4EH5A

Human p38 map kinase in complex with np-f4 and rl87
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
351
structure length
329
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 329
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh5A01
2HOGA 2HZIA 1PMVA 2RSVA 1NA7A 2UZVA 5IQEA 4A07A 3DAKA 3OXTA 4A7CA 5IA2A 2BRNA 4RPVA 3B8RA 4FTMA 2ITVA 3A7JA 3LFEA 2V7OA 2XP2A 2BFXA 3DXNA 3M42A 1IG1A 4U81A 3LAUA 2X4FA 3SQQA 4LOPA 3KMWA 1QL6A 4XV2A 3TNQB 2WU6A 3ULIA 5CSHA 4FTTA 5KZ0A 3QYWA 4V0GA 3MBLA 3GCUA 3NYOA 5CASA 4APCA 4AZFA 4CKIA 2YWPA 1SVHA 3PJCA 5J87A 4BIEA 1MRUA 2PVHA 3CTHA 5KHWA 4ZZMA 4BZNA 1LEZA 1OKZA 3OW3A 4QMMA 5AV3A 5LCKA 5DEYA 3R1QA 4G34A 4DGGA 2C47A 5CEOA 2B4SB 3LLTA 3NAXA 4JIAA 1WVXA 5I9VA 4BFMA 3TKUA 3JPVA 4CYJA 4CT2A 4EBWA 5EI6A 3KKVA 4RJ3A 4FTJA 4NU1A 5AR2A 5ETCA 5DR9A 3OCSA 3CSVA 4KRDA 3O7LB 1OL5A 5C1QB 2QQ7A 1OMWA 1URWA 3I7BA 3OCTA 1ERKA 2ZV2A 3EZVA 4CMOA 4JJRA 4FGRA 4GSBA 4MQ2A 3FSFA 4CFFA 4L68A 4O7VA 4L3JA 2X7FA 3MB6A 3UP2A 2NPQA 2WQNA 2XNPA 2EB2A 4KINA 4DYMA 4PUZA 5A4CA 4E5AX 4DT8A 5CAUA 4I94A 5IH4A 3ZZEA 4P5ZA 4FKLA 3JVSA 4CFUA 4F09A 2OICA 4CFMA 3VUMA 4PWNA 4OUCA 3LCOA 2DQ7X 3IECA 4AGUA 5C27A 3FE3A 3SX9A 4C8BA 5KMKA 1YOMA 3EQCA 4MD8E 4ACCA 2PVMA 3NCZA 3VIDA 4FSRA 4ZTSA 4QPSA 1ZYCA 3DKOA 4NWMA 4FL1A 2C1BA 2EXEA 4RQVA 3I5NA 5AUUA 3R7GA 4BKZA 4LRJA 3FLNC 1JSTA 4KSQA 2R5TA 3R30A 5ITAA 1ZWSA 5AP6A 3PA5A 3KL8A 5DRDA 3VW6A 4YHFA 1FINA 3JY9A 3VUIA 4CG8A 3VAPA 3HA8A 2YM5A 4KS8A 2XJ2A 3DCVA 4GT4A 5FD2A 3GU7A 4QTBA 4ALVA 4ERWA 4ZSJA 1Y6AA 4Y72A 5C8MA 2OBJA 2Y4PA 3GC7A 3HMPA 4CV8A 2BRMA 2PZPA 4WG4A 3O8UA 1J3HA 4YO6A 4QP4A 2GMXA 4YJRA 5D10A 2C6DA 3N4TA 5E1SA 3SHEA 4O1PA 2QOBA 3IOKA 4PMPA 1Q8TA 4CLIA 2JBOA 2XNBA 2ZDUA 3LPBA 2IVUA 4IADA 4YJSA 2WELA 4U42A 1OUYA 4KIQA 3H0YA 4IB3A 4C62A 4UEUA 4NM0A 2GCDA 5AM7A 4DFZE 2PUUA 3BLHA 4DHFA 3QAME 3RPRA 4K9YA 3GNIB 4C34A 3R2BA 4GU6A 5E8XA 5TKDA 3HUBA 4K1BA 4ANSA 3QRKA 5CSWA 5GJGA 3RZBA 5D11A 4EL9A 3KULB 4FTRA 3GU6A 5ANEA 3ZEWA 5JRQA 3Q2JA 3VF9A 1U5RA 1KE6A 3FPQA 1ZY5A 3EKNA 2W96B 4FKJA 4ASEA 1OL1A 2UW7A 4NEUA 3MA6A 2NNWB 1YWVA 3RZFA 3GXLA 5HE2A 3QWJA 4BBFA 4O0YA 2JEDA 1TKIA 3RK9A 4EC9A 4O0VA 4M0ZA 3LCKA 3R8ZA 3CKWA 3HV3A 3NIZA 4EJNA 5IH6A 2YA9A 1XH8A 3UBDA 4E93A 1H1PA 3CEKA 4ORKA 3UDBA 4AZEA 3QX4A 3BGQA 4F08A 3E64A 2VV9A 1ZAOA 4X6QC 1ZOHA 3PY1A 2BCJA 4U40A 1V1KA 3TZ8A 5AAEA 3HVCA 3EHAA 5CALA 4DBXA 2OIBA 3ZMMA 4YUQA 3R9HA 2VUWA 3H9FA 3KRJA 4FSMA 2QG5A 3C9WA 3M2WA 2PY3A 3EFKA 1GZOA 4OBPA 2BRHA 2XK3A 1UU9A 3GCPA 2FH9A 2VAGA 4TTHB 3MV5A 5HNBA 3CJGA 5HHWA 1H4LA 5AUWA 3ZCLA 5L4QA 3HMIA 3EZRA 2WMXA 3FBVA 3GU4A 3LVPA 4QYHA 4YPSA 4DFXE 2FYSA 3CP9A 5AUXA 2QR7A 5BUEA 3PWYA 1J7LA 3LCTA 5EQYA 3FV8A 4D2SA 3IGOA 3UIBA 3HLLA 2XKCA 2XK9A 3NUSA 3OFMA 1G3NA 3TJDA 2VZ6A 4IVDA 4K33A 3PTGA 4C02A 3F6XA 4AZTA 3E3BX 4NUSA 4UMPA 2QOQA 4M69B 1AD5A 4YLKA 5HE3A 3RJCA 1XH4A 1URCA 2XVDA 2PMIA 3H4JA 3N4VA 2OK1A 1DS5A 3OC1A 2BTRA 3QUEA 4CEGA 4I92A 4RWKA 3ANQA 3QLFA 4RJ5A 5HG9A 4FSWA 3LQ3A 2OH0E 5JRSA 3ORKA 2XKFA 4P90A 1OKWA 2YIXA 2BRGA 5JGBA 5LVLA 4DFYA 5HO6A 4H3BA 4IAIA 4XJ0A 3LM5A 4M14A 3KB7A 3FMKA 2C5NA 2W9ZB 1Q8YA 1CKPA 2H96A 4WSQA 4I5PA 3E7OA 4HZSA 3DDQA 4IIRA 2UW9A 4K8AA 4RQKA 4ACGA 4CZUA 4ZTRA 4EHVA 1Q61A 5J5TA 4FGBA 3TNHA 2ITPA 3AT3A 3TNIA 3MH3A 4IH8A 2WQMA 3ZO3A 4JLCA 5ANKA 4XS2A 2JDOA 1H0WA 2PZRA 3NCGA 5BYZA 4TNDA 5TO8A 4BC6A 1H01A 2YIRA 3PUPA 3PXRA 4M67A 3HDNA 4UZHA 4AS0A 2PZYA 5KO1A 3F5PA 5FP5A 3FQEA 4KIKA 2Y4IB 2ZV8A 3VUKA 2X2LA 4WUNA 3WIGA 1Q62A 4EQMA 5CAVA 3R04A 1HCKA 1WCCA 3U54A 1OGUA 2P2IA 5JFXA 4C59A 4C4JA 4AA5A 4G6OA 3Q9XA 4WNPA 4FSYA 3QRJA 4PTEA 2ZV9A 4O91A 3C5IA 2IJMA 3RWPA 1KSWA 3HX4A 4KWPA 4DBNA 4EBVA 5EM6A 3D2IA 5EM8A 1JPAA 2QU5A 4HNFA 2CNQA 4NK9A 3UC3A 3CS9A 5D1JA 2QURA 3DQWA 3UOHA 3G0EA 5A4LA 3DXQA 4YPDA 3WIKA 3ZYAA 3DKFA 5D9HA 4AW2A 3Q96A 3ZC5A 5M06A 2RF9A 2UZWE 3HZTA 3KULA 3ODYX 4MF0A 1OITA 3GCQA 5HX8A 2WTKC 4C35A 2C3KA 2PMLX 3ZC6A 5HQ0A 3GP0A 4FTAA 5TR6A 1XO2B 2QO9A 3GVUA 4NTSA 4QMWA 3FQSA 3QF9A 2C1AA 5DOSA 2W5AA 4CFVA 3JR1A 1K3AA 2W1CA 1J1CA 2F7EE 4M8TA 4OT5A 5HO8A 1AQ1A 2OI4X 4LM5A 4PTGA 4DAWA 2W7XA 4JDKA 3DAJA 5CAPA 3IW7A 2I7QA 4I0TA 2WMTA 2E9NA 3OMVA 4QP6A 2VO3A 2OSCA 3W33A 3DY7A 4C3RA 5EW3A 5EKNA 2WD1A 4ANOA 1HOWA 3ALOA 3E88A 4RC2A 3ACKA 3UIUA 4PMTA 3BBWA 4CXAA 2YDJA 1OIQA 2W1IA 2VWIA 4FV2A 4QQTA 5DYJA 4DTAA 3A7IA 2GHGA 3ENHA 5E7RA 3RNIA 5DE2A 4JBQA 5C8NA 4LYNA 4IX5A 4CKRA 4IZ5A 5AR3A 4TY1A 4NFNA 4EH4A 3D2KA 5DI1A 3I0QA 2XJ0A 2OZAA 2XJ1A 5HCXA 4AE9A 1I09A 1JLUE 2UZNA 2VNWA 4OTQA 4OTPA 4PMMA 4RMZA 4X21A 4XV1A 4I3ZA 4MQ1A 4MTAA 4IMYA 4RX8A 3DT1A 4DE4A 3VULA 1VZOA 2GQGA 3KRWA 3QRUA 3ZOSA 5AADA 3S1HA 3L8SA 4I1ZA 1U4DA 3NUAA 1OBDA 4K11A 2QO2A 3ATTA 4QP1A 4YBKA 5ETFA 4D4SA 4M69A 2HELA 3R7EA 1NY3A 2OG8A 3EIDA 4IX6A 4QTEA 3GB2A 3FL4A 5HBHA 3QQKA 2BZKB 4KB8A 3C50A 5H9BA 4L3PA 1RJBA 3EQFA 3SA0A 4JXFA 4EZ5A 4JI9A 1YHWA 3EKKA 4JDHA 4R77A 2HZNA 4WSYA 3ZFMA 4WA9A 3V8WA 2RG6A 2CGXA 3MYGA 4CVAA 4EC8A 5HU3A 3TWJA 3BPRA 4Q9SA 3RMFA 2PSQA 3IONA 4JRVA 4O2PA 