2QOCA 3COMA 4K11A 4AZSA 3AD4A 5L8LA 2YEXA 3SGCA 5HVJA 1OZ1A 3CQEA 1PXNA 2WGJA 3G0EA 5AV4A 2DQ7X 4RJ4A 3BQRA 1YXSA 4XBUA 4EK5A 3RMFA 3E88A 2PZIA 3SXRA 3GFEA 4IB5A 4UMTA 3QQUA 4USDA 4MXOA 5GZAA 2Z7LA 1Q8UA 4HCVA 3UPXA 4H1MA 3QRJA 3E87A 3ZDUA 3W55A 3MGYA 2X2KA 4OW8A 3MIAA 4RLKA 3BHTA 2O64A 1DM2A 3FSKA 2XNNA 5DR6A 4EONA 5IQIA 3HMIA 2QD9A 4AGUA 3PLSA 2X7GA 3OCSA 3CBLA 3DK3A 4MVFA 2C6MA 2XKCA 4ZMFA 3KXGA 4TY1A 3UIXA 1AGWA 1FINA 2XS0A 4L9IA 1UU9A 3FL5A 1AQ1A 1XR1A 3PG1A 3FMNA 4FSZA 2NRUA 4KNBA 3OY1A 2UVYA 5BUJA 4OLIA 5A3XA 1IG1A 5L6PA 3R04A 4O7ZA 4NJDA 1GNGA 2V62A 4IAFA 4MBJA 4OT6A 3RK9A 4ZP5A 2GS2A 5AP4A 3U6IA 4ASEA 2PZRA 4QYEA 4C2VA 2CKEA 5J5SA 3AT2A 4FZ7A 4RIYA 4XV1A 2BZHB 5IA2A 2F7ZE 3G9NA 3MVMA 1VYWA 2R9SA 3SAYA 2OI4X 1H01A 4DEBA 4QMYA 5L6WL 2BAKA 3P78A 4FIHA 4LFIA 4BDBA 4DGLC 4QMUA 4QMWA 3LJ1A 4KRCA 3UDBA 4KKHA 3D5UA 2REIA 5EM5A 5FQDC 4A9TA 4UMRA 3W2PA 4A4LA 2GS6A 3SVVA 4K9YA 3VJNA 5KZ0A 4TRLA 2H96A 2I6LA 2PK9A 3GVUA 5CZHA 5EG3A 3NWWA 5JQ8A 5CAVA 4MHAA 4UMPA 3MJ1A 4O1PA 2NNWB 2UW6A 4TYIA 2VTLA 4CG9A 2W4KA 2PMIA 3NIEA 2EXEA 3HP2A 3L9MA 4FSTA 4ZY4A 2V5QA 2E2BA 3VUIA 4C57A 4AZWA 4BDHA 5F9EA 4MBLA 4CKIA 3UIMA 2WO6A 4EI4A 2R3IA 2BUJA 4M14A 3ZO1A 2X6DA 4N0SA 4LGDA 4EL9A 3GB2A 3PIYA 1XH8A 4WBBB 3TKUA 4PTCA 4BN1A 4FEVA 4YC6A 2YWVA 2JC6A 4CSVA 4ZS0A 1YWNA 3IECA 5CNOA 5HIBA 3TG1A 3KXZA 1OMWA 2WOUA 1XO2B 4R7HA 5EHLA 1YDTE 4PTGA 2Z60A 3UZPA 4XV9A 5M4IA 1ZZLA 5GJGA 4R78A 3TKHA 3C5UA 3DBQA 4Y46A 4HCTA 4IACA 4LOQA 4ZSEA 5CU6A 1WBPA 2ETMA 2ZB1A 2RFNA 1RE8A 5HZNA 2OBJA 3HZTA 4D2VA 3KFAA 3F66A 4IC7A 3UE4A 3DDQA 1M2QA 3FI4A 4II5A 3FY0A 4C33A 3CY3A 5E8VA 4AP7A 5HE0A 4H05A 2FSOX 3O7LB 4FKTA 5GZ8A 3BE9A 4EOKA 3CIKA 2R3QA 1TKIA 3GU4A 3MH3A 4JLCA 4M68A 3ZZEA 4C34A 4NIFB 4ZSAA 2OIDA 3D4QA 3F7WA 3R63A 5EI6A 4R7BA 3NAXA 5EFQA 5IDNA 3KMUA 1YOJA 3E62A 3HRFA 5A46A 4AG8A 5JMSA 5DN3A 5M07A 2JIVA 1TVOA 5CT0A 2C3KA 1YOMA 4FA2A 4PMPA 2PE1A 2NP8A 2XIKA 3P79A 1UNLA 1OECA 4U80A 4YJQA 4XOYA 3C0IA 1KE8A 4B99A 3PRFA 3EIDA 4FOCA 3ATTA 4IAIA 2QODA 4NH1A 4EOLA 3GENA 5AR7A 4RC3A 3GEQA 4EK4A 2PVYA 2PE2A 2WU7A 4I0TA 5CI6A 4GH2A 3TIYA 5KO1A 5M4UA 3K54A 4ZLYA 3FEGA 2OH4A 4XV3A 3BHVA 3BYSA 3IW5A 3O51A 5LMBA 5KMMA 3ZC6A 3ZLWA 4D55A 5CF8A 4C7TA 4FSYA 2G15A 4ANMA 2RGPA 3EN6A 2HCKA 3EQFA 5E8WA 3UIUA 4JAJA 5HIEA 4J1RA 1PXPA 3F6XA 1UU3A 3HV3A 3QX4A 2BCJA 4NKSA 4YNEA 5DI1A 4XP0A 3V5PA 5M51A 3CQWA 2PPQA 3ZO4A 2XK7A 3Q6UA 1GY3A 4DT9A 2C4GA 2A4LA 2Q0NA 4YNOA 5JGBA 3W2SA 4O0TA 4XYFA 5DG5A 5HOAA 3LQ3A 1UVRA 1FVRA 4HCUA 4LI5A 2GTMA 4QP2A 5C8MA 3HEGA 5E1SA 1MUOA 4BF2A 4YLLA 3POZA 3IPHA 5EOBA 5HEZA 4EYMA 2XCKA 3HAVA 2A0CX 5AUUA 2BDWA 2YIXA 2X81A 4LG4A 5D11A 2O3PA 3LMIA 2HZ4A 4KKEA 2JIUA 4WNOA 5BVNA 4RT7A 3AC2A 3SKCA 5GIOE 2WMSA 2ZM4A 2IZUA 2WMXA 2GHMA 2XIYA 2ZV8A 3FUPA 2YLFA 3BLQA 3HRBA 3NUPA 4TYEA 3R1QA 3LXPA 2WB8A 3HUBA 3CD3A 3NUUA 3SLSA 5IG1A 3OHTA 2P3GX 4LM5A 1H8FA 2VTOA 1J3HA 1LUFA 2BKKA 4I3ZA 1SNXA 4IJPA 4JIKA 4WO5A 4E93A 1E1XA 1SVHA 5EDQA 3EFKA 4J97A 5HU3A 5L2IA 2W5HA 4R5SA 4QNYA 3PXFA 5AUWA 3B2TA 3VWAA 3R21A 2UVXA 3KGAA 3V8SA 4ASZA 5M09A 4DC2A 3NW6A 4R1YA 4U41A 3KULB 5J5TA 2W1FA 3VS6A 5LWNA 4YSMA 3S00A 4E4NA 4O7NA 3PTGA 4ALUA 4DYMA 1Z5MA 4G34A 4AGCA 1W82A 2YCQA 4M69B 3TUCA 1A48A 3BWJA 3PA4A 2H8HA 3PPZA 4LV5A 4RVKA 3ZXTA 5HQ0A 4YJTA 1KE9A 1MQBA 4MH7A 3ULZA 1STCE 4FEWA 3PE1A 4DGOA 5CF4A 4QTBA 3RWQA 2NPQA 4HGEA 4GG5A 2R0UA 2XIXA 5AAEA 5JGDA 3QWJA 4E6CA 5JT2A 2WELA 3BHUA 3NIZA 4KS8A 2BRMA 2Z7QA 1PXKA 4RWIA 5EYMA 4I93A 4FL2A 2JD5A 3FLNC 4J71A 4U43A 5ACBC 5CANA 5KCVA 1XH6A 2JKQA 4P90A 5LVNA 5K5XA 2Z7RA 1V1KA 3DJ5A 3GU8A 1R1WA 2O63A 3HMOA 4FIIA 4FTOA 5E92A 5A9UA 3AC1A 3E92A 3TTIA 2PUNA 3PJ3A 4H58A 5CEIA 4CCBA 5B7VA 3QQHA 2VV9A 3QRUA 4ERKA 2OKRA 2VTIA 2WTJA 5AV2A 4GIIA 4CFMA 3R7VA 5ICPA 3KA0A 5TF9A 1G5SA 2VO3A 3WOWA 3ELJA 5C4KA 3L8XA 3LPBA 5K4IA 2B9IA 3QTUA 3MTFA 2UZWE 5K5NA 