2CHLA

Structure of casein kinase 1 gamma 3
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
298
Chain Sequence
VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFALAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CASEIN KINASE I ISOFORM GAMMA-3
publication title Structure of Casein Kinase 1 Gamma 3
rcsb
source organism Homo sapiens
total genus 100
structure length 298
sequence length 298
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2chlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2chlA01
2GPHA 2C69A 3TKUA 2XVDA 3AGLA 4FZ7A 1P4FA 4QP9A 1YXXA 2VTPA 4DGGA 2ITQA 1FVRA 4KIPA 4M69B 4S33A 4WG3A 4F63A 3VBQA 3BLQA 4CFWA 4YJOA 3N9XA 3QRKA 3VQHA 1RE8A 4KKGA 5JRSA 1XH7A 2CCHA 3S2PA 3WOWA 2XB7A 1S9JA 2BDJA 4FT5A 2P2HA 5AUYA 4H1JA 3W1FA 4IWDA 4M97A 4EKLA 3VAPA 3LQ3A 1H4LA 3QX2A 5CNNA 3WF5A 3LJ2A 3E5AA 4MK0A 2C47A 3BYOA 5HNGA 5CAOA 2CKPA 4M0ZA 4HVSA 3WZDA 3PIXA 2QO7A 1Q99A 2EB2A 5HO7A 5B7VA 4G34A 2PYWA 4WIHA 4PNKA 3C9WA 4E1ZA 3MVMA 2PE2A 3Q52A 2C0OA 3U6HA 1XH6A 4U45A 4I4EA 1J1BA 5JRQA 3QGWA 4J53A 3SRVB 3O7LD 2GNGA 5DN3A 5EDRA 3GOKA 4U9AA 1WVYA 5HE2A 4AACA 3PA4A 3UGCA 4MD8E 4BI1A 1HOWA 5E8XA 3EFJA 3RCJA 3ZLXA 3PG1A 3BWJA 4KKEA 3M42A 4O7LA 3OCTA 3QTZA 4D0WA 3ATTA 4RIOA 3HX4A 4X2FA 2J9MA 3T3VA 4BY9E 2HZNA 2WIHA 4YR8A 2CLQA 2B9JA 3C4CA 4IM2A 4E6QA 3GI3A 2ITOA 4HVHA 1G8AA 3VUGA 2GQSA 2GTNA 3RMFA 4O91A 1PYEA 3QL8A 4AE9A 5HTBA 3KFAA 5LVMA 3R71A 4E5WA 1SM2A 4D4YA 3PRFA 4H3QA 4QMPA 5AP0A 4BIBA 2WU7A 5IH4A 4QTEA 5C8NA 3QA8A 3DZQA 2PVYA 4IAKA 4NKAA 3OWJA 3UJGA 4IH8A 3R9HA 4TKSA 4G2FA 5JZJA 2ZM3A 3R7VA 2PU8A 3DXQA 2HOGA 2QVSE 5DNRA 2PE0A 2JLDA 3EQRA 4JG6A 2X8IA 3ZM9A 4OT6A 2B4SB 2F4JA 5HCZA 4MBLA 1M17A 4YLJA 4C4GA 4RGJA 4IX4A 4ERWA 5AUUA 3BI6A 3EQFA 4A06A 3A8WA 4GG7A 3ZFMA 3KN5A 4BR3A 2G2IA 4JDIA 4UZDA 5JT2A 5F9EA 5D1JA 3G9LX 5AV4A 4XOZA 2CHLA 3FC2A 3OBGA 4YZDA 5T6KA 3EH9A 5L8KA 2XMYA 3EQIA 3HDNA 3OWKA 2JIUA 3VF8A 4EHVA 3CSVA 4BCQA 4DC2A 3SQQA 3K5VA 3LFFA 3FLYA 1H26A 2A27A 5A4LA 2AC5A 3HA6A 3MTLA 1L8TA 4I1ZA 4L00A 1KE6A 3BZ3A 4QMYA 3ORZA 4FV1A 5KMKA 4KIQA 4FV2A 3ODZX 2Y4IB 1UWJA 4FSMA 3RAIA 4BCIA 4C57A 5HE1A 4WD5A 5HE0A 4C4EA 3AD4A 5IH5A 2XK7A 3DY7A 4N70A 4O1OA 4TRLA 3VUDA 4BDGA 4R7BA 4NCTC 4O38A 4U3YA 5A14A 2ITPA 4AF3A 1M2QA 2HW7A 2AC3A 2B52A 4FKJA 4P5QA 1XHAA 3UC4A 3R7OA 3TV7A 4YTCA 2B9IA 5HX6A 1UU8A 4ZEGA 3H9OA 1ZYLA 2V0DA 3PY0A 1PXMA 3D5VA 4BC6A 4F6UA 4CZYB 4YBKA 2V22A 3HV7A 4G9CA 5IKWA 2BZIB 4PL4A 1OIUA 4N57A 3DKFA 4HYIA 5HLWA 3LW0A 4CKIA 3QCXA 4ALWA 5HO8A 3JVRA 2BTSA 3AC1A 3AC2A 4RQKA 3FDNA 4AOTA 5LVLA 3ID6C 4L8MA 1QPEA 2Y7JA 2OSCA 1BLXA 4NYEA 4OBQA 4USDA 4IVDA 4F7SA 4L45A 3FLNC 1Q61A 4L6QA 4WNMA 2Q83A 4LUDA 4DEBA 4ZJIA 3W2QA 2ERZE 4M68A 4MXAA 2EWAA 3E7OA 2WMSA 4DCAA 1MQBA 4BDCA 1JKLA 4WSYA 2HXQA 2WOTA 2B53A 3KF4A 3PE1A 3QALE 4KIOA 4YSMA 1UA2A 2C6EA 3AD6A 2W4JA 4AFJA 4BCOA 4DG0E 4EORA 4XYFA 2PVKA 3EJ1A 4BKYA 3CTHA 5K4IA 4D5KA 2EVAA 2XBJA 4IZ5A 4H3BA 1VEBA 4LFIA 3E63A 4HCTA 4FIJA 3GB2A 1PXLA 1RQQA 3TIZA 3UOJA 3BLRA 3PZEA 3NRMA 4RC2A 3Q53A 5KKRC 2C5YA 4TN6A 3FQSA 2VWXA 4FV3A 4DLIA 4JG7A 4GK4A 4XP0A 3REPA 3V01A 1XQZA 3I0QA 3PYYA 2YLFA 3GBZA 3TUDA 2UW0A 1QPCA 3M11A 3V5QA 3ULZA 2VNWA 3D94A 4G6OA 4HPUE 4ZLOA 3WARA 4XG7A 4FUXA 4IE9A 2VWZA 4Z9LA 3EMGA 4GRBA 4NUSA 2WTIA 3ZXTA 3TACA 3ZRMA 1IASA 3OCGA 2R3HA 2UZOA 4JIKA 3NX8A 4PTGA 3FHIA 4DE4A 1OITA 4D2TA 4RZVA 3MFTA 3R83A 3DAJA 4JRVA 4AZFA 2XRWA 4HZRA 4EI4A 2SRCA 4BGHA 5BVNA 4B99A 5LWMA 2XNMA 5HD7A 3EKKA 4F1MA 2DYLA 4EHZA 3OXZA 4J96A 4CT1A 5KX8A 2BVAA 2C6TA 5CVFA 3ANRA 3KVWA 2JIIA 3AXWA 3E3BX 4I94A 5KUPA 4O21A 4JQ7A 3VIDA 3KCFA 2W5BA 4IFGA 1WFCA 5AUZA 3TXOA 4LG4A 2PL0A 1WVWA 1DAYA 4MAOA 2CN8A 4BDHA 3MTFA 4QP2A 5D12A 2RL5A 5L3AA 3RK7A 4O7YA 2YIRA 3G33A 3KQ7A 2UVZA 4V01A 3MIYA 4IANA 2NP8A 4QMZA 4ANSA 2ZM4A 3HP5A 4QMNA 1YHSA 3W2RA 4LI5A 3DK6A 1AQ1A 4JVGA 3IQ7A 3NUSA 1GZOA 3BEAA 3SVVA 4HGSA 3TEIA 3FMKA 1W84A 5EQPA 5I9VA 3QUEA 4YSJA 5HIBA 2UZUE 4FV4A 1ZLTA 2IO6A 3KRRA 4IAAA 3FXZA 4C35A 4YUQA 3GXLA 3ETAA 4G5PA 2YDJA 1M52A 5HKMA 4IHPA 3OUNB 5F95A 5DGZA 4FKTA 5AR7A 3ORIA 2FGIA 4IDTA 4RVLA 3UZPA 3FKNA 3PVGA 1GIIA 3OP5A 4G1WA 3ZONA 4AT5A 4D1SA 5ACKA 4AGCA 2UW8A 5IMXA 2XCHA 4CQGA 3FPMA 2AUHA 4UBAA 5DH3A 4EJ7A 3HA8A 4R7HA 4BWPA 4D2VA 4HOKA 4O0RA 5T68A 4A7CA 5I5ZA 1BYGA 5ANKA 1M2RA 3PJ2A 4C2WA 2OWBA 4DFZE 3EKNA 4AW1A 3TN8A 2HW6A 4DCEA 1MRVA 3I5NA 1HCKA 3OVVA 2QURA 4Y85A 5AX9A 4FKWA 4TPTA 1KE5A 4MXYA 4QTAA 3MYGA 3UODA 4YO4A 5L8LA 4GUEA 4MNFA 2W4OA 4FZ6A 1GIHA 3RPRA 3F5XA 4OTDA 4D28A 2W5AA 3SXFA 3NW5A 4FGBA 4O7TA 4L68A 4C0TA 4EQUA 4EH5A 1H25A 4H05A 3D9VA 2UZDA 5LMAA 3ZSIA 5L2IA 3NUYA 3RPVA 3MH0A 5JH6A 3LCOA 4KSQA 4FTNA 5CTPA 5E8TA 3CLYA 5CANA 1M7NA 4OAUC 3EYHA 5K5XA 5FEEA 3COMA 4AXAA 2RFDA 2YISA 4D2RA 4AU8A 4ZSLA 5EHLA 4F1TA 4BWKA 4IB5A 2W9ZB 3I0OA 2UV2A 3HV3A 4C4IA 2R3JA 1NY3A 3PPZA 2GS7A 4RWKA 3Q5ZA 3OS3A 4BCPA 1EH4A 4OTPA 2B9FA 3O23A 3ZMMA 3ZO4A 2XYUA 4ERKA 4W4XA 4AZEA 2Y4PA 4TWOA 3MGYA 4FZDB 4V04A 4YBJA 4YZ9A 3TV4A 1QPJA 1KSWA 1Y6BA 2PZYA 2I0HA 1ERKA 2W1IA 3NAXA 4WBOA 5FRIA 3R6XA 2CGUA 