4EH5A

Human p38 map kinase in complex with np-f4 and rl87
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
351
structure length
329
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 103
structure length 329
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh5A01
5J9ZA 3C0HA 4NFNA 3NGAA 3EFWA 1MP8A 1OKYA 2J51A 3MIYA 4M69B 1GZOA 5LVOA 4YJUA 3F82A 3IECA 1OKWA 4AGUA 1SYKA 5I3OA 1OPJA 2HWPA 2WELA 3PIXA 2OIDA 4BGHA 4CMTA 3ORKA 4LM5A 3SOCA 3BWFA 3ZO2A 1IA9A 3TUBA 2CPKE 4FSWA 3T9IA 1M7QA 4EH4A 2C6IA 4G3FA 3V5WA 5DMZA 2RG6A 4BCFA 3C13A 5AEPA 2PUIA 4E8AA 4F9WA 3Q3BA 3C4WA 4GV1A 4O22A 4Y8DA 3R00A 5AX9A 1OM1A 4X0MA 4ZSJA 4YHJA 3UO4A 4AX8A 2ETMA 5BQ0A 3FL5A 5AIRA 3IGOA 4FICA 3VBXA 4HNFA 5CSXA 3DZOA 4P5QA 3REPA 4IX6A 2FVDA 2GNGA 4JAIA 3D7ZA 2GS6A 4TW9A 4BL1A 4UBAA 4A4XA 4YJQA 2PSQA 2ERKA 4RSSA 2XVDA 3CQEA 3HZTA 3R8VA 4ENXA 3R1QA 5C1QB 5IU2A 3OEFX 4FV7A 4K77A 3DBCA 4TXCA 5LCJA 4BVUA 3ENHA 4YLKA 3MN3A 4JDIA 5ICPA 3C4ZA 1J91A 3LCTA 4MNEB 2WTVA 1MRVA 3M11A 3UOHA 3TUDA 4PMPA 3DS6A 2ITXA 3KKVA 1STCE 3DTCA 4R1YA 4ZMFA 3FY0A 1ZZ2A 3C0IA 2E9UA 4MWIA 4FEXA 2BDFA 3OXZA 5HI2A 4O7TA 3FI8A 3SGCA 4HCTA 3QKKA 5C9CA 3R7OA 4YO4A 5JZNA 2Z7LA 2CKPA 1RE8A 4XHKB 4O0UA 4FKRA 4BKJA 4RQVA 5D7VA 3EH9A 1TVOA 3OMVA 5LWMA 3L9LA 2WHBA 4USEA 1GIHA 3NAXA 2J5FA 3M1SA 4H3PA 3V8WA 3LMHA 5HIDA 2VX1A 2JDTA 2ZYBA 3UNKA 3P86A 4FTKA 4FV3A 3TG1A 1W8CA 3CQUA 1XBBA 4ANOA 5CEQA 3BHTA 3CLYA 5JGDA 4Z7HA 4NIFB 1BL7A 3TACA 3I60A 2J90A 3PA5A 3H4JA 4XUFA 3B8QA 5BUIA 1JLUE 2YCFA 2NNWB 5T68A 3LMIA 2QOKA 3UODA 4DG3E 5IQIA 5AAGA 4K18A 2E9PA 3MFRA 3EIDA 4V04A 5AUXA 3RBWA 4EOMA 5E7RA 2R3GA 3DXQA 1H1SA 1UU9A 4PV0A 2Z60A 5ANOA 2Z7SA 3W2PA 2R3RA 2OJGA 3TV6A 3VRZA 5F9EA 3PVBA 4KIOA 4UX9A 1OL1A 4QP2A 1PF8A 5IPJA 4JX7A 3OVVA 4EHEA 4NM3A 5DA3A 4FNYA 4O27B 3VUMA 3UP2A 3TKUA 1V1KA 3RPYA 1V0OA 2O5KA 5EDRA 2HENA 2XNOA 4O0WA 2O8YA 4DEBA 4KA3A 4XLIA 1ZMWA 2QC6A 4TNBA 1APME 2V5QA 3PWYA 2R3LA 3IK3A 2JDVA 3PXFA 4FBXA 4I0TA 5IA4A 5EQYA 5LVNA 3QZFA 2PUPA 4ZLYA 2VWIA 3FQEA 4WA9A 5E8TA 3DGKA 2BFXA 3Q4TA 5ETCA 3ITZA 3HX4A 2WU7A 3DV3A 3WI6A 5IQCA 4FVPA 5IZFA 4MH7A 4C37A 3RK9A 3LKMA 3V5PA 2W96B 4IM2A 4RIYA 5D10A 3N4TA 2IVVA 1OECA 2YIQA 4JIAA 5DGZA 1OIYA 4XX9A 4ZP5A 2VZ6A 4OTGA 1SM2A 4UEUA 4LUDA 1HOWA 4XV1A 3MVJA 4TTHB 1PYEA 4U97A 3C5UA 3FMDA 3KY2A 5E8ZA 5AUUA 4FTIA 4IVBA 4BCIA 1X8BA 4LOQA 4QMVA 1B38A 4XLVA 3RGFA 4D9UA 4EH8A 5HO7A 3ZO4A 3ULIA 3Q5ZA 3ERKA 2IZSA 4XV9A 5HESA 5GJFA 5IUIA 2P0CA 3W2OA 5FP5A 3TKHA 5AP7A 4MXXA 3PUPA 3R73A 3TJCA 3C4CA 3NCGA 3ZRMA 2WQOA 3F3WA 3FHRA 3KRRA 4S32A 5AP5A 4BCGA 4QMNA 5A9UA 3GC9A 4YNEA 4C38A 3DJ6A 1H0WA 1BLXA 3NUSA 1JQHA 4LRJA 2EXCX 5BPYA 2XM9A 4BI2A 5F4NA 4WIHA 4G2FA 3HEGA 2OXYA 1DAYA 3O23A 3PWDA 1LUFA 5ETAA 5L2IA 1WCCA 4IE9A 4R6VA 4RIXA 2WMUA 5CSWA 2JKMA 4GKIA 4KABA 1SVHA 1U59A 5HVYA 5EKNA 3DNDA 1AD5A 5L2SA 1L8TA 2JKQA 5CU2A 3LJ0A 4IX4A 4CGAA 3VUHA 3FBVA 5E9EA 4HGTA 4Y72A 2E2BA 3NIEA 2BPMA 4LOPA 3PSDA 5HORA 1AGWA 4FSNA 2BRNA 3AXWA 4Y73A 4IHPA 3WE4A 4ZAUA 4O2ZA 2XIKA 3Q6UA 3MBLA 2Y6MA 1XKKA 3RALA 3KL8A 5EG3A 4M13A 5IDPA 5GZAA 4O7YA 3R9RA 2G15A 4NFMA 4DFLA 2IZRA 5AP3A 5CEIA 4IDTA 3KRJA 4EBVA 1FVRA 2O63A 3HMNA 4I4EA 3BU3A 1A06A 4YBJA 3SA0A 3CY3A 4M84A 4KBKA 4W8DA 1UKHA 3C4EA 3OWJA 5IQBA 2R3QA 2FYSA 3C51A 4QOXA 3HAMA 2VX3A 4FT3A 3QQLA 3OW4A 2VWXA 3UNJA 2VTTA 4BHZA 1KUTA 5IQFA 4EZ5A 3OXTA 2NRYA 