2X7OA 2ACXA 5AP0A 3PXZA 4CTCA 2OIBA 1YWRA 3R8UA 4DGMA 3CGOA 1ZOHA 5BMSA 3N51A 3TIZA 2XKEA 4FZ6A 5LARA 3SC1A 5FP5A 4AA4A 4PUZA 5HCYA 3FJQE 3R30A 1Y6BA 4BDFA 3DA6A 4O0VA 4GT4A 3TM0A 4CFUA 3PDTA 3CGFA 4U44A 4QP8A 3UODA 4A07A 3OROA 1WBNA 3A7HA 4RZVA 4R1VA 2CJMA 3ATSA 1OITA 1YXVA 3DBCA 3Q4UA 3KF4A 2VWBA 4I20A 5F4NA 2OZAB 3UNKA 3OT8A 1BL6A 1GZKA 4F1TA 2CLQA 2W9ZB 4YZBA 3GI3A 1T46A 1UKIA 3GGFA 3ZEWA 3AC3A 3HA8A 2WTKC 1S9IA 4PQNA 2YIYA 3PXKA 4FT9A 4WD5A 1LPUA 5TR6A 2QOQA 3ZYAA 3CJFA 4QP3A 1YHVA 3ZRKA 1Q62A 3QUEA 3DKFA 3KVWA 4QT1A 2EB3A 4CRSA 2J5EA 3SOCA 4F4PA 3LFQA 5DGZA 4TL0A 5L2SA 2QR8A 4JR7A 5D41A 3WF7A 3BZ3A 4DH3A 4M13A 2YM8A 4EJNA 2BR1A 4APCA 3KN6A 1J1BA 1Q5KA 3VUTA 5DRBA 1YWVA 2HK5A 5LVLA 1V0OA 3PPJA 4WRGA 4Y85A 3W18A 3PJCA 4DFNA 3CSVA 3UMXA 3CLYA 5CXZA 2YZLA 3I7CA 4OUCA 4JR3A 3CR0A 1ZYCA 4G3CA 4G3GA 5CU0A 2YM5A 2PUPA 4KUJA 4BGHA 3P9JA 3H4JA 3GC9A 3RTPA 3DBDA 2CN5A 4ACMA 3LFAA 2VX0A 4FV9A 4E8AA 4CGAA 3FHRA 1Q8ZA 3OWPA 3LFSA 4JQ8A 3VQHA 4R8QA 5FGKA 4JVGA 3OVVA 3IDPA 3CY2A 2XIRA 3OEFX 1L3RE 5AP2A 2OXYA 4FTJA 4PNKA 2YJRA 4FC0A 2HOGA 5IEXA 2YM7A 4Q9SA 3RAIA 4OTRA 3QQJA 4IB0A 4CCUA 3JR1A 2WHBA 3OUNB 3ODZX 3IQ7A 2FB8A 3LLTA 5H8EA 3MWUA 1WMKA 4DGNA 4MXZA 4L8MA 4YJSA 3EZVA 1IEPA 3RZBA 5A6NA 4RJ8A 5EYDA 5A4TA 1SM2A 2VNWA 3DQXA 3UG2A 5FEDA 5FXQA 4X0MA 3OTVA 4B0GA 1URCA 1YXXA 5AWMA 2J50A 2WMAA 3KB7A 4CFXA 4IWOA 1H1WA 3LAUA 3P4KA 4FIFA 2HWPA 3FQEA 1UU8A 5ANIA 3V5QA 5B2MA 4EHGA 2VTRA 3ORZA 5AIKA 5M08A 2V0DA 1JKTA 2WTCA 4CVAA 3BYMA 4PF4A 2OICA 4PWNA 4HVHA 4O7LA 1REJA 2OWBA 4ONAA 4W8EA 4EZ5A 1FMOE 4TYJA 3R2BA 3O96A 2QKRA 5CAOA 3FYJX 4DGGA 1Q61A 3ORMA 5L3AA 3R7EA 2QU6A 3C4WA 5ACKA 1WBWA 3N4TA 3QD0A 4ZY5A 2Y7JA 1ZMUA 4CV9A 1DI8A 2PE0A 4S30A 3U4WA 3TZ9A 4MWHA 2UW3A 3ODYX 1GAGA 5DA3A 2PU8A 4P5ZA 4F9BA 5DRDA 4CT2A 4YJPA 2HYYA 3KK9A 4MQ2A 3EQRA 3ITZA 4YC3A 4F64A 4G1WA 2F49A 3FMDA 5CSPA 5JZNA 4IMYA 4H36A 4XG2A 1U54B 3NVKI 5AUXA 3GC7A 2W5AA 4OGRA 5EKNA 3DLSA 4AT5A 4OBOA 3QL8A 4AW1A 4A9RA 5GIPE 3A4PA 2QOOA 5AAGA 4EUTA 1OGUA 3MFTA 3NNUA 4DINA 1GIIA 3BU5A 1OL7A 3D14A 3ZRLA 4ASXA 3ZHPC 4XUFA 4BDKA 4HOKA 4C62A 3U4UA 1KOBA 5BUEA 2W1HA 2YACA 3TJDA 4O21A 1PF8A 3DCVA 5DT3A 5CEOA 1WVYA 2WQMA 4DFXE 1YXTA 2DYLA 3IW8A 4M69A 3Q9YA 4JT3A 4M8TA 4MQ1A 3W2QA 3KXHA 5EYCA 2GHGA 3HYHA 3QD2B 4NCTA 3GFWA 4LMUA 3F2AA 3V6SA 4RJ3A 3T9IA 3JS2A 4RWKA 4O7TA 3GCPA 2B9FA 2R7BA 4FKGA 5I3OA 4IFCA 4FUYA 4X2NA 4XMOA 4ZIMA 5ETIA 5CSXA 5HO8A 2BFXA 3ZMMA 1U46A 4FG9A 4ZEGA 2ZV9A 3GT8A 3BWFA 5IQFA 3QC4A 2QQ7A 3HV6A 3KF7A 5IEVA 1JVPP 2NO3A 4PP9A 4U5JA 4AT4A 5C8NA 3SXSA 3IDBA 1H27A 2ZJWA 3PRIA 4FTTA 4NWMA 4EH2A 3ZO3A 1O6KA 2Q0BA 4XS2A 1JAMA 3LFNA 4YURA 4F0IA 4FV0A 4IX5A 4AOIA 4I0RA 3JXWA 4KIKA 3RCJA 4AXAA 5B0XA 4YMJA 4BDEA 3WF9A 2IO6A 4O0YA 4QNAA 2VTSA 2BRBA 2PUUA 1UWJA 4FUXA 3E8EA 5E8YA 4BWPA 2XA4A 4E20A 5AJQA 5CY3A 3BRBA 3EJ1A 5AR5A 4ASDA 3LVPA 1EH4A 2LAVA 5CEKA 2KTYA 4AACA 3VS1A 3ZO2A 5DHJA 4G5PA 5HICA 5TE0A 5LOHA 4O7SA 3JVSA 3OXIA 4RIYB 2WMBA 4KRDA 4FSNA 2W5BA 4QPSA 4TYGA 3UO6A 2GU8A 2Z8CA 2WEVA 3UQGA 1HCLA 2V7AA 1CDKA 1MP8A 1OKZA 3C0GA 1YOLA 2EXMA 2ZMDA 3ALNA 3G5DA 4O7VA 1BX6A 4YC8A 4DFYA 1CKPA 5AUVA 3CS9A 2ZYBA 4FICA 4IWDA 4U3ZA 3E93A 1PXLA 4H3QA 3BV3A 4E5BA 3L8PA 4EUUA 3U87A 2IPXA 4ZK5A 2QI8A 5E90A 4V04A 5FWKK 5FG8A 5HG5A 2ITYA 2VNYA 2VTNA 3OD6X 4I6FA 1J91A 2A1AB 1M7NA 1PJKA 2ZDTA 4FKQA 2O0UA 4FVPA 4GJ3A 1OI9A 1PMEA 4K1BA 3R9OA 3ENHA 4YSJA 1G3NA 2XK4A 4RFZA 2I0VA 2WQBA 4GEOA 4WSYA 1Z9XA 1Y91A 5TT7A 4BCKA 1CKJA 3VF9A 2XKFA 3ZLYA 3EN4A 3IO7A 3SHEA 4IAAA 2P2IA 4QMPA 3LKMA 4CZTA 3I4BA 2B0QA 2CGXA 3DXPA 3MA6A 5H9BA 3V04A 2OGVA 2IJMA 1Y8GA 3N9XA 3I0QA 4KB8A 2HW6A 2I40A 3D2IA 3Q9ZA 3L8VA 5LWMA 2WTVA 5EK7A 2UZTA 3O50A 4FTQA 3NUAA 3R7GA 3KCFA 1FPUA 3I81A 3BI6A 3VS7A 4D4VA 4PY1A 5I9XA 3ZXZA 5GINE 3QWKA 5DR2A 3QYZA 4TNDA 5KMIA 3Q9XA 2J6MA 2GTNA 2WEIA 4WNKA 3C4FA 5HVYA 4MD7E 3O7LD 