3F5PA 1JKTA 4JLCA 4K77A 4ZSAA 2XK9A 3KRLA 2QR8A 3EFLA 3FMHA 4RX9A 4J7BA 4G6NA 5CQUA 3CCNA 2BMCA 5FP6A 3RGFA 4APCA 2BALA 4HGTA 5KMOA 3DFAA 2A2AA 3GP0A 4JBVA 4NK9A 4AFEA 5AV0A 5IA3A 3U6IA 1UKIA 3UPZA 1OKWA 5EFQA 3QFVA 4TTHB 3Q6UA 3VS4A 2GHMA 3FE3A 4XG3A 3WZJA 4DH5A 4ZTMA 3LCKA 5AJQA 4GKIA 3BLHA 4GFGA 3QQLA 4AZVA 3O17A 4BDFA 4CFXA 4W4WA 3FZRA 2H34A 4RWJA 5FTQA 3W32A 3P5KA 4NM7A 4A4LA 3GU4A 2B54A 1OUYA 3PUPA 2X8DA 2VTHA 5AP5A 3ORPA 3CC6A 4BI2A 2UZBA 3DBDA 5HOAA 3F3TA 3MH1A 3OD6X 5CSVA 3A7JA 4YZNA 5F4NA 4PP9A 3C0GA 2IVTA 3VF9A 1T45A 4C4FA 3G9NA 3SD0A 5CSPA 3HMIA 3H3CA 3QUPA 4MWIA 5J1VA 4QTBA 3MVJA 4FT9A 3FEGA 4FG8A 3KY2A 2WQBA 2XKFA 4O7WA 5IQDA 2RKUA 2CPKE 2CDZA 2IWIA 5I9ZA 5ANEA 1ND4A 4RVTA 4LGHA 4C58A 5I3RA 4AN9A 2WZJA 4CFUA 2I0EA 5A3XA 3R1QA 3O8PA 3LQ5A 2QNJA 2GQRA 3PP0A 4RRVA 3HRBA 3FC1X 4FNWA 2VTRA 4QMLA 2PPQA 1FGIA 3FLSA 3QD2B 4FIGA 4C4JA 1H24A 1W8CA 2VD5A 5EQEA 2Z8CA 3ZXZA 2EXEA 5HU9A 5FTGA 1J7UA 4QP3A 2ITVA 2IJMA 2VGPA 4DT8A 2I40A 3IKAA 3PE2A 3UIBA 3DBEA 4M3QA 4U44A 3MH2A 4N6ZA 1WBSA 2VTIA 3HUBA 4GL9A 4ZJVA 2CNQA 3LFNA 1ZOHA 5CYIA 4CYIA 4D2PA 2CLXA 5M07A 4ENXA 3RHXA 1Q8UA 4J97A 3N4VA 2BHHA 5E1EA 2BDWA 3OHTA 2KULA 2Y0AA 4IC8A 4PDPA 4UY9A 5IH6A 1H01A 3ZC6A 3FZPA 4L46A 4LV8A 3QQJA 4PRJA 2WKMA 2XUUA 1PXNA 3AC3A 4QMUA 2OKRA 4K9YA 4AS0A 5AP7A 4IWOA 4C59A 5IMEA 4L42A 5GIPE 3QU0A 4AW2A 3ZYAA 3QC9A 4C38A 3U6JA 2ZM1A 4AWIA 3EL7A 4GCJA 3KRWA 3QRTA 4B8MA 1OM1A 4M15A 4NIFA 2ZV8A 5HGIA 3TJDA 4AN2A 5IU2A 5AR8A 2R7IA 3F6XA 3OT8A 4XNEA 5AMNA 1XKKA 2E9PA 4W8EA 4C02A 4R8QA 3C0IA 3LCSA 3PVBA 4PMSA 5CS6A 4D4RA 5CU0A 2ZV9A 1YXVA 4FSZA 5AAGA 1KV1A 2CKEA 2Z2WA 2Y6MA 4EWHA 4O22A 3P1AA 4QMOA 2QOFA 4EK4A 4OTFA 1KOAA 3C5UA 4KIKA 3WZKA 4BWXA 4KNBA 4GH2A 3UMXA 5CT7A 1PMVA 4HW7A 3KRXA 5BUJA 5HVYA 1Y6AA 2OJGA 4Q9SA 5M4IA 5AUVA 3HV6A 5AAEA 2C3KA 5KBRA 5A6NA 1ZYSA 1A06A 2B9HA 1OL5A 3OXIA 5CENA 2V7AA 1YXSA 4IW0A 5AR5A 3QTQA 3FL4A 3F3WA 4AW0A 4BBEA 5GZ8A 1RDQE 3IDPA 3Q6WA 2F49A 2ZYBA 4HVIA 3VUIA 4BHZA 4R7IA 4W9XA 4LGGA 4XV2A 3HMOA 3FMNA 3E8CA 2RSVA 2O5KA 4R6VA 3TZ8A 3QCYA 2OXYA 2ZB0A 4L44A 2FH9A 2JAMA 3ENMA 4GMYA 5CVHA 5M09A 5ANJA 2BIKB 4Y46A 1PRYA 5ETCA 3CQEA 5CXHA 4O86A 5CF5A 1QCFA 2YCFA 3RNIA 4XV1A 2C0IA 4O0VA 2V62A 4F09A 2FO0A 2VX0A 5AV1A 4UMRA 4RJ3A 2VTQA 4AUAA 1DI8A 5FM2A 3ACJA 4YPDA 3F3VA 3ZOSA 3HL7A 3RAKA 5E8WA 3MWUA 3ELJA 4WRSA 3L9LA 2O2UA 3WZUA 2IPXA 2OIDA 3QD4A 2IVVA 1NVRA 4JR3A 3BPRA 2OFVA 3FMDA 2GHGA 3PA3A 1UNGA 2WNTA 4O2PA 1Q24A 1J7LA 3MJ1A 4YGAA 2NRYA 1ZARA 5LCJA 4I4FA 4ITHA 2C6KA 4WUAA 5HHWA 2UW9A 4GUBA 4NT4A 2BRNA 2GDOA 3CJFA 4XX9A 5FBOA 1YWRA 4FYOA 2YAAA 5E90A 5K0KA 3UNZA 2BTRA 4ARKA 4XP2A 4YNOA 5DPVA 2XIZA 4RFZA 4U80A 2OXDA 2Y9QA 3UNKA 3NS9A 5FXSA 3DU8A 1PXJA 2WTCA 4ZY5A 3F7WA 4ZTNA 5EM7A 4WO5A 3ANQA 1I09A 4Y83A 2X7OA 5H8GA 3W2CA 5A4CA 2VTNA 3FZ1A 1H8FA 1ZRZA 2IN6A 2YFXA 2GCDA 3DA6A 5ETAA 1TQIA 2ZDUA 1MRYA 1H28A 1A9UA 5C1QB 5A54A 1MQ4A 2GQGA 2HENA 2I0YA 3TKIA 5DE2A 1H1PA 3FZTA 4OTGA 5GNKA 3FLZA 3R7EA 3UQFA 2V7OA 4YZMA 1J91A 1E9HA 2WXVA 3PFQA 3MFUA 2O63A 3BELA 3PY1A 4NW6A 3VN9A 4QNAA 1H1RA 3DT1A 5LMKA 2PY3A 3SA0A 3TDWA 2JFLA 2HZ4A 2W17A 4E5AX 5DYJA 4FBXA 4NM5A 4FKSA 3S4QA 3IW4A 3ZUVA 1GZ8A 4CFFA 4O82A 3O71A 4F64A 4FKUA 2F7ZE 4XG6A 4O7ZA 4I5MA 2BRGA 3L9PA 3PTGA 5L4QA 4XH6A 4KS8A 4WA9A 4QMTA 2PZPA 3H9FA 4ASXA 3JY9A 5LMBA 3S0OA 1U46A 5CEQA 3A2CA 5AEPA 2QOLA 5ANGA 1YOLA 4PL3A 3NGAA 4R78A 3O96A 2OJJA 4RX8A 3MPAA 4PV0A 4ZSEA 3I81A 3SAYA 4DFNA 4E5BA 4EOMA 1ZZLA 2BKZA 4MYGA 4WBBB 5CF8A 4HZSA 4NIFB 1P4OA 5AV2A 4ZY6A 4Q9ZA 2C3IB 5JGDA 3R7YA 4AN3A 4XG4A 5TO8A 5FEQA 4Q2AA 1V0BA 2HWOA 4CLJA 3HRFA 5LVPA 4L3JA 3GQLA 1QMZA 3F5GA 2YJRA 4UX9A 4MXXA 4KIKB 2YLEA 4IMYA 5CLPA 2XKEA 5HCXA 5GIOE 4BCHA 4R5YA 4JIAA 2I1MA 5HEZA 5HG9A 4XV9A 3RM7A 3B8RA 3OEZA 3QYZA 4BICA 5M4CA 4I92A 2F9GA 2JDVA 5D11A 3BQRA 3RINA 3EHAA 1YOMA 2R3GA 3MY0A 5DLSA 4A9UA 4FC0A 4CG9A 3Q9XA 4RC3A 2XJ1A 4EK6A 4F6WA 4C4HA 4AW5A 2RG6A 3KULA 4K11A 4G3CA 5FG8A 5J87A 2GU8A 1OVEA 3PRIA 4X6QC 1ZWSA 2WMUA 5IDPA 2B7AA 2ITNA 3E8NA 4BZNA 1M7QA 4B7TA 4YO6A 4E6DA 2BCJA 4DFUA 3QKMA 3VBYA 3IG7A 2QOBA 2ETRA 4RFYA 3NEWA 1XJDA 1ZMUA 3POOA 4RX7A 5EW9A 5ACBC 4AA5A 5LWNA 3UMWA 1OKVA 3HAVA 2QKWB 2VO7A 2VTMA 2ZDTA 4GK3A 4GK2A 4CQEA 5A9UA 3NYNA 4DF3A 3P7CA 4JDHA 5TT7A 3ZU7A 4DEIA 4IACA 3L8VA 2HYYA 3MV5A 4FZFB 5AWMA 4IB1A 4ZZOA 5KMLA 1KE9A 2C68A 4FK3A 4L53A 3EN4A 4M14A 2W1EA 4X3FB 4M13A 2QKRA 3CQWA 3LJ1A 4G3EA 3U55A 1PJKA 1SYKA 1MUOA 2YCSA 3SC1A 4G31A 4EOJA 3Q4CA 2UZVA 3POZA 4EJNA 4AT3A 4BTKA 4BDBA 4BCFA 2QD9A 1PHKA 2QHMA 3L8XA 3FBVA 3AD5A 4MTAA 2ZV2A 2FSLX 3CTJA 3TDVA 3AGMA 3LXPA 5DT0A 4EEVA 1YWVA 2C30A 2WO6A 2YIXA 5CU3A 3E8DA 4DGNA 5CEKA 1RJBA 2J7TA 4CV8A 4FEQA 2VTOA 3A7FA 4L43A 2XZSA 4RSSA 1YHWA 2X39A 3TUCA 4YJQA 5IUGA 2O64A 4TXCA 4DAWA 1GNGA 3ALOA 4Z16A 1URWA 1FMKA 2A19B 2X4ZA 4DTBA 2GNLA 2B55A 4CRSA 4EK3A 3ULIA 4I24A 3VUMA 4DFXE 3UQGA 4I23A 2XA4A 3FHRA 5IF1A 1YKRA 4FSQA 4OTRA 2GNHA 2IZSA 2Z7QA 3KXHA 3OZ6A 3MFSA 5E92A 4B4LA 2XF0A 3GCUA 4QTCA 1H1SA 5EM8A 3S00A 2OW3A 3ORNA 4I0TA 3KB7A 3LXLA 3NDMA 2HAKA 4YC8A 1NW1A 4I0SA 