4GVJA

Tyk2 (jh1) in complex with adenosine di-phosphate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
290
Chain Sequence
PTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead identification of novel and selective TYK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 290
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gvjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gvjA01
2FYSA 4JNWA 3Q4CA 3OCSA 4XJ0A 2XEYA 4XHKB 2VTNA 3AC8A 3LM5A 4YP8A 1EH4A 4NM0A 2C0IA 4IH8A 1ZYLA 5M08A 4F9WA 3L9LA 5C8MA 1ND4A 1P4FA 4I0SA 4FTKA 4JXFA 4LOQA 5IUIA 3D7TA 5A4TA 2NRUA 2YWVA 5H8BA 3L8PA 1KOBA 2QOBA 3PVWA 4GT4A 4BF2A 4EUUA 5DR2A 3W8QA 2ONLC 3ZBXA 4EHVA 4F1OA 4QMOA 3D4QA 2YA9A 4RIYA 2SRCA 4M68A 4FSMA 3PIXA 2AC5A 5BX0A 2OZAA 2OWBA 4EOQA 5KMMA 4I5MA 3KF4A 5FM3A 1FINA 3QCXA 4C3FA 4YJRA 3V5TA 5T68A 1XH7A 3WF7A 2JC6A 1VYWA 4FVRA 4RQVA 3LHJA 3NUPA 3DJ7A 2JITA 3FBVA 3OEZA 3FMHA 4O21A 4QMSA 5HGIA 3OT8A 5A14A 3LOKA 5JH6A 4X6RA 4C36A 2QC6A 3HA8A 5B0XA 4RG0A 3HX4A 4AA5A 4IX6A 2G15A 4CFNA 5EYDA 2PTKA 4EUTA 3LJ0A 3GC9A 3F7ZA 2IJMA 2C6LA 4DFUA 1PXNA 4AZTA 3F69A 3MA3A 4OUCA 3QRJA 2YIWA 3CY2A 3U55A 3K2LA 3CQWA 4G5JA 3HMNA 5CEPA 4ITHA 3D7TB 3LW0A 1YQJA 4C4HA 3EQGA 2C0TA 4ITJA 3ZM9A 2J7TA 1SZMA 3H4JA 3QYZA 5F9EA 2C6TA 1WFCA 5LMAA 5FWKK 4ANLA 2EB2A 4RX8A 4XBUA 2BRBA 4FTQA 4FIIA 2WFYA 1WBPA 4C3RA 4Y46A 4XV2A 4BFMA 2F7ZE 3MY0A 1YOJA 1FPUA 2BZHB 2OFVA 4IAKA 2BVAA 4MH7A 4CT1A 4MKCA 1UNHA 3A60A 4M14A 2YCFA 4M97A 4UV0A 4ZY6A 3RAIA 1H25A 3OWJA 1MQ4A 1CM8A 2WMBA 4DT8A 3UYSA 5CVGA 5CZHA 2H6DA 5AM7A 2VGPA 4BDIA 4DF3A 1WVYA 4PTEA 4YZBA 4XMOA 2ZB0A 3ALOA 3R9OA 2GS2A 4M84A 1XH4A 2VX0A 5CNOA 3A8WA 5HG8A 3NCZA 1YW2A 4TPTA 4KWPA 5HG9A 3R8MA 3SRVB 4BR3A 4I94A 3NUXA 5HNBA 1UV5A 4FEVA 4H3QA 5L2SA 4BWXA 1OL1A 2CKOA 4PWNA 4XX9A 4D1XA 4C4IA 1B38A 3QLGA 3L9PA 4DGOA 4AE6A 1YXVA 5AA9A 3UP2A 2C6DA 2HIWA 3JPVA 3RK7A 2X0GA 3MI9A 5TOZA 3FPQA 4FA2A 5AR5A 3ZC6A 3ZSIA 4ITIA 5L8KA 3ZSGA 3L9NA 5E8SA 2W4OA 4ZTSA 3LLTA 5EK7A 2C5XA 4YJTA 4IWOA 4YSJA 5BNJA 5IQGA 5C03A 4NKAA 4IAZA 1REJA 3HYHA 3DBEA 3DAKA 3ROCA 1I44A 2E9OA 4MQ2A 3HMIA 2FSOX 5ETFA 3UG2A 3ZUTA 2VWZA 2XP2A 3MESA 5H3QA 5AP5A 1CSNA 3QQUA 2VWBA 4FVQA 2C3IB 2PSQA 2VN9A 2Y7JA 3LQ8A 3QQJA 5C26A 4PDOA 1YWRA 2JDOA 5DNRA 4ALUA 5FXRA 5HIDA 3DKOA 4LUDA 3KXHA 2B7AA 4I5CA 3Q3BA 3U4WA 1BMKA 4Y85A 3PY0A 4L44A 4G3CA 4YURA 4B0GA 1U46A 2HAKA 1U4DA 2FSMX 2YAKA 4FV8A 5LARA 3DCVA 1O6LA 2WNTA 1K2PA 4P7EA 3P0MA 1ZARA 4ANOA 3CE3A 2B4SB 2R3KA 3AC2A 4FX3A 3RAHA 5GIPE 4EYMA 2B53A 1VYZA 4MXAA 5KHXA 1PRYA 3BLHA 2LAVA 3HMPA 3AMAA 5I4NA 3IW5A 4LV8A 1V0PA 4AA4A 1YRPA 4K9YA 3UIMA 5A6NA 2C47A 1QPDA 3DV3A 4M0ZA 4NCTA 4CXAA 2ZM4A 3MY1A 3DGKA 5M55A 4EH7A 2OLCA 4PP7A 5IQBA 2CJMA 2CNVA 2Z60A 3ATTA 5CAPA 5K9IA 1XH9A 3RPVA 4JQ7A 2GTNA 2ZV8A 4F09A 3PTGA 3IDBA 1ZMVA 4NSTA 4BCIA 4ANMA 4IWQA 4KABA 4D4VA 2WQBA 2DUVA 4QQTA 5IPJA 1OL7A 2JKKA 3UQCA 5IQFA 4RGJA 2HCKA 4K6ZA 2BKZA 1H26A 4CSVA 3MGYA 5EW9A 1GNGA 2QLUA 5EDQA 1YVJA 4DGMA 2KULA 4OTDA 4L3JA 4RJ3A 5KMNA 3R8PA 3R7GA 5AP7A 1BI7A 2VTRA 3MVJA 3THBA 5AV4A 4UYAA 2ZDUA 2OZOA 3BU3A 3Q9WA 2PUIA 4ALVA 1BL7A 1JBPE 3U6HA 2VWIA 5CWZA 5CXHA 4O86A 4JRVA 3FHIA 4JAIA 4E5BA 4OAUC 3QKKA 5HG5A 2V7OA 3BKBA 3QX2A 4FTTA 4ZZOA 4ZLOA 1ZWSA 2QU6A 5I0BA 1CKJA 4EZ5A 4KKHA 5CALA 2OK1A 4NM5A 4EYJA 1BKXA 2HY0A 2GCDA 4RJ8A 2X7OA 2PYWA 3A4OX 1VJYA 2A4LA 4U80A 4G1WA 5HHWA 4XRLA 1S9JA 3G33A 4OR5A 3LCKA 4Y83A 5FRIA 4EQMA 5K5NA 4CFFA 4YNEA 2J90A 5KMKA 3C13A 3FL5A 5EM7A 4IVCA 4TYHA 5CASA 4ZTQA 3LMHA 2VX1A 2XK8A 2DQ7X 1AQ1A 3FLZA 5J9ZA 2WZJA 3EQIA 1R0EA 2Z8CA 4JIKA 2Y4IC 1P5EA 4BKZA 2C3LA 3MTFA 2PVNA 2ITWA 4MCVA 4N4SA 2P2HA 3C0GA 4KSPA 3UNKA 2C68A 5C8KA 4FOCA 3NNXA 4S30A 4HVGA 5HIEA 4QMXA 4HGEA 1OZ1A 3QHWA 3R9RA 3FQSA 3GU8A 3SD0A 4BIEA 3GVUA 1APME 2GSFA 4TRLA 4NW6A 3SLSA 4B8LA 4OTHA 4IW0A 5AUUA 1YDTE 5IDPA 4G2FA 3RMFA 4QMWA 5I9WA 4D58A 4AFEA 1TVOA 3QQKA 4JJRA 5J8IA 5DWRA 5T6KA 3CJGA 2QKWB 2WIPA 5EHOA 3UP7A 2UZWE 3HMOA 4TWCA 5DPVA 4IVDA 3PG1A 4D5KA 3SA0A 2XYUA 5D7AA 2WMXA 3QA8A 4XP2A 5J95A 1DS5A 2WMVA 5CVHA 4HYUA 3PSCA 3UE4A 4GRBA 4J7BA 2HW6A 4TYHB 4BI2A 3VIDA 2OF2A 1OIUA 3GP0A 3OT3A 3VO3A 4HVSA 2BRHA 5AFVA 3FLYA 4DG3E 3O0GA 3F3UA 4MNEB 5IQAA 3KB7A 3Q2MA 5AAFA 4FYNA 4FV2A 1ZZ2A 4YTCA 5ANKA 3MB6A 4G3DA 3TEIA 4YGAA 4ONAA 2XKCA 2R3FA 3KFAA 4TNDA 1K9AA 2CGVA 3TNPC 4YZMA 1V0BA 3EB0A 1XBBA 2IO6A 1OI9A 2WMSA 3FMLA 3ZBFA 2R0UA 4AW0A 5CEQA 2YERA 4HGTA 5AIKA 3F5GA 4E5WA 4WBOA 4BCJA 3IOKA 3FZRA 4D4RA 3P4KA 4IJ9A 5JFVA 4NCTC 4P2KA 1FMKA 3I5ZA 3FHRA 1G5SA 5AP2A 4KINA 2BAKA 3K5VA 2UW7A 2XJ0A 4TWPA 2ZDTA 3FPMA 4O0YA 1F0QA 4A4XA 2YM6A 3MVLA 1FBNA 5DRBA 3ENMA 3LMIA 4ENXA 2WQOA 4ERKA 1OKZA 5D9HA 5AAGA 5JGDA 4ENYA 4I0RA 5DE2A 3IG7A 3BEGA 2UZBA 3TZ8A 1H0WA 2UZDA 1E1VA 5CQWA 5DYJA 4O0XA 3AMYA 3KULA 5IA3A 4ZJVA 5EFQA 4P5QA 2WXVA 2JKMA 5DFPA 4DE4A 2IVSA 2R3IA 3MH1A 4RPVA 3SDJA 3VBVA 4F9YA 5LVNA 4TL0A 4ORKA 3NNWA 4NJDA 5FDPA 1ATPE 4ZSAA 4WBBB 3C4ZA 3CD3A 2W1EA 4FV5A 3TKUA 2GQSA 2YIYA 3U54A 4AGCA 4CG8A 5IEYA 3S0OA 4X2NA 3QRKA 2CGUA 3I5NA 2W1HA 4ALWA 4CNHA 5A9UA 