4F7NA 4E73A 1K2PA 2OKRA 4C37A 2O64A 1WBTA 2J0IA 4D28A 4E6QA 3G6GA 3PJ2A 4DEEA 3DU8A 2IVTA 3BWJA 3DFCB 4XP0A 3VRZA 4JR3A 5T6KA 2CKEA 5HOAA 5AAFA 4NKAA 4I0SA 2XEZA 4FZFB 3UMWA 3KVWA 4HYSA 4Z55A 3U55A 4QQJA 3BEAA 3QQGA 3U9NA 2X81A 3A60A 3V5JA 2R3IA 3CY3A 2YM7A 4TL0A 4QMSA 2WMWA 3U6IA 3LMHA 5AFVA 4NM5A 5BUJA 4WKQA 3HV5A 1PY5A 4LI5A 1UU8A 4F1TA 2EWAA 2XKDA 3MW1A 3RALA 5CU3A 4C0TA 4BTFA 4F9BA 3UQCA 4FL2A 2WNTA 5CF8A 5J9LA 2B9IA 1FVVA 3QD4A 3BX5A 1WBOA 3DAEA 1B39A 3GUBA 2C68A 4LOQA 3ZONA 4CG9A 3SD0A 3RAWA 3SOAA 2X6EA 1G8SA 4DF3A 4XLIA 4Y85A 3R00A 5M4CA 4NL0A 1JKKA 3KRXA 5CEQA 5CT0A 4NTTA 3KXXA 3GOPA 3OVVA 3PG1A 4I6FA 4L52A 1W0XC 4RSSA 4DG0E 3CD8A 4ANMA 5L6PA 3ZFYA 5CVHA 4R6VA 2YIYA 3FAAA 4L44A 4UWCA 2RFDA 5AX3A 1ZYLA 1MP8A 3K2LA 4MNEB 4YBJA 3VS4A 4YZBA 4F0GA 4FT3A 4IZYA 4MBIA 2FA2A 3VF8A 4D2VA 1TQIA 3R0TA 2QOIA 2G2IA 3DBDA 2QOFA 1SM2A 2J4ZA 4IX3A 2YN8A 4NM3A 2CMWA 3F3UA 3PWDA 4F99A 5LJJA 4QPAA 4I5CA 3L8VA 3DK7A 3AMAA 4I6QA 3RK5A 4AWIA 3PIYA 3RPVA 3UJGA 4Y46A 5GZ9A 4K18A 1LEWA 4HNIA 3MVMA 4APPA 3OUNB 5I9XA 2A19B 1FOTA 3LE6A 5AJQA 5E8SA 3L1SA 2GNGA 3THBA 3QX2A 4BCPA 2GHMA 2IZUA 2QKRA 2RFEA 3NWWA 2A27A 4EHGA 2JLDA 1Q8UA 3S2PA 1OIRA 2VX3A 3RP9A 1O6LA 3UNKA 4R3RA 1Y8GA 2XEYA 3L9MA 4FT9A 5K5NA 3JS2A 4HGTA 4CZTA 5IMEA 2QHMA 4EWQA 5EQEA 1XH7A 2ERKA 2F49A 5JN2A 4AZSA 4EK5A 2Z7SA 4C7TA 4IWOA 4CRSA 4B4LA 3P5KA 3PXQA 4X7QA 4CSVA 4L7SA 2V5QA 5CU6A 3R7YA 1YHVA 1GZ8A 3VUTA 4B99A 5EDPA 4II5A 4O7WA 4O1OA 4Y73A 1V0PA 5KNJA 3DBEA 3R1SA 5J79A 4GYGA 2BKKA 2X6DA 4Y5HA 2HY0A 4U44A 3FKOA 5HORA 2J7TA 4JS8A 4ZSGA 3E7VA 3NUYA 5A4EA 2AUHA 5EI2A 2PUPA 3EB0A 4BYJA 4E1ZA 1R0EA 3T8OA 1R3CA 3MJ1A 3MN3A 3POOA 5JMSA 2J5FA 3V8TA 4E6AA 2X1NA 2DYLA 5E8TA 4TYHA 1M52A 3RBWA 1WFCA 1X8BA 3GT8A 5F20A 1RDQE 4FKOA 3KF7A 3VBYA 2BPMA 4ITHA 1YI4A 3CPCA 3DS6A 2VRXA 4BGQA 1QPEA 4CZYB 3LIJA 3OD6X 3Q9ZA 4AACA 3NAYA 3BHTA 3KA0A 4X2FA 4FK3A 4XOYA 2O3PA 4L8MA 3HA6A 1JVPP 3I5ZA 3HNGA 4KBAA 2B1PA 3HGKA 3E5AA 4BF2A 4EH3A 3P7AA 5HI2A 2R7IA 1VYZA 3HRBA 5BVNA 3G5DA 1J1BA 4EK6A 1YI3A 1UKIA 4L67A 4EQUA 3O7LD 2YITA 3O23A 2Y4IC 3FZSA 3PSDA 2QOOA 3S4QA 3QXOA 3WF8A 4B6LA 3EJ1A 4IC8A 2REIA 4F6WA 1M7NA 3BBTB 4FIGA 4PDOA 4FVPA 4GKIA 1LP4A 4RC4A 2BALA 5FWKK 2HZ0A 3VN9A 3WYXA 2YHVA 4BWXA 2JKQA 2XRUA 4DGOA 3FYJX 3MH0A 5EDRA 3WF5A 3C0IA 5EHYA 1FPUA 2UZEA 4FKIA 4RX9A 4AN2A 4H36A 4IJPA 2X8IA 3VBTA 5GZ8A 3UOKA 2BIKB 5J5SA 1CKIA 1FGIA 3PJ8A 4EOIA 4KKEA 2QLQA 4AF3A 1T46A 4MXZA 2VN9A 3DLZA 2YZLA 1YW2A 3WILA 4BCKA 1U54A 2BROA 2OXYA 4X3FC 3TKHA 3VW8A 1V0OA 4FZ7A 3SDJA 4M84A 3IQ7A 1CDKA 4WBOA 3SXRA 4IZAA 4XG3A 4F65A 4MXAA 3Q9WA 4XBUA 3GU8A 3DGKA 4KUJA 4IVBA 3KXHA 4Y5QA 2VO6A 4A9UA 4BDHA 3Q04A 4RIWA 3KY2A 3CD3A 3MPMA 1QPDA 3UO6A 3GENA 4R5SA 2QKWB 3G6HA 3F88A 4OTGA 4KSPA 3FMJA 2X4ZA 3MWUA 3W32A 4IFCA 1CTPE 5BX0A 1OECA 3NEWA 4WUAA 4YJQA 5IQDA 2R3LA 2WTWA 4YTHA 3W2CA 4ENYA 4ZTNA 3PXYA 1ZYJA 3U4UA 2ZVAA 3IW4A 4PDSA 3ROYA 3U9CA 4DA5A 2OJIA 4R78A 2YM3A 4KIPA 1PXNA 1QMZA 1QCFA 3R2YA 5A6NA 3EFLA 4QO9A 1YI6A 2WTDA 2WMBA 3A8XA 3UMXA 1DI8A 3V5WA 2CGVA 4UYNA 3R9RA 2ITQA 3DTWA 5KMMA 1A48A 3UO5A 3HAVA 2ZM3A 4MYGA 4IAKA 2WMQA 1CSNA 1Q24A 3GOKA 1BYGA 4TWCA 4XRLA 5FM2A 3PZHA 2ETRA 4GFMA 3DB8A 4PPBA 1OL2A 2C6IA 4IJ9A 4DLIA 4F70A 4NH1A 2XS0A 5IUHA 4RC3A 5AP0A 3VWAA 4AUAA 1DAWA 2GS7A 4EUTA 3BKBA 3DOGA 3ZBFA 2ACXA 2HIWA 1W82A 3MPAA 4GVAA 4BHZA 2X8EA 3UVPA 5AV4A 5AX9A 3T9TA 2XK6A 3DBQA 4OGRA 4K6ZA 4C4IA 2NRYA 2WPAA 5G6VA 3UIXA 4WG5A 1H25A 2V22A 2OF2A 4BKJA 4D2RA 3W1FA 2KULA 2JDSA 4GG7A 5C9CA 1Q8WA 1BL6A 1PMNA 4FUXA 3DNEA 5A9UA 2PUIA 2CSNA 4CD0A 2QLUA 4GIHA 3CQEA 4RWJA 3WE8A 1YXXA 5FQDC 1H24A 4N70A 1OPKA 4MF1A 3P08A 1H1SA 5AIRA 3ELJA 2WTVA 4UBAA 2XBJA 3COKA 3QZHA 4K0YA 1AGWA 2ERZE 3B8QA 3VBXA 5JZNA 3V01A 4CNHA 2J0JA 1UU3A 3DB6A 4A4XA 3GCVA 2VTOA 2E9VA 4ARKA 4O7LA 1ATPE 4M66A 2WTKB 5D7VA 3VO3A 4DT9A 3OT3A 2R3KA 4FSZA 4I93A 4UY9A 4QD6A 4BDEA 4Z7HA 4WRSA 4L46A 4LGDA 5IEYA 3IDCA 3R71A 2G9XA 1PRYA 3ORPA 4UXQA 4M7IA 2BRBA 3COMA 4GFOA 4H05A 3EN9A 3A4OX 5CQUA 5HIDA 3TZ9A 3QCXA 5HICA 3F5UA 1R78A 5FP6A 2B9FA 3R73A 3AC4A 4RIYB 3MFTA 1GY3A 3ACJA 3R7UA 4AXAA 3R9NA 2W9FB 2BDJA 3NRMA 3LJ0A 5HLPA 3FKLA 4R7IA 3T9IA 3TKIA 4AN3A 5LVOA 2JKMA 2R9SA 4KKHA 2QOCA 4MXCA 4FG7A 5M4FA 3H9RA 5EHOA 3VBWA 4IZ7A 4RJ8A 4Y95A 5ICPA 2I1MA 3QTSA 3UNJA 3ID6C 4UB7A 2JKKA 4RG0A 3SGCA 3UP7A 2WMAA 3P9JA 4CYIA 5IEVA 2HENA 1J91A 3BYUA 3QQFA 4I22A 3HRFA 3GBZA 3QBNA 2WOTA 4MXYA 2V0DA 3UQFA 3RGFA 5FGKA 4H1MA 4PNIA 2Y0AA 3AC8A 5A4TA 2P3GX 4UXLA 3UOJA 3U4WA 3GQLA 2E9OA 1BLXA 4QP7A 4P5QA 2ITWA 4OBQA 3HYHA 2WTIA 4IB5A 4F6SA 3QTIA 4EKLA 5IH5A 2YCFA 3LJ1A 1SVGA 3Q4ZA 2HZ4A 2W5BA 4NCTC 4QTAA 4RZWA 1JOWB 4ITJA 3D7TA 4IACA 2C69A 3OXZA 4BWKA 4TYIA 1GOLA 3HP5A 1OPLA 4DEIA 4QRCA 4TT7A 3QHWA 4KS7A 3PXZA 1YKRA 3FUPA 3MH2A 4WBBB 4ZJIA 4C36A 3LFBA 4LQMA 4C58A 3ZHPC 3GU5A 5IISA 5JZJA 5LWMA 5IQGA 3D15A 2QHNA 1QPJA 3LFQA 2R64A 3ZUVA 4DH7A 3E92A 3G0FA 3ALNA 3NIEA 2PUNA 4YTCA 1NVSA 3OZ6A 5HIEA 3LMGA 3WOWA 2R3FA 4TYGA 5CEMA 3V04A 3LHJA 1GAGA 1SYKA 2JBPA 3DV3A 4E4NA 