2Q83A 4DEEA 3EQCA 3UBDA 2PHKA 1REKA 1FGKA 4RJ6A 4O7WA 3MH1A 3H30A 4HYHA 4QP4A 3V01A 3PY3A 3U55A 3FL4A 3UNJA 4RC4A 2GSFA 4E4LA 3U54A 4NSTA 3FMEA 5A4LA 2QNJA 5IH4A 3JYAA 4LUEA 2PYWA 4HZSA 2GNJA 4EKLA 3TNHA 3QTXA 3TT0A 4G3FA 2OJIA 3DT1A 3HGKA 3NSZA 3FYKX 4QYFA 2R2PA 4FVQA 3SX9A 3TV7A 3HMMA 3PXYA 2PVLA 3MPTA 1JSTA 4NU1A 4UWCA 4DFBA 3S2PA 5GHVA 4FK3A 4S31A 3ZTXA 1PHKA 2YISA 2XB7A 4EC8A 4FKOA 5D12A 4GK2A 3D7TB 3VULA 2G01A 2JDTA 5BPYA 2R3LA 4WIHA 3UP2A 4R6VA 3AD6A 1F0QA 2QLQA 4PL5A 4I5MA 4XEYA 4DLJA 3EN7A 3G51A 4ZTRA 4PDSA 1OBGA 3IKAA 3QRIA 3VQUA 3F69A 3CJGA 3PY0A 5AX9A 2FSMX 3LCKA 4G3EA 2R0IA 5AR8A 3QCSA 4NW5A 3CKXA 2X2LA 2C5OA 4F65A 5EQEA 1BYGA 3TXOA 3OOGA 4OBPA 4DFUA 3BGZA 3R8MA 2CHLA 1U54A 4EWQA 3LFFA 2RFEA 3LCDA 3R1YA 5I9ZA 4RBLA 2ITTA 5LCKA 2JLDA 4CXAA 1O6YA 4IM2A 4YTHA 3NAYA 3VUKA 3WZDA 1QMZA 2RG6A 3DZQA 4JI9A 2UW0A 4LOOA 3EOCA 5M55A 3R73A 3IDCA 2CPKE 1PKDA 3OT3A 3RVGA 3LXKA 3TN8A 3O17A 4TKSA 3NNXA 3UOJA 3UQCA 4PPCA 3GXLA 4OT5A 5HCXA 4G6NA 4CFVA 2WIHA 4FYNA 3PA3A 4CQGA 5A4QA 4DG0E 3P7AA 3R71A 4ZJJA 3ZONA 3GCSA 4FZAB 5DEWA 4HGLA 5BUIA 2UZUE 4NM5A 4O27B 4L52A 4X3JA 3ZZWA 1ZZ2A 4G31A 4FSMA 5JZJA 4NT4A 4L68A 5C01A 4GT3A 4IZ7A 3SDJA 4XJ0A 3UNZA 4QPMA 1WBOA 4GT5A 5CEMA 5CLPA 4WT6A 4CNHA 4F9YA 2GNFA 3LQ5A 3U51A 4B7TA 1PXOA 3BHHA 3ORIA 2P0CA 4O6LA 4BKYA 5CF5A 2QO2A 4IH8A 5KKRB 1OL2A 2BILB 2XVDA 4EOOA 4I0SA 2PMNX 4P2KA 3ZU7A 4C2WA 3HVCA 3TDWA 5I5ZA 3LHJA 2YAKA 4K77A 5FTQA 3OXTA 2UW7A 2JFLA 4GYIA 1WAKA 2QHMA 4YO6A 2XK3A 4O2PA 4JBOA 5IMEA 5CSHA 2XYNA 3G33A 4HYSA 3T9TA 4JG8A 4DCEA 3AGMA 2WXVA 3RAWA 4O96A 2C6OA 1BUHA 4QMLA 4YJOA 1W98A 2OJGA 4HVSA 5JFXA 2XEYA 1NXKA 1XH7A 3GUBA 3OMVA 4L7FA 2JFMA 5A54A 1KV1A 2EUFB 2J7TA 3BYOA 5AM6A 4KAOA 4U8ZA 2OLCA 4RX9A 3P23A 4XP2A 3NRMA 2KULA 4IZAA 1ZY5A 3KL8A 4ANLA 3E7OA 3MVHA 2BFYA 4IVCA 2PMOX 4O91A 1XBAA 4C3FA 4HPTE 2Y0AA 3ZM4A 5ITAA 3R7OA 1UNHA 3R8VA 1PMNA 5EM7A 1KE5A 3NW7A 3Q6WA 4XRJA 1QCFA 3DDPA 5DLSA 3EKKA 2PTKA 2PWLA 3AXWA 5FBOA 4YPDA 4G9RA 2WMQA 5HO6A 4NFMA 5FDPA 5LVMA 3QGYA 3FZRA 3TACA 3Q4TA 3RPYA 2F4JA 1PRYA 4JS8A 4BHZA 3NEWA 2XK8A 4UXLA 1BL7A 5ANOA 4UYAA 3OC1A 3P7BA 4RJ5A 2C5NA 3DU8A 1U5QA 3FQHA 2BTSA 1URWA 2CCIA 2BAQA 2ZMCA 4D2RA 3EZRA 3I0OA 3GC8A 3QTSA 4G3DA 2FVDA 4H3BA 4KIOA 3U8WA 3WF5A 5FEQA 3VN9A 2XM9A 4AGWA 5CAPA 2W9FB 2B52A 2PVMA 3TNQB 3A7JA 4FEQA 4K18A 3DNDA 4DH1A 4LGGA 4DEAA 4FTLA 3DBEA 3QKKA 5CTPA 4YGAA 4FTNA 2QCSA 4KBCA 2GDOA 3FXZA 4CQEA 5CQWA 3C51A 3OW3A 1JKKA 5KKRC 2JDRA 3R9DA 1BKXA 2O65A 2VX1A 4LMNA 3RNYA 4C38A 3F7ZA 3R0TA 5J7BA 5KX8A 4F7JA 3HX4A 3ZC5A 3FLSA 4DFZE 5JH6A 2RKUA 3QRTA 2VN9A 4W9XA 4O84A 2QLUA 5E4HA 2GNHA 4ORKA 1H25A 5EI8A 2OSCA 1ZYJA 4I41A 1QPDA 3W2OA 3ZUUA 1UV5A 3FQSA 5H3QA 4RMZA 4GIHA 1ZMVA 4BDDA 4D9TA 3Q96A 5AP7A 1K9AA 4L3JA 3KMWA 4CMUA 3A7GA 5KUPA 3GCUA 5E8ZA 2WNTA 4GW8A 4IBMA 3R7UA 4O0XA 2O8YA 4BWXA 3QCXA 1OM1A 2W7XA 1H1PA 4LV8A 5JFWA 4FKIA 2JDVA 3FZSA 2CNVA 5DYJA 3AG9A 1WVWA 3MB7A 2RF9A 2JEDA 4EQMA 2QVSE 4AGDA 4JBVA 3QTZA 4AF3A 5A6OA 4X2FA 2WMUA 3QQGA 4YHFA 1AD5A 4R3PA 2XJ0A 5CI7A 5ETCA 2BIKB 2WPAA 3W1FA 1U5RA 1ZLTA 5L4QA 4QMNA 3HDNA 3ACJA 4AFJA 5JSMA 2C6TA 4RC2A 4YJRA 3GCVA 3PYYA 5AM7A 1P14A 3MESA 5C1QB 2BZJA 1DI9A 1UWHA 3UMWA 1V0BA 2I0EA 4RPVA 3D7TA 4FTCA 5G1XA 3W32A 4PMSA 3PA5A 2VTHA 3F5UA 2PZPA 2IW8A 4WNMA 4BGGA 4IDVA 3Q32A 1Z57A 2YWPA 1OPKA 4QMOA 4U7ZA 2W4JA 2B9JA 2AUHA 5LMAA 2CGUA 5B2LA 4RVTA 4DBNA 4AOTA 1M7QA 3UVRA 2XNBA 4BTFA 2HWOA 3FY2A 3KRLA 4W4WA 3QAME 3UC3A 3V3VA 4ANQA 1OPLA 3U6HA 1ND4A 4WOVA 3G6GA 3NR9A 5KE0A 2VTQA 1H24A 2R3OA 4NJ3A 3PSCA 4S33A 4EKKA 4GFMA 4PTEA 4ZSLA 2CMWA 3F3UA 4XHKB 3COHA 1NVRA 4F9CA 1LEWA 3W2CA 2C5YA 2GCDA 4U40A 5CSWA 4MX9A 3V6RA 3VF8A 1IA8A 3OBJA 3SA0A 3RHKA 3FPQA 1O9UA 4YBKA 2J0JA 5EOLA 3RAKA 3SG9A 1OL1A 5A4EA 3ERKA 3Q52A 2R64A 3HLLA 3EQGA 2B53A 2EB2A 3W2RA 5C4LA 3FZ1A 2GQGA 5HLPA 4E3CA 4BC6A 1PY5A 4BGQA 2B54A 