3GCPA 2I0EA 4C2WA 1PF8A 3AG9A 4FG8A 4IDVA 3IW4A 4NIFA 2CNUA 3VS1A 2YZLA 2Z02A 4QO9A 5DIAA 1UNLA 5IUGA 3JY9A 5HU3A 3NLBA 2I0HA 4R7IA 4DH3A 4TW9A 5IQHA 3QC4A 4FKPA 4F65A 1XQZA 2ITXA 2ETKA 3F6XA 4YLLA 4D9TA 4FTCA 3R8ZA 1KE9A 5HD4A 4PDSA 2VTTA 4PQNA 4G3FA 2WEIA 4XV1A 3PXFA 5CSXA 3V6RA 3QBNA 3H0YA 3R6XA 3CEKA 3EQCA 4PMSA 3ORNA 5DBXA 3ZS5A 2ITPA 3KULB 2JGZA 4A7CA 1OKWA 1J7UA 2IZSA 3HDMA 2I40A 4X3FB 1GOLA 4ANBA 4FTNA 4KIKB 5IKWA 4U3YA 3GB2A 1WCCA 2ERKA 3FI2A 5K0KA 3LCOA 1Q97A 4YSMA 4HW7A 3UZTA 2OFUA 2Q0BA 4HNIA 4QMZA 2BTSA 2R3QA 4LV5A 4DEDA 4Z7GA 5CAVA 4GU9A 3CKWA 3ET7A 3ID6C 2JD5A 3F3TA 2BCJA 3PVUA 1PJKA 2YCSA 4O96A 3CLYA 4DEBA 3D15A 4QMQA 5JT2A 5A3XA 3FYJX 1ZYCA 4YC8A 5ETIA 4HYHA 4YHFA 1UKIA 3MS9A 4U97A 4YPSA 4ZTHA 5CF5A 2R2PA 5H9BA 2OW3A 5KE0A 4ZIMA 4QYYA 5CLPA 4O0WA 1H1WA 3MDYA 4CMOA 4DINA 4NTSA 2QNJA 3IONA 2UZUE 4Y5HA 4DEAA 1IG1A 4B8MA 1WBVA 4GYIA 3N51A 5IISA 4I1ZA 2HZIA 5GHVA 5A4CA 4WD5A 4Y95A 4WNMA 3R8VA 4JDIA 3W8LA 4U40A 2J0LA 4RZWA 3KRWA 3LFCA 2QG5A 2G2HA 3BU5A 3F61A 5KZ0A 3A8XA 5GJGA 4PDYA 3ORZA 3HP5A 4ZTLA 2V0DA 1RW8A 2R5TA 3DFAA 1ZY4A 5ACKA 3UOKA 3DQXA 4FTMA 2LGCA 3FC1X 3OUKA 3UYTA 5AIRA 3JVSA 2IN6A 2WHBA 3LXKA 2QHNA 1VEBA 2WPAA 1UU7A 3V01A 1BL6A 3H3CA 3CPBA 2PVYA 4AE9A 3DAEA 3LJ1A 2RG5A 4YZDA 1JSUA 2HXLA 4A06A 3VUIA 5EW3A 3MVHA 2I1MA 2C6OA 4RZVA 4UMUA 4GJ2A 4U79A 3KXGA 2OXYA 1UWHA 3R71A 2W96B 5AWMA 3I6WA 5BYZA 3UGCA 3VBXA 3MVMA 3OCTA 4PPCA 4CZYB 3ZUUA 3A7IA 4LUEA 2VX3A 3OVVA 4FKVA 3RZBA 4JS8A 5IA2A 4UX9A 3OHTA 4Y73A 3R2BA 4I6FA 3RI1A 2X81A 3KK9A 3ANQA 1SNUA 3WZEA 2G01A 5HLNA 4IX5A 5CT7A 4I21A 2Y6MA 5EQYA 2C6EA 5DHJA 3LZBA 2W7XA 2ITNA 4F0FA 1JOWB 2W5AA 2YISA 4PL4A 4O38A 4ZSGA 4EHGA 4MBLA 4JBOA 3HV7A 1JAMA 1GIHA 3VRZA 4QTDA 1GZKA 4WG4A 4W4XA 3SC1A 1OIRA 4YJNA 1OGUA 1Y8YA 1M2PA 2IG7A 4EK8A 1LP4A 5HE2A 1WVXA 1WBSA 3V5JA 4R77A 4C4GA 4D4YA 4O83A 3TWJA 5JFSA 4JQ8A 4PL3A 5M4CA 3KU2A 3I81A 2B1PA 5HBJA 3NDMA 3PSDA 3PG3A 2OI4X 4XV9A 4O0SA 4Y5QA 4IZYA 5EQEA 4IADA 2C6KA 1XH8A 3GU7A 3GOPA 3QALE 4KKGA 2A27A 4PMTA 3ACKA 1NVQA 2EVAA 3MW1A 1REKA 3CJFA 5JEBA 1F3MC 3A7HA 3OWKA 5EW8A 3ALNA 5M57A 1XHAA 2X9FA 3KN6A 2OO8X 3V3VA 4DAWA 4ACHA 4UMQA 5TT7A 2G2FA 3ZXZA 3NAXA 3WYXA 4ZXTA 5A46A 3E8NA 1OPJA 3TNIA 3NPCA 4HZRA 4K8AA 2C1AA 4BGGA 4F6SA 2GNFA 4EH2A 1QPCA 5JKGA 2BHHA 4CQEA 5JSMA 5T3QA 1J7IA 5AADA 2NO3A 3P7BA 5M06A 2WMRA 3NYVA 2R3RA 3DY7A 4FKSA 5K0XA 1IR3A 3ORMA 4FV3A 2QOHA 2I6LA 3BLRA 4UWCA 4I24A 1AD5A 2XIXA 1PW2A 2HZ4A 3Q6WA 2WEVA 5AUWA 3Q9YA 1LPUA 5DR6A 4IE9A 3DJ5A 4I6QA 1YKRA 5FBOA 4AWIA 3FV8A 4M66A 2REIA 4TN6A 3DBCA 4EC8A 5BVWA 2XZSA 3FSFA 4WA9A 4FTIA 4BCQA 2JIVA 4FSYA 5HIBA 1ZYSA 3VJNA 4FEWA 5HNIX 3GT8A 3ZRKA 1H07A 3D2IA 5I9VA 5J5SA 2C1BA 3NWWA 3QCQA 3QF9A 3KA0A 4BDDA 4ZTRA 1BI8A 2XCHA 4R3PA 4PPBA 3RK5A 3W10A 3ZLYA 4FT0A 3DLZA 4NFMA 2P4IA 2OJGA 2VO7A 5CSHA 4CZUA 4ASDA 4NL0A 3GCSA 1J1BA 3V8SA 4MF0A 2VZ6A 5FP5A 4ACDA 3EZVA 3QRTA 3G15A 1V1KA 5M09A 4N0SA 3P08A 2YZAA 3UPXA 3D0EA 1H28A 5AV3A 2FSTX 2VWXA 3WF5A 4OT6A 3NIZA 3ZZWA 1IAHA 3A61A 2PUPA 5ANIA 2PMOX 1QPEA 2R3NA 3F82A 5GJDA 2PVLA 2WTJA 4GFGA 5IF1A 1WZYA 1U59A 1VZOA 3G5DA 3KXXA 4PX6A 2BFXA 2WQNA 4JDKA 5FP6A 4OAVB 1Y6BA 2YITA 5IQDA 4P4CA 4K77A 2PVMA 4EI4A 2Y9QA 4J97A 4K18A 1E1XA 4DLIA 4R7BA 4FSQA 2WB8A 5E91A 5IH4A 2GU8A 3E92A 5CU6A 1RE8A 5LCJA 5GZAA 1WAKA 1DAYA 3W32A 3MH0A 5A54A 2DS1A 2PVKA 2OJFE 3BHUA 3FLWA 5TF9A 2BDJA 5AEPA 4IB0A 5HZNA 4AP7A 2XK4A 3KMWA 1UNGA 4YJOA 4BHNA 2BZJA 5TR6A 2ITYA 5DT4A 2OKRA 4BI1A 3H9FA 3OY1A 3P1AA 2W99B 3I79A 3CPCA 3VAPA 3BYSA 1VR2A 4BYIA 4GK2A 2UW4A 4R6VA 5E8XA 4QOXA 4EL9A 3PJ2A 3HECA 2H34A 3D5VA 4BDJA 5ETCA 4C57A 3ZFYA 5CAUA 3C51A 4L9IA 4YBJA 4PF4A 4F0GA 3PYYA 4O27B 4LM5A 3BHHA 3P78A 2HENA 4TNBA 4EH5A 2W4KA 4U7ZA 3FAAA 2Y4PA 4JX3A 3S00A 3MIYA 4MXXA 4F1TA 5JMSA 2EWAA 1LEZA 3HDNA 4WSYA 3GFEA 2QCSA 3F3WA 3KGAA 3GC8A 4YUQA 5E8UA 3VBWA 2YCQA 1OBDA 1Q4LA 3NVKI 4K11A 3WF9A 4Q2AA 3LMGA 3A7JA 2IW6A 5C9CA 5KKRC 2VRXA 2C4GA 3VUDA 2WMUA 2YIQA 4ZS0A 2DWBA 4BCFA 1GAGA 2FH9A 4GVJA 4MYGA 4EWQA 1LEWA 3D2KA 5AP3A 3WOWA 3IW6A 3C4FA 3W2OA 4DTKA 4ZP5A 4CYJA 2F9GA 2O63A 5BVDA 4K33A 3EYHA 3AC5A 4A07A 3CD8A 3RNYA 4ZJJA 4EH9A 4FIFA 4RLLA 3ZO4A 4I4FA 4EK5A 1IASA 4FICA 3RINA 2W06A 1OIQA 2J0JA 3ULZA 2F4JA 4ZSEA 3IW7A 4FV0A 3EQFA 3UIXA 3R7OA 3E93A 4DH8A 4EOLA 1L3RE 4GS6A 3NUYA 3RHKA 2WOTA 4XS2A 2RKUA 3DJ6A 2GNLA 3L8SA 3Q4UA 5E1EA 4BWPA 5J7BA 5KZIA 3TV4A 2UW8A 4QYEA 3JXWA 3MYGA 2WTVA 3NR9A 3KVWA 4FV7A 2OG8A 4E26A 3BIZA 2WELA 1ZOGA 2CLQA 4I5HA 2VWVA 2YN8A 3RHXA 4AW1A 3QGWA 4AU8A 2IW9A 5AX9A 4BDHA 3TDWA 4EOPA 4H1JA 5E8ZA 3GENA 3G0FA 3BGZA 4AN3A 1M2RA 4XNEA 4DGGA 4IIRA 5IH6A 3BE2A 4D1ZA 3CCNA 4GIHA 3SRVA 1YHVA 4BTJA 3S1HA 2R3OA 3FY0A 3MPMA 3ZDIA 4EORA 2PVRA 2GPHA 2P33A 1P14A 3OW4A 2X6DA 4RC2A 3ZDUA 4AZVA 3NGAA 2O64A 3TNHA 3CGFA 3RVGA 3BX5A 5E8WA 5AP6A 1OL2A 3BBTB 4J8NA 4RWKA 2BTRA 4G9CA 3B8RA 1WBNA 2XK6A 1H0VA 2J0KA 2VU3A 5G6VA 4QP3A 4EZ3A 3LIJA 4QMVA 2ZYBA 4DEIA 3FC2A 1XBCA 3L9MA 5KMIA 3JYAA 4APPA 1OITA 5JZNA 1GY3A 4L52A 4QMLA 3PY1A 4ACGA 4PTCA 5FGKA 3LFNA 3RNIA 4UZDA 5CX9A 4C02A 