3P23A 2XBAA 2BILB 4L00A 4NJ3A 5A46A 3UTOA 5ANGA 1T45A 1PXPA 4OTWA 2Z2WA 3VS6A 5DG5A 4GVJA 4CTBA 3UNZA 4G3DA 1GIJA 1PKDA 3ZSIA 5IA1A 1QL6A 3RNIA 4I3ZA 5DFPA 3R8LA 4ZK5A 4AZSA 3BYOA 3U6JA 3EQGA 4LL5A 5E8VA 4D55A 1WMKA 3A99A 3ID6C 4RRVA 4O82A 4DLJA 4FKQA 5FG8A 1UU8A 5A54A 3OZ6A 4FGBA 4LG4A 1XQZA 4ACMA 3MI9A 1OMWA 4CT1A 2VWBA 4GIIA 4MTAA 4RX8A 4M97A 4OTQA 5KMIA 2R3JA 3PJ8A 4G34A 4RWIA 2CCIA 4BCOA 4QMSA 3JVSA 3LW0A 4TYEA 3R7VA 2ZAZA 4FSRA 3QXPA 2PTKA 4EQMA 3QLGA 1OITA 3A2CA 1W83A 4ZTMA 4GFOA 2I6LA 4NYEA 1KOBA 4IZ5A 2ITVA 4FTCA 4F0IA 4J7BA 4MNFA 4ZIMA 4U41A 1OUYA 4BN1A 2CKEA 3GBZA 4KKHA 4AQCA 4AG8A 5LVPA 2YM5A 3G0EA 2GNFA 4BTJA 4DG2E 2YISA 1YWVA 3UOJA 3PXZA 3FKOA 5AP6A 4O91A 3SW7A 3DXPA 4IC8A 4QYHA 4CYIA 3NVMB 3OCSA 2CGVA 4WBOA 2I0HA 5JN2A 4AZTA 3FKNA 3IONA 3FLWA 3MY0A 4JI9A 3TT0A 3FMMA 4OT6A 5EKOA 3KMUA 4X2JA 1F0QA 3EQBA 3L8PA 2CNUA 4FKTA 5EDPA 4C02A 2G1TA 2OLCA 3Q2JA 3PTGA 4MXOA 2FGIA 3ANRA 1BX6A 1SNXA 3GQLA 3F7WA 3R8ZA 4E93A 1ZOGA 4FTQA 4BICA 3OCBA 1H8FA 1W7HA 2HYYA 4QMUA 3R71A 3FQSA 2OFUA 3A7HA 4U7ZA 4YTHA 5BVOA 3EQIA 4FIJA 2YDJA 5D9HA 4E4XA 5CU0A 3HGKA 4UWBA 3TL8A 4O0XA 3WIKA 4FSTA 4AGWA 2BIYA 2Z8CA 4II5A 4OTRA 2J0MB 3POZA 3ALOA 2GFSA 2WEIA 3UJGA 5C01A 3GU4A 4JBOA 2W4OA 2J0IA 4M68A 3E88A 4X2GA 5HOAA 3MVMA 4FT0A 4YHTA 4HVHA 5CEKA 2ZOQA 5DT0A 5AUWA 4I5CA 5HD4A 4AW5A 3RWQA 2B0QA 3PG3A 2PE2A 3IKAA 3QZHA 2J5EA 3PJ3A 4NUSA 4A06A 2WMXA 5AP2A 5T6KA 3PP1A 3A4OX 3R7GA 4IWDA 4RFZA 1O6LA 3QKMA 3QCYA 4XOYA 3VRYA 1G5SA 2XNEA 4E6DA 2UZDA 5I3RA 4AZWA 4IJ9A 4BBEA 3OT8A 1Q24A 4J8MA 4RC3A 3E93A 4DCAA 3OTVA 4IACA 4XOZA 4HGEA 4WG4A 2B52A 2OIQA 1XH5A 2YIWA 1OPLA 3SG8A 2J4ZA 3MV5A 4MBJA 2PUUA 1OKVA 2OW3A 1CMKE 3KREA 2H34A 2AC5A 2PVNA 3D7TB 3DAKA 1UVRA 5AMNA 4AXAA 2BTRA 5EM6A 5CZIA 2V22A 3Q4ZA 2BZHB 1Z9XA 5JT2A 4D2WA 4L43A 3A7GA 4EK3A 3DDPA 2GPHA 4TYIA 4F09A 2OJ9A 1XO2B 3IOKA 4ASEA 4B4LA 4GU9A 3EN5A 4L46A 1XHAA 1WFCA 4YTCA 3OBJA 5EH0A 3ZXZA 4DEEA 2QOIA 4ITIA 4LFIA 4MKCA 5M4CA 2UZLA 4V05A 4P5ZA 3LFDA 3KA0A 3TM0A 1J1BA 4EYMA 5C03A 4GYGA 1P5EA 4EWHA 4FGRA 4JG6A 4O0TA 2Y7JA 3QU0A 2BRBA 5JZJA 3PXQA 3MFTA 4EK6A 2W99B 2W1CA 4O7WA 2CDZA 3VS7A 2E9OA 3OUNB 5TT7A 4ZSEA 1R1WA 3LXPA 4EBWA 3WARA 2JBPA 2WO6A 4KNBA 4ZTQA 5KMMA 2GQRA 2GU8A 2EB3A 3DTWA 3GENA 4WRGA 4FL2A 3ZUVA 3PE1A 2W5BA 4DCEA 5HVJA 2XH5A 3H9FA 3NYNA 4U44A 3W18A 2GQSA 2IPXA 1JSTA 5BMMA 5HVKA 3FC2A 4RFYA 5AV0A 1FGKA 4FZ7A 5AV3A 1BUHA 3L9MA 4RJ5A 3OG7A 4IH8A 5HBHA 4P90A 3GU6A 1URWA 2GHGA 3COIA 2WMWA 3VVHA 4NKAA 2ZV7A 5TR6A 3UE4A 3W1FA 5F94A 4EOOA 3R9OA 3A7IA 1Q97A 3Q4CA 1EH4A 2ZB0A 3Q60A 4C61A 3BYUA 3HUBA 5GHVA 2JKOA 1PJKA 3EYGA 3UDBA 2EXMA 5AR5A 4F63A 4BIEA 5BVWA 4BDEA 1YHSA 4BWXA 2ITNA 3LVPA 3E8EA 2FSLX 4MQ2A 4I5HA 5D11A 2W05A 4RVTA 4GSBA 4YJNA 3TZ9A 3LCSA 2R3OA 4G5PA 3OOGA 3UIMA 3RWPA 2BKKA 4Y85A 1SVGA 2YABA 3LLTA 3RAKA 4WG5A 1H00A 3V3VA 3NMUF 3FC1X 3LFCA 2HXLA 4RZVA 3S00A 3KULB 2PVKA 4PUZA 5CAVA 4NJDA 1W0XC 2PVFA 3PFQA 2UZWE 4FG9A 3AC5A 3P7BA 4GJ3A 2BRGA 2R0IA 3TV7A 2BHEA 4FKVA 2B9IA 4NEUA 2OIBA 2W06A 4EI4A 2WMSA 4F0GA 3BHHA 1OPKA 4I6HA 3ZS5A 3W2RA 2PUNA 4LRMA 4D4RA 4N70A 4DINA 1JKKA 3PA3A 4EC8A 4GUEA 2ONLC 4NWMA 4BI0A 4IWPA 4ZZOA 2VTNA 2V62A 3KXMA 5EFQA 4AA4A 3VBTA 4CQGA 5CASA 3R01A 2PU8A 5IQGA 3FLZA 2PMIA 2X0GA 4HCVA 5HIBA 5CU6A 4S30A 4J95A 3HMPA 1R0EA 3OTUA 4MBIA 2X2LA 3K2LA 4RWKA 3DBQA 1LPUA 4QQ5A 2W1HA 2AYPA 