2WTWA 2X8DA 2R3GA 4QP1A 3V5WA 2BALA 4EQUA 4M0ZA 4QMXA 4ZOGA 2XKDA 5DVRA 4YLKA 4U42A 4ERWA 3ZCLA 3QRKA 4Q5HA 4ZTLA 4ENXA 1MRVA 3PXRA 5HO7A 1Q99A 5CZIA 5H2UA 5M44A 1IRKA 3QCQA 1B6CB 2WIPA 4HGTA 5H8GA 3NUNA 4LOPA 3PJ1A 5HTBA 5AEPA 5AR4A 3MFRA 4QTCA 4UZDA 4O82A 4O1OA 2WTKB 2YIWA 4CKJA 4NEUA 3DGKA 1Y57A 4PL3A 1NY3A 2J4ZA 3KREA 3NDMA 2JKOA 4IB1A 3NNVA 3OZ6A 3QGWA 4MWIA 4RJ7A 4WG4A 4D2WA 4ZZOA 2J2IB 2FA2A 4CYJA 1OL5A 4Q5EA 4G6LA 1K2PA 3OEZA 3HMPA 2ITPA 2QKWB 4NM7A 4RSSA 2BVAA 4WA9A 2J9MA 4E6QA 5A4CA 5F20A 4FT7A 4YTIA 4WUAA 5HG7A 4F99A 4XRLA 4AZEA 3A60A 2W05A 2CKQA 2X39A 2X8IA 2IZTA 3FKOA 4DEDA 5DT4A 5K4JA 3CXWA 4BBFA 3ANRA 3BPRA 3MTLA 3DAKA 4DITA 2FO0A 2CGVA 3K5VA 3C5IA 2QOHA 4ACHA 4JXFA 3DFCB 4NM0A 4RIXB 4FR4A 1WZYA 3E8DA 2V55A 4D0XA 5H8BA 3DQWA 5FM3A 5HE3A 5CASA 3AC5A 2UW9A 2PVKA 4BKJA 1H4LA 5CYIA 2HZIA 2YHVA 4FVRA 5FBNC 4AOJA 2ETRA 3KXXA 1JSUA 4KIKB 1JQHA 3NYXA 4QOXA 2JKKA 1WCCA 3IS5A 4OR5A 3S4QA 4CLIA 1YVJA 4JDIA 2JKMA 3ORTA 4A4OA 4JJRA 3TWJA 4DN5A 1KOAA 1I44A 4D2TA 3KRWA 3FLWA 3UZRA 3E3PA 3Q9WA 2HY81 3D94A 3W8QA 4FV5A 3ENMA 3VBVA 1Q41A 4N6YA 1XQZA 3TUBA 4XG9A 4J95A 4E6AA 3ACKA 4ZMEA 4BCJA 5FTOA 3VS3A 4AFEA 5JK3A 4DT8A 3E3BX 2VO0A 2Y8OA 3LMHA 1P4OA 1XHAA 1YQJA 4IAYA 3VBQA 4EH9A 1FBNA 3OWKA 3F5GA 4OTQA 3BYVA 4CG8A 3FMKA 4Q2AA 4QYYA 2AC3A 2C5XA 3IONA 4R3RA 2G1TA 3PWDA 3D15A 4S34A 2P2HA 3HP5A 1ZYSA 2UUEA 5BYLA 5HTIA 5CSVA 4XG6A 4F6UA 2YM4A 1J7IA 1Q24A 3RPSA 4ZS4A 2WMVA 4YZ9A 3FZPA 3MY1A 4I6HA 4JX3A 5JFSA 2C1BA 1R39A 5IPJA 3EQBA 4ITIA 4DE4A 3TZ8A 1XH5A 4FTAA 3RPOA 4GK3A 3VVHA 2C6IA 1VJYA 4ANOA 3UC4A 2JDSA 4HGSA 1UA2A 3LZBA 3QXPA 4IADA 5BVFA 2G9XA 3JY9A 4D2SA 4NCTC 4OTDA 5EQPA 3ZSIA 5HLWA 3BKBA 2C6DA 3DPKA 4B4LA 2JAMA 3G2FA 2BIYA 4DH7A 3DJ7A 2CLXA 3GU7A 3R6XA 1GIHA 3R02A 4A9YA 4L01A 3NUYA 3ORNA 1XBCA 5T6KA 5JKGA 4OAVB 3PVBA 3ZUVA 2ITZA 3EHAA 4FKPA 5IDPA 5IU2A 5AUYA 4MXYA 4FGBA 4GFOA 5CU2A 5CXHA 5T68A 4C35A 3Q4ZA 3IOPA 2W1GA 4RX7A 4ZY6A 4I21A 1L8TA 4EK8A 4DBXA 2QOKA 1CKIA 1R3CA 2XBJA 1M17A 4LGHA 3K2LA 3DB6A 5HVKA 4FIJA 2QG7A 2Y6MA 5IQDA 5FXSA 3WILA 3ZSGA 3LQ8A 5AV0A 1YW2A 4AZTA 4GKHA 3EH9A 5FTGA 3JUHA 2J5FA 4M97A 2SRCA 4BDGA 5LVPA 2R3FA 4LYNA 3Q3BA 4M3QA 3LFCA 4BDJA 4F09A 2CNQA 3MY0A 3NNWA 3OF0A 2OU7A 4QP7A 2ITWA 2PL0A 5J8IA 3REPA 3UVQA 3SW4A 3ZFYA 1Q8TA 2HZNA 2WZJA 4TPTA 4Z16A 3PVWA 3PSDA 4FV6A 4FI1A 3PP0A 4TNBA 4Y8DA 5C27A 3OXZA 5HE2A 3W16A 4TWOA 4DHFA 4F7SA 4USEA 3EFJA 3KU2A 5HX8A 1GJOA 3AT4A 4C8BA 4FNXA 4FOBA 2Y6OA 3RALA 2VWXA 2XNOA 3WYXA 4I92A 4BVUA 3F3VA 4D4RA 1OIQA 2J0LA 2BHEA 1H1SA 2BDFA 3LXNA 5BVEA 3RKBA 3H3CA 4CD0A 4HVGA 4C4FA 3B8QA 4TN6A 4RIWA 2RFDA 3O0GA 4ACDA 3OWJA 3R28A 4PPAA 3FMHA 3VHKA 4ZZNA 4ZLOA 2C0TA 2OZOA 2YABA 3LMGA 4IX6A 1ZYDA 1IASA 2IVVA 5BVOA 2GHLA 2QOFA 3LIJA 5FM2A 3OUKA 5J79A 4O2ZA 2YIQA 3PXQA 5I0BA 1DAWA 2BTRA 1SVGA 3PE2A 4B6LA 4QRCA 1LR4A 3RI1A 3G15A 3RBWA 4IWPA 4AN3A 2YITA 1BI8A 3N4VA 4MD9E 3UVPA 3LLAA 4YZCA 1R0EA 5AP5A 2WKMA 3VBXA 4EWHA 2W1IA 3AMAA 1PYEA 4USFA 1QPJA 2C0IA 2CN8A 1VEBA 3LJ0A 2EXCX 1MRYA 3WARA 5EYKA 4DH8A 2YM3A 2IW9A 5DBXA 3MPMA 4BCIA 3QZHA 4X2GA 3QF9A 4UN0C 4C36A 4DTBA 3ORKA 4O22A 2XK6A 2ITXA 5C8KA 5LMKC 4HYIA 4FT3A 1PXMA 3GQIA 5E1EA 4BTJA 3Q4CA 4J7BA 3M1SA 5L8KA 2BRGA 2YDIA 3VW6A 1JPAA 2GFCA 3QQFA 4HNFA 2IN6A 2PVFA 4HPUE 3LFEA 4M12A 4TT7A 1FOTA 4FTUA 3P7CA 4FK6A 4FKWA 5CWZA 2WQNA 4EH3A 3HDMA 4GCJA 4PMMA 4WG5A 2ZB0A 4D1XA 3FAAA 3DJ6A 4DH5A 5L2TA 3BLRA 3QXOA 3QZIA 4YP8A 3P0MA 1B38A 4RWJA 4W4YA 2Z02A 5FUTA 3I79A 2YFXA 4JQ7A 5HBEA 2UZEA 2OH0E 2PY3A 3F3TA 4UWBA 4HZRA 5AV3A 4O0RA 4X2JA 1JWHA 3WZEA 3GNIB 3FBVA 5KMNA 3CPCA 4B8LA 5CU4A 3OOMA 5GNKA 2AYPA 3FI2A 2YN8A 5CALA 4O81A 2B9HA 2OFVA 4RIXA 2ZV2A 2BKZA 2HELA 1MRUA 3MV5A 2XNEA 5HX6A 4JDKA 5D10A 3ORLA 4ACCA 4BCQA 2FSTX 4V0GB 3AMBA 4FMQA 3VC4A 1NVSA 2YCFA 3QCYA 5BNJA 3NYNA 3G9LX 5D1JA 4M67A 3UP7A 4F1MA 3FV8A 1T45A 3ZOSA 3B8RA 3G90X 