3Q9WA 4G17A 1S9IA 2WMQA 4RLKA 2BZKB 4UMPA 5BVOA 3AT4A 3TM0A 2GNJA 3WBLA 4ANLA 5H3QA 4CTCA 4I6QA 4CCUA 3LMHA 1OKYA 3DB6A 3OY1A 3SXRA 4JNWA 4EUTA 4ANMA 1JSUA 2IW9A 5BYZA 4BFMA 3EQPA 4ENYA 4O7SA 3EOCA 3SXSA 4WG4A 4IVAA 2JKQA 4FUYA 3ZTXA 3PG3A 4JX3A 2IW8A 4H58A 4A4OA 2UVXA 3EQGA 3NW6A 3NYOA 2PK9A 3PJ3A 3LIJA 5J5SA 2WTJA 4ZSGA 4QQ5A 2C4GA 4P4CA 4WSQA 3NNWA 3F3UA 4NM3A 1IA9A 2P3GX 4L9IA 3N51A 4PPCA 4YJTA 3WF7A 2J50A 1O6KA 2PZRA 3VO3A 3P0MA 2GS2A 3PSBA 4QQJA 3NIEA 1JSTA 4FA2A 5CEIA 3O51A 4V05A 3KRJA 4EH2A 4LOPA 2J2IB 3ZFXA 2YIWA 2QCSA 4XJ0A 2ZB1A 1XBAA 4UALA 1ZYJA 1OB3A 1RW8A 3AG9A 4B8LA 4CKJA 3LHJA 3RAHA 4I3ZA 4FG9A 2YERA 4F9BA 3QQFA 1CKPA 1OKZA 4IB0A 5FP5A 2BFYA 4OTWA 3FAAA 4DTKA 3UP2A 1VYZA 4OW8A 4XG9A 3VBVA 5J7BA 2WD1A 2C0TA 2CGXA 3H10A 3FI4A 3AMAA 5I3OA 3ZLSA 5DHJA 4FT3A 3V5TA 5GJDA 3CD3A 4AGWA 5HORA 3VS1A 2C5OA 1KWPA 4MXCA 4PTCA 4NTTA 2XYNA 3I6UA 4NEUA 5E7RA 5EW8A 3KULB 4GJ2A 4BGGA 4E6CA 1QPDA 3QD0A 2C3LA 1CMKE 5EYCA 5KMMA 5FXQA 5GJFA 3OFMA 3RNYA 4ACDA 2GSFA 4GSBA 4NZWB 2PUUA 4XLVA 4DEGA 3ZUUA 1OL2A 4FE2A 1IAHA 2PSQA 2ZMDA 3DPKA 2J0IA 3CS9A 3QTUA 4XBUA 4H39A 1PKDA 2QO9A 3L1SA 2EB3A 4FL2A 5AUXA 3QQUA 4OBPA 3WYYA 4BTMA 5DRDA 5EI2A 2Z7RA 2QR7A 3VS5A 3PJ8A 3A4PA 4YPSA 5CZHA 5AV3A 3ATSA 5LARA 2OH4A 4DH3A 1QL6A 1UVRA 1TVOA 1YI6A 5HVKA 3JPVA 5EKNA 3A8XA 2HZ0A 5KO1A 3RTPA 5EQYA 4MBJA 3GFWA 3UBDA 5LOHA 4ID7A 4MQ2A 5KZIA 2ZVAA 4ANBA 2R3LA 4O96A 4GT4A 4IDVA 4ZTLA 3GU5A 1WCCA 2R3RA 3JVSA 3MBLA 5CAUA 3NNVA 2UW7A 4C7TA 4BTFA 4ZZNA 2IZUA 5CSXA 1M2PA 5BQ0A 3GUBA 2XEZA 2JKKA 2P33A 3IGOA 4XS2A 4E4NA 1Q3DA 2W9FB 2YDKA 5HO6A 4M12A 4W4YA 4C33A 2BAJA 3TUBA 5BYYA 3UVQA 4CZUA 2VO0A 4FTTA 4CV9A 3BU3A 3KMWA 4UYNA 2QHNA 3CTQA 3GGFA 3LZBA 5C27A 3UOHA 4BDAA 3E87A 4RZWA 1LEWA 3A60A 3EIDA 4BB4A 4E20A 1XH8A 3ITZA 4N6YA 4A9TA 2JAVA 3F61A 1BI8A 4I0RA 2J0KA 4O27B 4XV3A 4YZBA 3QRJA 1F0QA 1H07A 2FSOX 2OU7A 4ALUA 5DWRA 4DEEA 2QOCA 4U79A 5KCVA 2VWWA 2G1TA 3GU7A 2XNOA 3MS9A 3ROYA 2C6IA 2WEVA 3Q2MA 2UW6A 2QONA 2O65A 3E62A 4Y73A 4CCBA 3EQDA 5HQ0A 3G6HA 3O2MA 1ZMVA 3RI1A 4EOLA 4JBQA 4LRMA 1K2PA 4L7SA 2YM4A 4FTQA 1JAMA 4UMTA 3BV2A 4F1OA 3BBWA 4Y5HA 3NNXA 5AA9A 4CMTA 4YU2A 4TYHA 3MSSA 1XO2B 1XH9A 3BYVA 3PXKA 4XP3A 2Z60A 4TYEA 5KZ0A 4FV8A 3OTVA 4MXZA 1ZY5A 2P4IA 3UTOA 4FEXA 4ONAA 4YHJA 1PMUA 4PL5A 5E8YA 3ZDIA 3C4EA 2XNNA 4FODA 3H0YA 2CGVA 1OBGA 2P0CA 4G16A 2X4FA 1WBVA 4DTAA 3V5JA 5AP2A 2PTKA 4ANQA 3VC4A 4NCTA 4XHKB 3TNHA 5HLPA 1VR2A 4LQMA 1H0WA 4HCUA 3QTRA 1SNXA 3GNIB 5D9HA 2YCQA 2OJIA 3PWYA 3BBTB 4FOCA 3BYUA 5CSHA 5IA5A 3FLQA 3KGAA 4C3PA 4DEDA 2XIKA 3HV5A 4QP6A 1SMHA 2G9XA 3BHUA 5LVNA 5HTCA 4C2VA 4ACCA 3PXQA 3WZEA 1JNKA 4YZCA 4BTJA 1YDRE 3UIMA 1PYXA 4U5JA 5EHOA 2WMXA 3BU5A 2J0MB 4QPMA 3ALNA 2QU6A 5HICA 5CEOA 2JD5A 4II5A 3ZO1A 2I0VA 4LL0A 4EH9A 4YC3A 4FG7A 2WPAA 5BPYA 5KMIA 2OIBA 2XM9A 3NYVA 4DFBA 1IG1A 2WQEA 3BKBA 3BHVA 3T8OA 3WIGA 3WYXA 4NJDA 3LE6A 2QG7A 4IADA 4JXFA 5J9ZA 4Y72A 3TWJA 1LEZA 4JAIA 5EI6A 3CR0A 3AC5A 4F9CA 1UNLA 3QLFA 2ITTA 2NPQA 5H8BA 5HE3A 5J5TA 3OC1A 4DG2E 2GNFA 2XP2A 1GY3A 2UW4A 5EHYA 3G5DA 5FLFA 4EL9A 2YWVA 2P55A 2YA9A 2BZHB 3QYWA 3RPSA 2ITXA 2OGVA 2B0QA 3EN5A 4XG8A 3MH3A 2WQMA 3ZZWA 5CEPA 3AOXA 2G15A 2YEXA 2YIQA 4DT9A 5CAPA 2C6MA 4GJ3A 2C6LA 5IQFA 3ZSHA 1OPJA 3LFSA 4L67A 1ZXEA 4MD9E 4EQCA 2PVRA 4UXQA 5CALA 3HMNA 4V0GA 2PULA 3MESA 3MPMA 4EUUA 1DM2A 3IGGA 2R3FA 4FGRA 2IVUA 3CGFA 3BE2A 3D15A 1H00A 2HCKA 2OI4X 3U54A 2WTKC 4ZTRA 4TYGA 5FUTA 4FL3A 4BDDA 2X6EA 3FXXA 4P5ZA 4DH1A 3PJCA 1XH4A 4GS6A 3QXPA 5E1SA 2BAKA 2J0LA 2OZAA 3EQCA 4GYIA 4OUCA 5FGKA 3R9OA 4Z55A 4KAOA 3Q32A 4D4SA 4FEWA 5TR6A 2X6DA 3GFEA 2QO2A 3Q9YA 4EZ5A 5BMSA 4NWMA 2XJ0A 1OZ1A 5C8MA 1CKJA 2H9VA 3QGYA 5IPJA 4ASZA 4WNOA 2WEIA 3DJ7A 2ITWA 2G01A 3CPBA 3LPBA 3LCTA 3GU6A 5DIAA 3TG1A 5HBJA 1IRKA 1WBWA 2RFSA 3BRBA 5CU6A 5GHVA 3C4FA 3P4KA 4LGDA 2HY0A 2VWBA 3HV4A 2W1FA 3DKCA 3VUKA 5ANOA 2QI8A 3IW5A 2JIVA 5B0XA 4XRJA 4QYEA 4F0IA 2ETKA 2J0JA 2VTAA 2WMTA 2V55A 3C50A 4IVCA 3VHKA 4DH8A 4GYGA 4ZZMA 4RA4A 2WQOA 3EQHA 4TYHB 4AG8A 4DGOA 4H36A 2B1PA 2PVLA 4K18A 3R63A 5ICPA 3SW7A 5E8UA 1SVHA 4O7VA 1Q8WA 3I4BA 3DNDA 4DFLA 2VNYA 4MNEA 3ZSGA 3HAMA 3UVPA 4EOIA 3QZGA 5IEVA 4JX7A 5ANDA 4O81A 4WOVA 3DB8A 3VRYA 4FSNA 2FVDA 4TNBA 4UWCA 1XWSA 4NH1A 3PXZA 4RIWA 4YJUA 3E3PA 4FVPA 4AZTA 4EOQA 3RWQA 2E9VA 3G2FA 4LMUA 4Y8DA 5A4TA 2QLUA 4L3LA 4D9TA 4CFVA 5M57A 3QX4A 2WFYA 4ZAUA 2PUPA 2BROA 2OJ9A 1CSNA 3OCBA 4J8NA 3FSFA 4FI1A 4CGAA 3HZTA 4IC7A 5HX8A 4DA5A 2W4KA 2XNGA 4I20A 4TWNA 2XCKA 1KUTA 4RLLA 4EOKA 4CG8A 1F5QA 4HJOA 4K2RA 2VWYA 3U8WA 4PUZA 3W18A 3OUKA 3VW6A 1T46A 2XNPA 5L6WL 3UZRA 4XRLA 4E93A 3CEKA 4EKKA 2LGCA 3EFKA 3QCQA 3QCSA 1YVJA 5J9LA 3DXNA 2C1BA 4CMUA 4I93A 3NIZA 3ZFYA 5TF9A 5IQEA 1PXPA 1NXKA 2UZNA 3BGZA 3E64A 4EH7A 4GKHA 3KXXA 1SVEA 4EH8A 5CY3A 3A99A 5BVFA 4PWNA 2BRMA 4U0IA 5H8EA 3FI3A 4R3CA 1X8BA 4PDOA 4G9RA 1GJOA 4QD6A 4L3PA 5JQ8A 2XRUA 5CAQA 4HYHA 1DAWA 3M1SA 2OF2A 2F7EE 3FY0A 3PXRA 4FIIA 3L8PA 2HY81 4FKRA 4FVRA 1Y57A 5DI1A 4G6LA 3EZRA 3RP9A 1U5RA 3FMJA 1G8SA 5D41A 4KWPA 3PLSA 4YJNA 3FQHA 5KKRB 1OL7A 5L2TA 2R5TA 