2IVSA 5DE2A 4USFA 5DR2A 2VTSA 3ZLSA 3MPTA 4L01A 4DH5A 2Q0BA 5A4LA 5CAUA 1HCKA 2W4KA 2XKFA 5AUZA 4EH5A 5EM7A 4F6WA 4EEVA 2BTSA 2C0IA 4JIKA 1Z5MA 1O9UA 3DXNA 2KTYA 2I0YA 4XJ0A 4FV8A 4FV4A 2X7FA 2C30A 4JDKA 2PPQA 4RVKA 2PE0A 4KKEA 4PTCA 1NVSA 4J99A 4FV1A 5FGKA 3UVRA 2XIZA 3JYAA 4R1VA 3N4VA 4F0FA 2P3GX 3S4QA 4NTTA 4X6QC 3D5UA 3NUAA 1IASA 1M52A 4FKSA 3NUXA 4KWPA 3N9XA 4C58A 4GG5A 5BYZA 3F5GA 4DFUA 4UN0C 2FUMA 5M09A 2QOBA 2YM7A 3P5KA 4YLLA 1VR2A 4DGOA 3F2RA 5M08A 1YW2A 1W98A 4FSMA 4IFCA 3FYKX 4FIFA 4LUEA 3UBDA 4PNIA 5L6WL 3QHWA 4BFMA 2ZDUA 5EYMA 4FV0A 4I6QA 3SW4A 3EMGA 4KS7A 5J1VA 4PDSA 3ZLXA 3KRWA 3JR1A 1W84A 4H3BA 5KMJA 3QA0A 2BIKB 2JKKA 3A7FA 4ITJA 4MXCA 1PKGA 5J8IA 3O71A 1U5RA 4X2NA 4HVSA 3DK3A 3UOKA 5AP4A 4JBQA 4ZLOA 4WNPA 4FE2A 3IOPA 5FEDA 1OL6A 3DKGA 2B7AA 4CKRA 4DG0E 3LM5A 4RFMA 2VWWA 5KCVA 4FZDB 1OGUA 1R3CA 2OZOA 3PZEA 1ND4A 4XS2A 3KC3A 5DEWA 5CI7A 5HCXA 5AFVA 1GZNA 2P4IA 2C6MA 4YJTA 4ARKA 4WSQA 2OI4X 2I1MA 2JGZA 5ACBC 3IG7A 2YLEA 5HG9A 2QO9A 4A7CA 4NM0A 4NZWB 4EHVA 2B9JA 5EM5A 4X21A 1O6KA 3QWJA 4OTIA 4R5SA 1DS5A 4F1TA 2C68A 2PK9A 5E1SA 2QHNA 3OXIA 3ZLYA 4BIBA 3KN5A 2OH0E 3MY1A 4CMUA 5IKWA 4TL0A 1PMUA 1LP4A 4P4CA 3QHRA 4C62A 1FINA 4XG4A 4PDYA 5FXQA 4ZOGA 3PXKA 3ORXA 4IAAA 5H8BA 1K9AA 4FT9A 3TJDA 4CCBA 5JFWA 2OWBA 3LCDA 1I44A 5K0XA 3MW1A 4C57A 4W4YA 1TQPA 3PP0A 5HBEA 3HMOA 3JS2A 3EN6A 3NRMA 4M66A 2YWPA 3NUYA 4XRJA 4TWPA 3VN9A 1XH9A 4OBPA 4L8MA 4U79A 1LEWA 1J3HA 5B2MA 1PY5A 2GNLA 1E9HA 2VD5A 1Q8UA 3MYGA 2QOHA 2UZEA 3DKOA 3QZIA 3CTQA 1SVEA 1E1VA 2QR7A 3VUDA 3W55A 2VU3A 3I1AA 3I4BA 4XV2A 3HRFA 4F7LA 2V0DA 3ROYA 1ZLTA 5G1XA 1VYWA 4OBOA 4EQUA 3MVLA 2YCRA 4UY9A 3FMHA 4WNMA 5K4JA 4FKLA 1Q8WA 2HZNA 4B7TA 3EQHA 3F5PA 5DNRA 3MA6A 3UQGA 5J87A 1U5QA 4DT9A 5M4FA 5AR4A 5JQ5A 3ZYAA 3VS1A 2WU6A 1S9IA 3OBGA 4PF4A 3EQDA 4YURA 2JAVA 4ZTNA 4Y46A 4E5AX 5KHWA 3KK9A 4R3PA 2VWUA 2Y9QA 2J2IB 3BBWA 2FH9A 1Q62A 2RSVA 5DOSA 3PLSA 3LCOA 1GNGA 2G2HA 2BHHA 3F7ZA 4OLIA 4ZJVA 4OAVB 4N57A 4O7ZA 5J5TA 3VUTA 4DN5A 4U5JA 3NWWA 4K2RA 5GZ8A 3RAWA 4F9BA 4N6ZA 3U51A 3MY5A 2YDIA 5EQPA 3ZUUA 4GH2A 1R78A 4IWOA 3R2BA 4IADA 4LOOA 4A4LA 4DEIA 4ZY5A 4KD1A 2C1AA 1IAJA 4LYNA 5EHLA 2UVZA 1NT2A 3U54A 3M2WA 4UXQA 3D4QA 5CYIA 4G3GA 3QC4A 3RAIA 4HOKA 3MDYA 1GIIA 2HZ4A 2Y8OA 2XKCA 3PZHA 2YM8A 3QQKA 4X2KA 5L4QA 3MVHA 4DBNA 4UMTA 2PZ5A 1UWJA 5ETFA 5CAOA 4X3FA 5J95A 4K11A 3AMBA 3EFKA 5H8GA 3TN8A 3ENMA 1K2PA 3OCTA 5DVRA 1A48A 4YZ9A 2C6OA 1F3MC 3DLZA 5ANDA 2R3KA 5C8KA 3HMIA 4OTHA 5HG7A 5AADA 4FOCA 1Y91A 4F4PA 4GS6A 3GC8A 3ODZX 4A9YA 4R5YA 4IXPA 1PYXA 5CXZA 2PL0A 4XP2A 2Z02A 4WKQA 1RDQE 3GCVA 5AA8A 4I93A 4BTFA 1OIRA 4EOIA 5CZHA 4YO6A 4IDVA 3ZOSA 3QTZA 4EORA 1WBWA 4C4JA 5A6OA 5LVMA 5AM7A 1PXMA 3Q32A 4KIKA 4Y83A 3ZM9A 1DI8A 1H1WA 3VJNA 3LFFA 4TYGA 2YCQA 4FUYA 4IZAA 3LQ5A 3EQRA 4I92A 5AM6A 1MQBA 5HCZA 4QYYA 3D94A 3I5NA 1UU3A 4I0SA 3UG2A 4GFGA 4FV9A 3ULZA 5JMSA 5KMKA 1ZXEA 3BCEA 4D5HA 4YR8A 3CEKA 2JEDA 4IAFA 3QLFA 2QONA 1DM2A 3R8UA 2EB2A 2GSFA 2X8IA 4YSJA 1ZOEA 2J6MA 4W9WA 3TDWA 5TE0A 4C33A 5FP6A 4J53A 3HA8A 1J7IA 4DEHA 4Z7GA 3K5VA 4C4GA 2X7OA 3A60A 5LXMA 2QU6A 4M3QA 2X4ZA 4G3CA 3VQHA 1PMNA 2F2UA 4NCTC 3VHKA 3EFJA 4ZMEA 2XF0A 4PPBA 3F88A 3FZPA 4LMUA 5B7VA 3TDVA 3AD5A 1P2AA 3Q9ZA 3KK8A 3QA8A 4FL1A 2XK3A 3UPXA 4ACGA 5FTGA 4EHGA 3O50A 3VUKA 4NKSA 1JBPE 1YOLA 4AACA 4UWYA 3O2MA 4EH2A 1Y6AA 4NCTA 5KHXA 4ANQA 3P0MA 