3OBGA 4FV2A 4E4MA 2YIRA 2CKOA 4FTRA 2LGCA 3NPCA 4NUSA 4CEGA 1OIYA 4U3YA 3IW6A 3RPVA 4QQTA 3G0FA 2XYUA 2I7QA 3MH0A 4RX5A 4S2ZA 4UEUA 3RK5A 5IZFA 1TQIA 4WNPA 4WKQA 2R3HA 4A9UA 4BY9E 4M0YA 5HCZA 5ANEA 4XNEA 2PSQA 3QQLA 4XOZA 3I1AA 3IGOA 4ZAUA 3RGFA 4Y72A 5GJDA 5J1VA 5IQCA 4N6ZA 3E64A 3LXLA 1GZNA 4O0WA 1CSNA 4N70A 4PP7A 3VS0A 2R3MA 3PG3A 4PL4A 2A19B 3P5KA 5DWRA 4OAUC 3K5UA 4LL5A 4YBJA 3DAEA 1F5QA 3PZHA 2VTAA 4FKJA 4IB3A 3UOHA 3NCZA 5KMLA 4D1SA 3O8TA 5HHWA 2YJSA 5F94A 1YI6A 4RQVA 2UZLA 2ITNA 2QONA 3FLZA 2CSNA 4L42A 4L46A 4HVIA 1BLXA 4FNWA 5IQGA 5K0XA 3EQIA 3DBFA 2HXQA 4X3FA 4Z55A 2QG5A 2VZ6A 3WF8A 2YAAA 3WZJA 4A9SA 2H6DA 2FSLX 2XIZA 4PV0A 1CMKE 4YTCA 2J51A 5DNRA 2B4SB 1ATPE 3H0ZA 3C1XA 4V05A 5DT0A 1W0XC 3VAPA 5IA1A 3WF6A 4BIDA 3MFUA 4D4SA 4ZTNA 5L6OA 1GZ8A 2F7XE 3LE6A 4FIGA 5BVWA 5KBRA 3FLQA 3FI8A 3IGGA 3BQCA 4QQ5A 4FV8A 1WFCA 5I9VA 1H0WA 3KXMA 3VHEA 5IA5A 5CAQA 3O8UA 2OJ9A 3RP9A 4FZFB 4Z7HA 3V8WA 2VTPA 4GS6A 5LMKA 3FHIA 4W9WA 4C3PA 3UQFA 3TZMA 4ITHA 4IVBA 2QOLA 3QUPA 4TXCA 2BZIB 2J90A 5DFPA 5CEQA 4DTKA 3MJ2A 3TKIA 3M42A 1H1RA 2PVNA 4E6DA 4FYOA 2IVTA 3H9RA 2X6EA 4KBAA 1M2PA 4DEHA 1J7LA 2EVAA 4EHEA 3LCOA 3NS9A 4MNEA 4TWCA 5ETAA 3VS2A 5HU9A 1YHWA 4B8MA 4BDIA 3UIBA 4GYGA 1KUTA 4J98A 4LRJA 2FGIA 2XM8A 3C4ZA 4PNIA 4IXPA 4PDOA 3BU3A 3MS9A 4PDYA 2YCRA 3FLYA 4F9AA 4DFLA 5IA0A 2W96B 2Y4PA 3UOKA 5AMNA 4AW0A 4DTAA 3IW7A 3KK8A 4BIEA 2W1ZA 2ERKA 3POOA 3FC2A 4FX3A 3GU6A 4PMTA 3R1NA 4G9CA 2OIQA 3TJCA 4CRLA 3NMUF 2FUMA 3C4CA 4RFYA 2C3IB 4R3CA 5CAUA 4YHJA 2VWUA 4EZ7A 5JRQA 4X6QC 2XEZA 4BCFA 2Z2WA 3QTWA 4CZUA 4NK9A 3JY0A 4BZDA 1KSWA 1A9UA 2C69A 3AD5A 2VWZA 5AA9A 5KHXA 1YHSA 4UALA 1A06A 5E8XA 3RNIA 4FNZA 3TDVA 3EYGA 1J1CA 4G16A 5HGIA 3D9VA 4FGRA 4GL9A 4QTEA 3CKWA 4O0SA 5T3QA
chains in the Genus database with same CATH superfamily
4XBRA 5C03A 4BBMA 2CKPA 1W2DA 3D5WA 3DXNA 3F3WA 2PVHA 1KWPA 2ITUA 2JAVA 2IZRA 2YZAA 3I6WA 1W8CA 4R77A 4PPBA 4O86A 4G6OA 4UB7A 4FEUA 1S9JA 2F57A 2UW8A 3EN9A 4P5QA 4BTMA 4ZSGA 1IA9A 3QA0A 4QQJA 4QMQA 4U6RA 3AC8A 2PVJA 1PW2A 1ST0A 1IAHA 1QPCA 3PP1A 4OTPA 3T3VA 3C13A 4IHPA 4UMQA 3AGLA 2CNUA 2ZFYA 3D0EA 3N4UA 3CQUA 3GOPA 2VWVA 3QBNA 3F82A 1U59A 2HZ0A 2UZDA 4D2PA 1NW1A 3DXQA 4U0IA 3H10A 1GOLA 4UXQA 1YDSE 1PYXA 3HKOA 5E91A 5E8UA 4I4EA 5CQUA 2UZNA 3KRRA 1H26A 2QC6A 2VTJA 3R9RA 3V8TA 3F3ZA 5KMJA 4BDCA 4MXXA 5ANGA 5HG8A 4C3RA 4D1ZA 4ANBA 2BPMA 1MQ4A 4F0FA 2A27A 4GVJA 3ZFXA 2PUIA 3A99A 3MVLA 1IR3A 4AN9A 4S32A 5JN2A 4Y83A 2R3RA 4JNWA 4FBXA 4BCPA 4C0TA 2W0JA 2VD5A 2XRUA 1OIUA 4DHJA 4YU2A 3C0HA 2Y4IB 2HENA 3R7YA 3UG1A 4FSQA 3ALOA 4V0GA 1VLRA 4NL0A 4ZXTA 3RM7A 5BMMA 2P33A 4WUNA 4JQEA 5IA4A 3EL7A 5EW8A 4FSRA 5HD7A 4QMVA 3VUHA 4BDAA 1UU7A 4WRSA 4BKZA 2ETKA 3V5TA 5LXMA 3VO3A 1B39A 3D5VA 3GP0A 5J7HA 4FV4A 4XV2A 1KE7A 3ANQA 3CEKA 3FE3A 2F2UA 2CDZA 2QR7A 3II5A 1P5EA 2HY0A 2X1NA 1V0PA 3MY5A 3O8PA 3PFQA 4EK3A 1H1QA 5BYYA 3BBTB 4RVMA 4XLIA 4C58A 5M57A 1OGYA 2XRWA 3RWPA 4RG0A 4BCHA 2OFUA 2B1PA 3FC1X 4LUDA 4C4JA 2C47A 4DHIB 1SZMA 4F6SA 4Z7GA 1RQQA 5LJJA 1NA7A 1Q97A 1R0PA 1W7HA 3DK6A 3P08A 4ACGA 3R83A 2WMRA 2ZM3A 4B9DA 3CE3A 4D5HA 3RCDA 3UO4A 1G8AA 3C50A 3C9WA 4E4XA 4N4SA 3VS5A 3TV4A 4QP9A 3PJ8A 4U79A 4G5JA 4FODA 4AZFA 4K8AA 2UZBA 4L67A 5EW3A 4BCNA 3QKMA 2R3NA 4J8NA 4EQCA 4DG3E 3D2KA 5HESA 1R78A 2WMWA 4O4DA 3E7VA 1DAYA 4EZ3A 1ZRZA 2FH9A 2W1EA 3C4EA 5E9EA 4OTIA 1ZWSA 3QZGA 4L3LA 3ULIA 4IAZA 3A8WA 4DDIA 2F7EE 1H08A 2E9PA 1M14A 3L9NA 4TTHB 4K6ZA 5KNJA 5EHYA 3DK7A 2DS1A 4IX4A 4BZNA 5J9LA 1SYKA 3UPZA 4EC9A 3MSSA 5ETFA 1P4FA 3KMMA 5AX3A 4JBQA 3LM5A 4NM3A 4Y95A 4YTFA 5F1ZA 4YR8A 3U6JA 4RA4A 2C68A 4I22A 3JVRA 4FTIA 4HW7A 3QZFA 4YZMA 4BHNA 3PWYA 4GUEA 4MF1A 4FKSA 5I9WA 3FSFA 4BBEA 4QYGA 5AP6A 5TOZA 3K3JA 2P55A 3NYVA 3ZM9A 2IVUA 3TZ7A 4BICA 2PVRA 4RA5A 2XBAA 4DG2E 4Y73A 1XH9A 3UZTA 3Q2MA 3DFAA 4H3PA 2OO8X 3COIA 5AAFA 2Y4IC 3ZFMA 4BWKA 1XH4A 