4AAAA 3GUBA 4M7IA 5A4LA 5BQ0A 4CKRA 4RMZA 4W4YA 5L8JA 2UW5A 4JDJA 3TTIA 3CQUA 3EMGA 4USEA 4AOTA 4WUNA 4RIXB 3DBQA 4TYEA 4C62A 3GGFA 4AOJA 5M4IA 4DEEA 3AD4A 5IDNA 5C01A 3MPAA 4F70A 3ITZA 2W17A 3ZSHA 4FBXA 4ZEGA 3KC3A 3LXPA 4O0TA 3RPOA 4C0TA 4CV8A 2WQMA 3PSBA 4P5ZA 1STCE 1JPAA 3FKNA 4CFXA 3IS5A 4AW2A 1YXTA 3FKOA 4RFZA 4AZEA 5LVPA 1YHWA 2PPQA 5LVMA 2CCHA 2PVFA 3IDPA 4JT3A 4HVHA 3UOHA 2W0JA 2RL5A 3QTQA 2CSNA 2RSVA 4IX3A 5FEQA 2V62A 4E6CA 5DLSA 3FI8A 3DK7A 4BZDA 5DOSA 3PPZA 5KX8A 2HZNA 2YJSA 3VJOA 2FGIA 3MH2A 3MPTA 1PKDA 4IBMA 4TT7A 3LJ2A 3V8TA 4G6LA 4BZOA 3QZGA 4W4VA 2CKPA 3EQRA 4BDEA 2IZTA 5AUTA 3O8UA 3Q2JA 4BCPA 4C3PA 3LAUA 3R63A 1L8TA 4OGRA 4GG7A 3FJQE 5E4HA 3D7ZA 3ATSA 2R0IA 3PLSA 5L2IA 1DI8A 1URCA 4Y8DA 5IEVA 3I7BA 4LQMA 3T3UA 4H39A 3I6UA 4AZFA 3DKFA 5M51A 5HVJA 3BHTA 4FI1A 4O7LA 3FZTA 2B0QA 4B99A 4NUSA 2VAGA 2VTOA 2CCIA 5J1VA 4IAYA 1A9UA 1Y8GA 4FZDB 5H8GA 3NAYA 2GDOA 4KA3A 2B9JA 1H4LA 1ZZLA 2IW8A 1WBWA 2YCRA 4QPSA 2BROA 2O5KA 3R2YA 4L7FA 3FZPA 2XKDA 3CQEA 1OECA 4GUBA 4NM3A 4UYNA 3ZLXA 5BUJA 5CF8A 2QI8A 5L8LA 4ZZNA 3NNVA 3DA6A 5CT0A 4DG2E 3BWFA 4JQEA 4ZZMA 3IOPA 3U87A 4EJNA 3H10A 4EC9A 2B54A 1H1QA 4GT5A 3LE6A 5H2UA 4IB3A 3VUHA 4ZLYA 3QD4A 4OBPA 2C5NA 5KNJA 3K3IA 3LXLA 4YTHA 3NMUF 2PUUA 3ORTA 3HRCA 4I0TA 3UQGA 5K5XA 4DCEA 3SW4A 4FF8A 3VUKA 3LFSA 2QO2A 4A4LA 1E9HA 1PYEA 3KKVA 1XH6A 3OF0A 4N70A 2H96A 4L3PA 1YI4A 3HAVA 2RFSA 3CTQA 3FMNA 3OTUA 5DRDA 4AXAA 3HUBA 4PY1A 4BC6A 3C4WA 4FV6A 1NXKA 4FV9A 1OVEA 3RWPA 4CRSA 3G0EA 3DOGA 4EOKA 4N57A 4I22A 4J98A 1RJBA 5EHYA 3LQ3A 5BMSA 3U4UA 5GIOE 3NS9A 4QQCA 2R3PA 4IANA 3PE2A 4AT3A 4ANSA 1U54B 4FEQA 4D2WA 4FIEA 3GC0A 1JKSA 3UIBA 2PE1A 5CY3A 1YI3A 1Z57A 4KAOA 4L67A 1W83A 4PRJA 2JBPA 4QNYA 3RJCA 4FE2A 3OXIA 3ZHPC 1FQ1B 2C3JA 4P90A 4JBPA 3JS2A 3LLAA 4I41A 1GJOA 5AM6A 4IDTA 2YFXA 1J3HA 2ETMA 3ZCLA 3UTOA 2BHEA 2CKQA 5GJFA 2FVDA 3OUNB 4MNEA 3GXLA 3P86A 3KRJA 4F4PA 3IW8A 4MF1A 4JR3A 3LFBA 5AR7A 3UG1A 3PZEA 4NEUA 4UWYA 4ANNA 5IMEA 3DB6A 2ACXA 3FSKA 3KRXA 3Q9ZA 4M67A 1FMOE 4I92A 4JI9A 3Q04A 4NM7A 2RFNA 5ANJA 3RPRA 2W5HA 4FOBA 3OFMA 4ZLZA 1PMNA 3EIDA 2R7BA 5LWNA 5HI2A 1OKVA 4F6WA 4LRMA 3EH9A 2VWYA 1PXIA 1Y91A 5DEWA 5E8YA 5FEDA 3SG8A 2OU7A 2C5OA 4AGUA 5HE0A 1M14A 3KREA 3FZOA 4U42A 4KNBA 3FXZA 3HEGA 5EOBA 2QO7A 4W8EA 2UV2A 4XLIA 4CYIA 1OKYA 3KQ7A 4FKRA 4KSQA 1Q99A 3RAWA 2QURA 1FVTA 3WF6A 3KXMA 3PRIA 4MD9E 5CI7A 2UZEA 4RVKA 3QKLA 5I9YA 1J7LA 1PHKA 1KE5A 3QQFA 4OTPA 2I0VA 5I3OA 2R3JA 1QCFA 2F7EE 4MBJA 5EKNA 3AGMA 5LJJA 5D1JA 4O0UA 5CYIA 2W1FA 2WTIA 5CAOA 2B9IA 4IHPA 5J87A 4O7TA 3TCPA 1JWHA 3R1NA 5CU2A 2YDKA 4CKIA 2XA4A 4WNOA 3RZFA 5DN3A 4BKJA 4AUAA 4BIBA 1GZNA 3JUHA 1KE8A 3D5XA 3HVCA 4JAJA 4O22A 3ZFMA 5CU0A 5J79A 1W82A 5EKOA 4YLKA 3AD5A 3OBGA 4FUYA 3BZ3A 4OTFA 1PXJA 4ZMFA 2YDIA 3OWPA 3MJ2A 3E62A 1JKKA 2WKMA 3TKIA 5H8EA 4GH2A 4I5PA 4JRNA 4OW8A 4PNIA 2BMCA 4QP9A 4D2TA 5HTIA 4TYGA 4RJ4A 2QG7A 4OTIA 5DA3A 4WNKA 3VUGA 2VTMA 3DQWA 3GC7A 4GU6A 5CEKA 3SVVA 4HVIA 4MXCA 4LRKA 4O0RA 4BCKA 4FK3A 4H1MA 2OH4A 4F7SA 5JFWA 2PULA 3QCSA 2GNIA 4JX7A 3GCQA 4BTKA 3VRYA 2VNYA 4CTBA 2E9PA 4FIJA 3KRLA 4TTHB 1F5QA 3TUBA 2Y0AA 2QKRA 3EFJA 2QOLA 4PDPA 4CT2A 4O2PA 1JSVA 3QWJA 2F49A 3MY5A 3HV3A 4BN1A 3A7GA 4F1MA 4QYFA 4X3JA 3RPYA 3IK3A 4FSNA 3KXNA 4WOVA 4IJPA 1ZOHA 3OW3A 4X3FA 4RT7A 4CD0A 3HLLA 3WZKA 4JG6A 3GQLA 4KIKA 5KCVA 1IRKA 3TZ7A 3RALA 4KS7A 4G16A 4PV0A 2Y6OA 1XBAA 5A6OA 5JN2A 3DKGA 2HY81 5CU4A 4O91A 4H05A 1MRVA 4ERWA 2CPKE 4ACCA 2X39A 1HCKA 3MJ1A 4RIWA 1ERKA 1PXLA 3EL8A 2V7AA 3QUPA 4FSRA 4YLJA 4YZNA 2EXMA 4CV9A 1KUTA 3VWAA 1NT2A 3R04A 3FMMA 4RLKA 1Q8TA 2QD9A 1ZY5A 2W1ZA 4F64A 2XK3A 5EYKA 3OG7A 5EM6A 4V0GB 2UZOA 1GZ8A 2BZKB 2XIZA 2ZB1A 3KCKA 3Q9XA 3QZHA 4XBRA 2UW9A 4XYFA 3V5WA 5J9YA 4MHAA 3C0IA 4YZCA 2IPXA 4OTGA 2XIKA 4R5SA 2GNHA 1DM2A 4U41A 4E6QA 2XVDA 3CKXA 4E6DA 1W8CA 1XKKA 3TUCA 2ERZE 3UDBA 5A4EA 2OGVA 3C0HA 5CVFA 1SVEA 5J1WA 3RPSA 3F5PA 4IX4A 3S2PA 5DMZA 1BYGA 3BYOA 4N6YA 4AACA 1CDKA 3P23A 3K3JA 3JR1A 3OD6X 5G1XA 3M2WA 1PMVA 4WRGA 2P55A 3GU6A 3DDPA 4O7WA 4RJ6A 4R3CA 3RCJA 5AR4A 2W9ZB 3RTPA 1YOMA 3CBLA 3G9NA 3LCDA 5L2TA 4DYMA 1HOWA 3TXOA 4YU2A 4RIWB 4QMTA 5HO6A 5GNKA 3U8WA 3R83A 5ANEA 3T3VA 4RWLA 4PTGA 4X6QC 2QONA 3QYWA 3PXKA 4XOZA 5CU3A 4AT5A 3KVXA 3MB7A 3OP5A 5EM5A 3SX9A 1KV2A 2CLXA 3WIKA 5I3RA 2FB8A 5M44A 2BILB 2JEDA 3NNUA 5I9XA 5HCZA 4C37A 1SVHA 4HJOA 3FMDA 5CF4A 1I09A 3K5UA 5L2QA 3ODYX 4JR7A 5C1QB 4BIDA 4PPAA 3D5WA 5KMJA 2PZIA 3W16A 4M15A 2WU6A 4U0IA 1QMZA 2PZPA 4O1PA 2JKQA 2GQRA 2J51A 5ANOA 3WYYA 3UZPA 2BAJA 3BI6A 3G2FA 4QMMA 2JIUA 3VS3A 4F0IA 4ZTNA 2UW3A 3F2AA 3N9XA 3BLQA 4FVPA 5CNNA 4AN9A 5IG1A 3ERKA 5EM8A 3UIUA 3V51A 5HLPA 4DFXE 1OL6A 4W8DA 4AA0A 4YPDA 5L6OA 5IZFA 3ZRLA 5HD7A 5EOLA 2YM3A 3VHKA 2KTYA 4DN5A 1Q61A 3DZQA 4X0MA 3DS6A 4DC2A 4MXZA 3R9NA 3I7CA 4WG3A 3VUMA 3NZ0A 4AOIA 3O23A 3NYNA 3Q4ZA 2XRWA 3B2WA 3Q5IA 4C4EA 5FXQA 5HTBA 1OUKA 2B52A 1O6YA 3FDNA 4HNFA 4TYIA 1WBOA 3BRBA 5FTOA 2EXCX 2RF9A 3Q4TA 3ZLSA 3POOA 1OL5A 2A0CX 2O0UA 4L8MA 3RM6A 3VS7A 4D9UA 2R3MA 3LQ5A 2WIHA 1PMEA 1ZMUA 2O8YA 5JRSA 4BI0A 3G90X 5E1SA 