4RC4A 3NR9A 4CV8A 3DNEA 4BTKA 1QPEA 5HIEA 1JAMA 3ROCA 1DAWA 3QUEA 3ORMA 3G9LX 4IX3A 4HW7A 3ZO1A 4E6CA 1IEPA 3QRKA 4QP6A 5TOZA 2LAVA 3ZEWA 2PVJA 3TTJA 4D0XA 4O84A 3JUHA 5JK3A 3TNPC 3ETAA 2W1DA 4M14A 4AGDA 5BYLA 2UW9A 3QRUA 4N0SA 3P9JA 5EYDA 3KCKA 2QOCA 4FOBA 2PMNX 1J1CA 2CJMA 1NW1A 3JVRA 2CKQA 2JC6A 2R7BA 2IW9A 5AAEA 4E1ZA 3WZUA 4GT4A 3RINA 5CEPA 4L53A 4XG9A 2QOQA 2FSMX 3FMJA 3F6XA 3GOPA 4CRLA 3BHUA 3UYTA 3DQXA 3EHAA 4EOPA 4O7SA 4A9TA 3QCQA 2JD5A 5HQ0A 2OK1A 4RA4A 4AA0A 1WBSA 4L52A 4FKIA 3E63A 4HPTE 4HVGA 4KS8A 3QUDA 5C8MA 3QTSA 5JH6A 3V5QA 4DFBA 3F61A 4N6YA 4RIYB 3AT2A 1R39A 3HDMA 2XYUA 1Q4LA 2F49A 3HV7A 5CLPA 2F7EE 3RMFA 4C4HA 3CPCA 2WB8A 3SXRA 1JKLA 4KINA 2R3PA 4M7IA 3RI1A 2CHLA 2JIUA 3O17A 1ZYCA 3LFEA 4I6FA 4W8EA 4C3PA 5HNIX 3RZFA 4W4VA 4GK3A 4YZBA 2W4JA 4XP3A 5BVKA 3RTPA 2R5TA 3TCPA 3O8PA 4DBXA 2X4FA 2ZM1A 2YIXA 2BDJA 1WVYA 2J9MA 2JFLA 3UIXA 3UVPA 5IQDA 2F2CB 3MH2A 3Q2MA 3R9DA 4E20A 5J9YA 4QMZA 4YNOA 4ZY6A 1H08A 5EHYA 2UZVA 2A1AB 3QAME 3BU5A 3NLBA 4IVCA 5HO8A 5BNJA 2ACXA 2PZYA 3D9VA 4JJRA 4LL0A 3HL7A 3TNQB 4RT7A 1Q3DA 4IX5A 4DH7A 3POOA 3LMGA 4CFVA 2WQBA 3NUPA 2OXXA 3DB6A 4J71A 4L3PA 5GINE 4LV8A 4RWLA 3EL7A 5HG5A 4RBLA 3VAPA 3TNHA 5CALA 4RIXB 3HV6A 2VNWA 3NYOA 4J52A 2X1NA 4R7HA 3NCZA 4ZZMA 3PPZA 4ACDA 4D58A 4I5PA 2XKDA 4R78A 4EUUA 4GK2A 4Z3VA 5CF5A 4IM3A 5DIAA 3CJGA 4HNIA 2DYLA 4JBPA 3NW6A 3ORLA 5FM3A 4CFMA 2ITPA 4RJ4A 3L8XA 4G17A 4BDCA 4CVAA 4MXZA 4FVRA 2XS0A 1RQQA 2UV2A 2WMAA 4O86A 4RIWA 3HNGA 4R77A 2PVRA 3K3JA 5FXSA 3I79A 3AT3A 4NW6A 3SDJA 3ORPA 4D1SA 3V04A 4C0TA 2F9GA 3ZH8A 4L42A 1FBNA 4FNWA 4O0SA 3E64A 4C7TA 4CLIA 3UGCA 4K33A 4CYJA 4D9TA 3F3TA 3GI3A 1Y8YA 4W9XA 1OBDA 2YM4A 5FLFA 3DPKA 4A9SA 2KULA 3KB7A 1J7LA 3LAUA 5I9UA 3V6SA 3DJ7A 4MF0A 1A9UA 2C6EA 3RKBA 4TPTA 2UW3A 3EQCA 4JR3A 2VRXA 5FBOA 3TNWA 5EW9A 3P7AA 3EN7A 4Q5HA 4OGRA 4EK4A 5IA5A 2XMYA 3QKLA 1QCFA 3JY9A 4IAIA 3QD0A 3ZDIA 3ZSGA 4FTNA 3OWPA 1P4FA 4BTMA 3UQFA 3CC6A 4X3JA 2XCHA 1CDKA 2PVHA 3PJ1A 2PE1A 3PPJA 4KIPA 3DBDA 4RMZA 3FKLA 3CCNA 3ZRLA 1ZYSA 4CFFA 3P78A 2VWZA 3W10A 4DH8A 3E8DA 3R83A 2RGPA 1H28A 2RIOA 3D2KA 3VBYA 4FUXA 2H9VA 3RZBA 3FI4A 2XIRA 3BIZA 4NU1A 4CFWA 3CD8A 4GJ2A 4EK8A 2WEVA 1PW2A 2G9XA 2WOTA 3BRBA 1YDSE 5EM8A 2WKMA 3UP7A 4U42A 4FZ6A 1GOLA 4G1WA 5E92A 4RX7A 3ZM4A 5L6PA 4QTCA 4AU8A 1XWSA 4E5BA 3KXHA 4IZYA 4MAOA 2LGCA 5CVHA 4M8TA 5AA9A 3O96A 4QMXA 3CGFA 5CI6A 3QRIA 5AR2A 4FTRA 5CEMA 4RX5A 4DC2A 4MQ1A 3R8MA 4DT8A 3CP9A 1TQMA 2C5OA 1XH8A 2WMQA 3CQWA 1OL5A 4GFMA 4ZY4A 3E3PA 4O7NA 1UNLA 3ZBFA 5JGBA 3RCDA 1VYZA 4X7QA 5H2UA 2VN9A 4J8NA 3AC1A 5BVNA 1SNUA 4M15A 4MYGA 4CQEA 4XCUA 4JRNA 4PL5A 2UZOA 3GVUA 1JKTA 5I9VA 3LCKA 4QMWA 3KXGA 3ZC5A 5KMNA 1ZRZA 2OICA 5CEOA 2QD9A 1M2QA 3GCSA 3OP5A 5IG1A 5KMOA 3GC7A 4E4LA 4FYNA 4CD0A 4MHAA 4QMMA 4FIGA 4QP9A 4FIHA 2Z7RA 3VNTA 4FTTA 4EJ7A 5HLNA 3FDNA 4NTSA 2WTJA 2OZAA 4I21A 5CQWA 4KBCA 3T9TA 4AZFA 3UIBA 4Q2AA 4YZDA 5JGAA 2YZLA 4FKOA 3SC1A 3QD4A 3S2PA 3QTQA 3H0ZA 3BWJA 3RCJA 4H58A 4MBLA 3LHJA 4IANA 4EJNA 2YN8A 4QT1A 3W16A 2UVYA 4DFZE 3GU5A 4F9YA 3DA6A 5LQFA 3FWQA 4Q9ZA 3CE3A 4UZHA 1KE9A 1PXJA 4D0WA 1KE6A 3FLYA 5CWZA 3R8PA 4EKKA 4AFJA 3MGYA 3B8RA 5M4UA 3JY0A 2YDKA 3C0GA 5IEYA 3Q96A 5AWMA 3RHXA 3V5LA 4H05A 1H0VA 4IZ7A 3HYHA 4AZVA 4U80A 5M57A 3V8SA 3DB8A 3VS0A 3F3VA 2WFYA 4G9CA 1U54A 3NW5A 4U43A 3E8CA 4FEUA 1KOAA 3KMMA 4I24A 3R21A 4O0VA 3E5AA 