2J0MB 3MB6A 3MN3A 3I7BA 3VS4A 2QO7A 5AP3A 3I60A 4F6WA 2VU3A 4I94A 5FRIA 3FKLA 1P2AA 3BIZA 2VWWA 1FQ1B 4NKAA 4E26A 1OIRA 5CX9A 4TYHA 3WI6A 5M4CA 3KCKA 1WBSA 2VTTA 2ITQA 3E8NA 3IG7A 4K2RA 4E1ZA 4CMTA 4AE6A 3EL8A 3F5PA 4F7LA 3QD3A 2OF4A 3F2NA 5EM6A 1GZOA 5CNNA 4L53A 3S0OA 3KVXA 3RZFA 2OXDA 3KXNA 4BIBA 5HG9A 1G8JA 2OJFE 2C6LA 4EH4A 4RX8A 4JOAA 4QTAA 4YO4A 4APPA 4K33A 3A62A 4KSPA 4BYJA 3OCGA 3LW0A 4RIOA 3U9NA 1IAJA 4AQCA 3VIDA 3K3IA 3P5JC 1LP4A 4FT5A 2J0KA 3ZUTA 4CV8A 1F3MC 3BBWA 5EHOA 3DLZA 4EK6A 4GU9A 2YLEA 1JBPE 2XNGA 4AU8A 4RVLA 2W1CA 4UBAA 4FG7A 3SG8A 4AX8A 3HA6A 4ZJVA 3OCTA 2VTMA 4X7QA 2XANA 3COKA 4TWPA 2H34A 4OTGA 3EKNA 3MBLA 3NW5A 3TNIA 5IISA 5AR2A 4AZVA 3RAHA 3WE4A 2GNGA 4QMZA 2BRHA 4I1ZA 2VWIA 3EYHA 4GRBA 4CYIA 1H0VA 3U9CA 3TUDA 4W4VA 2UVZA 3W0MA 2V22A 5CEPA 3QTQA 3TNWA 3VUGA 4RRVA 5HKMA 3HECA 3PVUA 2R5TA 4FV1A 1Q8WA 2EU9A 3RINA 3UTOA 3BE2A 2VGOA 5FEEA 4MAOA 5I9YA 4E7WA 3TCPA 1OUYA 3QTIA 5JGAA 4XG7A 4RIWB 2F9GA 4HVDA 1E1VA 3R1SA 4UX9A 1PKGA 1W84A 2BAJA 2XK9A 3GOKA 4GV1A 4FE2A 2JBPA 4AAAA 5ANKA 4J52A 5HNIX 3EQDA 4IANA 5M4FA 2YA9A 1ZARA 4F08A 3DAJA 4E73A 5I3RA 5BVKA 4XG4A 3PVGA 5DMZA 5IH5A 5J9ZA 1OKWA 4IW0A 3SRVA 4O7YA 3OW4A 1YI3A 2PZYA 4KINA 2P4IA 4M15A 4O38A 4YPSA 4KBKA 4RWLA 4CFNA 3QALE 3DV3A 4GU6A 4RGJA 5D9HA 3Q2JA 2E9VA 4JIAA 5CENA 1WBTA 4NW6A 4BCMA 3VONA 4GK4A 5IEYA 3R9HA 4V01A 1PMVA 3NX8A 3VRZA 3AQVA 4M66A 4WG3A 3LFDA 3AC4A 5CVHA 1OKVA 2OXXA 4FZDB 4EH7A 3F61A 3VUMA 3FI3A 3PUFC 4RQKA 2X9FA 3C4XA 1ZOEA 2QOIA 1GIJA 4L44A 4AT3A 1Q8YA 3DTCA 3QKLA 4YZNA 4P7EA 1QL6A 2JGZA 5EDPA 4MF0A 3RM6A 3QA8A 1Q3WA 1XBBA 1ZXEA 3BELA 3RPRA 3S3IA 4FF8A 4CFFA 4LDTA 4FTMA 5DEYA 4MK0A 5C9CA 4DA5A 2GNLA 3ZRMA 4ENYA 3A8XA 4R5YA 4R7IA 3L1SA 2AC5A 1CTPE 3FWQA 3ZBFA 3P1AA 3WE8A 1YI4A 2XNMA 5ANDA 4L45A 2QO9A 5BYZA 4QD6A 2W4OA 1JOWB 2XJ2A 4EH6A 2PZ5A 3HMNA 3R2YA 4ZSJA 4YLJA 1YXUA 2ZM1A 1XJDA 3WBLA 3AKLA 4QMSA 3VW8A 5FXRA 4I23A 3BL9A 2V7OA 4H1JA 1SNUA 3NVMB 5JQ5A 3ET7A 4YJNA 4BYIA 3RHXA 2VWYA 3EQHA 4EYJA 5G6VA 2GMXA 3DKOA 4AS0A 2PMLX 5IQHA 1U4DA 2UW4A 2YM6A 4IIRA 4WSQA 2Z7SA 4D58A 2C3JA 3QFVA 2BMCA 3LFBA 2VO6A 4DLIA 2QU5A 3DY7A 3ZH8A 3MVJA 3MA3A 4U81A 1JSVA 4GMYA 4C4HA 1FVVA 2B55A 4EOMA 2AQXA 4Y5HA 5BQ0A 1FMKA 3E8CA 3V51A 2UW5A 4BI2A 5AADA 4F70A 2OK1A 4ZTQA 3S1HA 4BTKA 1KE6A 2XNPA 4GKIA 4I5CA 5EM8A 3RK7A 4IE9A 5K3YA 4FJVA 3M2WA 3NZ0A 4IEBA 3VBWA 2X2MA 4AW2A 4ZTSA 4FT0A 1H28A 3HV7A 4W8DA 2E9NA 4JL9A 3ZDIA 3WIKA 4JBPA 4MBIA 1ZY4A 2R3PA 4I24A 3UYTA 1OB3A 2WOTA 1OUKA 1SVEA 1HCKA 4IFGA 3TNPC 3WYYA 4C61A 3DKCA 3A61A 3QHRA 2XH5A 4FKRA 2G2IA 2JIIA 4ANNA 3FZOA 2JBOA 4MTAA 5DH3A 3D83A 4E5WA 3HAMA 2C6KA 4Z3VA 4ALWA 4QMMA 5FP6A 3BEAA 3QYWA 4LRKA 4X3FB 3O71A 3VBYA 4IZ5A 3GCQA 2G2HA 3FKNA 3MFSA 2XUUA 3KEXA 4L3PA 3A2CA 3SW7A 1YDRE 3EWHA 4FTKA 1J7UA 3DTWA 3GC0A 3NYOA 2UV2A 1Y8YA 2IW6A 3JPVA 5JFVA 1G8SA 3EFWA 3I6UA 4I4FA 4MXAA 2OJJA 4NTTA 1JNKA 3E5AA 1KV2A 4JDJA 3ROCA 4EOIA 3NUXA 4YHTA 2YDKA 3GBZA 4XG3A 2OW3A 4I5PA 5M06A 2A2AA 2HAKA 2YERA 4ZTHA 1ZOGA 2HIWA 4J96A 1UNGA 2WQOA 4KS7A 5CF6A 4QPAA 4DF3A 3AOXA 3TTJA 3EN5A 4JG7A 4LL0A 1JKLA 2RG5A 3MIYA 3QHWA 4ANSA 2YCSA 3OFMA 5IF1A 3E63A 4C4EA 4EBVA 2VRXA 2IZSA 4MNEB 3VNTA 3HV5A 5EQYA 2UZOA 3OWLA 4Q9ZA 4DAWA 2XCHA 3A4OX 4FV3A 3ZEPA 3DKGA 3NLBA 1ERKA 5J1WA 2ZAZA 3MW1A 1BMKA 1NVQA 3DS6A 3R00A 4IAKA 4KIPA 3HUCA 1H07A 4NIFA 4QYHA 4Z9LA 2X4ZA 5IUHA 3KQ7A 4JRNA 4UWYA 4N57A 4C02A 5A14A 3V5JA 1OL6A 2W1DA 3GU5A 3L9LA 3CTHA 2BZKB 2VO7A 1OBDA 3HNGA 5IH6A 2WQEA 1RDQE 3CC6A 3AMYA 4BR3A 4JAIA 2ERZE 1ZAOA 3QD4A 5C26A 4EOQA 5DPVA 4BI1A 4EOSA 4IZYA 4BRXA 5HLNA 3MI9A 5IMXA 3TI1A 4J8MA 4CZYB 3CCNA 3D5XA 4FKVA 3PIXA 2C1AA 3OY3A 2X4FA 2OG8A 4HNIA 4X3FC 5E8TA 2F2CB 3VRYA 4ZLZA 5HD4A 4KA3A 2DWBA 4YUQA 3F2RA 4IM0A 5DOSA 4U45A 4XP3A 3VUDA 4EJ7A 3PIZA 2YDJA 2GQSA 4L43A 3O23A 4A4XA 2H9VA 3ZLSA 4NZWB 4BJJA 4U97A 4DEGA 5IUGA 1LEZA 5AUZA 