3UPZA 2PL0A 4J71A 3QQLA 4PP9A 2A19B 2C0OA 2O65A 2BAQA 3AXWA 3QL8A 4FZAB 3QTWA 4GKHA 4JG7A 4QQ5A 3ZU7A 4YJVA 4LL0A 4MD7E 3FXXA 4FK6A 4OT5A 5IQEA 3IO7A 3PP1A 4OLIA 4Z9LA 4CMUA 3CC6A 4WG5A 5EHLA 3VW6A 3LKMA 2HOGA 3CP9A 4FTAA 5ETAA 4M13A 4WHZA 4DT9A 4TWOA 2FUMA 4X3FC 5CENA 2QQ7A 3PLAE 1H00A 3ZOSA 2OBJA 3AC3A 3VULA 4CQGA 4FNXA 3AT4A 5C27A 3V8WA 4O81A 3PY3A 4O2ZA 3K54A 1YHSA 5BMMA 3RWQA 1SVGA 4QNAA 4C33A 3SXRA 5EH0A 3QWKA 3DFCB 3O17A 5HE1A 4C38A 5C8NA 4MD8E 5E7RA 4DH1A 1M7NA 4AG8A 5DG5A 3UVRA 4RA5A 4E6AA 3PA5A 3PFQA 2PZ5A 4RWIA 4USFA 4B4LA 2WTCA 4FZFB 5CZIA 2ITVA 2NPQA 4G31A 4GT3A 3KK8A 4M69B 3TACA 4EH4A 5JRQA 4UXLA 1LUFA 2GFCA 2PHKA 3GQIA 5DT0A 4JDHA 4BCMA 2UVXA 1OM1A 4RVLA 2E2BA 3EFKA 2XB7A 4FT9A 2XS0A 4U81A 5IA0A 2ZMDA 3EL7A 4BL1A 5FD2A 5BVFA 3TG1A 5BPYA 3QQGA 4KBCA 5CTPA 5AR3A 4C34A 2YABA 5CF6A 3OCGA 1OUYA 2G1TA 1O6KA 2OJJA 2ZV9A 3PPKA 3V5QA 1HCLA 4QTEA 5HORA 3ORPA 2GNGA 3NCGA 4ASZA 3KL8A 3H9RA 4EK6A 2BRGA 2J2IB 4RFMA 3FZ1A 4YO6A 2BIYA 3KXZA 1Q41A 2OH0E 4XUFA 1FOTA 1XR1A 3R73A 3WF8A 4W9XA 1UU9A 4K0YA 4QTBA 4BYJA 4UALA 4F9AA 3QTRA 4MXYA 2XNEA 4ASXA 1BX6A 2NP8A 4D1SA 4XEYA 5E8VA 3A7FA 2X7GA 5HLWA 2A1AB 3KN5A 3MFRA 5D12A 3NW5A 3E63A 5CAQA 4DFBA 4YHTA 5AP0A 1W84A 2J9MA 3WZDA 4IZAA 4H3PA 2CNQA 2FA2A 4L00A 1ZLTA 2R9SA 5IU2A 1Q3WA 2VTQA 2W9FB 2YAAA 4RQKA 1NY3A 4MVFA 3GCVA 2OJ9A 4L7SA 2WGJA 2IZRA 3SAYA 1Z5MA 4MEDA 5AAEA 4O7RA 4QQJA 4GKIA 5FLFA 2F57A 3TTJA 4E3CA 4IMYA 2QOQA 3BYUA 1P4OA 4K2RA 4CFWA 2YEXA 5E8TA 4MK0A 3R0TA 1JKTA 3SXSA 3ZO2A 4DFYA 5I9ZA 2YJRA 2EU9A 3BU6A 3FQEA 4IFCA 3UVPA 4O7SA 3HZTA 3UMWA 3DBFA 4QMNA 2XNOA 4IWPA 1Q3DA 4Q5EA 1O9UA 2H8HA 5AUYA 2VV9A 4IVAA 3PJCA 2YACA 2XCKA 4ZSJA 3HL7A 3OBJA 3O7LD 2BZIB 4J95A 4R7HA 4HGSA 3VBQA 4CVAA 3SW7A 3TV7A 3LFEA 1B6CB 1IAJA 2X4ZA 4KBAA 1S9IA 1OPLA 2YWPA 3RK9A 4DG0E 3UNJA 3AC1A 1YXSA 4X2JA 4QP1A 1XJDA 3VN9A 4DGLC 4FC0A 4O7NA 5DR9A 4FNWA 3U6JA 5IA4A 5K4IA 2QVSE 1AGWA 5HQ0A 4XLVA 1Q8UA 4YJSA 4RX5A 5CEIA 2ITQA 1W0XC 3W2QA 3PP0A 4LGDA 3QAME 1SYKA 2W1DA 3TKHA 4DA5A 4GG5A 4NW5A 1IEPA 4U5JA 5CSWA 2WMTA 4ASEA 2HYYA 1KE7A 3L8XA 3QUDA 4GFOA 3FLSA 5L6PA 5LVLA 3LCTA 3UC3A 3IDCA 4CKJA 2Z7SA 2BDFA 4Z3VA 3N4TA 3R8LA 2Z7RA 5C4LA 2R3LA 2X8IA 3TN8A 4UN0C 3W2PA 4AW5A 2JKOA 4RFYA 3D14A 2J0IA 4EQUA 4IC7A 4Z16A 3MWUA 4MBIA 3UMXA 5I5ZA 2ZM1A 1XO2B 5F94A 4J96A 2Z7LA 2YM5A 3ELJA 4CLIA 2JDTA 4YBKA 5CQUA 3R7YA 4D2VA 3O7LB 3QLFA 1PKGA 4I20A 4IFGA 5HEZA 4E4MA 5CSPA 1U5QA 3S3IA 3WE8A 3C1XA 4AGWA 4H58A 3ANRA 2XNNA 1Y6AA 2Z2WA 5BVOA 5IH5A 2QOFA 3DTWA 3VQHA 3ORLA 1ZYJA 4QRCA 2PU8A 2G2IA 3CIKA 4BGHA 3NW6A 5J9LA 4NU1A 3BELA 4D2PA 3F5XA 5EI2A 4TYJA 3ULIA 1NVSA 3QFVA 1Q24A 4FKWA 3ZH8A 4AQCA 3EQDA 3GNIB 1Z9XA 3PJ8A 3PXYA 3QTZA 3DAJA 4AGDA 3UQFA 3E3PA 4OBOA 4JLCA 5TO8A 2ETRA 4GVAA 4Q5HA 3HGKA 5JK3A 5KMOA 3EQBA 3PRFA 4I6BA 5KBQA 3GEQA 4FT7A 3ACJA 2HW7A 3E8EA 4FKOA 1SNXA 4FTRA 3ZMMA 2ITOA 1M52A 2P0CA 2XUUA 3VQUA 3L1SA 5B2MA 2WMQA 5BUEA 2RFEA 4RIXA 1CMKE 4M8TA 3PVBA 4I4EA 3RGFA 3PIYA 3NVMB 2ZMCA 4FKTA 5HO7A 3TT0A 3PA4A 3FL4A 4A9UA 3GU4A 1QL6A 1RQQA 3AC4A 4YZ9A 2XMYA 1FVRA 4X2KA 2IVUA 4NYEA 3IGOA 3QXOA 2X8DA 5DI1A 3TV6A 4DEGA 3SQQA 4DFLA 3NUUA 3QQHA 4NZWB 4E73A 1ZYDA 4ZMEA 1FVVA 4CRLA 1H1PA 3LVPA 1CTPE 3Q96A 4MWIA 4LL5A 3G6GA 4S33A 2VO6A 3CSVA 5HG7A 3MBLA 5ANGA 3SKCA 3QTIA 5EYCA 2FSLX 3WI6A 2GS7A 2XM9A 3A4PA 3FMKA 3P7AA 3R00A 3DXPA 3NRMA 4FL1A 4IVBA 5CS6A 3DPKA 3CTJA 2VTPA 4JOAA 1KOAA 4XG4A 5BYYA 4C4FA 3R02A 4GMYA 2QOKA 4L45A 4D0XA 1BUHA 3OC1A 4FKUA 3WIGA 4CLJA 4EQCA 4PMPA 4FEUA 3E64A 5IEXA 5AUXA 4L53A 2PE2A 5AP4A 4WIHA 2WU7A 4RIYB 3FZSA 4FKJA 2PY3A 2GS6A 3LFFA 5CSVA 5AJQA 4I93A 2OZAB 3UBDA 3WBLA 3SGCA 3O96A 3QTSA 4HYSA 1Q5KA 3MFUA 4OTRA 5BVKA 2OJIA 3T9IA 2CN8A 4GCJA 5JGAA 3PWDA 3R8UA 3NIEA 5KUPA 2OIQA 1MRYA 3LXNA 4FT3A 4IB1A 3QRIA 5BVEA 4KS8A 2XIRA 3BE9A 3ZC5A 4U8ZA 4O84A 5D7VA 3ZTXA 2X9EA 1PXOA 3R1QA 5AMNA 3NUNA 3FI3A 4RSSA 5BVNA 2XRUA 5HNGA 3G51A 3T8OA 3LFDA 2X7FA 4M3QA 3DK3A 4C2VA 1DAWA 4MNFA 4E20A 2QLQA 3DDQA 5FDXA 2B9HA 1OMWA 5FG8A 4CMTA 5JFXA 2VTAA 2GHLA 1YWNA 3SHEA 4EH8A 4YO4A 1YDSE 2OF4A 1Q8YA 2RG6A 4GIIA 4M0YA 3C9WA 2YDJA 1LR4A 3MV5A 3Q53A 4FNZA 4RJ5A 4UMTA 5CEMA 3KMUA 5L6WL 3OOMA 4ANQA 4QP4A 4EOSA 3AT2A 4EJ7A 4U6RA 1ZXEA 5IQCA 3COKA 4DH5A 1WMKA 4BWKA 5K4JA 4FZ7A 4R8QA 2WO6A 4FKGA 4KB8A 4DH7A 3UC4A 4F08A 5IMXA 3M1SA 4CFUA 3GU5A 4NWMA 5E9EA 4AS0A 4BDFA 4EOIA 4KIPA 3KMMA 4FSZA 2G9XA 2BR1A 2XKEA 3O51A 4X21A 3CTHA 4E1ZA 3IKAA 4EWHA 4EKLA 5AV1A 3BPRA 1ZAOA 3MFSA 2V55A 4XG6A 3HAMA 5M4UA 4IB5A 1W7HA 3DU8A 3GI3A 2NNWB 4IAFA 2OIDA 4H36A 3OTVA 3QA0A 3BHVA 3ZEWA 4F99A 2PE0A 4A4OA 4BCGA 3R9HA 2Y4IB 3UVQA 3KF7A 1GZOA 4KBKA 3V6SA 4TXCA 5D10A 5L2WA 1XWSA 4U9AA 2QHMA 4C4JA 3R7UA 1G3NA 3MTLA 4MXOA 4AZSA 1U54A 2E9UA 1JSTA 1MUOA 4M12A 2PMIA 4QTAA 1PXMA 3VS4A 4HZSA 3P5KA 4XG2A 4EH3A 1ZMWA 4DBXA 1YWVA 2F7XE 3DB8A 3NUSA 4RX7A 5HICA 2WQEA 5B7VA 5J5TA 4IZ7A 4MQ1A 4ZJIA 5KHWA 4E93A 1H8FA 2WTWA 3TJDA 2YM8A 3S4QA 3R7EA 3HKOA 3A62A 3UO6A 4FYOA 5LMBA 5LCKA 4CTCA 2HWOA 2R64A 3VS5A 3AMBA 3E5AA 5JGBA 4F7LA 4DHFA 4QYHA 2JLDA 4L43A 4OBQA 2C30A 