2VTRA 3FLNC 3NNWA 3SRVA 1QPJA 3G9NA 4E7WA 5K4IA 3ZC6A 4QP7A 3U9NA 4OUCA 4EQCA 2R3HA 2XBJA 4G9RA 1BL6A 2FA2A 2HW7A 4B0GA 5B2LA 5C4KA 3AC2A 4D2PA 2CLXA 2UW0A 5DPVA 1T46A 2PVYA 3VHEA 2WMRA 4FSUA 2WOUA 3GT8A 5CSHA 5KE0A 4IFGA 1PHKA 3I81A 3R7IA 1WBPA 3ANQA 1Q8YA 3L8VA 4RLLA 5H3QA 3LFBA 4V0GA 2XK8A 3CXWA 4D5KA 3DY7A 3D0EA 5C4LA 2ZV9A 4G3EA 3V5TA 2QI8A 3A8WA 2A27A 3BEGA 2OJJA 2C0TA 2CN5A 2QOOA 4IWQA 4O7RA 2QCSA 5LWNA 3F66A 4KB8A 3I0OA 5KBQA 5A4EA 3PXYA 2PYWA 3Q9WA 1ZY4A 4QPMA 1H1RA 5HTIA 4HVDA 3NNUA 3OC1A 1BYGA 5CU4A 3UMWA 3TNIA 1P14A 2X81A 3NYXA 3B2TA 1ZY5A 3WIGA 3H0YA 5JRQA 4EYJA 3O0GA 3FHIA 3W8QA 5EI8A 1Q8TA 2ERZE 3IW4A 5EQEA 3FPQA 4QTDA 5AV4A 1G8SA 4YJSA 4K6ZA 3C4XA 3FSFA 5B0XA 1KWPA 2PHKA 3QCXA 5DLSA 4BDIA 5K5NA 3DBFA 4F7JA 3VC4A 4EONA 2YIYA 4GCJA 3BYVA 4F65A 2YM6A 1OUKA 4GK4A 3U87A 3IGGA 3L9PA 3V6RA 4JLCA 4PMSA 1Y6BA 5HCYA 3DDQA 1M7NA 1UNHA 3V51A 4A07A 4NW5A 4I41A 4C2VA 3LQ8A 4FT5A 4IB0A 4IM0A 4I94A 4FKJA 5AR7A 3S1HA 3FLSA 1WBOA 3IS5A 2HXQA 5E91A 4F1OA 4YBKA 4A9UA 3R1YA 3BYMA 3P7CA 4M0YA 2CN8A 4ANSA 3VUIA 3MFSA 5ETIA 5BX0A 2W7XA 5FDPA 4S31A 3RPRA 4U45A 4F6UA 3PYYA 4BCNA 4HVIA 5IH6A 4EH3A 3FZRA 3TUCA 1XBCA 2VTAA 3OWLA 4CZTA 5I9XA 5LOHA 1B39A 2HW6A 4PWNA 4ALUA 3RPVA 5AJQA 1V0BA 3MWUA 3BE2A 5LARA 2XYNA 2VGOA 4FG7A 1W82A 4F1MA 1OL7A 2RF9A 3EN4A 5IA3A 1YXTA 4JX3A 1RW8A 3E3BX 4UXLA 3UMXA 4CMOA 1WAKA 2A0CX 2W5AA 5CF4A 2OG8A 2W1IA 4APCA 3F3UA 3OS3A 4CT2A 3ZLWA 5IQHA 1Q3WA 5J7BA 4XG8A 4AW0A 5FTQA 3FPMA 4O1OA 2YLFA 4K1BA 5HNGA 2P33A 3KMWA 3EZVA 4ANMA 4FVQA 3EJ1A 4BYJA 2UW6A 3Q52A 2OXDA 4WUNA 1XH7A 2FO0A 3AD6A 5EYKA 3AT4A 4DGGA 5A4QA 2H6DA 2QQ7A 1TQIA 4JOAA 3DU8A 1QPCA 5EW8A 1FMOE 1XBAA 4PL3A 2V7OA 4DTBA 3G6HA 2F7XE 3OFMA 1PXNA 1E1XA 5EOBA 5I0BA 2YM3A 3R0TA 4G6NA 2QKWB 4AE9A 2I0EA 4BCKA 3ATTA 3MH3A 2W1GA 2XM8A 3CJFA 4R7BA 3L1SA 4MXYA 4Q9SA 1PXIA 5L8LA 4QYEA 3WOWA 4U3ZA 2YJSA 3E8NA 2WMBA 4S33A 5J9LA 5KO1A 3ET7A 4EOLA 3SG9A 4DGNA 4R7IA 3D15A 3T3VA 2WIHA 4BBMA 3SV0A 4FZFB 5HE3A 5E8XA 4K8AA 3U4WA 5HEZA 4B99A 4E5WA 2WQEA 1F5QA 3W8LA 1K3AA 4I1ZA 3QC9A 3WZJA 4YC3A 3G15A 3LQ3A 5I9ZA 5HD7A 4BDFA 3GGFA 4U0IA 3VBQA 4DFNA 4PTEA 2BZJA 2C3KA 4C8BA 3HDNA 2C6LA 3LIJA 4FIIA 2A19B 2IZTA 4L68A 2OBJA 3A7JA 5GJGA 3ZEPA 4DEDA 2G2FA 5A14A 4O83A 2QLQA 5FM2A 4QTAA 5AX3A 4E3CA 3PPKA 4RVLA 5IMXA 2OO8X 1YOMA 2C5XA 2CCHA 3NSZA 3NUNA 1YVJA 4AT3A 4BZDA 2R3MA 4QYGA 4F99A 3MPAA 5IA2A 5HBJA 3GXLA 2EXEA 4HGSA 3UZPA 4B8LA 4H39A 4C36A 2FB8A 5DRDA 4QMYA 1CKJA 2O0UA 4EC9A 3QCSA 2VWYA 4M0ZA 4UV0A 4O1PA 1CKPA 2BROA 4BF2A 4H36A 4EUTA 2ITUA 3R04A 2PZIA 3KVXA 3QTIA 4WNOA 2HCKA 3ZSHA 4TKSA 4ACCA 3R22A 3NNVA 2ITQA 3HMMA 5L8JA 5AV2A 4C2WA 4XMOA 2IG7A 5IISA 1S9JA 2ZV8A 3HUCA 3JPVA 4DITA 4WO5A 3I7BA 3IPHA 4FEVA 3QTRA 3OF0A 3QYWA 2GTMA 3D5XA 5EI6A 5TF9A 3Q04A 5LJJA 2JDRA 2PY3A 2CNQA 3CKXA 2ESMA 4UWCA 5JQ8A 4RIOA 3LXNA 3VBVA 4JG8A 4QMPA 3RK5A 4AW2A 3ELJA 3TZ8A 3G5DA 3LXKA 1NA7A 5JRSA 3I0QA 5I9WA 4YPDA 2HWOA 3B2WA 2E9NA 1WVXA 5BUJA 2JIVA 3EQPA 3MS9A 1ZZLA 3DQWA 2BAKA 2F57A 2G01A 2XUUA 2ZVAA 3FYJX 3PG1A 4BI1A 5ITAA 3HP5A 2J0LA 3QALE 2Y4IC 4J98A 4R8QA 4C3FA 3KQ7A 1YI6A 3BBTB 4ZJJA 4Z16A 3E92A 2ZMCA 4RA5A 5DHJA 2G2IA 2DUVA 2Q83A 4A4OA 2HZ0A 3KXNA 2GFCA 4ONAA 5JSMA 4NT4A 3R6XA 4YZMA 4WRSA 5AIKA 3VBWA 4HYSA 4M67A 2IWIA 2H96A 3F69A 3FMNA 4GEOA 4I5MA 5K5XA 4FNZA 2YITA 4L7SA 2BFYA 3FI2A 2VWVA 5M55A 5EYCA 3FJQE 1OIQA 