4J99A 4ZZMA 5GZ9A 4IVDA 4M84A 4MEDA 4IQ6A 2BHHA 3BLHA 3Q5IA 4M7IA 5L2WA 5J95A 4BB4A 3MYGA 2I0YA 2O5KA 2QURA 3H9FA 4IC8A 1I09A 5HTCA 3SOAA 4YZDA 1M52A 3LJ2A 4D28A 2ESMA 2VX3A 2WFYA 1M2RA 4KABA 4MKCA 4F9WA 4ID7A 4JDHA 3HL7A 4IM3A 3R7IA 1X8BA 2GPHA 2ONLC 3FDNA 4A06A 3R8LA 1W83A 4Y5QA 4ARKA 2ZV7A 2NYAA 5K9IA 4O0UA 4ZTMA 5KMKA 4OBQA 2R4BA 3BCEA 5CU3A 4DCAA 5AV1A 4KWPA 5ANJA 3IW4A 1PMUA 2NRYA 4ZJIA 3BU6A 4XLVA 2RL5A 4FKUA 3W33A 4TZRA 4O4BB 4PX6A 4G2FA 3G6HA 4KIQA 2RIOA 4HYUA 4BCGA 4FL3A 4QO9A 1OKYA 4AA5A 3ETAA 1ZMWA 4UY9A 1NT2A 4QQCA 3KULA 1YRPA 4X2KA 5AA8A 4FSUA 3DZOA 5JEBA 1APME 3BHYA 3OP5A 3LCTA 2VAGA 3D7ZA 2ZOQA 3HV4A 3QC9A 4GFGA 5D7VA 3A7IA 4QP6A 4L6QA 3KRXA 4KD1A 2E9UA 4F63A 3VJOA 4G17A 3ZSHA 4WHZA 3PZEA 3QTRA 4FL1A 1XKKA 4GVAA 3W0SA 2EWAA 3T3UA 1YKRA 4AWIA 3W0QA 2XP2A 4E5AX 2C30A 4K0YA 2HW7A 3PFYA 3LCSA 4WBOA 4EHVA 2C6EA 2BROA 5E7RA 4RZWA 5I9UA 5B2KA 3PLAE 3T8OA 4QMTA 3WZKA 2I1MA 3MPAA 1O6LA 2VUWA 1JLUE 5HBHA 4C59A 4AA0A 4EH8A 4CKRA 3EMGA 2GQRA 3THBA 4AE9A 2IG7A 4KSQA 3PJ2A 3SD0A 4F7NA 3P86A 1FVTA 2C3LA 4JG6A 4D4YA 3CPBA 5J87A 3UDZA 4PRJA 3M11A 4LRMA 3SQQA 2UZVA 4NTSA 3IK3A 2GNIA 1CM8A 1W2CA 4IX3A 5LVOA 3Q53A 4FNYA 3UGCA 2ZVAA 3PUPA 4CTBA 4KKGA 2JITA 4XG8A 4D9UA 3BV2A 3TL8A 4F0GA 2ZDUA 2Y9QA 3C7QA 4I6BA 4MCVA 1PXIA 4O4FA 1K3AA 5AUTA 4U9AA 3ZBXA 3ID6C 2I0HA 2XJ1A 5EKOA 5TKDA 4IDTA 3F5XA 1WVXA 4NYEA 4H39A 4P4CA 2ITVA 3ZS5A 4UMUA 4JX7A 5DIAA 4XCUA 4J53A 1SMHA 1ZYLA 5HE1A 4C37A 4A7CA 4W4XA 4XH6A 2FYSA 5IA3A 3SV0A 2OZAA 5EI2A 3UYSA 2J0IA 2W06A 4O83A 5F95A 2C0OA 1WBVA 3L9PA 3CTJA 5CVFA 4O7RA 2IWIA 4EOJA 1RW8A 3DOGA 3HRCA 5HNBA 5AFVA 3Q5ZA 4AN2A 3PSBA 4CLJA 4BI0A 4UYNA 5FD2A 4EBWA 4OTFA 2WU6A 5IQBA 5EH0A 1PXJA 3I5NA 1HOWA 2QHNA 2ITOA 2WMTA 2X0GA 1VR2A 5J9YA 2X9EA 3QLGA 5LQFA 2VGPA 3TEIA 3CP9A 1VYZA 3KY2A 3PY1A 4MD8E 2ONLA 2QOBA 4IJ9A 4D0WA 2RSVA 4TYHB 2RFSA 4EH5A 4NFNA 2DUVA 4XX9A 3S95A 2BRNA 2W17A 4IVAA 4OTHA 3BYUA 5GJFA 3R9NA 4OTWA 3FMJA 4TWNA 4L00A 4O6EA 3FMLA 4YJUA 3EQPA 4YJVA 5AP1A 1DS5A 4I6QA 5FLFA 5K0KA 4I5HA 2BDJA 4FSWA 3ORXA 4FG8A 5CS6A 1JKSA 5M53A 3NGAA 4TW9A 3KN5A 4C4IA 4L7SA 2CGWA 3F88A 3W8LA 4GSBA 3KRJA 4DEIA 5LCJA 2E9OA 4ITJA 4AAYA 4MYGA 3ZLXA 5KHWA 4BL1A 1VZOA 3R01A 2C5VA 4GG7A 3Q60A 5DE2A 3QUDA 5BVDA 3CD8A 3NCGA 3FXXA 4EOPA 3KKVA 3R8PA 3UJGA 4D5KA 3BEGA 3ROYA 5HI2A 4BFMA 3TV6A 3UOLA 3DNEA 1TQPA 3BGPA 4MXCA 4AUAA 1OPJA 2GS7A 5AIRA 1TQMA 5DR9A 2G2FA 3Q04A 2GFSA 4EHZA 5HBJA 5M56A 5D7AA 2R3KA 5BX0A 1BI7A 3QQKA 2WTIA 1RJBA 4CFWA 4GUBA 5CVGA 3ORPA 4FIEA 3BLAA 1E9HA 3DB8A 3BX5A 3IOKA 4FKLA 5HNGA 5EW9A 3R22A 3QX2A 3EB0A 5IQEA 2WTDA 3QLFA 3NUSA 3O2MA 4UZHA 3SXFA 2XF0A 3H9OA 2HXLA 3QU0A 3FZTA 4X6RA 5IUIA 4BCOA 2WAJA 3MDYA 4MNFA 3BGQA 1QPEA 4C4GA 4JRVA 3EFLA 2IVSA 3FXWA 5KMOA 4IWQA 4F1OA 4GJ2A 2CCHA 5HIDA 5CT7A 3W10A 1XMMA 3F9NA 3PPKA 5KZIA 2R3JA 4FEXA 3FMMA 4AW5A 3SRVB 5HORA 3R8ZA 5AR3A 3AKKA 5E8SA 1OVEA 1Q4LA 5TO8A 1Y6AA 2R7IA 5I4NA 3UO5A 5EDRA 4CMOA 2XZSA 2X7FA 2OF2A 2W99B 2B7AA 3LM0A 5JRSA 5L8JA 3RJCA 3AT3A 3KC3A 1FGIA 4CT1A 4UV0A 5L2QA 3A7FA 1H00A 4QTDA 3OS3A 4BZOA 2PULA 5IKWA 3CTQA 2JDOA 3OG7A 4X21A 1XWSA 3WZUA 5IQAA 4EORA 2XMYA 4LQMA 3VBTA 3FPMA 2IEWA 3H0YA 3OCBA 2X8EA 1Q3DA 3GQLA 4ALVA 3OTUA 5FDXA 3V5LA 3WIGA 4RLLA 5KBQA 2WD1A 2O2UA 3B2WA 4EEVA 3I5ZA 4FV7A 4PDPA 4RFMA 1UKHA 3MH2A 3L8SA 3LOKA 4HJOA 2QOCA 3COMA 4K11A 4AZSA 3AD4A 5L8LA 2YEXA 3SGCA 5HVJA 1OZ1A 3CQEA 1PXNA 2WGJA 3G0EA 5AV4A 2DQ7X 4RJ4A 3BQRA 1YXSA 4XBUA 4EK5A 3RMFA 3E88A 2PZIA 3SXRA 3GFEA 4IB5A 4UMTA 3QQUA 4USDA 4MXOA 5GZAA 2Z7LA 1Q8UA 4HCVA 3UPXA 4H1MA 3QRJA 3E87A 3ZDUA 3W55A 3MGYA 2X2KA 4OW8A 3TMOA 3MIAA 4RLKA 3BHTA 2O64A 1DM2A 3FSKA 2XNNA 5DR6A 4EONA 5IQIA 3HMIA 2QD9A 4AGUA 3PLSA 2X7GA 3OCSA 3CBLA 3DK3A 4MVFA 2C6MA 2XKCA 4ZMFA 3KXGA 4TY1A 3UIXA 1AGWA 1FINA 2XS0A 4L9IA 1UU9A 3FL5A 1AQ1A 1XR1A 3PG1A 3FMNA 4FSZA 2NRUA 4KNBA 3OY1A 2UVYA 5BUJA 