2XBAA 5LOHA 2V5QA 1MQBA 4XOYA 4G17A 5E90A 5CXZA 2RIOA 4MWHA 3T9TA 3TNWA 5LVOA 1FGKA 1R1WA 3QX4A 3TIZA 4UXQA 5FQDC 4ZY4A 4RBLA 3UOLA 2PMLX 3CR0A 4QT1A 4AX8A 4J1RA 2XH5A 2XNGA 2ZVAA 4YC6A 4B7TA 4S32A 2O2UA 5F4NA 4HPTE 4KKEA 4F7NA 1M17A 2XKFA 4LRJA 4WO5A 2W1GA 3W55A 2XNBA 4BDCA 4EK4A 3DK6A 1YDRE 4L6QA 3BQCA 3O71A 3BWJA 2VTJA 4G9RA 4IM2A 2XK7A 4NT4A 4ZY5A 2FO0A 3W1FA 4IXPA 4D55A 3R9DA 1U5RA 2HXQA 5HX8A 1M7QA 4XP3A 3C4EA 4QP7A 3VC4A 2W5BA 4S31A 3EFWA 4FODA 3RBWA 4BHZA 4ZK5A 4EZ7A 4YTFA 4R1VA 1J1CA 4II5A 3M42A 3NYOA 4ACMA 4BCOA 2EB3A 4RC3A 4O6LA 4FV1A 2XM8A 3VUTA 3FUPA 3PXZA 4J53A 4D28A 1MRUA 5F1ZA 4O0VA 3TDVA 3ZLWA 3VBYA 2QR8A 3QD3A 2YM4A 1JLUE 4IAAA 4BDBA 4BKYA 3EHAA 4GV1A 4HYIA 4X2GA 3WE4A 3GCUA 3RKBA 5L4QA 2YHVA 4LYNA 5AV2A 4XG3A 3F5UA 4RVTA 1M2QA 5M56A 4O7VA 1JKLA 4YR8A 4KUJA 1IA8A 3E7OA 3HA6A 4FR4A 4TY1A 1NW1A 4L42A 1YI6A 4XG9A 4YHJA 5KBRA 3R28A 1H1SA 3OWLA 4FTJA 2VD5A 4I6HA 5EDRA 3ZONA 4ZTMA 4QP6A 2CGXA 5DT3A 2PZRA 2J4ZA 4F6UA 4W9WA 4IZ5A 5JQ8A 2WD1A 2OXDA 1R0PA 3DZOA 3BEAA 3PE1A 4UY9A 5EYMA 2UW0A 3CXWA 4J52A 4BDGA 5ITAA 2CHLA 4EBWA 3DTCA 2XEZA 2WOUA 4I23A 1FGIA 4HGLA 4O7YA 3QKMA 1KWPA 5EDPA 3E3BX 2P2IA 4JBQA 4QD6A 1H27A 2X1NA 5LXMA 3EN6A 1CKIA 2GMXA 4QPMA 1J91A 3QTXA 3LPBA 4PMMA 5HU9A 3WZUA 5HO8A 3EYGA 4LOOA 3ETAA 3COMA 4JIAA 2I0YA 2VTHA 5K3YA 3H0ZA 3W33A 1T45A 3BYMA 4FV4A 3Q5ZA 5LMKA 2VNWA 3FMJA 3R22A 1DI9A 3ZRMA 4RC4A 2JFLA 4C8BA 4QPAA 2WMAA 2EXEA 2O3PA 3IECA 2QU5A 3ZXTA 3HRFA 4R5YA 3M11A 3F9NA 3FMEA 4XCUA 3UNZA 3ZEPA 3JVRA 4IM3A 3OOGA 4ARKA 3VS0A 4BBMA 3GOKA 2XNMA 2XIYA 4JVGA 4V0GA 2B9FA 2CMWA 2YM7A 3OCBA 5DEYA 2YIRA 2IVVA 4W4WA 4R1YA 5FTGA 1R3CA 1UVRA 3IGGA 3TI1A 3OROA 5HE3A 2J6MA 2NRYA 3A2CA 5AR8A 3TUDA 4RA4A 4XP0A 2R7IA 3V5PA 2GFSA 3EFLA 4BDKA 4DITA 1G8SA 3FYKX 4EOMA 2ITTA 4KRCA 4PNKA 5A4QA 4X2FA 3U9NA 5FBNC 4ZAUA 4V01A 5D11A 3C5UA 4FSWA 4XV3A 2C5VA 3BV3A 3I0OA 1KE6A 3QTUA 5I9UA 3R30A 3KY2A 4CCUA 3W18A 3MSSA 3GFWA 3AT3A 2WMWA 2XBJA 2RFDA 2C6IA 2UVZA 3CY3A 3EKKA 5B2LA 2XF0A 5JQ5A 3POZA 2F2CB 3EN7A 3HMMA 4HVDA 3LFAA 1H1RA 4FNYA 4C58A 4AZWA 2WAJA 2ESMA 2A2AA 3VHEA 3PVGA 4FZ6A 1NVRA 3QUEA 5IA1A 4CCBA 4U3ZA 1R39A 2QODA 1PYXA 4Z7HA 3H30A 3SG9A 2AUHA 4RWJA 3LM0A 4Q9SA 3UO5A 4GFMA 3IPHA 3KEXA 4KRDA 2AYPA 2J5EA 4YTIA 5AUZA 3BHYA 5KO1A 3C50A 3AD6A 3COHA 5AR2A 3U9CA 1WVWA 4ZOGA 3TL8A 3PZHA 1PXKA 4IQ6A 3VS6A 4QP2A 3B8QA 2J0MB 5ICPA 3QCYA 4TWNA 3PJ3A 3OXTA 2PZYA 4C35A 3F2RA 3KCFA 2GNJA 3Q60A 1YXUA 2JFMA 3FKLA 4NFNA 5ACBC 5M53A 4ZS4A 4DLJA 3DT1A 3NEWA 5HKMA 4FTOA 1JVPP 4G34A 3F88A 3N4UA 4R3RA 3QHRA 3QU0A 4KIOA 3SOAA 3TNQB 4E4LA 3Q32A 3BV2A 4LFIA 1H24A 3TIYA 4BVUA 1UU8A 2QOCA 4YMJA 2F2UA 4TKSA 3FLNC 5LQFA 3F7WA 3RM7A 3AQVA 3REPA 3P9JA 4BICA 3NSZA 5HCYA 4D2SA 4F9CA 3NYXA 4C61A 5CEOA 4O82A 4MTAA 3TJCA 4HPUE 4FIHA 2VTSA 1MP8A 3DNEA 3FEGA 3WARA 4IC8A 5AX3A 1UKHA 2C6MA 5BYLA 3EQHA 4APCA 3QD2B 4ZSLA 5FUTA 1K3AA 2BRMA 3HUCA 4V04A 4C7TA 3PPJA 4NIFB 3C4XA 2ZV7A 2X8EA 4GEOA 2VTLA 4BBEA 4JBVA 2Q0NA 4N6ZA 3O8PA 1Q62A 4QP8A 2VUWA 4UWBA 5DGZA 5KMLA 4RJ7A 3NW7A 3G9LX 3BGPA 5FEEA 2V22A 3D94A 3E88A 5TE0A 3UJGA 3O2MA 3PDTA 5GINE 1URWA 5CANA 3HV6A 3E8DA 5HVYA 5LMKC 3ZZEA 3RCDA 4EOOA 2JBOA 4JL9A 4U44A 3MA6A 3G6HA 5M4FA 4GJ3A 4AF3A 2XK9A 4D4SA 2X2LA 4FG9A 1G8AA 4BY9E 2J5FA 2XJ1A 2HK5A 5CI6A 4PUZA 2JIIA 2VWUA 3HV4A 2W1CA 4MAOA 4IAIA 4DCAA 2R3HA 4LGGA 2QOOA 4U45A 3EJ1A 2YLEA 2VTIA 4IM0A 4LMNA 4F9BA 4M69A 3SV0A 4E5AX 2CN5A 1RDQE 1KSWA 3DLSA 3FWQA 4WNPA 3VVHA 4BRXA 4HCVA 4K1BA 4F7JA 4DFZE 2BALA 2YIXA 3MN3A 3CGOA 4J8MA 3VBTA 1SM2A 3F2NA 3ZFXA 3FI4A 3QGYA 4JG8A 4FSUA 2WTKB 4GK3A 4FKLA 3LFQA 3D83A 4RVMA 2IZUA 2Z7QA 4HCUA 4WUAA 3ROYA 3VF9A 3UZRA 4EHEA 5HOAA 3V5LA 4NTTA 4WRSA 1PMUA 4EOJA 4FL2A 2ZV2A 3ODZX 4UZHA 5DH3A 3RP9A 3VS2A 5HCXA 2P3GX 4HOKA 4NKSA 1UA2A 1PY5A 4F63A 3U6IA 2PWLA 2XNPA 3ZO1A 3EN5A 3O50A 4H3BA 4OTQA 4YJQA 5J7HA 4BBFA 2HZ0A 4QMUA 4RRVA 4DGNA 4QTCA 2BDWA 5JZJA 3OS3A 3FXWA 3B2TA 4FKIA 2UZTA 4YJPA 4A9RA 2UZVA 5AA8A 2JDSA 3WILA 3U51A 3F66A 2JAMA 5HBHA 4DEHA 4LOPA 3UOJA 4RX9A 4UMPA 4G3EA 4LMUA 1H08A 2DYLA 2PUNA 2VO3A 2UVYA 2UW6A 2PK9A 3TM0A 1OIYA 5AUVA 4XH6A 2OXXA 3E87A 5BUIA 4Y72A 4L3LA 2BKKA 4I3ZA 4A9SA 2I7QA 2B55A 4V05A 1KV1A 3BCEA 3EZRA 5B2KA 4PL5A 3CS9A 3DBDA 5GZ8A 1OPKA 1GIIA 1TQMA 2Y8OA 3OEFX 4CFVA 2WTDA 4BZNA 1Y57A 2BRNA 3D9VA 2CDZA 2QR7A 2XJ2A 3EN4A 2C5YA 2GQGA 3L8VA 1Q8ZA 2IWIA 3I60A 3EWHA 4RIOA 3W2CA 3FLQA 3P79A 3HNGA 3PXRA 4GSBA 4A9TA 1BLXA 2RGPA 1X8BA 1A06A 4FKQA 2BUJA 4GUEA 2UZNA 4J99A 3BYVA 3HRBA 3I4BA 3COIA 4O1OA 3AGLA 2C69A 4U43A 2VGOA 4QMPA 5D41A 4EHZA 5EQPA 4FGRA 3MFTA 2OICA 4D2RA 4BTFA 3KRRA 3F3VA 2JAVA 3BQRA 1R78A 3C4CA 2ONLA 3E8CA 3EQPA 2VWWA 5IQIA 1YOLA 4BGQA 4GW8A 4UBAA 1ZOEA 4G5PA 4FT5A 4DTBA 3HV5A 4AFJA 3PA3A 3RAKA 1Q8WA 3P7CA 5F20A 4D0WA 3MH3A 3R01A 4QYGA 3ORIA 5EI6A 4EKKA 3PXQA 4BB4A 2CKEA 4BTMA 4KD1A 4DBNA 1PXPA 4L46A 5HX6A 1IA9A 4LG4A 4S2ZA 3PIZA 2X2KA 3SOCA 3NUAA 3R7VA 1B39A 3UODA 5HESA 2HWPA 3OXZA 1JQHA 4FIGA 3F3ZA 1TQPA 2X4FA 4WSQA 3DXQA 1UU3A 3FY2A 4GK4A 4G6NA 4R78A 2GHGA 1TQIA 3BGQA 2X6EA 3C7QA 4YJUA 5AP1A 