4LV5A 2UW3A 3S1HA 4BCMA 2X1NA 2VGOA 4AGUA 2BIYA 3PWDA 2XK8A 5JGAA 1OECA 1UU9A 2WTDA 2W5HA 4GV1A 2PVJA 4G3DA 4M0YA 1TQMA 3K3IA 3R02A 4WKQA 5J8IA 5M55A 2X8EA 1YDSE 4FKLA 1H0VA 4KBAA 3UP7A 1KE8A 5I0BA 5IA2A 4F0GA 2VWUA 4BDIA 4JL9A 2GTMA 4AE6A 1NVSA 2A1AB 1R0EA 3NR9A 5FD2A 3MPTA 4Z7GA 4S30A 1Q8YA 4C3FA 3ET7A 4FV9A 4FV6A 3BV3A 3F3ZA 2YABA 4V0GB 5EG3A 4CSVA 4FTAA 1HCLA 5BX0A 3P9JA 5I9YA 2PMNX 4ZS4A 4RPVA 5HI2A 1XBCA 5HG7A 4ZS0A 3R22A 3A7HA 1PXKA 3BGPA 3MJ2A 4I41A 5EDQA 3HMMA 3H9RA 3EWHA 5IQBA 2OZAB 3DK3A 3AMBA 1Y8YA 3ZO3A 2JGZA 2EU9A 5IUHA 2GFCA 4F65A 4RG0A 4JT3A 4DG3E 4BHNA 3GCVA 2JBPA 3PXYA 4A9RA 3BYSA 3ZBFA 3LFEA 2VWVA 3NPCA 3FMMA 4AZWA 2X2LA 3JS2A 3KMUA 3MI9A 5A46A 4IQ6A 4M67A 3E88A 3I7CA 4NSTA 2YWPA 3NUPA 4I6BA 4F4PA 4CTBA 1G5SA 1R3CA 1V0PA 5IG1A 4MF0A 4QQTA 4FTRA 4FKVA 4EH4A 1R78A 2O0UA 3FUPA 5CU2A 3DAEA 1FGKA 4FR4A 5K9IA 2OLCA 1Q8ZA 2WMBA 2ZOQA 5JFWA 4DHFA 4AGDA 5FM3A 3UG1A 3Q04A 3DV3A 4EBVA 1FMOE 3VQUA 3COHA 3HRCA 3MN3A 3Q4TA 1STCE 3P23A 1JPAA 1O6YA 5B2MA 5KE0A 4EYMA 3DQWA 3DLSA 1R39A 3R01A 3IDBA 4FTIA 4U41A 1JSVA 4MNEB 3VJOA 4BF2A 4EOOA 3LXKA 3TL8A 3V51A 3UPXA 4IX3A 2DQ7X 3D5XA 4HNFA 3PA5A 4RIWB 5C4LA 5EKOA 4MCVA 2RFEA 2YCRA 2R64A 4FKIA 4TYJA 4RJ7A 3FKLA 5L2WA 4GT3A 5AR3A 4B6LA 4IM0A 2R3KA 4FTLA 3QWJA 4DEHA 4NU1A 3G0EA 2UZTA 1XH5A 4FV5A 5K5NA 4FT0A 3HUCA 4G5JA 3EQBA 1VYWA 4FTJA 4J99A 4PMMA 3RZFA 4Z7HA 3CKWA 3P78A 4G3GA 3U9CA 4CD0A 3QUDA 4IWQA 1A48A 2NNWB 4QYFA 5DEYA 4O0XA 3ZZEA 3TCPA 3DXPA 4LYNA 4IFCA 3DAKA 5D7AA 4GFMA 4Y95A 4GU6A 5ANIA 4TL0A 4MVFA 4QO9A 4UWBA 3R00A 1WBTA 3IPHA 2WMWA 4FTOA 4PDSA 5AIKA 2QOKA 5I4NA 3NVKI 5DEWA 4QMQA 4IAZA 5JKGA 4ANNA 3OW4A 3F82A 4K1BA 4D4VA 1DI9A 4X2GA 3QRUA 4S32A 5DVRA 4QP4A 2XNBA 3R8MA 4FT7A 3DS6A 3FYKX 1ZOGA 5LXMA 3UZTA 4F6SA 5KBQA 1CKIA 1AGWA 4QP1A 5G1XA 2BRBA 4CFMA 1U59A 2QOHA 5GINE 5DR9A 2BUJA 3SV0A 4X3JA 4YTHA 4XMOA 3HP2A 4O0YA 4JI9A 3Q4UA 4FIFA 3IW7A 3OEFX 5M56A 4TWPA 4BI0A 3R28A 5IQHA 2DS1A 4D5HA 3BHTA 3RZBA 3D14A 2JKOA 1J7IA 3SG9A 2BZJA 3K5UA 1PKGA 4W4VA 2FSTX 2HZIA 3Q2JA 3C0HA 3NMUF 3GEQA 3LXNA 5KMNA 4N0SA 1OMWA 2XK6A 5EM6A 1LP4A 3NUUA 4K33A 5CI6A 4EZ3A 3LMIA 1LUFA 3R73A 3LVPA 2X81A 3ODYX 4NJ3A 5L8JA 3WF6A 4HVDA 4F9WA 2W1DA 4JBOA 4B9DA 3OOMA 3R2BA 4XG2A 4YJSA 3QLGA 4YJPA 1REJA 5CF6A 5EI8A 4E26A 4UZHA 2JC6A 3OXTA 2CMWA 3SHEA 3V3VA 4PP7A 5K4JA 1OL1A 1Q4LA 3D5WA 4R3PA 3PVUA 1XR1A 5HZNA 3LKMA 3GC8A 5C01A 3SKCA 3MW1A 1KV2A 5FXRA 4BVUA 4JAJA 3UVRA 2X7GA 3RWPA 4CFNA 3TZ7A 5I9WA 3I6WA 3NYXA 4HPTE 1FINA 5JMSA 4EK8A 4ZSJA 3R9NA 2BHEA 2EUFB 4MWHA 1OPLA 4LM5A 1W82A 2ITZA 3F2AA 5AAFA 3V6RA 1YI3A 4WNKA 3F88A 2XS0A 3IOPA 2WELA 4HCVA 2O8YA 2VO6A 4YURA 5L6OA 3SG8A 3C7QA 3KC3A 2BAQA 1PF8A 3Q3BA 3VS7A 3VWAA 2E9NA 2DUVA 4F9YA 3R9RA 5J9YA 2Z7SA 4O0TA 2PVHA 4HNIA 1Z5MA 4E8AA 2VTLA 3EYGA 3GC7A 4U97A 5DT4A 1APME 1IA8A 2CSNA 3W2PA 2I7QA 5J7HA 2XK3A 3QQGA 4M84A 3C51A 2GHLA 3EB0A 4U81A 1SVGA 3TZMA 2BILB 2C5VA 5L6PA 4NL0A 4F7NA 4X6RA 3RJCA 3WE8A 4YJRA 3B8QA 4PPAA 4S34A 1FPUA 5LCKA 4FEVA 4ZTHA 5BVKA 2VWIA 2C1AA 4ZMFA 4C61A 3IO7A 2HELA 4EHGA 3CY2A 4GVJA 4IX6A 4IWPA 4WRGA 4WUNA 4QMXA 4E73A 5IA0A 2A0CX 3ORXA 5AP6A 2RIOA 3NW7A 3OTUA 5EW3A 5TKDA 4KBCA 4DLJA 2OK1A 5DR2A 5EYKA 3FPQA 4BN1A 4YJVA 5EYDA 5HD4A 2YN8A 3ERKA 4DGLC 1YI4A 5EK7A 4O1PA 3AT2A 3LFDA 1H1WA 3DZOA 2YM5A 4RJ8A 3VJNA 3AMYA 2UUEA 3IS5A 3MA6A 4I6FA 3P08A 5AFVA 3QHRA 3II5A 4LOQA 3QHWA 3R7IA 2ACXA 4X0MA 4ACHA 4C36A 4XLIA 3G90X 3HECA 3VBWA 4C37A 2PVMA 3JXWA 2YDIA 1WMKA 5GZAA 5HNIX 2I6LA 4ZIMA 4EH6A 2GNIA 5AR2A 4AQCA 3HNGA 5AP4A 4P7EA 2R3OA 4BBFA 4D0XA 5E8ZA 1V0OA 2F2CB 3LMGA 3KXNA 5IDNA 4KS7A 3WE4A 4BRXA 2VUWA 2CKQA 2UZWE 1YXUA 2YZLA 3O7LB 3R21A 4FNXA 4WHZA 3CJGA 3W8QA 5L2QA 4YHTA 2BKKA 4H1MA 2QQ7A 2WQNA 3PIZA 2QG5A 2G2FA 3ACKA 2V5QA 2BFXA 3RVGA 3BGQA 1Q97A 5DR6A 3UYSA 1NT2A 2JDOA 3VS6A 2XKDA 5HNBA 3CIKA 1R0PA 5IA1A 2FSMX 2VU3A 3GC0A 3P7BA 5CAVA 4DBNA 3R8PA 4FTMA 1I44A 3LOKA 3GVUA 1Y91A 4RIYA 2VX1A 3QZIA 5IEYA 3TT0A 3FY2A 4FV7A 4CMOA 3LFAA 3I5ZA 2R3NA 3TNQB 3W55A 4BCGA 4EH3A 4EZ7A 5HG8A 2Z7LA 4KSPA 2JDTA 2XJ2A 5K3YA 5D10A 1PMNA 5DA3A 3A4OX 4IJPA 3KXGA 4EQMA 3D83A 1BKXA 3BQCA 4O0UA 5LVOA 3ORLA 4JQEA 3LM0A 4I6HA 3F5UA 1CDKA 3FL5A 3MVHA 1H27A 2G2HA 2J4ZA 4F9AA 4AAAA 3EN6A 3UNJA 2X2MA 2WTVA 4J95A 5B2KA 2R0IA 3S95A 4TNDA 3WF9A 3OROA 3WF8A 4C8BA 5EOBA 4RIXA 3ZH8A 5F94A 3PXFA 2RFNA 3NSZA 4AP7A 4BBMA 3HDMA 2XH5A 3FQEA 2LAVA 5IQAA 3FWQA 3FSKA 4GW8A 3TJCA 2JKMA 2PUNA 4C62A 3R1NA 1JOWB 3LFBA 4EONA 4TY1A 4PDYA 3KK9A 4X2KA 5FDPA 4OR5A 4LRJA 2R3PA 4QRCA 2BRHA 2QOOA 5HIEA 4RX5A 1ZMWA 4A4XA 3O8TA 5AUTA 5J79A 2EXMA 1GOLA 4L52A 4KINA 3GENA 1UU7A 4LRKA 4GIIA 4KRCA 4BGQA 2FYSA 5E8SA 2J90A 3GOPA 3QZHA 4I5PA 1Q5KA 3IOKA 3UDBA 4ANOA 3T3UA 3R8ZA 2JDRA 2Q0BA 4BKZA 2C5NA 4BCJA 2ZAZA 3W16A 3DJ6A 2RG5A 3NUXA 3R2YA 5BUEA 5K0XA 4J52A 2X9FA 4HYUA 1ZYDA 3UO4A 4FTUA 4D1ZA 4DFYA 5BYLA 3NZ0A 4C3RA 4Y5QA 3AC8A 4AX8A 4WNPA 3TNPC 4A9SA 3EL8A 5E9EA 4TZRA 3C4ZA 2PE1A 3GCQA 3LAUA 5E91A 5IUIA 5IQIA 1V1KA 4NW5A 3B2TA 3R9DA 3TNIA 5CSWA 5DMZA 3VRZA 3D7TA 3DKOA 5IA4A 3L8SA 2CJMA 3ENHA 5HESA 2BDFA 4XCUA 