4OLIA 5A3XA 1IG1A 5L6PA 3R04A 4O7ZA 4NJDA 1GNGA 2V62A 4IAFA 4MBJA 4OT6A 3RK9A 4ZP5A 2GS2A 5AP4A 3U6IA 4ASEA 2PZRA 4QYEA 4C2VA 2CKEA 5J5SA 3AT2A 4FZ7A 4RIYA 4XV1A 2BZHB 5IA2A 2F7ZE 3G9NA 3MVMA 1VYWA 2R9SA 3SAYA 2OI4X 1H01A 4DEBA 4QMYA 5L6WL 2BAKA 3P78A 4FIHA 4LFIA 4BDBA 4DGLC 4QMUA 4QMWA 3LJ1A 4KRCA 3UDBA 4KKHA 3D5UA 2REIA 5EM5A 5FQDC 4A9TA 4UMRA 3W2PA 4A4LA 2GS6A 3SVVA 4K9YA 3VJNA 5KZ0A 4TRLA 2H96A 2I6LA 2PK9A 3GVUA 5CZHA 5EG3A 3NWWA 5JQ8A 5CAVA 4MHAA 4UMPA 3MJ1A 4O1PA 2NNWB 2UW6A 4TYIA 2VTLA 4CG9A 2W4KA 2PMIA 3NIEA 2EXEA 3HP2A 3L9MA 4FSTA 4ZY4A 2V5QA 2E2BA 3VUIA 3NFFB 4C57A 4AZWA 4BDHA 5F9EA 4MBLA 4CKIA 3UIMA 2WO6A 4EI4A 2R3IA 2BUJA 4M14A 3ZO1A 2X6DA 4N0SA 4LGDA 4EL9A 3GB2A 3PIYA 1XH8A 4WBBB 3TKUA 4PTCA 4BN1A 4FEVA 4YC6A 2YWVA 2JC6A 4CSVA 4ZS0A 1YWNA 3IECA 5CNOA 5HIBA 3TG1A 3KXZA 1OMWA 2WOUA 1XO2B 4R7HA 5EHLA 1YDTE 4PTGA 2Z60A 3UZPA 4XV9A 5M4IA 1ZZLA 5GJGA 4R78A 3TKHA 3C5UA 3DBQA 4Y46A 4HCTA 4IACA 4LOQA 4ZSEA 5CU6A 1WBPA 2ETMA 2ZB1A 2RFNA 1RE8A 5HZNA 2OBJA 3HZTA 4D2VA 3KFAA 3F66A 4IC7A 3UE4A 3DDQA 1M2QA 3FI4A 4II5A 3FY0A 4C33A 3CY3A 5E8VA 4AP7A 5HE0A 4H05A 2FSOX 3O7LB 4FKTA 5GZ8A 3BE9A 4F78A 4EOKA 3CIKA 2R3QA 1TKIA 3GU4A 3MH3A 4JLCA 4M68A 3ZZEA 4C34A 4NIFB 4ZSAA 2OIDA 3D4QA 3F7WA 3R63A 5EI6A 4R7BA 3NAXA 5EFQA 5IDNA 3KMUA 1YOJA 3E62A 3HRFA 5A46A 4AG8A 5JMSA 5DN3A 5M07A 2JIVA 1TVOA 5CT0A 2C3KA 1YOMA 4FA2A 4PMPA 2PE1A 2NP8A 2XIKA 3P79A 1UNLA 1OECA 4U80A 4YJQA 4XOYA 3C0IA 1KE8A 4B99A 3PRFA 3EIDA 4FOCA 3ATTA 4IAIA 2QODA 4NH1A 4EOLA 3GENA 5AR7A 4RC3A 3GEQA 4EK4A 2PVYA 2PE2A 2WU7A 4I0TA 5CI6A 4GH2A 3TIYA 5KO1A 5M4UA 3K54A 4ZLYA 3FEGA 2OH4A 4XV3A 3BHVA 3BYSA 3IW5A 3O51A 5LMBA 5KMMA 3ZC6A 1XMLA 3ZLWA 4D55A 5CF8A 4C7TA 4FSYA 2G15A 4ANMA 2RGPA 3EN6A 2HCKA 3EQFA 5E8WA 3UIUA 4JAJA 5HIEA 4FRFA 4J1RA 1PXPA 3F6XA 1UU3A 3HV3A 3QX4A 2BCJA 4NKSA 4YNEA 5DI1A 4XP0A 3V5PA 5M51A 3CQWA 2PPQA 3ZO4A 2XK7A 3Q6UA 1GY3A 3W0RA 4DT9A 2C4GA 2A4LA 2Q0NA 4YNOA 5JGBA 3W2SA 4O0TA 4XYFA 5DG5A 5HOAA 3LQ3A 1UVRA 1FVRA 4HCUA 4LI5A 2GTMA 4QP2A 5C8MA 3HEGA 5E1SA 1MUOA 4BF2A 4YLLA 3POZA 3IPHA 5EOBA 5HEZA 4EYMA 2XCKA 3HAVA 2A0CX 5AUUA 2BDWA 2YIXA 2X81A 4LG4A 5D11A 2XALA 2O3PA 3LMIA 2HZ4A 4KKEA 2JIUA 4WNOA 5BVNA 4RT7A 3AC2A 3SKCA 5GIOE 2WMSA 2ZM4A 2IZUA 2WMXA 2GHMA 2XIYA 2ZV8A 3FUPA 2YLFA 3BLQA 3HRBA 3NUPA 4TYEA 3R1QA 3LXPA 2WB8A 3HUBA 3CD3A 3NUUA 3SLSA 5IG1A 3OHTA 2P3GX 4LM5A 1H8FA 2VTOA 1J3HA 1LUFA 2BKKA 4I3ZA 1SNXA 4IJPA 4JIKA 4WO5A 4E93A 1E1XA 1SVHA 5EDQA 3EFKA 4J97A 5HU3A 5L2IA 2W5HA 4R5SA 4QNYA 3PXFA 5AUWA 3B2TA 3VWAA 3R21A 2UVXA 3KGAA 3V8SA 4ASZA 5M09A 4DC2A 3NW6A 4R1YA 4U41A 3KULB 5J5TA 2W1FA 3VS6A 5LWNA 4YSMA 3S00A 4E4NA 4O7NA 3PTGA 4ALUA 4DYMA 1Z5MA 4G34A 4AGCA 1W82A 2YCQA 4M69B 3TUCA 1A48A 3BWJA 3PA4A 2H8HA 3PPZA 4LV5A 4RVKA 3ZXTA 5HQ0A 4YJTA 1KE9A 1MQBA 4MH7A 3ULZA 1STCE 4FEWA 3PE1A 4DGOA 5CF4A 4QTBA 3RWQA 2NPQA 4HGEA 4GG5A 2R0UA 2XIXA 5AAEA 3ML1A 5JGDA 3QWJA 4E6CA 5JT2A 2WELA 4BIEA 3BHUA 3NIZA 4KS8A 2BRMA 2Z7QA 1PXKA 4RWIA 5EYMA 4I93A 4FL2A 2JD5A 3FLNC 4J71A 4U43A 5ACBC 5CANA 5KCVA 1XH6A 2JKQA 4P90A 5LVNA 5K5XA 2Z7RA 1V1KA 3DJ5A 3GU8A 1R1WA 2O63A 3HMOA 4FIIA 4FTOA 5E92A 5A9UA 3AC1A 3E92A 3TTIA 2PUNA 3PJ3A 4H58A 5CEIA 4CCBA 5B7VA 3QQHA 2VV9A 3QRUA 4ERKA 2OKRA 2VTIA 2WTJA 5AV2A 4GIIA 4CFMA 3R7VA 5ICPA 3KA0A 5TF9A 1G5SA 2VO3A 3WOWA 3ELJA 5C4KA 3L8XA 3LPBA 5K4IA 2B9IA 3QTUA 3MTFA 2UZWE 5K5NA 2X7OA 2ACXA 5AP0A 3PXZA 4CTCA 2OIBA 1YWRA 3R8UA 4DGMA 3CGOA 1ZOHA 5BMSA 3N51A 3TIZA 2XKEA 4FZ6A 5LARA 3SC1A 5FP5A 4AA4A 4PUZA 5HCYA 3FJQE 3R30A 1Y6BA 4BDFA 3DA6A 4O0VA 4GT4A 3TM0A 4CFUA 3PDTA 3CGFA 4U44A 4QP8A 3UODA 4A07A 3OROA 1WBNA 3A7HA 4RZVA 4R1VA 2CJMA 3ATSA 1OITA 1YXVA 3DBCA 3Q4UA 3KF4A 2VWBA 4I20A 5F4NA 2OZAB 3UNKA 3OT8A 3TYKA 1BL6A 1GZKA 4F1TA 2CLQA 2W9ZB 4YZBA 3GI3A 1T46A 1UKIA 3GGFA 3ZEWA 3AC3A 3HA8A 2WTKC 1S9IA 4PQNA 2YIYA 3PXKA 4FT9A 4WD5A 1LPUA