4E8AA 5KKRB 2WTKC 2W05A 5EI8A 2PMNX 1CKPA 2VO0A 2ZOQA 4QMYA 3WZJA 1H01A 4UB7A 3FQHA 4WT6A 5HVKA 1W98A 2ZAZA 2BPMA 3Q52A 3ORKA 4FTLA 2XYNA 4E4NA 3PUPA 4L01A 3R1SA 3ZUVA 4XG8A 2OIBA 5C4KA 5M07A 3OMVA 4GYGA 4USDA 3DXNA 4FEXA 1UWJA 2JDRA 2YLFA 3UO4A 1A48A 1ZRZA 3EN9A 3E7VA 5FXSA 3ZYAA 4UEUA 5DVRA 3EOCA 3VNTA 5L3AA 4CG9A 3LCSA 2GHMA 4E7WA 3VF8A 3H9OA 3R21A 3JY0A 4LGHA 4WKQA 4FG7A 1WBTA 4EH6A 3S95A 4E4XA 3D5UA 4NK9A 5LWMA 1SMHA 2EUFB 4G3GA 3O8TA 4TZRA 4YC3A 1XH5A 2PVHA 3SXFA 3IQ7A 3DKCA 5E92A 4FMQA 4O7ZA 3GBZA 5ANDA 2ZM3A 3TZMA 3MIAA 3EKNA 3NX8A 4IWDA 5AV0A 4A9YA 2R3GA 4UMRA 3HP2A 2J50A 4Z55A 3ZM4A 2AC3A 4FTUA 5IUHA 4CZTA 4FL3A 3AOXA 2UZLA 4EEVA 3QC9A 2PVJA 4X7QA 4BDAA 4BCHA 2ZJWA 3QZIA 4IACA 2JDVA 4YNOA 3V04A 4AN2A 2Q83A 2H9VA 5HBEA 4B9DA 1OB3A 3PWYA 2X2MA 4D5HA 3QD0A 1YXXA 4NH1A 4MX9A 3W2SA 4FGBA 3PJ1A 4GL9A 3A99A 3I0QA 3QXPA 5GZ9A 2UUEA 4HCTA 1NA7A 2C3KA 3W2RA 2QOIA 5FTQA 3OY3A 1V0OA 3QZFA 2ITUA 4XRJA 3FE3A 4XG7A 3QRUA 4IEBA 4C59A 5HTCA 1GIJA 3C5IA 1TKIA 2OSCA 4Q9ZA 3I1AA 2R4BA 5IA5A 2BFYA 1OBGA 4DTAA 2E9VA 4ID7A 3ORXA 5TKDA 3ZO3A 3R1YA 3ENHA 5EG3A 3VW8A 4FSTA 1JNKA 5FM2A 3OZ6A 4BCNA 2W1IA 4B6LA 4OTWA 4CGAA 4CEGA 2W4JA 3TZ9A 2E9NA 2HELA 3DNDA 4S34A 2BIKB 2ITZA 4G6OA 4KIQA 3R7IA 4CFMA 4FUXA 3N4VA 4EK3A 5F95A 3II5A 3BBWA 1P2AA 4AT4A 2GTMA 4EONA 1QPJA 2IVTA 3Q6UA 4DFNA 4O6EA 4EBVA 1T46A 4L68A 4LI5A 2CGWA 2QO9A 4NJ3A
chains in the Genus database with same CATH superfamily
2FYSA 4JNWA 3Q4CA 3OCSA 4XJ0A 2XEYA 4XHKB 2VTNA 3AC8A 3LM5A 4YP8A 4AXCA 1EH4A 4NM0A 2C0IA 4IH8A 1ZYLA 5M08A 4F9WA 3L9LA 5C8MA 1ND4A 1P4FA 4I0SA 4FTKA 4JXFA 4LOQA 5IUIA 3D7TA 5A4TA 2NRUA 2YWVA 5H8BA 3L8PA 1KOBA 2QOBA 3PVWA 4GT4A 4BF2A 4EUUA 5DR2A 3W8QA 2ONLC 3ZBXA 4EHVA 4FRFA 4F1OA 4QMOA 3D4QA 2YA9A 4RIYA 2SRCA 4M68A 4FSMA 3PIXA 2AC5A 5BX0A 2OZAA 2OWBA 4EOQA 5KMMA 4I5MA 3KF4A 5FM3A 1FINA 3QCXA 4C3FA 4YJRA 3V5TA 5T68A 1XH7A 3WF7A 2JC6A 1VYWA 4FVRA 4RQVA 3LHJA 3NUPA 3DJ7A 2JITA 3FBVA 3OEZA 3FMHA 4O21A 4QMSA 5HGIA 3OT8A 5A14A 3LOKA 5JH6A 4X6RA 4C36A 2QC6A 3HA8A 5B0XA 4RG0A 3HX4A 4AA5A 4IX6A 2G15A 4CFNA 5EYDA 2PTKA 4EUTA 3LJ0A 3GC9A 3F7ZA 2IJMA 2C6LA 4DFUA 1PXNA 4AZTA 3F69A 3MA3A 4OUCA 3QRJA 2YIWA 3CY2A 3U55A 3K2LA 3CQWA 4G5JA 3HMNA 5CEPA 4ITHA 3D7TB 3LW0A 1YQJA 4C4HA 3EQGA 2C0TA 4ITJA 3ZM9A 2J7TA 1SZMA 3H4JA 3QYZA 5F9EA 2C6TA 1WFCA 5LMAA 5FWKK 4ANLA 2EB2A 4RX8A 4XBUA 2BRBA 4FTQA 4FIIA 2WFYA 1WBPA 4C3RA 4Y46A 4XV2A 4BFMA 2F7ZE 3MY0A 1YOJA 1FPUA 4O4EA 2BZHB 2OFVA 4IAKA 2BVAA 4MH7A 4CT1A 4MKCA 1UNHA 3A60A 4M14A 2YCFA 4M97A 4UV0A 4ZY6A 3RAIA 1H25A 3OWJA 1MQ4A 1CM8A 2WMBA 4DT8A 3UYSA 1ST0A 5CVGA 5CZHA 2H6DA 5AM7A 2VGPA 4BDIA 4DF3A 1WVYA 4PTEA 4YZBA 4XMOA 2ZB0A 3ALOA 3R9OA 2GS2A 4M84A 1XH4A 2VX0A 4DDGA 4O4FA 5CNOA 3A8WA 4BJJA 5HG8A 3NCZA 1YW2A 4TPTA 4KWPA 5HG9A 3R8MA 3SRVB 4BR3A 4I94A 3NUXA 5HNBA 1UV5A 4FEVA 4H3QA 5L2SA 4BWXA 1OL1A 2CKOA 4PWNA 4XX9A 4D1XA 4C4IA 1B38A 3QLGA 3L9PA 4DGOA 4AE6A 1YXVA 5AA9A 3UP2A 2C6DA 2HIWA 3JPVA 3RK7A 2X0GA 3MI9A 5TOZA 3FPQA 4FA2A 5AR5A 3ZC6A 3ZSIA 4ITIA 5L8KA 3ZSGA 3L9NA 5E8SA 2W4OA 4ZTSA 3LLTA 5EK7A 2C5XA 4YJTA 4IWOA 4YSJA 5BNJA 5IQGA 5C03A 4NKAA 4IAZA 1REJA 3HYHA 3DBEA 3DAKA 3ROCA 1I44A 2E9OA 4MQ2A 3HMIA 2FSOX 5ETFA 3UG2A 3ZUTA 2VWZA 2XP2A 3MESA 5H3QA 5AP5A 1CSNA 3QQUA 2VWBA 4FVQA 2C3IB 2PSQA 2VN9A 2Y7JA 3LQ8A 3QQJA 5C26A 4PDOA 1YWRA 2JDOA 5DNRA 4ALUA 5FXRA 3BL7A 5HIDA 3DKOA 4LUDA 3KXHA 4BJJB 2B7AA 4I5CA 3Q3BA 3U4WA 1BMKA 4Y85A 3PY0A 4L44A 4G3CA 4YURA 4B0GA 1U46A 2HAKA 1U4DA 2FSMX 2YAKA 4FV8A 5LARA 3DCVA 1O6LA 2WNTA 1K2PA 4P7EA 3P0MA 1ZARA 4ANOA 3CE3A 2B4SB 2R3KA 3AC2A 4FX3A 3RAHA 5GIPE 4EYMA 2B53A 1VYZA 4MXAA 5KHXA 1PRYA 3BLHA 2LAVA 3HMPA 3AMAA 5I4NA 3IW5A 4LV8A 1V0PA 4AA4A 1YRPA 4K9YA 3UIMA 5A6NA 2C47A 1QPDA 3DV3A 4M0ZA 4NCTA 4CXAA 2ZM4A 3MY1A 3DGKA 5M55A 4EH7A 2OLCA 4PP7A 5IQBA 2CJMA 2CNVA 2Z60A 3ATTA 5CAPA 5K9IA 1XH9A 3RPVA 4JQ7A 2GTNA 2ZV8A 4F09A 3PTGA 3IDBA 1ZMVA 4NSTA 4BCIA 4AXFA 4ANMA 4IWQA 4KABA 4D4VA 2WQBA 2DUVA 4QQTA 5IPJA 1OL7A 2JKKA 3UQCA 5IQFA 4RGJA 2HCKA 4K6ZA 2BKZA 1H26A 4CSVA 3MGYA 5EW9A 1GNGA 2QLUA 5EDQA 1YVJA 4DGMA 2KULA 4OTDA 4L3JA 4RJ3A 5KMNA 3R8PA 3R7GA 5AP7A 1BI7A 2VTRA 3MVJA 3THBA 5AV4A 4UYAA 2ZDUA 2OZOA 3BU3A 3Q9WA 2PUIA 4ALVA 1BL7A 1JBPE 3U6HA 2VWIA 5CWZA 5CXHA 4O86A 1TZDA 4JRVA 3FHIA 4JAIA 4E5BA 4OAUC 3QKKA 5HG5A 2V7OA 3BKBA 3QX2A 4FTTA 4ZZOA 4ZLOA 1ZWSA 2QU6A 5I0BA 1CKJA 4EZ5A 4LDTA 4KKHA 5CALA 2OK1A 4NM5A 4EYJA 1BKXA 2HY0A 2GCDA 4RJ8A 2X7OA 2PYWA 3A4OX 1VJYA 2A4LA 2X0PA 4U80A 4G1WA 5HHWA 4XRLA 1S9JA 3G33A 4OR5A 3LCKA 4Y83A 5FRIA 4EQMA 2IEWA 5K5NA 4CFFA 4YNEA 2J90A 5KMKA 3C13A 3FL5A 5EM7A 4IVCA 4TYHA 5CASA 4ZTQA 3LMHA 2VX1A 2XK8A 2DQ7X 1AQ1A 3FLZA 5J9ZA 2WZJA 3EQIA 1R0EA 2Z8CA 4JIKA 2Y4IC 1P5EA 4BKZA 2C3LA 3MTFA 2PVNA 2ITWA 4MCVA 4N4SA 2P2HA 3C0GA 4KSPA 3UNKA 2C68A 5C8KA 4FOCA 3NNXA 4S30A 4HVGA 5HIEA 4QMXA 4HGEA 1OZ1A 3QHWA 3R9RA 3FQSA 3GU8A 2X0QA 3SD0A 4QEBA 4BIEA 3GVUA 1APME 2GSFA 4TRLA 4NW6A 3SLSA 4B8LA 3AKLA 4OTHA 4IW0A 5AUUA 1YDTE 5IDPA 4G2FA 3RMFA 4QMWA 5I9WA 4D58A 4AFEA 1TVOA 3QQKA 4JJRA 5J8IA 5DWRA 