2CCIA 4J98A 3ZHPC 3UOKA 3VS2A 4BYJA 3DNEA 3ZLYA 4CKRA 4PMTA 4QYGA 4X2NA 4IIRA 3LJ0A 2C6OA 4MBIA 3Q9ZA 4CEGA 3F69A 4U8ZA 5TOZA 4E7WA 4BDEA 5EOLA 2RF9A 3V6SA 3TTIA 4M66A 2W05A 4P90A 5CT0A 4CYJA 4PMPA 3VBXA 5CU4A 5CXZA 5J1WA 2YITA 4YTIA 3S3IA 1GAGA 3QTWA 2VO3A 4IAFA 4JRNA 4J8MA 5C9CA 2FA2A 3OBJA 4UMUA 4FTKA 3KCKA 1IAJA 3BCEA 3HYHA 5AP3A 4RQVA 4OGRA 3NLBA 3VHEA 4GT5A 3LLAA 4EHEA 2AYPA 4GG5A 4C34A 4NFNA 4DYMA 3HLLA 4QPAA 4J1RA 4ZY4A 4K0YA 4Q5EA 1XBBA 3DKGA 3Q60A 4FSWA 4RBLA 4YP8A 2OZOA 5HBEA 4QP7A 4IZYA 4TYIA 5AP1A 2YM3A 3HGKA 3QTIA 3QQHA 3V5PA 4FNZA 3SW4A 2BPMA 5HBHA 4F0FA 4R77A 4UYAA 1PXIA 5AM6A 4ZJJA 3O8UA 1R1WA 3UOLA 2ESMA 3CY3A 3PPKA 5D7VA 3JR1A 1OPKA 1P2AA 2VV9A 3AC4A 1U54A 5DT3A 3VS3A 3QBNA 4JR7A 4I5HA 2R2PA 5KHXA 3NUNA 3A61A 4RIYB 1CM8A 4FZAB 4USFA 3VUTA 2IZTA 4D2SA 5E4HA 4U6RA 4LUEA 4QMWA 5IZFA 3U4UA 4F08A 5DBXA 1YXTA 3H4JA 3RM6A 4GVAA 5JZNA 3V5WA 4IZAA 3C1XA 3DCVA 4UXLA 4PQNA 2R7BA 1K3AA 4QT1A 3NVMB 3F2RA 2ZJWA 3UIUA 4OTHA 3KN6A 1JWHA 4D1XA 4ZXTA 4AOJA 1OIQA 4GEOA 1UV5A 4RT7A 5A6OA 3RKBA 5M51A 4QP8A 5HG5A 1Q8TA 1AD5A 2VZ6A 4FSTA 3AQVA 4TWCA 5AIRA 5EYMA 4ACMA 1WZYA 5AR4A 5EDPA 1Q3WA 5IQGA 5F1ZA 3R7UA 5FWKK 4EK5A 3ZLWA 4O0SA 4RIXB 5JEBA 3KEXA 4GU9A 3E92A 3FZSA 2R9SA 3G6GA 1W7HA 4APPA 1JVPP 4ZP5A 2ITYA 1SNUA 5FQDC 3DBFA 2XNEA 3FI2A 4CT2A 5CI7A 3PJ1A 3COIA 3QRIA 4I5CA 4QMMA 3OT3A 3RPYA 3I60A 4CLIA 3UYTA 1O9UA 4ZMEA 1BUHA 1OIYA 1WBNA 4AA4A 5EM5A 3O50A 2Q0NA 3TI1A 4EBWA 3PLAE 3NWWA 4TT7A 4E4XA 1JKSA 2CN5A 3E8EA 3JY0A 5J95A 5FTOA 2UVYA 1JQHA 2QODA 4FL1A 4JJRA 2F57A 2QOIA 4QNYA 3I1AA 4IAYA 3TIYA 4BDJA 3W33A 1B6CB 2VX3A 3MFRA 4A07A 4DEAA 4X2JA 4W9WA 2Z02A 4G3FA 4CVAA 1MRUA 4KUJA 3SGCA 1J1CA 3KKVA 4QMVA 3CP9A 4MQ1A 5BVWA 5FDXA 4NTSA 4CZTA 2CKOA 3R04A 2GS6A 3TKHA 1UNHA 3IONA 5ETFA 2VTSA 3D2IA 4YMJA 4UN0C 2YJSA 2UW5A 4NFMA 3PY3A 3DTWA 5CVGA 4D2WA 4MD7E 1G3NA 2R3QA 3P79A 4FIEA 2W1CA 4BDKA 1E1VA 2PWLA 3IK3A 1ZAOA 2WOUA 1URCA 3D7TB 1PY5A 3IW6A 3KVXA 3R7GA 3RCDA 3WI6A 3QD3A 3VULA 3I7BA 2PZIA 4JBPA 4BL1A 3IDCA 2UZLA 3EFWA 2WMVA 4U7ZA 2OXXA 3OW3A 3KXZA 5TE0A 5G6VA 4BCKA 4CRLA 4O83A 1YOJA 4M8TA 3DLZA 2XM8A 3SOCA 2DWBA 3U4WA 4BZOA 4JDKA 5HIDA 4F7JA 4ORKA 3RK9A 3U9NA 5C8KA 2VTJA 3QZFA 3MVLA 4MXOA 4OAVB 4O6LA 3BIZA 1PXOA 3BX5A 2F2UA 2OO8X 3VNTA 4RVKA 3Q96A 5B2LA 5LQFA 2C3JA 3MY1A 3O0GA 4W8DA 4ZLZA 5CQWA 3T9TA 4FTCA 5JQ5A 4F99A 4ZTSA 2GMXA 2J5EA 2W99B 3A7GA 3DTCA 3GCSA 4QOXA 3PSCA 4EYJA 4USEA 1VZOA 1P14A 1K9AA 2EXCX 2JEDA 2WGJA 2XEYA 3QTSA 1FQ1B 5CWZA 3W8LA 4A9YA 3R0TA 3TNWA 2O3PA 3VW8A 3QQKA 3ORMA 4R5SA 3CPCA 4YHFA 2H8HA 4ZK5A 5M08A 1F3MC 2J6MA 4IXPA 5E8VA 5KMJA 4GIHA 2YM6A 4BIEA 1BL7A 4QMSA 3ZUTA 1B39A 3IECA 4EC9A 2IG7A 3ZO2A 1ZYCA 2IVSA 4O2ZA 3U87A 1U54B 4R3RA 3N4TA 4UWYA 3C5IA 5DG5A 5F20A 4U3ZA 5CASA 1ATPE 3QC4A 3B2WA 4O7RA 2JDSA 4XUFA 5T3QA 3FKOA 4FF8A 1ZZ2A 1P5EA 4O6EA 1UU3A 3ZS5A 4ASEA 4XOYA 4TW9A 4RWIA 3VS0A 3CGOA 4KD1A 4KABA 1OL6A 2WIPA 1FOTA 3KA0A 3KL8A 4XBRA 3M2WA 4LOOA 3ZRLA 2QC6A 3KXMA 3FMLA 3F66A 4UMQA 4EC8A 5AA8A 2XBAA 4Q5HA 3BWFA 4RJ6A 3T9IA 3ZBXA 4X3FC 2PHKA 4BCNA 2X9EA 5ITAA 4K8AA 5BVEA 2IZRA 4PX6A 2H96A 3DQXA 3JYAA 5L2SA 3FXWA 3PVWA 2WMAA 3RHKA 3K2LA 3N4UA 1UKHA 4DITA 4HVGA 3NUAA 5CZIA 3SLSA 2Y6OA 2YHVA 1GIJA 3D5UA 4WG5A 4X7QA 3RK5A 5JFSA 4FOBA 1TQPA 5JFVA 4PF4A 2JITA 4MKCA 5A4EA 2HIWA 1YWNA 2PZ5A 5IEXA 4OTIA 3UO6A 3ZCLA 3EN9A 2CNVA 3DGKA 3ORKA 4RJ5A 3V5LA 1U5QA 4KA3A 5BUIA 2PUIA 4CXAA 5ETIA 3THBA 3A62A 2WMRA 4CNHA 3PDTA 4PNIA 4MX9A 3BHYA 5HLNA 5CF4A 1IEPA 2P2IA 3V8WA 1ZOEA 3UO5A 2YZAA 3QKLA 3GC9A 4I22A 3ZDUA 3CQUA 4L01A 2C5XA 5DFPA 2H6DA 3C13A 2OJFE 2W1ZA 4IBMA 3QKKA 4FYNA 4IB3A 5M44A 1OI9A 1PW2A 5M53A 5DOSA 1CTPE 2BR1A 5IQCA 3R8VA 3HEGA 4ASDA 1BX6A 2XKCA 1Q41A 3COKA 3R8UA 3NCGA 2A4LA 5JK3A 5GJGA 3V8SA 4E3CA 3UG2A 4IJ9A 1M14A 2ZV7A 3ZC5A 2E9OA 2CNUA 2W1HA 3DFCB 5LMKC 1OIRA 5C26A 4QQCA 3BYMA 1JLUE 1J3HA 4FVQA 5H2UA 3P7AA 2YAKA 4YLLA 5AM7A 4RJ4A 4O0WA 4D58A 2ITUA 2ONLC 1YQJA 4K6ZA 4RWLA 3PSDA 4OTQA 4FSRA 4F70A 2XIRA 3D7ZA 1O6LA 4FSUA 2OBJA 4DBXA 4EOSA 4HGEA 4IEBA 2IW6A 5HCYA 2WAJA 4JDJA 3R8LA 4XEYA 3RALA 3TTJA 4F7LA 4O7NA 2Y8OA 4FEUA 1YW2A 3DDPA 3OG7A 5M06A 3CBLA 2OH0E 4UEUA 2X0GA 3VBTA 4I21A 3ROCA 3WIKA 5BMMA 4E4LA 4LL5A 4S31A 3DBQA 4HGLA 2XIYA 2VTTA 1U4DA 5JN2A 4OBOA 1KOBA 1LPUA 2W7XA 1VJYA 4U43A 4ACGA 1WBPA 4HYSA 4S2ZA 4U40A 4MHAA 5C4KA 4AT4A 4Z3VA 3MB6A 2R3IA 4RMZA 3FJQE 5JSMA 4FSYA 1BI7A 1JBPE 4RA5A 3HMPA 2OFUA 2JFMA 3SX9A 2WU6A 2WB8A 3K3JA 1REKA 1OGUA 2J5FA 3U51A 3DDQA 3QXOA 4IX5A 3BE9A 2R4BA 4JOAA 4BIDA 4RVMA 3LQ8A 4U42A 4JG8A 1FVVA 4IAIA 2Y4IC 2R3MA 4D55A 4N4SA 1H08A 1MP8A 2W96B 3OWPA 5JGBA 3OY3A 4PY1A 4M69A 3F7ZA 4QYHA 4FICA 3MDYA 1FVTA 2YIYA 5IISA 3UC3A 2VN9A 3DBCA 3EN7A 3KU2A 3PIYA 4X3FA 4KBKA 3JUHA 4YC6A 2NRUA 3CE3A 3IW8A 3OCSA 2YACA 3AT3A 4H3PA 1W83A 4IVBA 4QPSA 1KE7A 4E4MA 5HU3A 3Q4ZA 3R1YA 5CNOA 5GZ9A 5JFXA 4WT6A 1Z9XA 3UQCA 2QLQA 4ITJA 3A7IA 5I9UA 3MIAA 5LJJA 3PZHA 1E1XA 4FX3A 3UIXA 4FMQA 2R0UA 3HVCA 3GT8A 4DN5A 2KTYA 4B0GA 2W06A 2YM8A 2F7XE 5HTIA 3ZEPA 4AZSA 4AOIA 3QA0A 4UV0A 3CXWA 4RFMA 4J71A 3GQIA 3LLTA 