2GFSA 3BWFA 4C2VA 4BCOA 4F7SA 2HK5A 2GS6A 2XIXA 4USDA 3UODA 3CGOA 4A4LA 3AT2A 3IGGA 2UZOA 3EFWA 2WIPA 4GKHA 3R28A 3MY0A 4L53A 5AMNA 4E5WA 3U87A 5AEPA 2YEXA 5AV0A 4JBOA 4QYFA 5K0KA 5IPJA 4H3QA 3U51A 3AMBA 5IA4A 4I20A 4PTCA 1MUOA 4GV1A 3D5UA 5F95A 4UV0A 2GPHA 4AW5A 4IQ6A 1PXIA 3VRYA 5M4UA 4JNWA 4MH7A 2XIRA 1PXOA 2ZYBA 1KV2A 4GH2A 4JAJA 3VVHA 4BVUA 4E4LA 4EOMA 4H58A 5IQBA 4ZY6A 3AC5A 3FI8A 3KQ7A 4ZAUA 4WNKA 3SG9A 3R7OA 4ACHA 2BZHB 1H00A 2VX1A 3Q5IA 4J98A 2WQBA 4QMYA 1ZMWA 5EM5A 3QQJA 2W5HA 3DQXA 3ZEPA 5JKGA 3GFWA 2OXDA 2X0GA 4FTQA 1XBBA 1MQ4A 2VWYA 2YIWA 3PG3A 4JQ7A 4MK0A 2YABA 2KTYA 5AP5A 3L9PA 3COHA 5TT7A 3N9XA 3EQGA 3R01A 4FTLA 2ZMDA 4EOQA 2AC3A 5BVEA 3BGZA 2YISA 1YVJA 2H9VA 5AR5A 4W9XA 2BDFA 4B8LA 2PU8A 1W84A 5F94A 2WXVA 1UWJA 2PVRA 3CCNA 4Y8DA 3R1YA 4G17A 2YAKA 2ZM4A 3QLGA 4IM3A 4CTBA 2XK4A 1Z57A 4OW8A 2B52A 4BCGA 2VTSA 3G51A 4O0UA 5CNNA 5C4KA 2EVAA 3LCSA 4ALWA 5H3QA 4YSMA 4AP7A 3D7ZA 3KMUA 3RKBA 1SNUA 3PSCA 5D7AA 3SOCA 2ZB0A 2B55A 4O7NA 4FNWA 3WYYA 2A1AB 4DINA 4FR4A 5CX9A 3SVVA 4IWPA 2OLCA 3E8NA 4A9SA 1JWHA 3ZLXA 4U43A 4RIYA 4XMOA 4CTCA 4O38A 4AA0A 4LGHA 3ZLSA 3V3VA 5ANOA 2BVAA 1ZRZA 4FV8A 4QMOA 3QTZA 1GJOA 2ZJWA 3VS3A 2FGIA 2VU3A 3CGFA 4FNXA 3R8UA 2YFXA 4G9CA 5JGAA 2ITXA 4BIBA 1PHKA 2XCKA 3NX8A 3HEGA 3IOPA 4U3YA 2GTNA 4XH6A 5CU2A 3SRVB 4LRMA 2W1ZA 1UWHA 1KE5A 4FICA 5EYDA 2Q0NA 1PMUA 1TQMA 1KE7A 3S95A 4EH9A 3VS1A 2W17A 3FKNA 5M53A 3OW4A 3DBFA 3UTOA 4D0WA 4YZMA 2ONLA 4PL4A 5JFSA 1RQQA 2BILB 3PLAE 4I5MA 4BRXA 4JX3A 4S31A 1CKJA 4LL0A 4PX6A 3UZTA 3QTUA 2B0QA 5FTOA 4I6HA 3TUDA 3Q52A 4ERKA 5IG1A 3BLQA 3F82A 4XG4A 4BCJA 3W55A 3QKKA 2J51A 4FKUA 4ACDA 1YXUA 3V5PA 2C30A 4QOXA 3HV7A 4GS6A 5CF6A 2VWBA 3LCDA 1IASA 2FO0A 4G9RA 4EHEA 3C5UA 3TZMA 4YJUA 3EYHA 1F0QA 5DMZA 2ITYA 1LPUA 5BYLA 2P55A 5HVJA 3OT8A 3PDTA 2IO6A 4OT6A 5CAQA 5BVKA 4LOOA 3COIA 2W4OA 4WHZA 4UMQA 5K4IA 2PVLA 1VJYA 2G1TA 5DR6A 3UVRA 4I23A 4NKSA 5IQAA 3KN5A 4QPMA 2QNJA 5LOHA 1DM2A 2BHHA 2GQRA 2C3LA 4IVCA 3P4KA 4FV6A 5HNIX 5L8LA 3C0GA 2VTPA 3P23A 4MHAA 2C6TA 5LMAA 4GJ3A 5CI7A 3R7VA 3NPCA 4HGLA 2UVYA 3EL7A 4CQEA 4F9YA 2OJJA 4EZ7A 4GCJA 4AE6A 2UW3A 3I7CA 4JR7A 2OXXA 4A9RA 1LUFA 4FTOA 4JIKA 4XV9A 4CV9A 4L7FA 4QQ5A 3TUBA 3QRTA 4ZSLA 3FMHA 3QTWA 4FF8A 3UE4A 3KEXA 4FSQA 4X3FB 3R83A 4D9UA 2LGCA 4ZMEA 3D4QA 4RX5A 3C4FA 1Q3WA 4N0SA 5D41A 3VS7A 4AZWA 1WVWA 4GMYA 2F4JA 3DTCA 4F64A 4JG7A 2A2AA 4XBRA 4BB4A 2JIUA 2H6DA 4G3CA 4I5HA 3D5VA 5BMMA 4ZS0A 3RM6A 3DA6A 4R7BA 4B0GA 2FSOX 4FT7A 3R8PA 2J5EA 3QL8A 4DGNA 1OKVA 2WMVA 5CEKA 3TTIA 4D5KA 4U41A 2I0VA 3O17A 3LXKA 5CS6A 5CZIA 5E8UA 5ETAA 4PL5A 3K54A 3MVJA 5CENA 3TIZA 3ZLWA 4F4PA 5AUTA 3CKXA 3P0MA 4RJ6A 1XHAA 3PRIA 4YSJA 2CPKE 3H10A 3R6XA 5HCYA 4O0SA 1NXKA 4B9DA 4D2WA 4EEVA 4M97A 2FVDA 2W1FA 3OWJA 4O96A 1UA2A 1W7HA 2YAAA 3E63A 2H34A 3OWKA 3Q4UA 4TNBA 3FY0A 3ETAA 3ZXZA 2E2BA 5I0BA 4ENXA 4FC0A 5DR2A 5EYMA 4YJTA 4F9AA 2R3PA 1A9UA 3BZ3A 3P86A 4I4EA 2XNNA 3PPJA 3SXSA 5HZNA 5FBOA 4FEQA 4YNEA 3BU3A 5IKWA 3ORTA 3ZDUA 4BDGA 4DEHA 4AZVA 1SMHA 4FODA 5HD7A 3F7ZA 1IR3A 1FQ1B 1E1VA 2PE2A 4LGGA 4DH8A 4C3FA 3QYZA 4TWNA 4QYYA 4EOLA 3WF7A 4LV5A 2ITTA 2QVSE 4QP8A 3WF9A 3TDWA 3Q6WA 4F6UA 2JD5A 3BU6A 4ID7A 4YR8A 4JT3A 2C6LA 4MVFA 1U59A 4BBMA 5KBQA 4HGSA 1XR1A 4G16A 3FMNA 4NJ3A 5F1ZA 1UU7A 1YXSA 3K3IA 3V6RA 3AMYA 3DBCA 3RNYA 3FY2A 2VTNA 3FLWA 2W1DA 2GHLA 3R21A 4QMPA 4ZMFA 2O5KA 2VTJA 5IUGA 1UKHA 3KCKA 4IWQA 2C6OA 4XNEA 3G90X 2WMSA 3RI1A 4NW6A 4AFEA 5L6OA 3LLAA 3SC1A 5IQFA 1KE9A 4EH8A 1WBWA 5M07A 2YLEA 3QCYA 5HX6A 2VX0A 3KC3A 3FLSA 4ASDA 4W4WA 4BGHA 3ZRKA 4QMUA 3EQRA 4DC2A 2P0CA 3MFRA 5IQHA 2X7GA 5DNRA 4LUEA 5DGZA 2W1EA 2I0HA 2JDVA 2R3QA 2R3NA 2VNYA 3ZFXA 2YZAA 4U6RA 4DEAA 5BQ0A 4PDYA 4NIFB 5CT7A 4XV3A 1YWNA 2YWVA 1P5EA 2UW6A 3Q2MA 4C33A 1YDSE 4YZCA 5CQWA 3TXOA 5AR8A 4BR3A 4RIOA 4YC3A 5DHJA 5CSXA 1B6CB 5B0XA 3CIKA 1JAMA 4IFGA 2HWPA 4IC7A 4D4YA 1PKGA 2C5VA 3BYVA 2YERA 5EYCA 4AT4A 4DG3E 3ORZA 1PXMA 3CPBA 1VYWA 4ONAA 4EHZA 2X39A 3BCEA 4KNBA 1S9JA 1NVRA 2WIHA 4DH3A 3I6UA 2HCKA 3I1AA 2XCHA 4BCHA 2F7ZE 2HW7A 4B7TA 2QONA 3QQHA 4RIXB 3FJQE 3VQHA 3W16A 3F2NA 2CLQA 3RK7A 5KMJA 2AYPA 3BHHA 4HYUA 2ITNA 4L00A 3AD4A 4W8EA 4FZAB 2AC5A 3A8WA 4TYJA 3UPZA 2J0KA 3OBJA 3VUDA 4CFNA 3FMEA 3OCGA 5BYYA 3BI6A 5HG7A 3QQLA 3I79A 5GJDA 2WTCA 1JSVA 2R3RA 2C0IA 4FG8A 5IUIA 3RPOA 4X3FA 3OP5A 4KBCA 1A06A 5CF4A 5I9YA 1MQBA 4FIEA 4P7EA 5HNGA 1IEPA 3R8LA 3MVHA 4A9TA 2WMUA 3AXWA 4USFA 4AW0A 2YCRA 3CXWA 3B2WA 5DPVA 5AUVA 4MXXA 3CBLA 2W06A 3D5WA 3PPKA 4XOZA 3UGCA 4A06A 3TZ7A 3D14A 4FZ6A 4YZNA 1P2AA 3EQHA 3OOGA 4I4FA 4QMVA 2R3GA 4C57A 4FX3A 3BELA 3LZBA 2QI8A 4CFWA 2FSMX 2WQOA 4NSTA 5AV2A 5IA0A 2QU6A 1ZY4A 4UN0C 2VGPA 3TACA 2HWOA 4AG8A 4KRCA 5LQFA 5J8IA 5I9WA 4DH5A 2HW6A 1OVEA 2RIOA 1PXLA 3KGAA 3TDVA 3ZH8A 3TG1A 5I5ZA 4F7JA 4GU9A 5HCZA 4NW5A 4Q2AA 2X8DA 3LMIA 3PA3A 3LFCA 3RCJA 5C4LA 2QODA 4FIJA 4R8QA 3KN6A 4FOBA 4G1WA 3TI1A 4AOIA 1OL6A 3KFAA 1STCE 4FKWA 4NT4A 2PE1A 2GU8A 1YDRE 3C4ZA 4IANA 3TL8A 3S0OA 4YJOA 2X9FA 4O7SA 2BMCA 4U5JA 3I81A 1APME 4J71A 2J50A 2IW9A 4ZJVA 3FI3A 