5T6KA 3CJGA 2QKWB 2WIPA 5EHOA 3UP7A 2UZWE 3HMOA 4TWCA 5DPVA 4IVDA 3PG1A 4D5KA 3SA0A 2XYUA 5D7AA 2WMXA 3QA8A 4XP2A 5J95A 1DS5A 2WMVA 5CVHA 4HYUA 3PSCA 3UE4A 4GRBA 4J7BA 2HW6A 4TYHB 4BI2A 3VIDA 2OF2A 1OIUA 3GP0A 3OT3A 3VO3A 4HVSA 2BRHA 5AFVA 3FLYA 4DG3E 3O0GA 3F3UA 4MNEB 5IQAA 3KB7A 3Q2MA 5AAFA 4FYNA 4FV2A 1ZZ2A 4YTCA 5ANKA 3MB6A 4G3DA 3TEIA 4YGAA 4ONAA 2XKCA 2R3FA 3KFAA 4TNDA 1K9AA 2CGVA 3TNPC 4YZMA 1V0BA 3EB0A 1XBBA 2IO6A 1OI9A 2WMSA 3FMLA 3ZBFA 2R0UA 4AW0A 5CEQA 2YERA 4HGTA 5AIKA 3F5GA 4E5WA 4WBOA 4BCJA 3IOKA 3FZRA 4D4RA 3P4KA 4IJ9A 5JFVA 4NCTC 4P2KA 1FMKA 3I5ZA 3FHRA 1G5SA 5AP2A 4KINA 2BAKA 3K5VA 2UW7A 2XJ0A 4TWPA 2ZDTA 3FPMA 4DHZA 4O0YA 1F0QA 4A4XA 2YM6A 3MVLA 1FBNA 5DRBA 3ENMA 3LMIA 4ENXA 2WQOA 4ERKA 1OKZA 5D9HA 5AAGA 5JGDA 4ENYA 4I0RA 5DE2A 3IG7A 3BEGA 2UZBA 3TZ8A 1H0WA 2UZDA 1E1VA 5CQWA 5DYJA 4O0XA 3AMYA 3KULA 5IA3A 4ZJVA 5EFQA 4P5QA 2WXVA 2JKMA 5DFPA 4DE4A 2IVSA 2R3IA 3MH1A 4RPVA 3SDJA 3VBVA 4F9YA 5LVNA 4TL0A 4ORKA 3NNWA 4NJDA 5FDPA 1ATPE 4ZSAA 4WBBB 3C4ZA 3CD3A 2W1EA 4FV5A 3TKUA 2GQSA 2YIYA 3U54A 4AGCA 4CG8A 5IEYA 3S0OA 4X2NA 3QRKA 2CGUA 3I5NA 2W1HA 4ALWA 4CNHA 5A9UA 3GCPA 2I0EA 4C2WA 1PF8A 3AG9A 4FG8A 4IDVA 3IW4A 4NIFA 2CNUA 3VS1A 2YZLA 2Z02A 4QO9A 5DIAA 1UNLA 5IUGA 3JY9A 5HU3A 3NLBA 2I0HA 4R7IA 4DH3A 4TW9A 5IQHA 3QC4A 4FKPA 4F65A 1XQZA 2ITXA 2ETKA 3F6XA 4MUQA 4YLLA 4D9TA 4FTCA 3R8ZA 1KE9A 5HD4A 4PDSA 2VTTA 4PQNA 4G3FA 2WEIA 4XV1A 3PXFA 5CSXA 3V6RA 3QBNA 3H0YA 3R6XA 3CEKA 3EQCA 4PMSA 3ORNA 5DBXA 3ZS5A 2ITPA 3KULB 2JGZA 4A7CA 1OKWA 1J7UA 2IZSA 3HDMA 2I40A 4X3FB 1GOLA 4ANBA 4FTNA 4KIKB 5IKWA 4U3YA 3GB2A 1WCCA 2ERKA 3FI2A 5K0KA 3LCOA 1Q97A 4YSMA 4HW7A 3UZTA 2OFUA 2Q0BA 4HNIA 4QMZA 2BTSA 2R3QA 4LV5A 4DEDA 4Z7GA 5CAVA 4GU9A 3CKWA 3ET7A 3ID6C 2JD5A 3F3TA 2BCJA 3PVUA 1PJKA 2YCSA 4O96A 3CLYA 4DEBA 3D15A 4QMQA 5JT2A 5A3XA 3FYJX 1ZYCA 4YC8A 5ETIA 4HYHA 4YHFA 1UKIA 3MS9A 4U97A 4YPSA 4ZTHA 5CF5A 2R2PA 5H9BA 2OW3A 5KE0A 4ZIMA 4QYYA 5CLPA 4O0WA 1H1WA 3MDYA 4CMOA 4DINA 4NTSA 2QNJA 3IONA 2UZUE 4Y5HA 4DEAA 1IG1A 4B8MA 1WBVA 4GYIA 3N51A 5IISA 4I1ZA 2HZIA 5GHVA 5A4CA 4WD5A 4Y95A 4WNMA 3R8VA 4JDIA 3W8LA 4U40A 2J0LA 4RZWA 3KRWA 3LFCA 2QG5A 2G2HA 3BU5A 3F61A 5KZ0A 3A8XA 5GJGA 4PDYA 3ORZA 3HP5A 4ZTLA 2V0DA 1RW8A 2R5TA 3DFAA 1ZY4A 5ACKA 3UOKA 3DQXA 4FTMA 2LGCA 3FC1X 3OUKA 3UYTA 5AIRA 3JVSA 2IN6A 2WHBA 3LXKA 2QHNA 1VEBA 2WPAA 1UU7A 3V01A 1BL6A 3H3CA 3CPBA 2PVYA 4AE9A 3DAEA 3LJ1A 2RG5A 4YZDA 1JSUA 2HXLA 4A06A 3VUIA 5EW3A 3MVHA 2I1MA 2C6OA 4RZVA 4UMUA 4GJ2A 4U79A 3KXGA 2OXYA 1UWHA 3R71A 2W96B 5AWMA 3I6WA 5BYZA 3UGCA 3VBXA 3MVMA 3OCTA 4PPCA 4CZYB 3ZUUA 3A7IA 4LUEA 2VX3A 3OVVA 4FKVA 3RZBA 4JS8A 5IA2A 4UX9A 3OHTA 4Y73A 3R2BA 4I6FA 3RI1A 2X81A 3KK9A 3ANQA 1SNUA 3WZEA 2G01A 5HLNA 4IX5A 1W2CA 4I21A 2Y6MA 5CT7A 5EQYA 2C6EA 5DHJA 3LZBA 2W7XA 2ITNA 4F0FA 1JOWB 2W5AA 2YISA 1XMLA 4PL4A 4O38A 4ZSGA 4EHGA 4MBLA 4JBOA 3HV7A 1JAMA 1GIHA 3VRZA 4QTDA 1GZKA 4WG4A 4W4XA 3SC1A 1OIRA 4YJNA 1OGUA 1Y8YA 1M2PA 2IG7A 4EK8A 1LP4A 5HE2A 1WVXA 1WBSA 3V5JA 4R77A 4C4GA 4D4YA 4O83A 3TWJA 5JFSA 4JQ8A 4PL3A 5M4CA 3KU2A 3I81A 2B1PA 5HBJA 3NDMA 3PSDA 3PG3A 2OI4X 4XV9A 4O0SA 4Y5QA 4IZYA 5EQEA 4IADA 2C6KA 1XH8A 3GU7A 3GOPA 3QALE 4KKGA 2A27A 4PMTA 3ACKA 1NVQA 2EVAA 3MW1A 1REKA 3CJFA 5JEBA 1F3MC 3A7HA 3OWKA 5EW8A 3ALNA 5M57A 1XHAA 2X9FA 3KN6A 2OO8X 3V3VA 4DAWA 4ACHA 4UMQA 5TT7A 2G2FA 3ZXZA 3NAXA 3WYXA 4ZXTA 5A46A 3E8NA 1OPJA 3TNIA 3NPCA 4HZRA 4K8AA 2C1AA 4BGGA 4F6SA 2GNFA 4EH2A 1QPCA 5JKGA 2BHHA 1G8JA 4CQEA 5JSMA 5T3QA 1J7IA 5AADA 2NO3A 3P7BA 5M06A 2WMRA 3NYVA 2R3RA 3DY7A 4FKSA 5K0XA 1IR3A 3ORMA 4FV3A 2QOHA 2I6LA 3BLRA 4UWCA 4I24A 1AD5A 2XIXA 1PW2A 2HZ4A 3Q6WA 2WEVA 5AUWA 3Q9YA 1LPUA 5DR6A 4IE9A 3DJ5A 4I6QA 1YKRA 5FBOA 4AWIA 3FV8A 4M66A 2REIA 4TN6A 3DBCA 4EC8A 5BVWA 2XZSA 3FSFA 4WA9A 4FTIA 4BCQA 2JIVA 4FSYA 4F78A 5HIBA 1ZYSA 3VJNA 4FEWA 5HNIX 3GT8A 3W0QA 3ZRKA 1H07A 3D2IA 5I9VA 5J5SA 2C1BA 3NWWA 3QCQA 3QF9A 3KA0A 4BDDA 4ZTRA 1BI8A 2XCHA 4R3PA 4PPBA 3RK5A 3W10A 3ZLYA 4FT0A 3DLZA 4I6LA 4NFMA 2P4IA 2OJGA 2VO7A 5CSHA 4CZUA 4ASDA 4NL0A 3GCSA 1J1BA 3V8SA 4MF0A 2VZ6A 5FP5A 4ACDA 2ZFYA 3EZVA 3QRTA 3G15A 1V1KA 5M09A 4N0SA 3P08A 2YZAA 3UPXA 3D0EA 1H28A 5AV3A 2FSTX 2VWXA 3WF5A 4OT6A 3NIZA 3ZZWA 1IAHA 3A61A 2PUPA 5ANIA 2PMOX 1QPEA 2R3NA 3F82A 5GJDA 2PVLA 2WTJA 4GFGA 5IF1A 1WZYA 1U59A 1VZOA 3G5DA 3KXXA 4PX6A 2BFXA 2WQNA 4JDKA 5FP6A 4OAVB 1Y6BA 2YITA 5IQDA 4P4CA 4K77A 2PVMA 4EI4A 2Y9QA 4J97A 1ST4A 4K18A 1E1XA 4DLIA 4R7BA 4FSQA 2WB8A 5E91A 5IH4A 2GU8A 3E92A 5CU6A 1RE8A 5LCJA 5GZAA 1WAKA 1DAYA 3W32A 3MH0A 5A54A 2DS1A 2PVKA 2OJFE 3BHUA 3FLWA 5TF9A 2BDJA 5AEPA 4IB0A 5HZNA 4AP7A 2XK4A 3KMWA 1UNGA 4YJOA 4BHNA 2BZJA 5TR6A 2ITYA 5DT4A 2OKRA 4BI1A 3H9FA 3OY1A 3P1AA 2W99B 3I79A 3CPCA 3VAPA 3BYSA 1VR2A 4BYIA 4GK2A 2UW4A 4R6VA 5E8XA 4QOXA 4EL9A 3PJ2A 3HECA 2XANA 2H34A 3D5VA 4BDJA 5ETCA 4C57A 3ZFYA 5CAUA 3C51A 4L9IA 4YBJA 4PF4A 4F0GA 3PYYA 4O27B 4LM5A 3BHHA 3P78A 2HENA 3AKKA 4TNBA 4EH5A 2W4KA 4U7ZA 3FAAA 2Y4PA 4JX3A 3S00A 3MIYA 4MXXA 4F1TA 5JMSA 2EWAA 1LEZA 3HDNA 4WSYA 3GFEA 2QCSA 3F3WA 3KGAA 3GC8A 4YUQA 