3BHHA 3OOGA 3R1SA 3SRVA 1WBOA 3GU8A 3V8TA 1PMEA 4FKGA 1JKKA 2E9UA 4YTFA 3I79A 3PPJA 5CEMA 1LR4A 2NO3A 3ORTA 3ZM4A 3KMMA 3WILA 1W0XC 3QTXA 5HVJA 3DK7A 3OMVA 3SDJA 2PVNA 2VAGA 4ZLYA 5AADA 2PVFA 3Q5IA 4BKJA 4OLIA 3KREA 4PTEA 3E7VA 1UWHA 4KKHA 5BVDA 3F9NA 2QOQA 3QAME 4FNYA 2XK4A 4ZOGA 3E93A 1OUKA 2X2KA 3TV6A 3OWLA 3L9MA 3H0ZA 4QYYA 1BL6A 5M4UA 1NA7A 4JS8A 1H1QA 1YDTE 3DOGA 3RPOA 3TZ9A 3K54A 3QF9A 5A4QA 1TKIA 4R1YA 1YHVA 2ONLA 2PMLX 5AX3A 3LCDA 4OT5A 5FBNC 1Y8GA 3ZEWA 1ZY4A 3H30A 3RBWA 2XIXA 3NNUA 2UZEA 3FZOA 3W2OA 2WTKB 4ITIA 2WHBA 4MEDA 4FKOA 3MY5A 2OG8A 3G51A 4IZ7A 4FK6A 2W0JA 4LMNA 4EWQA 4NKSA 3PP1A 2E2BA 2ETMA 3C4XA 4EOPA 4M7IA 2FUMA 2VRXA 2ZMCA 4JQ8A 3MA3A 4UB7A 1WAKA 3EZVA 4BZDA 5M4FA 4MH7A 4KB8A 1GZNA 1OBDA 1DS5A 1IR3A 2WTWA 3NAYA 2X7FA 4GFOA 4BYIA 3QWKA 3DJ5A 4DH7A 5KNJA 3V04A 2PMIA 1FBNA 3MB7A 3D0EA 3SOAA 2OF4A 4FIHA 3C4WA 5CX9A 4E6AA 2HXLA 4AA0A 4O84A 3FLWA 4KRDA 2OICA 4FKQA 4ZTQA 2CGWA 3W2SA 4R1VA 3FYJX 3L9NA 3CD8A 4FV0A 3FI8A 3VUHA 5FEDA 1NVQA 3BEGA 1SZMA 4ALVA 3BU6A 1WVXA 5DRBA 3R30A 3RAWA 3D4QA 5C03A 3NCZA 3W10A 3KF7A 2QU5A 3LM5A 2C6DA 3HKOA 2HK5A 4L7FA 5AUWA 4RC4A 2YM7A 2GFSA 3F2NA 3UE4A 4X21A 1Z57A 2RGPA 3ZRKA 1BMKA 3D2KA 2PMOX 3G0FA 3VVHA 2J51A 5KHWA 4MF1A 1GZKA 4YNEA 3G15A 3KK8A 2OIQA 4P2KA 1Q62A 3LFQA 4FKPA 5EH0A 4YLKA 5BNJA 2FB8A 1L3RE 1YRPA 3P86A 4NM0A 2REIA 3GCPA 3LFCA 3FMEA 1W98A 4IM3A 4PPBA 4D9UA 4DINA 5I9XA 3CKXA 5H9BA 2HWPA 2W1GA 3OF0A 4QTDA 4DGMA 2ERKA 1B38A 3FV8A 2JBOA
chains in the Genus database with same CATH superfamily
2GPHA 2C69A 3TKUA 2XVDA 3AGLA 4FZ7A 1P4FA 4QP9A 1YXXA 2VTPA 4DGGA 2ITQA 1FVRA 4KIPA 4M69B 4S33A 4WG3A 4F63A 3VBQA 3BLQA 4CFWA 4YJOA 3N9XA 3QRKA 3VQHA 1RE8A 4KKGA 5JRSA 1XH7A 2CCHA 3S2PA 3WOWA 2XB7A 1S9JA 2BDJA 4FT5A 2P2HA 5AUYA 4H1JA 3W1FA 4IWDA 4M97A 4EKLA 3VAPA 3LQ3A 1H4LA 3QX2A 5CNNA 3WF5A 3LJ2A 3E5AA 4MK0A 2C47A 3BYOA 5HNGA 5CAOA 2CKPA 4M0ZA 4HVSA 3WZDA 3PIXA 2QO7A 1Q99A 2EB2A 5HO7A 5B7VA 4G34A 2PYWA 4WIHA 4PNKA 3C9WA 4E1ZA 3MVMA 2PE2A 3Q52A 2C0OA 3U6HA 1XH6A 4U45A 4I4EA 1J1BA 5JRQA 3QGWA 4J53A 3SRVB 3O7LD 2GNGA 5DN3A 5EDRA 3GOKA 4U9AA 1WVYA 5HE2A 4AACA 3PA4A 3UGCA 4MD8E 4BI1A 1HOWA 5E8XA 3EFJA 3RCJA 3ZLXA 3PG1A 3BWJA 4KKEA 3M42A 4O7LA 3OCTA 3QTZA 4D0WA 3ATTA 4RIOA 3HX4A 4X2FA 2J9MA 3T3VA 4BY9E 2HZNA 2WIHA 4YR8A 2CLQA 2B9JA 3NFGB 3C4CA 4IM2A 4E6QA 3GI3A 2ITOA 4HVHA 1G8AA 3VUGA 2GQSA 2GTNA 4AXDA 3RMFA 4O91A 1PYEA 3QL8A 4AE9A 5HTBA 3KFAA 5LVMA 3R71A 4E5WA 1SM2A 4D4YA 3PRFA 4H3QA 4QMPA 5AP0A 4BIBA 2WU7A 5IH4A 4QTEA 5C8NA 3QA8A 3DZQA 2PVYA 4IAKA 4NKAA 3OWJA 3UJGA 4IH8A 3R9HA 4TKSA 4G2FA 5JZJA 2ZM3A 3R7VA 2PU8A 3DXQA 2HOGA 2QVSE 5DNRA 2PE0A 2JLDA 3EQRA 4JG6A 2X8IA 3ZM9A 4OT6A 2B4SB 2F4JA 5HCZA 5BV3A 4MBLA 1M17A 4YLJA 4C4GA 4RGJA 4IX4A 4ERWA 5AUUA 3BI6A 3EQFA 4A06A 3A8WA 4GG7A 3ZFMA 3KN5A 4BR3A 2G2IA 4JDIA 4UZDA 5JT2A 5F9EA 5D1JA 3G9LX 5AV4A 4XOZA 2CHLA 3FC2A 3OBGA 4YZDA 5T6KA 3EH9A 5L8KA 2XMYA 3EQIA 3HDNA 3OWKA 3UDZA 2JIUA 3VF8A 4EHVA 3CSVA 4BCQA 4DC2A 3SQQA 3K5VA 3LFFA 3FLYA 1H26A 2A27A 5A4LA 2AC5A 3HA6A 3MTLA 1L8TA 4I1ZA 4L00A 1KE6A 3BZ3A 4QMYA 3ORZA 4FV1A 5KMKA 4KIQA 4FV2A 3ODZX 2Y4IB 1UWJA 4FSMA 3RAIA 4BCIA 4C57A 5HE1A 4WD5A 5HE0A 4C4EA 3AD4A 5IH5A 2XK7A 3DY7A 4N70A 4O1OA 4TRLA 3VUDA 4BDGA 4R7BA 4NCTC 4O38A 4U3YA 5A14A 2ITPA 4AF3A 1M2QA 2HW7A 2AC3A 2B52A 4FKJA 4P5QA 1XHAA 3UC4A 3R7OA 3TV7A 4YTCA 2B9IA 5HX6A 1UU8A 4ZEGA 3H9OA 1ZYLA 2V0DA 3PY0A 1PXMA 3D5VA 4BC6A 4F6UA 4CZYB 4YBKA 2V22A 3HV7A 4G9CA 5IKWA 2BZIB 4PL4A 1OIUA 4N57A 3DKFA 4HYIA 5HLWA 3LW0A 4CKIA 3QCXA 4ALWA 5HO8A 3JVRA 2BTSA 3AC1A 3AC2A 4RQKA 3FDNA 4AOTA 5LVLA 3ID6C 4L8MA 1QPEA 2Y7JA 2OSCA 1BLXA 4NYEA 4OBQA 4USDA 4IVDA 4F7SA 4L45A 3FLNC 1Q61A 4L6QA 4WNMA 2Q83A 4LUDA 4DEBA 4ZJIA 3W2QA 2ERZE 4M68A 4MXAA 2EWAA 3E7OA 2WMSA 4DCAA 1MQBA 4BDCA 1JKLA 4WSYA 2HXQA 2WOTA 2B53A 3KF4A 3PE1A 3QALE 4KIOA 4YSMA 1UA2A 2C6EA 3AD6A 2W4JA 4AFJA 4BCOA 4DG0E 4EORA 4XYFA 2PVKA 3EJ1A 4BKYA 3CTHA 5K4IA 4D5KA 2EVAA 2XBJA 4IZ5A 4H3BA 1VEBA 4LFIA 3E63A 4HCTA 4FIJA 3GB2A 1PXLA 1RQQA 3TIZA 3UOJA 3BLRA 3PZEA 3NRMA 4RC2A 3Q53A 5KKRC 2C5YA 4TN6A 3FQSA 2VWXA 4FV3A 4DLIA 4JG7A 4GK4A 4XP0A 3REPA 3V01A 1XQZA 3I0QA 3PYYA 2YLFA 3GBZA 3TUDA 2UW0A 1QPCA 3M11A 3V5QA 3ULZA 2VNWA 3D94A 4G6OA 4HPUE 4ZLOA 3WARA 4XG7A 4FUXA 4IE9A 2VWZA 4Z9LA 3EMGA 4GRBA 4NUSA 2WTIA 3ZXTA 3TACA 3ZRMA 1IASA 3OCGA 2R3HA 2UZOA 4JIKA 3NX8A 4PTGA 3FHIA 4DE4A 1OITA 4D2TA 4RZVA 3MFTA 3R83A 3DAJA 4JRVA 4AZFA 2XRWA 4HZRA 4EI4A 2SRCA 4BGHA 5BVNA 4B99A 5LWMA 2XNMA 5HD7A 3EKKA 4F1MA 2DYLA 4EHZA 3OXZA 4J96A 4CT1A 5KX8A 2BVAA 2C6TA 5CVFA 3ANRA 3KVWA 2JIIA 3AXWA 3E3BX 4I94A 5KUPA 4O21A 4JQ7A 3VIDA 3KCFA 2W5BA 4IFGA 1WFCA 5AUZA 3TXOA 4LG4A 2PL0A 1WVWA 1DAYA 4MAOA 2CN8A 4BDHA 3MTFA 4QP2A 5D12A 2RL5A 5L3AA 3RK7A 4O7YA 2YIRA 3G33A 3KQ7A 2UVZA 4V01A 3MIYA 4IANA 2NP8A 4QMZA 4ANSA 2ZM4A 3HP5A 4QMNA 1YHSA 3W2RA 4LI5A 3DK6A 1AQ1A 4JVGA 3IQ7A 3NUSA 1GZOA 3BEAA 3SVVA 4HGSA 3TEIA 3FMKA 1W84A 5EQPA 5I9VA 3QUEA 4YSJA 5HIBA 2UZUE 4FV4A 1ZLTA 2IO6A 3KRRA 4IAAA 3FXZA 4C35A 4YUQA 3GXLA 3O5AA 3ETAA 4G5PA 2YDJA 1M52A 5HKMA 