1Y57A 5JH6A 4M3QA 4DCEA 4Z7GA 3DZOA 3F3WA 3FYKX 3P78A 3QCSA 2PVJA 3EYGA 3PE2A 5CVGA 2CGWA 1PJKA 3NGAA 3TN8A 4ZTLA 5BVWA 3ZUTA 5AA9A 4XP3A 2ZMCA 3EQDA 3Q6UA 3FZ1A 3TV7A 2Y6OA 4U8ZA 5TOZA 2O63A 4O21A 1GNGA 1IA9A 2GNLA 2YDIA 2FSTX 1H07A 2PPQA 3G15A 1Q97A 4O81A 4BYIA 3LJ2A 4FV5A 2O8YA 4RX7A 3EN6A 3N4UA 1FVRA 1GZKA 3R1NA 4S30A 1IAJA 2B7AA 3NUXA 4UMTA 3K5VA 5DIAA 4BCMA 5M09A 3JXWA 3BRBA 5DBXA 4USEA 2JAVA 3PVBA 4YLJA 3KREA 4NYEA 2XM8A 3JY0A 1FVTA 4G3FA 2IVVA 4L6QA 5E8VA 4HPUE 4V05A 3EQIA 4FEWA 2C4GA 4Q5EA 1GIHA 5C26A 2C6EA 2GTMA 2W1GA 4GFGA 4UWBA 3VC4A 4IAYA 2CGUA 3RWQA 3EMGA 3PJ1A 1REJA 4EONA 5HLNA 2OJGA 2BAQA 4GVJA 5A6OA 3QALE 4OTFA 4BZDA 4C3PA 5HTBA 4EJ7A 3DZQA 3UVQA 5FXSA 3N51A 4QMZA 3QA0A 1TVOA 5DH3A 3QUDA 1L8TA 3NVKI 4ZZOA 3AD6A 3LKMA 5TF9A 4D5HA 3RINA 2JIVA 4ASZA 4U79A 1BX6A 2B9JA 2R7BA 5DT4A 5AV1A 5HG5A 2Z02A 2DWBA 3FLQA 1H1RA 3FC2A 1FBNA 3ZDIA 5KBRA 2RG5A 4F63A 2I6LA 3SXFA 4AU8A 1B38A 4D2PA 5GJFA 3MESA 1YWRA 2VWVA 4E20A 3ERKA 1OKYA 1WZYA 1I44A 4FMQA 4R3PA 5EHLA 4F1OA 5EK7A 3BGPA 4TWPA 4MNEA 4TYEA 4V0GB 4BHNA 1Y8YA 3A2CA 4UMRA 3PVWA 5K5XA 2NO3A 3TNWA 3VS6A 3UPXA 5CSPA 3SAYA 2CKOA 3OXIA 5CYIA 3IW5A 3RM7A 3O96A 4BL1A 4HOKA 1Y6BA 3NNXA 4EOPA 5I3RA 5E91A 2RGPA 2XZSA 5K4JA 5T68A 3EH9A 3MH1A 4CKJA 2ZDTA 3FL5A 3POZA 4C4FA 5HLWA 2CCIA 2W0JA 1PXKA 1XH6A 3HV6A 4FIIA 4IAZA 1NW1A 4WNOA 5KKRB 3V5LA 1W98A 3K3JA 3BV2A 5CZHA 1UNGA 4TN6A 1PMEA 5KE0A 3A7FA 5M56A 3U8WA 3O50A 2BDWA 2BKZA 2JGZA 3JYAA 2WQEA 3QKMA 3BE2A 4FT5A 4XP2A 4MNFA 4NCTA 1GIIA 3M11A 2BR1A 3Q32A 4YJPA 5LVMA 2XNEA 4ZSEA 4C61A 5M4IA 4M0YA 4RFMA 2PVNA 2OJFE 3GC8A 5LARA 3RPYA 4FT0A 4D0XA 4BDDA 4F9WA 3H0ZA 4FIHA 3L9LA 4G2FA 3CR0A 3VUHA 5E4HA 1W8CA 3HV4A 5AP4A 4DTKA 2JC6A 1ZMUA 3Q5ZA 5ETIA 3WI6A 4KA3A 3IW6A 4L45A 1WBVA 2R2PA 4IAAA 2C0OA 3NLBA 4FSTA 4HCUA 3CC6A 4AFJA 4LUDA 2VTLA 3BLRA 4UWYA 3ZS5A 3FHIA 2I40A 4AX8A 5A54A 1OZ1A 3C0HA 5KMIA 3E8EA 2F9GA 3BV3A 3UZPA 4O6LA 4P4CA 5LMBA 1OUKA 2R3HA 2XYUA 3NNWA 2Z60A 3DNDA 4O0TA 3DDPA 4N6YA 4GEOA 4X0MA 2C6MA 1MRYA 3ITZA 3FZTA 3PY0A 4BCFA 2UZTA 1E1XA 4RA4A 2UZUE 5J1WA 3KVXA 4EYJA 5CWZA 4EKKA 3EN4A 5HVKA 5FM3A 4TPTA 1Q41A 5LMKC 3BHYA 2VWZA 2UW4A 2XBAA 3DJ7A 5G1XA 2WB8A 2PYWA 3FEGA 4QQCA 5D12A 3ZSGA 1ZLTA 2GNHA 2NRUA 3DLSA 3AG9A 3PA4A 4EH6A 4HW7A 5KMLA 5HESA 3NW6A 3FMLA 4ITIA 4OAUC 3ZRMA 3F5XA 4HVIA 3BE9A 1OL7A 3A7GA 4G31A 4OTWA 4S2ZA 3SG8A 4KKGA 2XK8A 3PVGA 3PSBA 4IWDA 2R3MA 4E4MA 5AP7A 2JFMA 5I9ZA 1UNLA 4AGDA 2C3IB 2EUFB 4GL9A 4JDJA 3BQCA 4JVGA 5FXQA 1OBGA 4QTDA 2IPXA 1DI9A 2DS1A 4IHPA 1FMOE 4NJDA 5IU2A 4XG6A 1G5SA 3IS5A 4L43A 4H1JA 4R1VA 2IN6A 2BAJA 3W2OA 5M51A 4FVRA 4RZVA 4O7ZA 4DFUA 4BCQA 2XUUA 2J6MA 4JAIA 4ANLA 1QPCA 3FDNA 4EQCA 4ANQA 5DEWA 2XNOA 3AD5A 4H39A 4IVAA 4RRVA 1FGKA 3OS3A 1H27A 4KBKA 3VBQA 2ZM1A 3IDPA 3QD0A 2UVXA 4U97A 5AP3A 4P2KA 3NVMB 4DN5A 1H1WA 2XH5A 2C6KA 1M2RA 4FKTA 4GIIA 2Y9QA 3E8DA 2F2CB 4YO4A 2YDKA 3ORXA 3ZBXA 4ZTMA 3PXKA 4WT6A 4O27B 5JFWA 4EH7A 5L8JA 5HIBA 5KX8A 3LFAA 2EB3A 4CCBA 4DH1A 2WEIA 2R0IA 4N4SA 5E1EA 2PVFA 3HRCA 2ZOQA 4JG6A 4GRBA 2WMRA 1Q4LA 3R7IA 3S3IA 3ROCA 4F0IA 1PF8A 2PMOX 3QXPA 4U9AA 4S32A 4I24A 4PMSA 5FBNC 3D9VA 5AP2A 3IK3A 3QQUA 4FE2A 4FTIA 5BPYA 1BKXA 4HPTE 4QMTA 4OTHA 3FMDA 3C13A 5GIPE 2PTKA 4IAFA 4IBMA 4E7WA 3TNPC 3OF0A 3ZO2A 3MB7A 1YHSA 3ANRA 3P1AA 4ZLYA 3HMNA 3LQ8A 5IQCA 3TIYA 2R4BA 3AQVA 4F9CA 4OR5A 3O2MA 3D83A 4YU2A 1NT2A 4YP8A 5L2WA 5HVYA 3VUGA 3IW8A 2XRWA 3NYXA 4EUUA 2Z7RA 3DFAA 4PRJA 4CMUA 3AC1A 5J1VA 2E9UA 2W4KA 2W99B 4PP7A 3KRRA 5JK3A 3C4XA 4IX4A 4U45A 5ACBC 4FI1A 3HMMA 1EH4A 1YXVA 2H8HA 4BIDA 4QT1A 5CI6A 2Q0BA 4QYGA 1JQHA 3BIZA 3MVLA 2J90A 4EOSA 4FV7A 3K5UA 4EWHA 3CTJA 2XKEA 4D1ZA 4GT3A 3NUUA 3P7CA 4FKGA 3TJCA 4Z3VA 4ZP5A 2LAVA 3VS0A 4D58A 4H3PA 4PQNA 2XNMA 3EFJA 4ZZNA 4J8NA 1PYEA 5AUZA 3W2PA 1E9HA 3UC4A 1H8FA 2JDTA 2CHLA 4OBOA 2WU7A 5JQ5A 2YM6A 2J9MA 2XIKA 3PVUA 1KOAA 2C5OA 4BN1A 1Q99A 4KIKB 4Y83A 3DXPA 4ZS4A 4QNYA 4FYNA 2EXMA 4B8MA 4XHKB 4GK2A 4FEXA 4BZOA 3MY1A 4MWHA 4FTUA 2XK7A 3EN7A 1OB3A 3RHXA 2I0YA 4PPCA 3WF6A 3ZU7A 4DEDA 4DGMA 3FLZA 3VJOA 3RPSA 2VTTA 3HDMA 3OBGA 3UG1A 4PL3A 4RWIA 4Q9ZA 4JG8A 2ESMA 3GQIA 1KE8A 1XKKA 1HCLA 2ETMA 3BYSA 3NSZA 1YRPA 3NMUF 4U0IA 2XNGA 4C4GA 4D9TA 3OUKA 2GDOA 3MIAA 4E26A 3TM0A 5CXZA 4DCAA 4FZDB 3SW4A 3GFEA 4R7HA 4EZ3A 4UZDA 5IA1A 5LCJA 4XG7A 1PXPA 2UZDA 5KUPA 5GINE 4V01A 1H0VA 1ZYSA 4RVKA 3KXNA 3MGYA 5ANJA 4BKYA 2VWXA 4IE9A 1ZXEA 3QHRA 4W4VA 4C2WA 4PPAA 4QP3A 2HXLA 3OEZA 4YLLA 5IEXA 2GSFA 3FWQA 1KUTA 2IWIA 4C38A 4G3GA 2CN5A 2Q83A 4X3JA 5ANIA 4XCUA 2C0TA 4LL5A 4W4YA 2Z7QA 4BDKA 3UNZA 4FSNA 5DWRA 2ITOA 4YGAA 2V7AA 2ITZA 3ZSIA 3RHKA 1VR2A 5B2MA 3D94A 4XG2A 3LM0A 3RAIA 3MPTA 3Q9YA 3R9DA 3KF4A 4ASXA 2YM8A 3W10A 5HO7A 4S33A 3QD3A 3QA8A 1L3RE 3H3CA 2UZBA 1KV1A 3LOKA 2OZOA 5K9IA 4D55A 3O8TA 3DKCA 1KWPA 5IMXA 2PHKA 2PZ5A 2XIYA 3NW5A 4ZLZA 5BNJA 3PRFA 3ORMA 3DJ6A 1WBNA 2QOKA 2BUJA 4MAOA 3O71A 5JEBA 2Y7JA 4IEBA 1F3MC 4X2NA 2GNJA 3KRLA 2ZAZA 4G6LA 3UYTA 5BVDA 4WRGA 3W2SA 2F57A 3UQGA 1G8AA 5EH0A 4YNOA 3W18A 4ZIMA 2OZAB 5KKRC 1WMKA 