2JDOA 2VAGA 5FRIA 3NW7A 3SXFA 4MVFA 1SZMA 5G6VA 3U8WA 2GNJA 1FPUA 2RFSA 2VTHA 2XZSA 4QPAA 3VW6A 2C47A 3HLLA 3WF5A 1FVTA 4D1ZA 4YU2A 2O65A 3PRFA 3VS2A 3D5WA 3MB6A 5TO8A 3R7UA 3C1XA 2C1BA 2WNTA 4O6LA 4XP0A 3SAYA 2IW8A 2ZB1A 3A8XA 3ACJA 3H9OA 3COKA 3NAYA 4G16A 3MIAA 5A3XA 4BGGA 3GCQA 5KKRC 3PJ2A 2HAKA 4WBBB 5AP0A 4XV3A 3TTIA 5F95A 4ANNA 1PRYA 1NY3A 3OCGA 2W9FB 4YP8A 3EWHA 3R2YA 2DWBA 2XIXA 3DKCA 2BRMA 4PQNA 3WZEA 5H8EA 4ANLA 5FEEA 3WF6A 4DLIA 2PMLX 3WZKA 2R64A 5C27A 3K3IA 4FR4A 1KE8A 2C3LA 4CG8A 2UZBA 3OW3A 2YWVA 4OAUC 3U55A 2BZIB 4JS8A 2XP2A 1YHVA 4I6BA 5KKRB 4FI1A 3AC4A 3PVWA 4TWNA 4ANBA 4RWJA 2NO3A 2ITTA 3BYSA 4JDHA 3UC3A 3WE8A 3TIZA 5HTCA 2XK7A 4USDA 3BHVA 2XB7A 1IG1A 1YXUA 4H3QA 4WNKA 4X3FC 4ZTSA 5LMAA 1IRKA 1H25A 4QRCA 5FEQA 1ZMUA 2UZUE 3MA3A 2PULA 4KUJA 2W0JA 1REJA 2EUFB 4LV5A 3H10A 3OHTA 4XNEA 3BHYA 3SX9A 3QTUA 3LFQA 3CR0A 3BQRA 4NL0A 3DT1A 5CAPA 5HLPA 1M2RA 1WBVA 1JNKA 4QP1A 2C6KA 3VS5A 2CKOA 3NVKI 5CSPA 4X3FB 3C50A 3ORTA 4RLKA 3A4PA 2VO7A 5DR6A 2BCJA 5IUGA 4LI5A 2VO0A 3PA4A 4RX9A 3EB0A 3QBNA 5DRBA 4YGAA 2E9VA 4O7VA 3E7VA 2XEZA 3QQGA 2P2IA 3CKWA 4OW8A 3ZZEA 5HE0A 2XRWA 5J7HA 1MRUA 4U3YA 4GT5A 3K5UA 4AFEA 3ACKA 5B2KA 2IJMA 4D4YA 3QQJA 5BUEA 2ZV2A 4GU6A 1H24A 4QO9A 3RM7A 3LOKA 1PMVA 3T3UA 3ZMMA 2B55A 1DI9A 1H27A 3HV3A 1FOTA 1G3NA 1YI4A 3PSCA 3PY0A 4L3LA 5E8SA 1CTPE 3FXWA 4L6QA 3W2QA 5IDNA 4FTUA 4KIKB 3COHA 5HHWA 5I9YA 5JFVA 5CQUA 4IEBA 1O6YA 2QODA 1Y57A 4DFXE 1REKA 4GMYA 2PZRA 5HG8A 4IMYA 4PP9A 3SQQA 1H1QA 4QTBA 1H07A 4UB7A 3WYYA 2YJRA 4B8MA 4BB4A 3BKBA 2X9EA 3AQVA 3U4UA 1OVEA 2UW7A 4K9YA 5J1WA 4LMNA 5FBNC 4JVGA 5LVLA 4D4VA 2V55A 5DWRA 4ZSLA 1PXOA 3F9NA 3NDMA 3KRLA 2QKRA 4QMLA 4GYIA 1M14A 1AQ1A 2OU7A 4MNEA 4XBUA 3H30A 4UZDA 5LCKA 3QWKA 3TZ7A 3AD4A 3SD0A 4YZCA 5I4NA 5BYYA 2AUHA 2QHMA 3FMEA 3GNIB 2IVUA 3KN6A 2BMCA 2HY0A 3G33A 4RGJA 4ZJIA 1H4LA 5CVGA 5HX8A 2CGWA 2YACA 4BKZA 4BCMA 3QTXA 3HV5A 4FKWA 1YOJA 3TKIA 2Q0NA 3GC0A 4FEWA 1ZOHA 2ITYA 4WG3A 4IW0A 2RL5A 2CGXA 5AP1A 3Q53A 2VO3A 1OIUA 1PXLA 3C7QA 4KIQA 5EI2A 3CS9A 4MCVA 4UYNA 3TEIA 2QURA 3ZRKA 3MTFA 4NSTA 4BDKA 5C8NA 4L9IA 5HE1A 1YXVA 3F2AA 4L44A 4AA5A 5GJDA 5JEBA 1LR4A 1YHWA 2UUEA 4FIEA 2YIRA 4ZTRA 4D2TA 4PNKA 3HKOA 1VJYA 4AOIA 4EKLA 5CF6A 2GNIA 4NIFA 4D2RA 4Y95A 4TT7A 4YTIA 4F6SA 1UA2A 3KCFA 5CU3A 4YJOA 3F3ZA 4RJ3A 2IN6A 3BV3A 3E7OA 4FSYA 2X39A 4FNXA 4V01A 1KSWA 2B54A 5FUTA 4U8ZA 5CT7A 4UMPA 3F5UA 4EH9A 4QQCA 1IA8A 1YXXA 2X6DA 2OJFE 5JKGA 4U6RA 3W2CA 2WXVA 4OBQA 5CT0A 3VF9A 4GL9A 4CXAA 4EZ7A 1ZAOA 3MJ1A 2GHMA 2C69A 2VTJA 4OTDA 2J7TA 4EOSA 1UV5A 4U81A 1LEZA 4C4FA 4IBMA 4QMTA 2QO2A 3UO6A 5IF1A 1GZ8A 3PVGA 1JOWB 4O0RA 4IAYA 4DA5A 1WVWA 3IO7A 1FQ1B 1VEBA 3QRJA 4AN2A 3AC3A 2HELA 3PIYA 2PWLA 3G0FA 4ZEGA 3IW6A 5HE2A 3DAJA 2W1EA 3WBLA 4NK9A 4BRXA 4E4NA 2B53A 3TV4A 4L67A 5M07A 1NVQA 4P2KA 3PXRA 3TWJA 3I5ZA 2AC3A 1YWNA 1IAHA 2OH4A 4QP3A 2IO6A 3IDBA 3HP2A 3IW7A 4JQ8A 4WUAA 4AOJA 4E6AA 3N4UA 4CLJA 3BE9A 4GVAA 4TYJA 4CV9A 4BZNA 4QNYA 4HCUA 2F7ZE 5HKMA 3ATSA 4AZEA 3S95A 3L9NA 5AUYA 2XNMA 3QD3A 4H1JA 3VF8A 2XNGA 3LJ1A 4GRBA 3FAAA 4BY9E 4LQMA 3ZUTA 4O0YA 5D1JA 4ZTLA 3R28A 3CGOA 1YRPA 3NNXA 5K0KA 4DF3A 4EL9A 5D12A 2J0KA 3ZCLA 5K9IA 3TXOA 2C5NA 4FEQA 3VS4A 3UYSA 3Q5IA 3BI6A 3KXXA 3IW8A 4KRCA 5EK7A 4QPSA 4PMTA 5HICA 5L2QA 4CZYB 1ZYDA 4FTAA 1I09A 4JAJA 4ASXA 4BCJA 3T8OA 3DJ5A 4E26A 1H1PA 3OOMA 3EYHA 4I22A 