5E8UA 3VBWA 2YCQA 1OBDA 1Q4LA 3W0OA 4K11A 3NVKI 3WF9A 4Q2AA 3LMGA 3A7JA 2IW6A 5C9CA 5KKRC 2VRXA 2C4GA 3VUDA 2WMUA 2YIQA 4ZS0A 2DWBA 4BCFA 1GAGA 2FH9A 4GVJA 4MYGA 4EWQA 1LEWA 3D2KA 5AP3A 3WOWA 3IW6A 3C4FA 3W2OA 4DTKA 4ZP5A 4CYJA 2F9GA 2O63A 5BVDA 4K33A 3EYHA 3AC5A 4A07A 3CD8A 3RNYA 4ZJJA 4EH9A 4FIFA 4RLLA 3ZO4A 4I4FA 4EK5A 1IASA 4FICA 3RINA 2W06A 1OIQA 2J0JA 3ULZA 2F4JA 4ZSEA 3IW7A 4FV0A 3EQFA 3UIXA 3R7OA 3E93A 4DH8A 4EOLA 1L3RE 4GS6A 3NUYA 3RHKA 2WOTA 4XS2A 2RKUA 3DJ6A 2GNLA 3L8SA 3Q4UA 5E1EA 4BWPA 5J7BA 5KZIA 3TV4A 2UW8A 4QYEA 3JXWA 3MYGA 2WTVA 3NR9A 3KVWA 4FV7A 2OG8A 4E26A 3BIZA 2WELA 1ZOGA 2CLQA 4I5HA 2VWVA 2YN8A 3RHXA 4AW1A 3QGWA 4AU8A 2IW9A 5AX9A 4BDHA 3TDWA 4EOPA 4H1JA 5E8ZA 3GENA 3G0FA 3BGZA 4AN3A 1M2RA 4XNEA 4DGGA 4IIRA 5IH6A 3BE2A 4D1ZA 3CCNA 4GIHA 3SRVA 1YHVA 4BTJA 3S1HA 2R3OA 3FY0A 3MPMA 3ZDIA 4EORA 2PVRA 2GPHA 2P33A 1P14A 3OW4A 2X6DA 4RC2A 3ZDUA 4AZVA 3NGAA 2O64A 3TNHA 3CGFA 3RVGA 3BX5A 5E8WA 5AP6A 1OL2A 3BBTB 4J8NA 4RWKA 2BTRA 4G9CA 3B8RA 1WBNA 2XK6A 1H0VA 2J0KA 2VU3A 5G6VA 4QP3A 4EZ3A 3LIJA 4QMVA 4JMQA 2ZYBA 4DEIA 3FC2A 1XBCA 3L9MA 5KMIA 3JYAA 4APPA 1OITA 5JZNA 1GY3A 4DHJA 4L52A 4QMLA 3PY1A 4ACGA 4PTCA 5FGKA 3LFNA 3RNIA 4UZDA 5CX9A 4C02A 4AAAA 3GUBA 4M7IA 5A4LA 5BQ0A 4CKRA 4RMZA 4W4YA 5L8JA 2UW5A 4JDJA 3TTIA 3CQUA 3EMGA 4USEA 4AOTA 4WUNA 4RIXB 3DBQA 4TYEA 4C62A 3GGFA 4AOJA 5M4IA 4DEEA 3AD4A 5IDNA 5C01A 3MPAA 4F70A 3ITZA 2W17A 3ZSHA 4FBXA 4ZEGA 1XMMA 3KC3A 3LXPA 4O0TA 4DHIB 3RPOA 4C0TA 4CV8A 2WQMA 3PSBA 4P5ZA 1STCE 1JPAA 3FKNA 4CFXA 3IS5A 4AW2A 1YXTA 3NFGB 3FKOA 4RFZA 4AZEA 5LVPA 1YHWA 2PPQA 5LVMA 2CCHA 2PVFA 3IDPA 4JT3A 4HVHA 3UOHA 2W0JA 2RL5A 3QTQA 2CSNA 2RSVA 4IX3A 3W0RA 5FEQA 2V62A 4E6CA 5DLSA 3FI8A 3DK7A 4BZDA 5DOSA 3PPZA 5KX8A 2HZNA 2YJSA 3VJOA 2FGIA 3MH2A 3MPTA 1PKDA 4IBMA 4TT7A 3LJ2A 3V8TA 4G6LA 4BZOA 3QZGA 4W4VA 2CKPA 3EQRA 3AKJA 4BDEA 2IZTA 5AUTA 3O8UA 3Q2JA 4BCPA 4C3PA 3LAUA 3R63A 1L8TA 4OGRA 4GG7A 3FJQE 5E4HA 3D7ZA 3ATSA 2R0IA 3PLSA 5L2IA 1DI8A 1URCA 4Y8DA 5IEVA 3I7BA 4LQMA 3T3UA 4H39A 3I6UA 4AZFA 3DKFA 5M51A 5HVJA 3BHTA 4FI1A 4O7LA 3FZTA 2B0QA 4B99A 4NUSA 2VAGA 2VTOA 2CCIA 5J1VA 4IAYA 1A9UA 1Y8GA 4FZDB 5H8GA 3NAYA 2GDOA 4KA3A 2B9JA 1H4LA 1ZZLA 2IW8A 1WBWA 2YCRA 3PUFC 4QPSA 2BROA 2O5KA 3R2YA 4L7FA 3FZPA 2XKDA 3CQEA 1OECA 4GUBA 4NM3A 4UYNA 3ZLXA 5BUJA 5CF8A 2QI8A 5L8LA 4ZZNA 3NNVA 3DA6A 5CT0A 4DG2E 3BWFA 4JQEA 4ZZMA 3IOPA 3U87A 4EJNA 3H10A 4EC9A 2B54A 1H1QA 4GT5A 3LE6A 5H2UA 4IB3A 3VUHA 4ZLYA 3QD4A 4OBPA 2C5NA 5KNJA 3K3IA 3LXLA 4YTHA 3NMUF 2PUUA 3ORTA 3HRCA 4I0TA 3UQGA 5K5XA 4DCEA 3SW4A 4FF8A 3VUKA 3LFSA 2QO2A 4A4LA 1E9HA 1PYEA 3KKVA 1XH6A 3OF0A 4N70A 2H96A 4L3PA 1YI4A 3HAVA 2RFSA 3CTQA 3FMNA 3OTUA 5DRDA 4AXAA 3HUBA 4PY1A 4BC6A 3C4WA 4FV6A 1NXKA 4FV9A 1OVEA 3RWPA 4CRSA 3G0EA 3DOGA 4EOKA 4N57A 4I22A 4J98A 1RJBA 5EHYA 3LQ3A 5BMSA 3U4UA 5GIOE 3NS9A 4QQCA 2R3PA 4IANA 3PE2A 4AT3A 4ANSA 1U54B 4FEQA 4D2WA 4FIEA 3GC0A 1JKSA 3UIBA 2PE1A 5CY3A 1YI3A 1Z57A 4KAOA 4L67A 1W83A 4PRJA 2JBPA 4QNYA 3RJCA 4FE2A 3OXIA 3ZHPC 1FQ1B 2C3JA 4P90A 4JBPA 3JS2A 3LLAA 4I41A 1GJOA 5AM6A 4IDTA 2YFXA 1J3HA 2ETMA 3ZCLA 3UTOA 2BHEA 2CKQA 5GJFA 2FVDA 3OUNB 4MNEA 3GXLA 3P86A 4FJVA 3KRJA 4F4PA 3IW8A 4MF1A 4JR3A 3LFBA 5AR7A 3UG1A 3PZEA 4NEUA 4UWYA 4ANNA 5IMEA 3DB6A 2ACXA 3FSKA 3KRXA 3Q9ZA 4M67A 1FMOE 4I92A 4JI9A 3Q04A 4NM7A 2RFNA 5ANJA 3RPRA 2W5HA 4FOBA 3OFMA 4ZLZA 1PMNA 3EIDA 2R7BA 5LWNA 5HI2A 1OKVA 4F6WA 4LRMA 3EH9A 2VWYA 1PXIA 1Y91A 5DEWA 5E8YA 5FEDA 3SG8A 2OU7A 2C5OA 4AGUA 5HE0A 1M14A 3KREA 3FZOA 4U42A 4KNBA 3FXZA 3HEGA 5EOBA 2QO7A 4W8EA 2UV2A 4XLIA 4CYIA 1OKYA 3KQ7A 4FKRA 4KSQA 1Q99A 3RAWA 2QURA 1FVTA 3WF6A 3KXMA 3PRIA 4MD9E 5CI7A 2UZEA 4RVKA 3QKLA 5I9YA 1J7LA 1PHKA 1KE5A 3QQFA 4OTPA 2I0VA 5I3OA 2R3JA 1QCFA 2F7EE 4MBJA 5EKNA 3AGMA 5LJJA 5D1JA 4O0UA 5CYIA 2W1FA 2WTIA 5CAOA 2B9IA 4IHPA 5J87A 4O7TA 3TCPA 1JWHA 3R1NA 5CU2A 2YDKA 4CKIA 2XA4A 4WNOA 3RZFA 5DN3A 4BKJA 4AUAA 4BIBA 1GZNA 3JUHA 1KE8A 3D5XA 3HVCA 4JAJA 4O22A 4O4DA 3ZFMA 5CU0A 5J79A 3PFYA 1W82A 5EKOA 4YLKA 3AD5A 3OBGA 4FUYA 3BZ3A 4OTFA 1PXJA 4ZMFA 2YDIA 3OWPA 3MJ2A 3E62A 1JKKA 2WKMA 3TKIA 5H8EA 4GH2A 4I5PA 4JRNA 4OW8A 4PNIA 2BMCA 4QP9A 4D2TA 5HTIA 4TYGA 4RJ4A 2QG7A 4OTIA 5DA3A 2XALA 4WNKA 3VUGA 2VTMA 3DQWA 3GC7A 4GU6A 5CEKA 3SVVA 4HVIA 4MXCA 4LRKA 4O0RA 4BCKA 4FK3A 4H1MA 2OH4A 4F7SA 5JFWA 2PULA 3QCSA 2GNIA 4JX7A 3GCQA 1W2FA 4BTKA 3VRYA 2VNYA 4CTBA 2E9PA 4FIJA 3KRLA 4TTHB 1F5QA 3TUBA 2Y0AA 2QKRA 3EFJA 2QOLA 4PDPA 4CT2A 4O2PA 1JSVA 3QWJA 2F49A 3W0SA 3MY5A 3HV3A 4BN1A 3A7GA 4F1MA 4QYFA 4X3JA 3RPYA 3IK3A 4FSNA 3KXNA 4WOVA 4IJPA 1ZOHA 3OW3A 4X3FA 4RT7A 4CD0A 3HLLA 3WZKA 4JG6A 3GQLA 4KIKA 5KCVA 1IRKA 3TZ7A 3RALA 4KS7A 4G16A 4PV0A 2Y6OA 1XBAA 5A6OA 5JN2A 3DKGA 2HY81 5CU4A 4O91A 4H05A 1MRVA 4ERWA 2CPKE 4ACCA 2X39A 1HCKA 3MJ1A 4RIWA 1ERKA 1PXLA 3EL8A 2V7AA 3QUPA 4FSRA 4YLJA 4YZNA 2EXMA 4CV9A 1KUTA 3VWAA 1NT2A 3R04A 3FMMA 4RLKA 1Q8TA 2QD9A 1ZY5A 2W1ZA 4F64A 2XK3A 5EYKA 3OG7A 5EM6A 4V0GB 2UZOA 1GZ8A 2BZKB 2XIZA 2ZB1A 3KCKA 3Q9XA 3QZHA 4XBRA 2UW9A 4XYFA 3V5WA 5J9YA 3VONA 4MHAA 3C0IA