3IPHA 4BDJA 2WHBA 5EW9A 1CM8A 3P7BA 5BVFA 3P79A 4EYMA 4FL3A 4ZEGA 3HMOA 5L2IA 3TUCA 4BTKA 5CLPA 3G33A 3NUPA 5HBJA 1Z5MA 3IDBA 1U5QA 2HY81 3DK3A 4E6CA 5M57A 2C5XA 4TZRA 1OI9A 3F9NA 4HYHA 5AIKA 5K0XA 3CQUA 4IB1A 2PMNX 1T45A 2XB7A 1PKDA 5KHXA 1M7QA 4X2GA 2JAMA 4E3CA 4HVDA 2QOHA 4BDCA 4FV3A 3MA3A 1JKTA 4OTIA 3O0GA 3NNUA 4LMUA 5KMNA 3C4WA 2BFYA 2RFSA 5AA8A 4XG8A 5IQIA 4I6BA 3C51A 3ZO1A 4CGAA 5ACKA 3NZ0A 2QO7A 4XEYA 5AWMA 4TW9A 4XX9A 3V51A 2UW8A 4RLLA 3F3ZA 4M13A 2OFUA 2ETKA 3VQUA 4PNKA 3GC9A 4RLKA 1JBPE 4K77A 2JITA 5FRIA 2YM4A 2R0UA 4CQGA 3ATSA 4HVHA 1U46A 5KMOA 1H28A 3FPMA 1OIUA 4FKSA 4FV0A 1YOJA 2IVSA 2QD9A 2BIYA 2EU9A 3FI4A 3F61A 3C4EA 2JIIA 4RT7A 5H8EA 5A4QA 5CU0A 3KXMA 3H9OA 3PZEA 4BDBA 4KAOA 1YDTE 3D5XA 3ORNA 3UIMA 2CKQA 3D0EA 3JUHA 4XRJA 1MRVA 3AC2A 4EI4A 2WZJA 4G3DA 3G9NA 3DPKA 1O6YA 5CSVA 3GI3A 2FSLX 4J96A 3BYOA 3OHTA 1XH9A 4TXCA 3ENMA 4EK4A 1IRKA 5CEIA 5J7BA 3LW0A 3UOLA 2A4LA 2VO7A 3LXPA 2OF4A 5FUTA 2OGVA 3FZPA 4AOJA 2YJSA 4OTRA 5JT2A 2XA4A 1PYXA 3MIYA 5FEDA 2PVKA 3NR9A 4BICA 1WBSA 3PFQA 4I21A 3OTUA 3E87A 4WIHA 2DUVA 3JVRA 4MBJA 3I0OA 1ZZ2A 3QZFA 4J97A 2X9EA 5FEEA 4X6RA 4J95A 1P14A 4IDVA 4E8AA 4O84A 4TWOA 4NM7A 1UV5A 2C5YA 5L2SA 4O86A 1M14A 3V5QA 2IW6A 4JBPA 5AP1A 5DLSA 5IZFA 4YHTA 2HYYA 4GT5A 3C1XA 1M17A 5F9EA 3RTPA 5FXRA 2Z2WA 4G5JA 4BCNA 5H2UA 4YJNA 3QU0A 2QCSA 4GJ2A 5DG5A 4A4OA 3BEGA 4YZDA 4PDPA 1W83A 2OU7A 5CANA 3ORIA 3R63A 4O7RA 3ZUUA 4GG5A 4RJ4A 4BDFA 5B2LA 4YC6A 1SZMA 3A61A 4W4XA 1P4FA 3NW7A 4RVTA 5L2TA 1JNKA 2O2UA 3S00A 1BMKA 4G5PA 3WARA 2C3JA 3Q53A 2BAKA 1RE8A 2XMYA 4V04A 3BYMA 5LVPA 4FKPA 2GFCA 4LG4A 4CFXA 1XQZA 4FK6A 3MTFA 4FTCA 4R1YA 3AT4A 3KU2A 2JFLA 5HE1A 5HG8A 1R39A 3UG2A 2RKUA 5B7VA 3UO4A 2VTHA 1H08A 3BHVA 1UVRA 3ZM9A 2WKMA 4S34A 5KCVA 5CEPA 1IA8A 1H1QA 3QGWA 4O0RA 2Y6MA 5L3AA 4FIFA 4LMNA 3KXZA 4GUBA 2PK9A 3KMMA 4QP2A 1NVQA 2F7XE 3SRVA 4AQCA 4F7LA 3A99A 3QZIA 5HU9A 1K9AA 4U80A 3L8XA 5E8ZA 5BVOA 1BI7A 2YJRA 3LFDA 3WZUA 4DEGA 4OLIA 2GQSA 4DFBA 3REPA 4QNAA 4KIOA 2WGJA 3QD2B 4ALUA 3EOCA 3E8CA 5FEQA 5EG3A 4DG2E 5EQPA 3GEQA 3OROA 5JGDA 4MX9A 3LFFA 4AT3A 3SV0A 1R1WA 4WO5A 3MFUA 3Q60A 5DFPA 5DVRA 3PJ3A 3HP2A 3WZDA 2OH4A 3QTXA 2B9HA 2ONLC 3CY2A 1FMKA 2OFVA 3ULZA 3ZM4A 5AR7A 3U6JA 2G15A 3MDYA 2R3JA 4FKVA 3QRIA 4FTNA 2XM9A 3V5TA 3EWHA 1BUHA 2V62A 1TQPA 4RWLA 4TYHB 2YCSA 4BY9E 3II5A 2JKOA 3RAHA 2UW5A 4QP9A 4BI2A 4W9WA 5HE0A 4EOJA 1YXTA 4FVQA 5F4NA 4QMQA 1ZYDA 4ZTHA 2IW8A 5ANGA 1YOLA 3F69A 4D1XA 5FDPA 3E3PA 1Q5KA 5LXMA 3DJ5A 4PP9A 3W2RA 4D1SA 1XJDA 4E5BA 4EK3A 3QTQA 4DLJA 4I0RA 3PLSA 5J9YA 5EYKA 3LXLA 3RAKA 3OOMA 3GCSA 4J52A 4NFMA 2WOUA 3IG7A 3ZSHA 4OAVB 3QWKA 4TRLA 4FA2A 2GNIA 3QFVA 3W8LA 4ACMA 4Z9LA 3T3VA 3R9OA 4HJOA 4JQEA 5IF1A 4AW1A 4UYAA 3CTQA 2PE0A 3ZZWA 4BWPA 4MEDA 5LVNA 2XIZA 5EI8A 1XBCA 1Y91A 2IZSA 5TE0A 1M2QA 1V0BA 4R3CA 5GHVA 4BGGA 5A46A 5E9EA 3VBVA 4DTBA 3AC3A 4D4VA 4EOKA 3FQHA 3BQRA 3CLYA 4FNYA 4ANNA 1VEBA 2X2KA 3F2AA 5EOLA 1XBAA 4FV4A 5M08A 5A14A 4M68A 5EKOA 3VS5A 3KK8A 4DFNA 4EORA 4MD7E 4EOOA 2X2MA 5E8WA 3PP1A 4AOTA 2YIQA 2VTRA 4M12A 4HZRA 2OJ9A 3EQPA 2Z8CA 4ZJJA 3MY5A 4WOVA 1U54B 4U3ZA 2O0UA 4N57A 1XH5A 2WO6A 1ZOEA 3W2QA 3A62A 3AGLA 4G3EA 5CTPA 3WBLA 3SLSA 3E93A 4BCIA 3HL7A 1BL7A 4YURA 4RJ7A 3VHKA 5M44A 4O22A 4FTKA 2CLXA 2JDRA 4RIWB 3SKCA 4ZY5A 4FV9A 3HKOA 3QCQA 4YJVA 5M55A 2G01A 4ZK5A 4DITA 4WD5A 5T3QA 3AOXA 3OY3A 1OPJA 1S9IA 4NZWB 4QYEA 5CU4A 5JQ8A 1PXJA 5J9ZA 3O8PA 5E92A 2Y8OA 4PV0A 2RFNA 4YHJA 5H8GA 2ZB1A 2R3OA 3HUCA 4IDTA 3IO7A 4O0WA 3F66A 1J7UA 3E62A 2W1HA 1LR4A 1ZMVA 3OY1A 4FKRA 2IZTA 3ZTXA 3KCFA 3FHRA 3FI2A 1R0PA 4IM2A 5FTQA 4HCVA 5ANDA 2X7OA 4MXOA 3MFSA 4IXPA 4J1RA 2G2FA 1H26A 4N6ZA 4CLJA 3RVGA 4MKCA 2V55A 3NUNA 3M1SA 3QC9A 5I3OA 3BHUA 2VWWA 3Q4CA 3TCPA 3ZO4A 3OWPA 4FKQA 5DA3A 3WZEA 2PL0A 3PIZA 4JOAA 2W05A 1OIYA 1YQJA 4O6EA 4XUFA 1ZARA 2OO8X 3I6WA 4Q5HA 1RW8A 4QMLA 3R02A 4O2ZA 4MWIA 3PYYA 4GK4A 5FTGA 3MJ2A 4FEVA 3EN5A 3OTVA 4JDIA 2VD5A 4ZSAA 1GZNA 4QMXA 3OWLA 2VO0A 2CDZA 3QGYA 1F5QA 1SVEA 2HXQA 3VJNA 2UZLA 3C4CA 3FMMA 4GUEA 2G2HA 2W4JA 4JX7A 5AAGA 3LQ5A 5BMSA 2CKPA 2CJMA 4RFYA 3FSKA 1WAKA 4ZLOA 2CNVA 3NYVA 4EH2A 1BI8A 2CN8A 3FLYA 5A3XA 2Z7LA 5LMKA 3F2RA 4AA4A 3F3VA 4O83A 4FSUA 4A9YA 4C4HA 4FNZA 4FYOA 3ZXTA 5AR4A 2E9PA 3QC4A 1JSUA 4HYIA 3OG7A 2BHEA 4YTIA 5CY3A 4ANBA 4RFZA 2BZJA 3WZKA 3CJFA 2YLFA 2FB8A 3UYSA 3G9LX 4NIFA 4EK8A 5C8KA 1OM1A 5L6WL 3PPZA 3C7QA 5I9UA 3R8MA 3EQBA 4X2KA 5C01A 4D4RA 4DFLA 5GIOE 2SRCA 3HAMA 5EM7A 2FUMA 4KABA 4YZ9A 4AGWA 2OWBA 3O51A 4IB0A 4ZOGA 1Q8ZA 4BTMA 3GGFA 3KXGA 3GC0A 4ZXTA 5DRBA 1Z9XA 3PXFA 4U7ZA 4XLVA 2ITUA 1REKA 1JKLA 1UNHA 5CVFA 4ZTQA 5HEZA 3H30A 3V6SA 4UX9A 3VNTA 3MTLA 3QTRA 1O9UA 2HAKA 1XWSA 2J0LA 2VWUA 3MSSA 5DT0A 2J0MB 4RIXA 5B2KA 3WZJA 4AN9A 4FEUA 3OEFX 3TT0A 3FZRA 3L9NA 4GYIA 5CXHA 2B53A 2PWLA 2B54A 4L3LA 5HKMA 4DGLC 5HD4A 3CQWA 5L8KA 3FXWA 4MBLA 4IM0A 3AGMA 3DKGA 3FC1X 4K2RA 4IW0A 4J7BA 2QOLA 3Q4TA 2P4IA 2RL5A 5GNKA 5BUIA 1ND4A 1SNXA 2UVZA 2WEVA 3FZOA 4L9IA 5E8YA 4HGEA 2A0CX 3VS2A 3I4BA 2PULA 1DAYA 1KOBA 2I0EA 1CMKE 3I60A 