5L2TA 2GTNA 4FSZA 2WTWA 4O81A 4AGCA 4TYHA 2ZDTA 4H1MA 5IH4A 2A2AA 4TYHB 5IQAA 4O7LA 5L2WA 3CD3A 3BEAA 4FKGA 3FE3A 3UOLA 4U9AA 3OY3A 3QRTA 4G31A 2GS7A 1XJDA 1GY3A 1OZ1A 3ZZWA 4XG3A 3MB7A 2I0VA 4FYOA 2XCKA 4CSVA 2X8EA 3PE2A 3QL8A 1G8AA 1MUOA 2CMWA 3R9NA 1Y8GA 3OEZA 1OBGA 2BALA 1ZYJA 2YFXA 3GU7A 1BMKA 2XNNA 3OUKA 3QGWA 4RIWB 3RPOA 2B9FA 4G5JA 3FEGA 2F4JA 3CY2A 3QUPA 5AAFA 2VTLA 4NM5A 4PL4A 3NEWA 3P08A 5CENA 3QFVA 1FVVA 2J0JA 3Q9YA 4WD5A 5DR9A 5ANKA 4A9RA 3G2FA 4FSQA 3UVQA 2EU9A 2RG5A 4D4SA 3UG1A 4AN3A 4O38A 4E6QA 2OF4A 3FLQA 5GZ9A 1UKIA 3DK6A 3PDTA 4PP7A 4W4WA 3GCPA 3MPMA 3JXWA 2XJ1A 2YEXA 5M53A 5FWKK 3UZTA 4BZOA 2Y0AA 3QD2B 3H9RA 4L7FA 4PRJA 4FTLA 4D2VA 4UYAA 2C6TA 3TIYA 4MEDA 4RJ6A 5BVEA 2XIYA 3D2IA 3BU6A 3PSBA 4ENYA 4F9CA 5KMLA 3BELA 4APPA 4QYFA 4BR3A 2VO6A 1URCA 2BAJA 3HVCA 3PIZA 1JSUA 3EOCA 4EOKA 5IEVA 1HCLA 3PY3A 3FXXA 5KBRA 4KAOA 5CTPA 2JDSA 3OROA 5IA0A 2REIA 5DT4A 4ERWA 3GFWA 4PX6A 4O2PA 2W1FA 3HAVA 3BPRA 2RFEA 4JDJA 3DFAA 3VW8A 4FL3A 2Y6OA 5ANIA 3BV2A 2YA9A 4L3JA 2QR8A 4PPAA 1JKSA 3GB2A 4AP7A 4DE4A 4F64A 5HO6A 2UZNA 3P1AA 3VULA 5L6OA 2B1PA 2BRHA 2WTKC 4C3RA 2PVMA 3VO3A 1UNGA 4MD8E 4TRLA 4YJPA 1Q61A 4BCQA 3H3CA 4EZ3A 1YXSA 2XNBA 3EFLA 1RJBA 3MH0A 3NIZA 3UC4A 4AW1A 4D1XA 5M51A 3LFAA 3C4FA 2VGPA 3F2NA 4MF1A 3QQHA 4BWPA 4LRKA 1FGIA 2W1ZA 4CEGA 2VX0A 4IJPA 3CPBA 5AV1A 3DLSA 4FV6A 1GAGA 2XNPA 3DFCB 3R63A 1YKRA 2OGVA 4FV2A 4JQEA 2ZMDA 4BIDA 4QMQA 3RHKA 2WTKB 4P7EA 4HYIA 1JSVA 3C9WA 2O3PA 4KSQA 3CSVA 4FTJA 1ERKA 2R3FA 1YI3A 1TKIA 4DTAA 5JFXA 2VUWA 5EOLA 1WZYA 3W2SA 4CRSA 1KE5A 4RJ8A 3UQCA 3Q4UA 3AG9A 3DBEA 2GS2A 3NX8A 4TZRA 5AR3A 5T3QA 2B9HA 5IEXA 5CXHA 4W4XA 5HNBA 3TI1A 4JQ7A 3LPBA 2C3JA 3ORIA 5E8UA 4JT3A 2R3NA 4J96A 3SHEA 2OZAB 3QQUA 4X6RA 1L3RE 3MJ2A 3NUUA 4FF8A 2X9FA 2WTCA 2WPAA 2YCSA 1NXKA 3ORNA 2JITA 5CS6A 3ORZA 3KRXA 5CY3A 5AR8A 5GIPE 5J5SA 3WF7A 3DCVA 5E8YA 3EL8A 5E4HA 1KE7A 2VTMA 3MH1A 5I5ZA 2PVLA 4XG7A 3EQFA 1JPAA 3O51A 5EDQA 1UWHA 2X2KA 2VTOA 2YAAA 4RC2A 3ZO3A 4DGMA 4PDOA 3EN9A 4F9AA 4ZZNA 3D83A 1OB3A 4GUBA 4DTKA 4TWOA 3THBA 4C34A 1U54B 2GNHA 2ITOA 2OKRA 2WMVA 4YC6A 3Q6WA 3VWAA 1QMZA 3RK7A 4CFUA 4ZLZA 3II5A 4D2SA 4ORKA 4AF3A 4K0YA 2C3IB 1NVRA 3NYVA 4KRDA 4QMOA 1WBTA 3FSKA 4U40A 4YPSA 5KZ0A 2OFVA 3D5VA 3R7YA 3SRVB 3ZFMA 4EWQA 4DGLC 4Y5HA 5FDXA 1YQJA 3ZFYA 2ETRA 4AE6A 3LZBA 4ITHA 2QNJA 2GQGA 3ZBXA 3CTHA 2ZJWA 4ZSAA 4LGDA 4AUAA 2UVXA 2JLDA 3KU2A 1GZKA 3L8SA 3G90X 3QYZA 5BMSA 1ZMVA 3E87A 3KVWA 4G6LA 2CNVA 3BQCA 5H9BA 2C4GA 5CNOA 4I20A 3DK7A 4YLJA 5A6NA 4IC7A 4V0GB 3ZHPC 1XH6A 4F7SA 4TNDA 5LMBA 3P4KA 2OSCA 5J79A 4GW8A 4N4SA 3AMYA 4TN6A 4CCUA 4OTPA 3HV4A 5TKDA 3LLAA 2B4SB 4G6OA 3UZRA 2O2UA 5ACKA 5FD2A 4BCHA 3FZSA 3S3IA 2SRCA 4IAZA 3FZTA 2WQMA 3VIDA 5CAQA 1B6CB 4RG0A 4Q5EA 4C35A 4QQJA 4DFYA 3AGLA 3O7LB 2WTIA 3COMA 4ASDA 5FTOA 2X2MA 2UW5A 3MTLA 3N51A 4IVAA 3D7TA 3LE6A 2GDOA 4DEAA 5E90A 2VV9A 5FQDC 4XRLA 4CKIA 2CSNA 1CSNA 2W9ZB 4LGGA 4NM7A 3AC8A 5E1EA 4CFNA 4HJOA 3FI3A 3R7EA 4IB5A 3MSSA 3NZ0A 4KBAA 3GCUA 4I4FA 3SXSA 3AMAA 5CANA 3FY2A 3BGPA 3R9HA 4ID7A 1M2PA 3VUGA 3C5IA 2WGJA 2RKUA 4TY1A 3FL4A 4S2ZA 3W33A 2XRUA 3PRIA 2ZM3A 3LFNA 4QD6A 1OKZA 5A4TA 3SKCA 4UALA 4YJVA 4WHZA 4EH7A 3A62A 2GCDA 1BI7A 3DAEA 1WBNA 4I0RA 3VQUA 2Z7QA 3AGMA 4OR5A 3GU8A 1H26A 5M56A 2EVAA 4KSPA 4YC8A 5HX6A 4YZNA 1ZWSA 3MFUA 4BYIA 4YTFA 3HECA 5M4IA 4QQTA 3IQ7A 5D7AA 5AUTA 2X6EA 