4IHPA 3OUNB 5F95A 5DGZA 4FKTA 5AR7A 3ORIA 2FGIA 4IDTA 4RVLA 3UZPA 3FKNA 3PVGA 1GIIA 3OP5A 4G1WA 3ZONA 4AT5A 4D1SA 5ACKA 4AGCA 2UW8A 5IMXA 2XCHA 4CQGA 3FPMA 2AUHA 4UBAA 5DH3A 4EJ7A 3HA8A 4R7HA 4BWPA 4D2VA 4HOKA 4O0RA 5T68A 4A7CA 5I5ZA 1BYGA 5ANKA 1M2RA 3PJ2A 4C2WA 2OWBA 4DFZE 3EKNA 4AW1A 3TN8A 2HW6A 4DCEA 1MRVA 3I5NA 1HCKA 3OVVA 2QURA 4Y85A 3W0PA 3NFFB 5AX9A 4FKWA 4TPTA 1KE5A 4MXYA 4QTAA 3MYGA 3UODA 4YO4A 5L8LA 4GUEA 4MNFA 2W4OA 4FZ6A 1GIHA 3RPRA 3F5XA 4OTDA 4D28A 2W5AA 3SXFA 3NW5A 4FGBA 4O7TA 4L68A 4C0TA 4EQUA 4EH5A 1H25A 4H05A 3D9VA 2UZDA 5LMAA 3ZSIA 5L2IA 3NUYA 3RPVA 3MH0A 5JH6A 3LCOA 4KSQA 4FTNA 5CTPA 5E8TA 3CLYA 5CANA 1M7NA 4OAUC 3EYHA 5K5XA 5FEEA 3COMA 4AXAA 2RFDA 2YISA 4D2RA 4AU8A 4ZSLA 5EHLA 4F1TA 4BWKA 4IB5A 2W9ZB 3I0OA 2UV2A 3HV3A 4C4IA 2R3JA 1NY3A 3PPZA 2GS7A 4RWKA 3Q5ZA 3OS3A 4BCPA 1EH4A 4OTPA 2B9FA 3O23A 1W2FA 3ZMMA 3ZO4A 2XYUA 4ERKA 4W4XA 4AZEA 2Y4PA 1ST0A 4TWOA 3MGYA 4FZDB 4V04A 4YBJA 4YZ9A 3TV4A 1QPJA 1KSWA 1Y6BA 2PZYA 2I0HA 1ERKA 2W1IA 3NAXA 4WBOA 5FRIA 3R6XA 2CGUA 3F5PA 1JKTA 4JLCA 4K77A 4ZSAA 2XK9A 3KRLA 2QR8A 3EFLA 3FMHA 4RX9A 4J7BA 4G6NA 5CQUA 3CCNA 2BMCA 5FP6A 3RGFA 4APCA 2BALA 4HGTA 5KMOA 2X0OA 2A2AA 3DFAA 3GP0A 4JBVA 4NK9A 5AV0A 4AFEA 5IA3A 3U6IA 1UKIA 3UPZA 1OKWA 5EFQA 3QFVA 4TTHB 3Q6UA 3VS4A 2GHMA 3FE3A 4XG3A 3WZJA 4DH5A 4ZTMA 3LCKA 5AJQA 4GKIA 3BLHA 4GFGA 3QQLA 4AZVA 3O17A 4BDFA 4FRFA 4CFXA 4W4WA 3FZRA 2H34A 4RWJA 5FTQA 3W32A 3P5KA 4NM7A 4A4LA 1W2DA 3GU4A 2B54A 1OUYA 3PUPA 2X8DA 2VTHA 5AP5A 3ORPA 3CC6A 4BI2A 2UZBA 3UDTA 3DBDA 5HOAA 3F3TA 3MH1A 3OD6X 5CSVA 3A7JA 4YZNA 5F4NA 4PP9A 3C0GA 2IVTA 3VF9A 1T45A 4C4FA 3G9NA 3SD0A 5CSPA 3HMIA 3H3CA 3QUPA 4MWIA 5J1VA 4QTBA 3MVJA 4FT9A 3FEGA 1W2CA 4FG8A 3KY2A 1XMMA 2WQBA 2XKFA 4O7WA 5IQDA 2RKUA 2CPKE 2CDZA 2IWIA 5I9ZA 5ANEA 1ND4A 4RVTA 4LGHA 4C58A 5I3RA 4AN9A 2WZJA 4CFUA 2I0EA 5A3XA 3R1QA 3O8PA 3LQ5A 2QNJA 2GQRA 3PP0A 4RRVA 3HRBA 3FC1X 4FNWA 2VTRA 4QMLA 2PPQA 1FGIA 3FLSA 3QD2B 4FIGA 4C4JA 1H24A 1W8CA 2VD5A 5EQEA 2Z8CA 3ZXZA 2EXEA 5HU9A 5FTGA 1J7UA 4QP3A 2ITVA 2IJMA 2VGPA 4DT8A 2I40A 3IKAA 3PE2A 3UIBA 3DBEA 4M3QA 4U44A 3MH2A 4N6ZA 1WBSA 2VTIA 3HUBA 4GL9A 4ZJVA 2CNQA 3LFNA 1ZOHA 5CYIA 4CYIA 4D2PA 2CLXA 5M07A 4ENXA 3RHXA 1Q8UA 4J97A 3N4VA 2BHHA 5E1EA 2BDWA 3OHTA 2KULA 2Y0AA 4IC8A 4PDPA 4UY9A 5IH6A 1H01A 3ZC6A 3FZPA 4L46A 4LV8A 3QQJA 4PRJA 2WKMA 2XUUA 1PXNA 3AC3A 4QMUA 2OKRA 4K9YA 4AS0A 5AP7A 4IWOA 4C59A 5IMEA 4L42A 5GIPE 3QU0A 4AW2A 3ZYAA 3QC9A 4C38A 1TZDA 3U6JA 2ZM1A 4AWIA 3EL7A 4GCJA 3KRWA 3QRTA 4B8MA 1OM1A 4M15A 4NIFA 2ZV8A 5HGIA 3TJDA 4AN2A 5IU2A 5AR8A 2R7IA 3F6XA 3OT8A 4XNEA 5AMNA 1XKKA 2E9PA 4W8EA 4C02A 4R8QA 3C0IA 3LCSA 3PVBA 4PMSA 5CS6A 4D4RA 5CU0A 2ZV9A 1YXVA 4FSZA 5AAGA 1KV1A 2CKEA 2Z2WA 2Y6MA 4EWHA 4O22A 3P1AA 4QMOA 2QOFA 4EK4A 4OTFA 1KOAA 3C5UA 4KIKA 3WZKA 4BWXA 4KNBA 4GH2A 3UMXA 5CT7A 1PMVA 4HW7A 3KRXA 5BUJA 5HVYA 1Y6AA 2OJGA 4Q9SA 5M4IA 5AUVA 3HV6A 5AAEA 1VLRA 2C3KA 5KBRA 5A6NA 1ZYSA 1A06A 2B9HA 1OL5A 3OXIA 5CENA 2V7AA 1YXSA 4IW0A 5AR5A 3QTQA 3FL4A 3F3WA 4AW0A 4BBEA 5GZ8A 1RDQE 3IDPA 3Q6WA 2F49A 2ZYBA 4HVIA 3VUIA 4BHZA 4R7IA 4W9XA 4LGGA 4XV2A 3HMOA 3FMNA 3E8CA 4AXCA 2RSVA 2O5KA 4R6VA 3TZ8A 3QCYA 2OXYA 2ZB0A 4L44A 2XANA 2FH9A 2JAMA 3ENMA 4GMYA 5CVHA 5M09A 5ANJA 2BIKB 4Y46A 1PRYA 5ETCA 3CQEA 5CXHA 4O86A 5CF5A 1QCFA 2YCFA 3RNIA 4XV1A 2C0IA 4O0VA 2V62A 4F09A 2FO0A 4QEBA 2VX0A 5AV1A 4UMRA 4RJ3A 2VTQA 4AUAA 1DI8A 5FM2A 3ACJA 4YPDA 3F3VA 3ZOSA 3HL7A 3RAKA 5E8WA 3MWUA 3ELJA 4WRSA 3L9LA 2O2UA 3WZUA 2IPXA 2OIDA 3QD4A 2IVVA 1NVRA 4JR3A 3BPRA 2OFVA 3FMDA 2GHGA 3PA3A 1UNGA 2WNTA 4O2PA 1Q24A 1J7LA 3MJ1A 4YGAA 2NRYA 1ZARA 5LCJA 4I4FA 4ITHA 2C6KA 4WUAA 5HHWA 2UW9A 4GUBA 4NT4A 2BRNA 2GDOA 3CJFA 4XX9A 5FBOA 1YWRA 4FYOA 2YAAA 5E90A 5K0KA 3UNZA 2BTRA 4ARKA 4XP2A 4YNOA 5DPVA 2XIZA 4RFZA 4U80A 2OXDA 2Y9QA 3BLAA 3UNKA 3NS9A 5FXSA 3DU8A 1PXJA 2WTCA 4O4CA 4ZY5A 3F7WA 4ZTNA 5EM7A 4WO5A 3ANQA 1I09A 4Y83A 2X7OA 5H8GA 3W2CA 5A4CA 2VTNA 3FZ1A 1H8FA 1ZRZA 2IN6A 2YFXA 2GCDA 3DA6A 5ETAA 1TQIA 2ZDUA 1MRYA 1H28A 1A9UA 5C1QB 5A54A 1MQ4A 2GQGA 2HENA 2I0YA 3TKIA 5DE2A 1H1PA 3FZTA 4OTGA 5GNKA 3FLZA 3R7EA 3UQFA 2V7OA 4YZMA 1J91A 1E9HA 2WXVA 3PFQA 3MFUA 2O63A 3BELA 3PY1A 4NW6A 3VN9A 4QNAA 1H1RA 3DT1A 5LMKA 2PY3A 3SA0A 3TDWA 2JFLA 2HZ4A 2W17A 4E5AX 5DYJA 4F78A 4FBXA 4NM5A 4FKSA 3S4QA 3IW4A 3ZUVA 1GZ8A 4CFFA 4O82A 3O71A 4F64A 4FKUA 2F7ZE 4XG6A 4O7ZA 4I5MA 2BRGA 3L9PA 3PTGA 5L4QA 4XH6A 4KS8A 4WA9A 4QMTA 2PZPA 3H9FA 4ASXA 3JY9A 5LMBA 3S0OA 1U46A 5CEQA 3A2CA 5AEPA 2QOLA 5ANGA 1YOLA 4PL3A 3NGAA 4R78A 3O96A 2OJJA 4RX8A 3MPAA 4PV0A 4ZSEA 3I81A 3SAYA 4DFNA 4E5BA 4EOMA 1ZZLA 2BKZA 4MYGA 4WBBB 5CF8A 4HZSA 4NIFB 1P4OA 5AV2A 4ZY6A 4Q9ZA 2C3IB 5JGDA 3R7YA 4AN3A 4XG4A 5TO8A 5FEQA 4Q2AA 1V0BA 2HWOA 4CLJA 3HRFA 5LVPA 4L3JA 3GQLA 1QMZA 3F5GA 2YJRA 4UX9A 4MXXA 4KIKB 2YLEA 4IMYA 5CLPA 2XKEA 5HCXA 5GIOE 4BCHA 4R5YA 4JIAA 2I1MA 5HEZA 5HG9A 4XV9A 3RM7A 3B8RA 3OEZA 3QYZA 4BICA 5M4CA 4I92A 2F9GA 2JDVA 5D11A 3BQRA 3RINA 3EHAA 1YOMA 2R3GA 3MY0A 5DLSA 4A9UA 4FC0A 4CG9A 3Q9XA 4RC3A 2XJ1A 4EK6A 4F6WA 4C4HA 4AW5A 2RG6A 