5FLFA 2CNUA 4MD9E 1Q3DA 3Q3BA 4HVGA 4BI1A 4BDAA 2F2UA 2GS2A 4FBXA 3MS9A 4O82A 3FXXA 4F0FA 3F7WA 4TKSA 3R22A 5HTCA 3QZGA 3R8VA 4YC8A 2QR8A 2BZIB 4JQ8A 4JL9A 3B2TA 3LFSA 1JKSA 4XG9A 2XF0A 5IDNA 3KK9A 3QUPA 3SW7A 2J2IB 4KD1A 4HVSA 5CNOA 5IA5A 2VTQA 5J95A 3TV6A 4J99A 5CF5A 4LRKA 2YCQA 4FG9A 3ODZX 4C4EA 3ZRLA 4L01A 4JRNA 4MCVA 5C03A 5JSMA 4D2TA 1O6KA 4CMTA 3F3TA 4RBLA 4G6NA 3NYNA 4CRLA 1WBPA 2P33A 3D7TB 5CAOA 5GZAA 1IAHA 3NDMA 5FDXA 3MI9A 2VTIA 4FOCA 3LFNA 3LXNA 5H8BA 5I4NA 4GW8A 3BU5A 4BTJA 1ZOGA 4AAAA 5L2QA 3VHEA 2NP8A 4I41A 2WFYA 3WE4A 2P2HA 2VGOA 4E4XA 4RGJA 3T3UA 4WNMA 3QKLA 3PP0A 2VTMA 2PZIA 4BDIA 2O65A 2UW0A 3HECA 4BI0A 2CCHA 5EOBA 4UMUA 5IA3A 5EDQA 4O7TA 4CCUA 3PIXA 4BBEA 5J7HA 4OTDA 4J8MA 3ET7A 1PW2A 4FUYA 4UALA 2UUEA 4LFIA 5HGIA 3CE3A 1WVYA 4AT5A 4YMJA 2WAJA 4Z16A 4WG3A 4FV1A 1P4OA 4EH5A 3A4PA 4PY1A 3U6HA 3RCDA 4GK3A 2QC6A 4R5YA 2WTJA 4LV8A 4PF4A 4RVMA 4YTFA 3UZRA 3NS9A 2ZV7A 4F1MA 4RA5A 4HCTA 3NNVA 2XYNA 2IZRA 5AM6A 3FXZA 4RVLA 4DEBA 1GIJA 5JFVA 4JBVA 4O7YA 3PE1A 1J7IA 4W8DA 3A7HA 4QMNA 5DT3A 2BTSA 4E6DA 1M2PA 2GNFA 2UV2A 2VTAA 4XYFA 4AGCA 4J53A 4QTCA 3L8PA 3PY3A 2OIDA 3W8QA 2YACA 2OW3A 3EL8A 3IKAA 2PVYA 5DN3A 5KZIA 3ZLYA 5HTIA 2QG7A 3F5GA 3G2FA 2EXCX 5K3YA 5FG8A 3ORLA 3OCBA 5LWNA 5HBEA 4CT1A 3V8SA 3TV4A 3DK6A 5EW8A 5AUYA 4ZY4A 5E90A 1ZZLA 4M15A 4O0XA 4X2JA 4L42A 3TEIA 2IG7A 2OIQA 5IDPA 5EFQA 3TTJA
chains in the Genus database with same CATH superfamily
2HOGA 2HZIA 3BLAA 1PMVA 2RSVA 1NA7A 2UZVA 5IQEA 4A07A 3DAKA 3OXTA 4A7CA 5IA2A 2BRNA 4RPVA 3B8RA 4FTMA 2ITVA 3A7JA 3LFEA 2V7OA 2XP2A 2BFXA 3DXNA 3M42A 1IG1A 4U81A 3LAUA 2X4FA 3SQQA 4LOPA 3KMWA 1QL6A 4XV2A 3TNQB 2WU6A 3ULIA 5CSHA 4FTTA 5KZ0A 3QYWA 4V0GA 3MBLA 3GCUA 3NYOA 5CASA 4APCA 4AZFA 4CKIA 2YWPA 1SVHA 3PJCA 5J87A 4BIEA 1MRUA 2PVHA 3CTHA 5KHWA 4ZZMA 4BZNA 1LEZA 1OKZA 3OW3A 4QMMA 5AV3A 5LCKA 5DEYA 3R1QA 4G34A 4DGGA 2C47A 3W0PA 5CEOA 2B4SB 3LLTA 3NAXA 4JIAA 1WVXA 5I9VA 4BFMA 3TKUA 3JPVA 4CYJA 4CT2A 4EBWA 5EI6A 3KKVA 4RJ3A 4FTJA 4NU1A 5AR2A 3BL7A 5ETCA 5DR9A 1W2DA 3OCSA 3CSVA 4KRDA 3O7LB 1OL5A 5C1QB 2QQ7A 1OMWA 1URWA 3I7BA 3OCTA 1ERKA 2ZV2A 3EZVA 4CMOA 4JJRA 4FGRA 4GSBA 4MQ2A 3FSFA 4CFFA 4L68A 4AXEA 1ST4A 4L3JA 4O7VA 2X7FA 3MB6A 3UP2A 2NPQA 2WQNA 2IF8A 2XNPA 2EB2A 4KINA 4DYMA 4PUZA 5A4CA 4E5AX 4DT8A 5CAUA 4I94A 5IH4A 3ZZEA 4P5ZA 4FKLA 3JVSA 4CFUA 4F09A 2OICA 4CFMA 3VUMA 4PWNA 4OUCA 3LCOA 2DQ7X 3IECA 4AGUA 5C27A 3FE3A 3SX9A 4C8BA 5KMKA 1YOMA 3EQCA 4MD8E 4ACCA 2PVMA 3NCZA 3VIDA 4FSRA 4ZTSA 4QPSA 1ZYCA 3DKOA 4NWMA 4FL1A 2C1BA 2EXEA 4RQVA 3I5NA 5AUUA 3R7GA 4BKZA 4LRJA 3FLNC 1JSTA 4KSQA 2R5TA 1W2CA 3R30A 5ITAA 1ZWSA 5AP6A 3PA5A 3KL8A 5DRDA 3VW6A 4YHFA 1FINA 3JY9A 3VUIA 4CG8A 3VAPA 3HA8A 2YM5A 4KS8A 2XJ2A 3DCVA 4GT4A 5FD2A 3GU7A 4QTBA 4ALVA 4ERWA 4ZSJA 1Y6AA 4Y72A 5C8MA 4BJJA 2OBJA 2Y4PA 3GC7A 3HMPA 4CV8A 2BRMA 2PZPA 4WG4A 3O8UA 1J3HA 4YO6A 4QP4A 2GMXA 4YJRA 5D10A 2C6DA 3N4TA 5E1SA 3SHEA 4O1PA 2QOBA 3IOKA 4PMPA 1Q8TA 4CLIA 2JBOA 2XNBA 2ZDUA 3LPBA 2IVUA 4IADA 4YJSA 2WELA 4U42A 1OUYA 4KIQA 3H0YA 4IB3A 4C62A 3W0QA 4UEUA 4NM0A 2GCDA 5AM7A 4DFZE 2PUUA 3BLHA 4DHFA 3QAME 3RPRA 4K9YA 3GNIB 4C34A 3R2BA 4GU6A 5E8XA 5TKDA 3HUBA 4K1BA 4ANSA 3QRKA 5CSWA 5GJGA 3RZBA 5D11A 4EL9A 3KULB 4FTRA 3GU6A 5ANEA 3ZEWA 5JRQA 3Q2JA 3VF9A 1U5RA 1KE6A 3FPQA 1ZY5A 3EKNA 2W96B 4FKJA 4ASEA 1OL1A 2UW7A 4NEUA 3MA6A 2NNWB 1YWVA 3RZFA 3GXLA 5HE2A 3QWJA 4BBFA 4O0YA 2JEDA 1TKIA 3RK9A 4EC9A 4O0VA 4M0ZA 3LCKA 3R8ZA 3CKWA 3HV3A 3NIZA 4EJNA 5IH6A 2YA9A 1XH8A 4AXDA 3UBDA 4E93A 1H1PA 3CEKA 4ORKA 3UDBA 4AZEA 3QX4A 3BGQA 4F08A 3E64A 2VV9A 1ZAOA 4X6QC 1ZOHA 4LDTA 3PY1A 2BCJA 4U40A 1V1KA 3TZ8A 5AAEA 3HVCA 3EHAA 5CALA 4DBXA 2OIBA 3ZMMA 4YUQA 3R9HA 2VUWA 3H9FA 3KRJA 4FSMA 2QG5A 3C9WA 3M2WA 2PY3A 3EFKA 1GZOA 4OBPA 2BRHA 2XK3A 1UU9A 3GCPA 2FH9A 2VAGA 4TTHB 3MV5A 5HNBA 3CJGA 3W0RA 5HHWA 1H4LA 5AUWA 3ZCLA 5L4QA 3HMIA 3EZRA 2WMXA 3FBVA 3GU4A 3LVPA 4QYHA 4YPSA 4DFXE 2FYSA 3CP9A 5AUXA 2QR7A 5BUEA 3PWYA 1J7LA 3LCTA 5EQYA 3FV8A 4D2SA 3IGOA 3UIBA 3HLLA 2XKCA 2XK9A 3NUSA 3OFMA 1G3NA 3TJDA 2VZ6A 4IVDA 4K33A 3PTGA 4C02A 4DDGA 3F6XA 4AZTA 3E3BX 4NUSA 4UMPA 2QOQA 4M69B 1AD5A 4YLKA 5HE3A 3RJCA 1XH4A 1URCA 2XVDA 2PMIA 3H4JA 3N4VA 2OK1A 1DS5A 3OC1A 2BTRA 3QUEA 4CEGA 4I92A 4RWKA 3ANQA 3QLFA 4RJ5A 5HG9A 4FSWA 3LQ3A 2OH0E 5JRSA 3ORKA 2XKFA 4P90A 1OKWA 2YIXA 2BRGA 5JGBA 5LVLA 4DFYA 5HO6A 4H3BA 4IAIA 2XARA 4XJ0A 3LM5A 4M14A 3KB7A 3FMKA 2C5NA 2W9ZB 1Q8YA 1CKPA 2H96A 4WSQA 4I5PA 3E7OA 4HZSA 3DDQA 4IIRA 2UW9A 4K8AA 4RQKA 4ACGA 4CZUA 4ZTRA 4EHVA 1Q61A 5J5TA 4FGBA 3TNHA 2ITPA 3AT3A 3TNIA 3MH3A 4IH8A 2WQMA 3ZO3A 4JLCA 5ANKA 4XS2A 2JDOA 1H0WA 2PZRA 3NCGA 5BYZA 4TNDA 5TO8A 4BC6A 1H01A 2YIRA 3PUPA 3PXRA 4M67A 3HDNA 4UZHA 4AS0A 2PZYA 5KO1A 3F5PA 5FP5A 3FQEA 4KIKA 2Y4IB 2ZV8A 3VUKA 2X2LA 4WUNA 3WIGA 1Q62A 4EQMA 5CAVA 3R04A 1HCKA 1WCCA 3U54A 1OGUA 2P2IA 5JFXA 4C59A 4C4JA 4AA5A 4G6OA 3Q9XA 4WNPA 4FSYA 3QRJA 4PTEA 2ZV9A 4O91A 3C5IA 2IJMA 3RWPA 1KSWA 3HX4A 4KWPA 4DBNA 4EBVA 5EM6A 3D2IA 5EM8A 1JPAA 2QU5A 4HNFA 2CNQA 4NK9A 3UC3A 3CS9A 5D1JA 2QURA 3DQWA 3UOHA 3G0EA 5A4LA 3DXQA 4YPDA 3WIKA 3ZYAA 3DKFA 5D9HA 4AW2A 3Q96A 3ZC5A 5M06A 2RF9A 2UZWE 3HZTA 3KULA 3ODYX 4MF0A 1OITA 3GCQA 5HX8A 2WTKC 4C35A 2C3KA 2PMLX 3ZC6A 5HQ0A 3GP0A 4FTAA 5TR6A 1XO2B 2QO9A 3GVUA 4NTSA 4QMWA 3FQSA 3QF9A 2C1AA 5DOSA 2W5AA 4CFVA 3JR1A 3VONA 1K3AA 2W1CA 1J1CA 2F7EE 4M8TA 4OT5A 5HO8A 1AQ1A 2OI4X 4LM5A 4PTGA 4DAWA 2W7XA 4JDKA 3DAJA 5CAPA 3IW7A 2I7QA 4I0TA 2WMTA 2E9NA 3OMVA 4QP6A 2VO3A 2OSCA 3W33A 3DY7A 4C3RA 5EW3A 5EKNA 2WD1A 4ANOA 1HOWA 3ALOA 3E88A 4RC2A 3ACKA 3UIUA 4PMTA 3BBWA 4CXAA 2YDJA 1OIQA 2W1IA 2VWIA 4FV2A 4QQTA 5DYJA 4DTAA 3A7IA 2GHGA 3ENHA 5E7RA 3RNIA 5DE2A 4JBQA 5C8NA 4LYNA 4IX5A 4CKRA 4IZ5A 5AR3A 4TY1A 4NFNA 4EH4A 3D2KA 5DI1A 3I0QA 2XJ0A 2OZAA 2XJ1A 5HCXA 4AE9A 1I09A 1JLUE 2UZNA 2VNWA 4OTQA 4OTPA 4PMMA 4RMZA 4X21A 4XV1A 4I3ZA 4MQ1A 4MTAA 4IMYA 4RX8A 3DT1A 4DE4A 3VULA 1VZOA 2GQGA 3KRWA 3QRUA 3ZOSA 5AADA 4DDIA 3S1HA 3L8SA 4I1ZA 1U4DA 3NUAA 1OBDA 4K11A 2QO2A 3ATTA 4QP1A 4YBKA 5ETFA 4D4SA 4M69A 2HELA 3R7EA 1NY3A 2OG8A 3EIDA 4IX6A 1TFFA 4QTEA 3GB2A 3FL4A 5HBHA 3QQKA 2BZKB 4KB8A 3C50A 5H9BA 4L3PA 1RJBA 3EQFA 3SA0A 4JXFA 4EZ5A 4JI9A 1YHWA 3EKKA 4JDHA 4R77A 2HZNA 4WSYA 3ZFMA 4WA9A 3V8WA 2RG6A 2CGXA 3MYGA 4CVAA 4EC8A 5HU3A 3TWJA 3BPRA 4Q9SA 3RMFA 2PSQA 3IONA 4JRVA 4O2PA 4F7NA 4E73A 1K2PA 2OKRA 4C37A 2O64A 1WBTA 2J0IA 4D28A 4E6QA 3G6GA 3PJ2A 4DEEA 3DU8A 2IVTA 3BWJA 3DFCB 4XP0A 3VRZA 4JR3A 5T6KA 2CKEA 5HOAA 5AAFA 4NKAA 4I0SA 2XEZA 4FZFB 3UMWA 3KVWA 4HYSA 4Z55A 3U55A 4QQJA 3BEAA 4I6LA 3QQGA 3U9NA 2X81A 3A60A 3V5JA 2R3IA 3CY3A 2YM7A 4TL0A 4QMSA 2WMWA 3U6IA 3LMHA 5AFVA 4NM5A 5BUJA 4WKQA 3HV5A 1PY5A 4LI5A 1UU8A 4F1TA 2EWAA 2XKDA 3MW1A 3RALA 5CU3A 4C0TA 4BTFA 4F9BA 3UQCA 4FL2A 2WNTA 5CF8A 5J9LA 2B9IA 1FVVA 3QD4A 3BX5A 1WBOA 3DAEA 1B39A 3GUBA 2C68A 4LOQA 3ZONA 4CG9A 3SD0A 3RAWA 3SOAA 2X6EA 1G8SA 4DF3A 4XLIA 4Y85A 3R00A 5M4CA 4NL0A 1JKKA 3KRXA 5CEQA 5CT0A 4NTTA 3KXXA 3GOPA 3OVVA 3PG1A 4I6FA 4L52A 1W0XC 4RSSA 4DG0E 3CD8A 4ANMA 5L6PA 3ZFYA 5CVHA 4R6VA 2YIYA 3FAAA 4L44A 4UWCA 2RFDA 5AX3A 1ZYLA 1MP8A 3K2LA 4MNEB 4YBJA 3VS4A 4YZBA 4F0GA 4FT3A 4IZYA 4MBIA 2FA2A 3VF8A 4D2VA 1TQIA 3R0TA 2QOIA 2G2IA 3DBDA 2QOFA 1SM2A 2J4ZA 4IX3A 2YN8A 4NM3A 2CMWA 3F3UA 3PWDA 4F99A 5LJJA 4QPAA 4I5CA 3L8VA 3DK7A 3AMAA 4I6QA 3RK5A 3UDZA 4AWIA 3PIYA 3RPVA 3UJGA 4Y46A 5GZ9A 4K18A 1LEWA 4HNIA 3MVMA 4APPA 3OUNB 5I9XA 2A19B 1FOTA 3LE6A 5AJQA 5E8SA 3L1SA 4FRFA 2GNGA 3THBA 3QX2A 4BCPA 2GHMA 2IZUA 2QKRA 2RFEA 3NWWA 2A27A 4EHGA 2JLDA 1Q8UA 3S2PA 1OIRA 2VX3A 3RP9A 1O6LA 4O4CA 4R3RA 3UNKA 1Y8GA 2XEYA 3L9MA 4FT9A 5K5NA 3JS2A 4HGTA 4CZTA 5IMEA 2QHMA 4EWQA 5EQEA 1XH7A 2ERKA 2F49A 5JN2A 4AZSA 4EK5A 2Z7SA 4C7TA 4IWOA 4CRSA 4B4LA 3P5KA 3PXQA 4X7QA 4CSVA 4L7SA 2V5QA 5CU6A 3R7YA 1YHVA 1GZ8A 3VUTA 4B99A 5EDPA 4II5A 4O7WA 4O1OA 4Y73A 1V0PA 5KNJA 3DBEA 3R1SA 5J79A 4GYGA 2BKKA 2X6DA 4Y5HA 2HY0A 4U44A 3FKOA 5HORA 2J7TA 4JS8A 4ZSGA 3E7VA 3NUYA 5A4EA 2AUHA 5EI2A 2PUPA 3EB0A 4BYJA 4E1ZA 1R0EA 3T8OA 1R3CA 3MJ1A 3MN3A 3POOA 5JMSA 2J5FA 3V8TA 4E6AA 4LV7A 2X1NA 2DYLA 5E8TA 4TYHA 1M52A 3RBWA 4O4FA 1WFCA 1X8BA 3GT8A 5F20A 1RDQE 4FKOA 3KF7A 3VBYA 2BPMA 4ITHA 1YI4A 3CPCA 3DS6A 2VRXA 4BGQA 1QPEA 4CZYB 3LIJA 3OD6X 3Q9ZA 4AACA 3NAYA 3BHTA 3KA0A 3TMOA 4X2FA 4FK3A 4XOYA 2O3PA 4L8MA 3HA6A 1JVPP 3I5ZA 3HNGA 4KBAA 2B1PA 3HGKA 3E5AA 4BF2A 4EH3A 3P7AA 5HI2A 2R7IA 1VYZA 3HRBA 5BVNA 3G5DA 1J1BA 3W0NA 4EK6A 1YI3A 1UKIA 4L67A 4EQUA 3O7LD 2YITA 3O23A 2Y4IC 3FZSA 3PSDA 2QOOA 3S4QA 3QXOA 3WF8A 4B6LA 3EJ1A 4IC8A 2REIA 4F6WA 1M7NA 3BBTB 4FIGA 4PDOA 4FVPA 4GKIA 1LP4A 4RC4A 2BALA 5FWKK 2HZ0A 3VN9A 3WYXA 2YHVA 4BWXA 2JKQA 2XRUA 4DGOA 3FYJX 3MH0A 5EDRA 3WF5A 3C0IA 5EHYA 1FPUA 2UZEA 4FKIA 4RX9A 4AN2A 4H36A 4IJPA 2X8IA 3VBTA 5GZ8A 3UOKA 2BIKB 5J5SA 1CKIA 1FGIA 3PJ8A 4EOIA 4KKEA 2QLQA 4AF3A 1T46A 4MXZA 2VN9A 3DLZA 2YZLA 1YW2A 3WILA 4BCKA 1U54A 2BROA 2OXYA 4X3FC 3TKHA 3VW8A 1V0OA 4FZ7A 3SDJA 4M84A 3IQ7A 1CDKA 4WBOA 3SXRA 4IZAA 4XG3A 4F65A 4MXAA 3Q9WA 4XBUA 3GU8A 3DGKA 4KUJA 4IVBA 3KXHA 4Y5QA 2VO6A 4A9UA 4BDHA 3Q04A 4RIWA 3KY2A 3CD3A 3MPMA 1QPDA 3UO6A 3GENA 4R5SA 2QKWB 3G6HA 3F88A 4OTGA 4KSPA 3FMJA 2X4ZA 3MWUA 3W32A 4IFCA 1CTPE 5BX0A 1OECA 3NEWA 4WUAA 4YJQA 5IQDA 2R3LA 2WTWA 4YTHA 3W2CA 4ENYA 4ZTNA 3PXYA 1ZYJA 3U4UA 2ZVAA 3IW4A 4PDSA 3ROYA 3U9CA 4DA5A 2OJIA 4R78A 2YM3A 4KIPA 1PXNA 1QMZA 1QCFA 3R2YA 5A6NA 3EFLA 4QO9A 1YI6A 2WTDA 2WMBA 3A8XA 3UMXA 1DI8A 3V5WA 2CGVA 4UYNA 3R9RA 2ITQA 3DTWA 5KMMA 1A48A 3UO5A 3HAVA 2ZM3A 4MYGA 4IAKA 2WMQA 1CSNA 1Q24A 3GOKA 1BYGA 4TWCA 4XRLA 5FM2A 3PZHA 2ETRA 4GFMA 3DB8A 4PPBA 1OL2A 2C6IA 4IJ9A 4DLIA 4F70A 4NH1A 2XS0A 5IUHA 4RC3A 5AP0A 3VWAA 4AUAA 1DAWA 2GS7A 4EUTA 3BKBA 3DOGA 3ZBFA 2ACXA 2HIWA 4AAYA 1W82A 3MPAA 4GVAA 4BHZA 2X8EA 3UVPA 5AV4A 5AX9A 3T9TA 2XK6A 3DBQA 4OGRA 4K6ZA 4C4IA 2NRYA 2WPAA 5G6VA 3UIXA 4WG5A 1H25A 2V22A 2OF2A 4BKJA 4D2RA 3W1FA 2KULA 2JDSA 4GG7A 5C9CA 1Q8WA 1BL6A 1PMNA 4FUXA 3DNEA 5A9UA 2PUIA 4QEBA 2CSNA 4CD0A 2QLUA 4GIHA 3CQEA 4RWJA 3WE8A 1YXXA 5FQDC 1H24A 4N70A 2NYAA 1OPKA 4MF1A 3P08A 1H1SA 