3KULA 4K11A 4G3CA 5FG8A 5J87A 2GU8A 1OVEA 3PRIA 4X6QC 1ZWSA 2WMUA 5IDPA 2B7AA 2ITNA 3E8NA 4BZNA 1M7QA 4B7TA 4YO6A 4E6DA 2BCJA 4JMQA 4DFUA 3QKMA 3VBYA 3IG7A 2QOBA 2ETRA 4RFYA 3NEWA 1XJDA 1ZMUA 3POOA 4RX7A 5EW9A 5ACBC 4AA5A 5LWNA 3UMWA 1OKVA 3HAVA 2QKWB 2VO7A 2VTMA 2ZDTA 4GK3A 4GK2A 4CQEA 5A9UA 3NYNA 4DF3A 3P7CA 4JDHA 5TT7A 3ZU7A 4DEIA 4IACA 3L8VA 2HYYA 3MV5A 4FZFB 5AWMA 4IB1A 4ZZOA 5KMLA 1KE9A 2C68A 4FK3A 4L53A 3EN4A 4M14A 2W1EA 4X3FB 4M13A 2QKRA 3CQWA 3LJ1A 4G3EA 3U55A 1PJKA 1SYKA 1MUOA 2YCSA 3SC1A 4G31A 4EOJA 3Q4CA 2UZVA 3POZA 4EJNA 4AT3A 4BTKA 4BDBA 4BCFA 2QD9A 1PHKA 2QHMA 3L8XA 3FBVA 3AD5A 4MTAA 2ZV2A 1OGYA 2FSLX 3CTJA 3TDVA 3AGMA 3LXPA 5DT0A 4EEVA 1YWVA 2C30A 3W0RA 2WO6A 2YIXA 5CU3A 3E8DA 4DGNA 5CEKA 1RJBA 2J7TA 4CV8A 4FEQA 2VTOA 3A7FA 4L43A 2XZSA 4RSSA 1YHWA 4BJJA 2X39A 3TUCA 3BL7A 4YJQA 5IUGA 2O64A 4TXCA 4DAWA 1GNGA 3ALOA 4Z16A 1URWA 1FMKA 2A19B 2X4ZA 4DTBA 2GNLA 2B55A 4CRSA 4EK3A 3ULIA 4I24A 3VUMA 4DFXE 3UQGA 4I23A 2XA4A 3FHRA 5IF1A 1YKRA 4FSQA 4OTRA 2GNHA 2IZSA 2Z7QA 3KXHA 3OZ6A 3MFSA 5E92A 4B4LA 2XF0A 3GCUA 4QTCA 1H1SA 5EM8A 3S00A 2OW3A 3ORNA 4I0TA 3KB7A 3LXLA 3NDMA 2HAKA 4YC8A 1NW1A 4I0SA 3Q9WA 4G17A 1S9IA 2WMQA 4RLKA 2BZKB 4UMPA 5BVOA 3AT4A 3TM0A 2GNJA 3WBLA 4ANLA 5H3QA 4CTCA 2X0PA 4I6QA 4CCUA 1OKYA 3LMHA 3DB6A 3OY1A 3SXRA 4JNWA 4EUTA 4ANMA 1JSUA 2IW9A 5BYZA 4BFMA 3EQPA 4ENYA 4O7SA 3EOCA 3SXSA 4WG4A 4IVAA 2JKQA 4FUYA 3ZTXA 3PG3A 4JX3A 2IW8A 4H58A 4A4OA 2UVXA 3EQGA 3NW6A 3NYOA 2PK9A 3PJ3A 3LIJA 5J5SA 2WTJA 4ZSGA 4QQ5A 2C4GA 4P4CA 4WSQA 3NNWA 3F3UA 4NM3A 1IA9A 2P3GX 4L9IA 3N51A 4PPCA 4YJTA 3WF7A 2J50A 1O6KA 2PZRA 3VO3A 3P0MA 2GS2A 3PSBA 4QQJA 3NIEA 1JSTA 4FA2A 5CEIA 3O51A 4V05A 3KRJA 4EH2A 4LOPA 2J2IB 3ZFXA 2YIWA 2XAMA 2QCSA 4XJ0A 2ZB1A 1XBAA 4UALA 1ZYJA 1OB3A 1RW8A 3AG9A 4B8LA 4CKJA 3LHJA 3RAHA 4I3ZA 4O4EA 4FG9A 2YERA 4F9BA 3QQFA 1CKPA 1OKZA 4IB0A 5FP5A 2BFYA 4OTWA 3FAAA 4DTKA 3UP2A 1VYZA 4OW8A 4XG9A 3VBVA 5J7BA 2WD1A 2C0TA 2CGXA 3H10A 3FI4A 3AMAA 5I3OA 3ZLSA 5DHJA 4FT3A 3V5TA 5GJDA 3CD3A 4AGWA 5HORA 3VS1A 2C5OA 1KWPA 4MXCA 4PTCA 4NTTA 2XYNA 3I6UA 4NEUA 5E7RA 5EW8A 3KULB 4GJ2A 4BGGA 4E6CA 1QPDA 3QD0A 2C3LA 1CMKE 5EYCA 5KMMA 5FXQA 5GJFA 3OFMA 3RNYA 4ACDA 2GSFA 4GSBA 4NZWB 2PUUA 4XLVA 4DEGA 1XMLA 3ZUUA 1OL2A 4FE2A 1IAHA 2PSQA 2ZMDA 3DPKA 2J0IA 3CS9A 3QTUA 4XBUA 4H39A 1PKDA 2QO9A 3L1SA 2EB3A 4FL2A 5AUXA 3QQUA 4OBPA 3WYYA 4BTMA 5DRDA 5EI2A 2Z7RA 2QR7A 3VS5A 3PJ8A 3A4PA 4YPSA 5CZHA 5AV3A 3ATSA 5LARA 2OH4A 4DH3A 1QL6A 1UVRA 1TVOA 1YI6A 5HVKA 3JPVA 5EKNA 3A8XA 2HZ0A 5KO1A 3RTPA 5EQYA 4MBJA 3GFWA 3UBDA 5LOHA 4ID7A 4MQ2A 5KZIA 2ZVAA 4ANBA 1G8KA 2R3LA 4O96A 3W0MA 4GT4A 4IDVA 4ZTLA 3GU5A 1WCCA 2R3RA 3JVSA 3MBLA 5CAUA 3NNVA 2UW7A 4C7TA 4BTFA 4ZZNA 2IZUA 5CSXA 1M2PA 5BQ0A 3GUBA 2XEZA 2JKKA 2P33A 3IGOA 4XS2A 4E4NA 1Q3DA 2W9FB 2YDKA 5HO6A 4M12A 4W4YA 4C33A 2BAJA 3TUBA 5BYYA 3UVQA 4CZUA 2VO0A 4FTTA 4CV9A 3BU3A 3KMWA 4UYNA 2QHNA 3CTQA 3GGFA 3LZBA 5C27A 3UOHA 4BDAA 4BJJB 3E87A 4RZWA 1LEWA 3A60A 3EIDA 4BB4A 4E20A 1XH8A 3ITZA 4N6YA 4A9TA 2JAVA 3F61A 1BI8A 4I0RA 2J0KA 4O27B 4XV3A 4YZBA 3QRJA 1F0QA 1H07A 2FSOX 2OU7A 4ALUA 5DWRA 4DEEA 2QOCA 4U79A 5KCVA 2VWWA 2G1TA 3GU7A 2XNOA 3MS9A 3ROYA 2C6IA 2WEVA 3Q2MA 2UW6A 2QONA 2O65A 3E62A 3AKJA 1ST4A 4Y73A 4CCBA 3EQDA 5HQ0A 3G6HA 3O2MA 1ZMVA 3RI1A 4EOLA 4JBQA 4LRMA 1K2PA 4L7SA 2YM4A 4FTQA 1JAMA 4UMTA 2A98A 3BV2A 4F1OA 3BBWA 4Y5HA 3NNXA 5AA9A 4CMTA 4YU2A 4TYHA 3MSSA 1XO2B 1XH9A 3BYVA 3PXKA 4XP3A 2Z60A 4TYEA 5KZ0A 4FV8A 3OTVA 4MXZA 1ZY5A 2P4IA 3UTOA 4FEXA 3W0OA 4ONAA 4YHJA 1PMUA 4PL5A 5E8YA 3ZDIA 3C4EA 2XNNA 4FODA 3H0YA 2CGVA 1OBGA 2P0CA 4G16A 2X4FA 1WBVA 4DTAA 3V5JA 5AP2A 2PTKA 4ANQA 3VC4A 4NCTA 4XHKB 3TNHA 5HLPA 1VR2A 4LQMA 1H0WA 4HCUA 3QTRA 1SNXA 3GNIB 5D9HA 2YCQA 2OJIA 3PWYA 3BBTB 4FOCA 3BYUA 5CSHA 5IA5A 3FLQA 3KGAA 4C3PA 4DEDA 2XIKA 3HV5A 4QP6A 1SMHA 2G9XA 3BHUA 5LVNA 5HTCA 4C2VA 4ACCA 3PXQA 3WZEA 1JNKA 4YZCA 4BTJA 1YDRE 3UIMA 1PYXA 4U5JA 5EHOA 2WMXA 3BU5A 2J0MB 4QPMA 3ALNA 2QU6A 5HICA 5CEOA 2JD5A 4II5A 3ZO1A 2I0VA 4LL0A 4EH9A 4YC3A 4FG7A 2WPAA 5BPYA 5KMIA 2OIBA 2XM9A 3NYVA 4DFBA 1IG1A 2WQEA 3BKBA 3BHVA 3T8OA 3WIGA 3WYXA 4NJDA 3LE6A 2ZFYA 2QG7A 4IADA 4JXFA 5J9ZA 4Y72A 3TWJA 1LEZA 4JAIA 5EI6A 3CR0A 3AC5A 4F9CA 1UNLA 3QLFA 2ITTA 2NPQA 5H8BA 5HE3A 5J5TA 3OC1A 4DG2E 2GNFA 2XP2A 1GY3A 2UW4A 5EHYA 3ML1A 3G5DA 5FLFA 4EL9A 2YWVA 2P55A 2YA9A 2BZHB 3QYWA 3RPSA 2ITXA 2OGVA 2B0QA 3EN5A 4XG8A 3MH3A 2WQMA 3ZZWA 5CEPA 3AOXA 2G15A 2YEXA 2YIQA 4DT9A 5CAPA 2C6MA 4GJ3A 2C6LA 5IQFA 3ZSHA 1OPJA 3LFSA 4L67A 1ZXEA 4MD9E 4EQCA 3AKKA 2PVRA 4UXQA 5CALA 3HMNA 4V0GA 2PULA 3MESA 3MPMA 4EUUA 1DM2A 3IGGA 2R3FA 4FGRA 2IVUA 3CGFA 3BE2A 3D15A 1H00A 2HCKA 2OI4X 3U54A 2WTKC 4ZTRA 4TYGA 5FUTA 4FL3A 4BDDA 2X6EA 3BL9A 3FXXA 4P5ZA 4DH1A 3PJCA 1XH4A 4GS6A 3QXPA 5E1SA 2BAKA 2J0LA 2OZAA 3EQCA 4GYIA 4QDEA 4OUCA 5FGKA 3R9OA 4Z55A 4KAOA 3Q32A 4D4SA 4FEWA 5TR6A 2X6DA 3GFEA 2QO2A 3Q9YA 4EZ5A 5BMSA 4NWMA 2XJ0A 1OZ1A 5C8MA 1CKJA 2H9VA 3QGYA 5IPJA 4ASZA 4WNOA 2WEIA 3DJ7A 2ITWA 2G01A 3CPBA 3LPBA 3LCTA 3GU6A 5DIAA 3TG1A 5HBJA 1IRKA 1WBWA 2RFSA 3BRBA