5AIRA 3ELJA 2XAOA 2WTVA 4UBAA 2XBJA 3COKA 3QZHA 4K0YA 1AGWA 2ERZE 3B8QA 3VBXA 5JZNA 3V01A 4CNHA 2J0JA 1UU3A 3DB6A 4A4XA 3GCVA 2VTOA 2E9VA 4ARKA 4O7LA 1ATPE 4M66A 2WTKB 5D7VA 3VO3A 4DT9A 3OT3A 2R3KA 4FSZA 4I93A 4UY9A 4QD6A 4BDEA 4Z7HA 4WRSA 4L46A 4LGDA 5IEYA 3IDCA 3R71A 2G9XA 1PRYA 3ORPA 4UXQA 4M7IA 2BRBA 3COMA 4GFOA 4H05A 3EN9A 3A4OX 5CQUA 5HIDA 3TZ9A 3QCXA 5HICA 3F5UA 1R78A 5FP6A 2B9FA 3R73A 3AC4A 4RIYB 3MFTA 1GY3A 3ACJA 3R7UA 4AXAA 3R9NA 2W9FB 2BDJA 3NRMA 3LJ0A 5HLPA 3FKLA 4R7IA 3T9IA 3TKIA 4AN3A 5LVOA 2JKMA 2R9SA 4KKHA 2QOCA 4MXCA 4FG7A 5M4FA 3H9RA 5EHOA 3VBWA 4IZ7A 4RJ8A 4Y95A 5ICPA 2I1MA 3QTSA 3UNJA 3ID6C 4UB7A 2JKKA 4RG0A 3SGCA 3UP7A 2WMAA 3P9JA 4CYIA 5IEVA 2HENA 1J91A 3BYUA 3QQFA 4I22A 3HRFA 3GBZA 3QBNA 2WOTA 4MXYA 2V0DA 3UQFA 3RGFA 5FGKA 4H1MA 4PNIA 2Y0AA 3AC8A 5A4TA 2P3GX 4UXLA 3UOJA 3U4WA 3GQLA 2E9OA 1BLXA 4QP7A 4P5QA 2ITWA 4OBQA 3HYHA 2WTIA 2XANA 4IB5A 4F6SA 3QTIA 4EKLA 5IH5A 2YCFA 3LJ1A 1SVGA 3Q4ZA 2HZ4A 2W5BA 4NCTC 4QTAA 4RZWA 1JOWB 4ITJA 3D7TA 4IACA 2C69A 3OXZA 4BWKA 4TYIA 1GOLA 3HP5A 1OPLA 4DEIA 4QRCA 4TT7A 3QHWA 4KS7A 3PXZA 1YKRA 3FUPA 3MH2A 4WBBB 4ZJIA 4C36A 3LFBA 4LQMA 4C58A 3ZHPC 3GU5A 5IISA 5JZJA 5LWMA 5IQGA 3D15A 2QHNA 1QPJA 3LFQA 2R64A 3ZUVA 4DH7A 3E92A 3G0FA 3ALNA 3NIEA 2PUNA 4YTCA 1NVSA 3OZ6A 5HIEA 3LMGA 3WOWA 2R3FA 4TYGA 5CEMA 3V04A 3LHJA 1GAGA 1SYKA 2JBPA 3DV3A 4E4NA 2GFSA 3BWFA 4C2VA 4BCOA 4F7SA 2HK5A 2GS6A 2XIXA 4USDA 3UODA 3CGOA 4A4LA 3AT2A 3IGGA 2UZOA 3EFWA 2WIPA 4GKHA 3R28A 1ST0A 3MY0A 4L53A 5AMNA 4E5WA 3U87A 5AEPA 2YEXA 5AV0A 4JBOA 4QYFA 5K0KA 5IPJA 4H3QA 3U51A 3AMBA 5IA4A 3BL9A 4I20A 4PTCA 1MUOA 4GV1A 3D5UA 5F95A 4UV0A 2GPHA 4AW5A 4IQ6A 1PXIA 3VRYA 5M4UA 4JNWA 4MH7A 2XIRA 1PXOA 2ZYBA 1KV2A 4GH2A 4JAJA 3VVHA 4BVUA 4E4LA 4EOMA 4H58A 5IQBA 4ZY6A 3AC5A 3FI8A 3KQ7A 4ZAUA 4WNKA 3SG9A 3R7OA 4ACHA 2BZHB 1H00A 2VX1A 3Q5IA 4J98A 2WQBA 4QMYA 1ZMWA 5EM5A 3QQJA 2W5HA 3DQXA 3ZEPA 5JKGA 4DHZA 3GFWA 2OXDA 2X0GA 4FTQA 1XBBA 1MQ4A 2VWYA 2YIWA 3PG3A 4JQ7A 4MK0A 2YABA 2KTYA 5AP5A 3L9PA 3COHA 5TT7A 3N9XA 3EQGA 3R01A 4FTLA 2ZMDA 4EOQA 2AC3A 5BVEA 3BGZA 2YISA 1YVJA 2H9VA 5AR5A 4W9XA 2BDFA 4B8LA 2PU8A 1W84A 5F94A 2WXVA 1UWJA 2PVRA 3CCNA 4Y8DA 3R1YA 4G17A 2YAKA 2ZM4A 3QLGA 4IM3A 4CTBA 2XK4A 1Z57A 4OW8A 2B52A 4BCGA 2VTSA 3G51A 4O0UA 5CNNA 5C4KA 2EVAA 3LCSA 4ALWA 5H3QA 4YSMA 4AP7A 3D7ZA 3KMUA 3RKBA 1SNUA 3PSCA 5D7AA 3SOCA 2ZB0A 2B55A 4O7NA 4FNWA 3WYYA 2A1AB 4DINA 4FR4A 5CX9A 3SVVA 4IWPA 2OLCA 3E8NA 4A9SA 1JWHA 3ZLXA 4U43A 4RIYA 4XMOA 4CTCA 4O38A 4AA0A 4LGHA 3ZLSA 3V3VA 5ANOA 2BVAA 1ZRZA 4FV8A 4QMOA 3QTZA 1GJOA 2ZJWA 3VS3A 2FGIA 2VU3A 3CGFA 4FNXA 3R8UA 2YFXA 4G9CA 5JGAA 2ITXA 4BIBA 1PHKA 2XCKA 3NX8A 3HEGA 3IOPA 4U3YA 2GTNA 4XH6A 5CU2A 3SRVB 4LRMA 2W1ZA 1UWHA 1KE5A 4FICA 5EYDA 2Q0NA 1PMUA 1TQMA 1KE7A 3S95A 4EH9A 3VS1A 2W17A 3FKNA 5M53A 3OW4A 3DBFA 3UTOA 4D0WA 4YZMA 2ONLA 4PL4A 5JFSA 1RQQA 2BILB 3PLAE 4I5MA 4BRXA 4JX3A 4S31A 1CKJA 4LL0A 4PX6A 3UZTA 3QTUA 2B0QA 5FTOA 4I6HA 3TUDA 3Q52A 4ERKA 5IG1A 3BLQA 3F82A 4XG4A 4BCJA 3W55A 3QKKA 2J51A 4FKUA 4ACDA 1YXUA 3V5PA 2C30A 4QOXA 3HV7A 4GS6A 5CF6A 2VWBA 3LCDA 1IASA 2FO0A 4G9RA 4EHEA 3C5UA 3TZMA 4YJUA 3EYHA 1F0QA 5DMZA 2ITYA 1LPUA 5BYLA 2P55A 5HVJA 3OT8A 3PDTA 2IO6A 4OT6A 5CAQA 5BVKA 4LOOA 3COIA 2W4OA 4WHZA 4UMQA 5K4IA 2PVLA 1VJYA 2G1TA 5DR6A 3UVRA 4I23A 4NKSA 5IQAA 3KN5A 4QPMA 2QNJA 5LOHA 1DM2A 2BHHA 2GQRA 2C3LA 4IVCA 3P4KA 4FV6A 5HNIX 5L8LA 3C0GA 2VTPA 3P23A 4MHAA 2C6TA 5LMAA 4GJ3A 5CI7A 3R7VA 3NPCA 4HGLA 2UVYA 3EL7A 4CQEA 4F9YA 2OJJA 4EZ7A 4GCJA 4AE6A 2UW3A 3I7CA 4JR7A 2OXXA 4A9RA 1LUFA 4FTOA 4JIKA 4XV9A 4CV9A 4L7FA 4QQ5A 3AKKA 3TUBA 3QRTA 4ZSLA 3FMHA 3QTWA 4FF8A 3UE4A 3KEXA 4FSQA 4X3FB 3R83A 4D9UA 2LGCA 4ZMEA 3D4QA 4RX5A 3C4FA 1Q3WA 4N0SA 5D41A 3VS7A 4AZWA 1WVWA 3KIOC 4GMYA 2F4JA 4O4BB 3DTCA 4F64A 4JG7A 2A2AA 4XBRA 4BB4A 2JIUA 2H6DA 4G3CA 4I5HA 3D5VA 5BMMA 4ZS0A 3RM6A 3DA6A 4R7BA 4B0GA 2FSOX 4FT7A 3R8PA 2J5EA 3QL8A 4DGNA 1OKVA 2WMVA 5CEKA 3TTIA 4D5KA 4U41A 2I0VA 3O17A 3LXKA 5CS6A 5CZIA 5E8UA 5ETAA 4PL5A 3K54A 3MVJA 5CENA 3TIZA 3ZLWA 4F4PA 5AUTA 3CKXA 3P0MA 4RJ6A 3ML1A 1XHAA 3PRIA 4YSJA 2CPKE 3UDSA 3H10A 3R6XA 5HCYA 4O0SA 1NXKA 4B9DA 4D2WA 4EEVA 4M97A 2FVDA 2W1FA 3OWJA 4O96A 1UA2A 1W7HA 2YAAA 4QDEA 3E63A 2H34A 3OWKA 3Q4UA 4TNBA 3FY0A 3ETAA 3ZXZA 2E2BA 5I0BA 4ENXA 4FC0A 5DR2A 5EYMA 4YJTA 4F9AA 2R3PA 1A9UA 3BZ3A 3P86A 4I4EA 2XNNA 3PPJA 3SXSA 5HZNA 5FBOA 4FEQA 4YNEA 3BU3A 5IKWA 3ORTA 3ZDUA 4BDGA 4DEHA 4AZVA 3NFGB 1SMHA 4FODA 5HD7A 3F7ZA 1IR3A 1FQ1B 1E1VA 2PE2A 4LGGA 4DH8A 4C3FA 3QYZA 4TWNA 4QYYA 4EOLA 3WF7A 4LV5A 2ITTA 2QVSE 4QP8A 3WF9A 3TDWA 3Q6WA 4F6UA 2JD5A 3BU6A 4ID7A 4YR8A 4JT3A 2C6LA 4MVFA 1U59A 4BBMA 5KBQA 4HGSA 1XR1A 4G16A 3FMNA 4NJ3A 5F1ZA 1UU7A 1YXSA 3K3IA 3V6RA 3AMYA 3DBCA 3RNYA 3FY2A 2VTNA 3FLWA 2W1DA 2GHLA 3R21A 4QMPA 4ZMFA 2O5KA 2VTJA 5IUGA 1UKHA 3KCKA 4IWQA 2C6OA 4XNEA 3G90X 2WMSA 3RI1A 4NW6A 4AFEA 5L6OA 3LLAA 3SC1A 5IQFA 1KE9A 4EH8A 1WBWA 5M07A 2YLEA 3QCYA 5HX6A 2VX0A 3KC3A 3FLSA 4ASDA 4W4WA 4BGHA 3ZRKA 4QMUA 3EQRA 4DC2A 2P0CA 3MFRA