2HOGA 4O21A 4RJ7A 4GT3A 4XG2A 4JL9A 4XYFA 4ACHA 4JBVA 4FX3A 4CG9A 2NPQA 4ZXTA 2XKEA 3QQFA 4XEYA 3UIUA 4CKJA 3U9CA 1CKIA 1QPDA 3BLQA 4BCPA 2R3IA 4FZAB 5M44A 3IDCA 4C4IA 2FSOX 2XK9A 3IW5A 2WQNA 4MWHA 4R3CA 1GJOA 2XK4A 4X2FA 4YHFA 3MESA 4GKHA 2X7GA 4ZS4A 1M17A 1Q5KA 4EOQA 2ETKA 2R0UA 4B9DA 1XH4A 2WZJA 3UPZA 3QXOA 5CF8A 5K3YA 3PY1A 4R3RA 1KV2A 3P79A 2R4BA 3QX2A 4O96A 1FMKA 1P4OA 3QTWA 5ANJA 4AN9A 4AOTA 3GEQA 5IQEA 5AUVA 4IQ6A 3GOKA 4IVDA 4PPCA 1Q41A 5HZNA 4DH3A 2WMTA 5BVFA 1VZOA 3EKKA 3KULA 3R02A 4GG7A 4QP4A 1BKXA 2UZTA 4KKGA 4NH1A 4ALVA 4I23A 4Z9LA 4F7NA 3VS3A 3QF9A 2QOFA 2JBOA 3LJ2A 4TWCA 4ASZA 4C4EA 3BZ3A 3V5JA 2BDWA 2QVSE 4WOVA 2XJ2A 4BHNA 3E62A 5F1ZA 2NRUA 3TZMA 5GNKA 5FXRA 5EHOA 4QP8A 4FK3A 2XJ0A 3WYXA 4WT6A 4EOJA 1XR1A 2DS1A 4FC0A 3KXZA 4J97A 1MRYA 4JRVA 4UMRA 3FXZA 3RNYA 2JIIA 3FZ1A 5EW3A 3OD6X 4HZSA 3ODYX 1JVPP 2YAKA 4DEGA 4RPVA 3LXLA 2QU5A 4F70A 4AAAA 3D14A 2CLQA 2ONLA 4RQKA 4CNHA 3LM0A 4S34A 4MD7E 4XBRA 4FG8A 4BKYA 4HYUA 5A4CA 3ZU7A 3QGYA 3F5XA 3RVGA 2W17A 3CIKA 4QNAA 1U4DA 2OF2A 2ZM4A 4Y5QA 4FA2A 2HIWA 4JXFA 3OY1A 2ITZA 5CSVA 2C6DA 5CX9A 3WZDA 5KX8A 3IDPA 2P2HA 3OWKA 4D28A 3GFEA 5M06A 2V7AA 1H01A 2W5HA 3GP0A 2RFDA 4Z55A 5C26A 3HRBA 3GUBA 4MK0A 3W32A 3WF9A 2BAQA 3I7CA 2GHLA 4ZS0A 2UW8A 2R2PA 4ZTHA 2VTPA 5IMEA 4AWIA 4B6LA 2WD1A 3FZOA 4AS0A 2WIPA 2J50A 2HK5A 4O6EA 2C0OA 3RP9A 3M42A 4HZRA 4HGLA 1YDTE 4HYHA 4XG6A 3EKNA 3FMLA 3ZONA 5DEYA 1ATPE 2XEYA 1Q99A 3KFAA 5IUHA 3G51A 4E4MA 4J1RA 3QZGA 1R0PA 5HGIA 1BI8A 2QO7A 2O64A 4IB1A 2VTQA 3DZQA 3ZFXA 4BBFA 5L8KA 4JR7A 5DT3A 2YHVA 5BVDA 4CTCA 1OL2A 3HA6A 5CVFA 4YSMA 1IR3A 4IB3A 3DKFA 3BLRA 4UMQA 3I6WA 4FTOA 4FT7A 4AT4A 4MX9A 3HRCA 4MXAA 4BDDA 2IVTA 2YERA 4BDAA 3U6HA 2BZKB 3V8TA 2I7QA 1ZYLA 2CGUA 1UU7A 5L3AA 3O8UA 3NS9A 2GMXA 2H8HA 3KF7A 3Q9XA 5CNNA 3FMKA 4CZUA 4EK5A 2ITWA 3KF4A 4CFXA 3QX4A 4BDHA 2UW4A 1U46A 2YZAA 4AT5A 4E73A 2DQ7X 4WSYA 3RAHA 2HY81 3RJCA 4ERKA 2QG7A 5DYJA 3PLAE 2PMOX 2Y4IB 4UMUA 4BDJA 4PDPA 3PJCA 2Y4PA 2HZIA 4PMMA 4ALWA 3LFSA 2QLUA 2WAJA 2FSTX 4PTGA 2BUJA 5KNJA 3OT3A 4RZWA 3NPCA 1ZARA 5DBXA 2IW6A 3PVUA 2OJIA 3R1SA 4IAKA 4PY1A 4RVMA 3K54A 4YJRA 1OI9A 1SMHA 2R9SA 5E8WA 4YMJA 4EHZA 3KGAA 3R1NA 4L45A 1Z57A 4JG7A 3RM6A 1Q8ZA 2I40A 3FV8A 5JFSA 2EWAA 4FTMA 4BDGA 3FUPA 4MD9E 4OTFA 3V01A 4FV5A 4DYMA 2QG5A 3BX5A 5HU3A 2A4LA 3G6GA 4JNWA 4DHFA 3ALNA 5KZIA 3CTJA 4FODA 5D41A 3RPSA 4BDBA 1PXKA 4XH6A 2BVAA 4DH1A 3BLHA 4F08A 3S0OA 5GIOE 3ZXTA 4YUQA 2IZUA 3ZTXA 1MQ4A 3ZDUA 4EH6A 3AOXA 4QTEA 4LGHA 2XA4A 2NP8A 5DH3A 3WILA 4C59A 2RFNA 5HTBA 3CBLA 3O8TA 2PZPA 2VTIA 4ZSGA 3A61A 3FQHA 1V0PA 2P55A 2X8DA 3DOGA 3SOAA 4HPUE 5DI1A 1JWHA 2JFMA 5LMKC 2JAMA 5HLWA 1PMEA 2BKZA 3WF8A 3SLSA 4FKPA 4FK6A 2BR1A 5KUPA 2C5VA 3U6IA 4FKUA 3BGQA 2R7IA 3EZRA 3GQIA 3SVVA 4BC6A 3BGZA 4FMQA 3VJOA 2QOLA 2C5YA 1YWRA 5IH5A 3I6UA 3KEXA 4IIRA 2VNYA 1YDRE 3R30A 5LMKA 4BWKA 3O7LD 5F20A 4OT5A 1CM8A 5ANEA 2WTDA 4GIHA 4BGQA 5DN3A 3UO5A 5HU9A 4DAWA 4M12A 1J7UA 1KV1A 4M69A 2XK6A
chains in the Genus database with same CATH superfamily
5J9ZA 3C0HA 4NFNA 3NGAA 3EFWA 1MP8A 1OKYA 2J51A 3MIYA 4M69B 1GZOA 5LVOA 4YJUA 3F82A 3IECA 1OKWA 4AGUA 1SYKA 5I3OA 1OPJA 2HWPA 2WELA 3PIXA 2OIDA 4BGHA 4CMTA 3ORKA 4LM5A 3SOCA 3BWFA 3ZO2A 1IA9A 3TUBA 2CPKE 4FSWA 3T9IA 1M7QA 4EH4A 2C6IA 4G3FA 3V5WA 5DMZA 2RG6A 4BCFA 3C13A 5AEPA 2PUIA 4E8AA 4F9WA 3Q3BA 3C4WA 4GV1A 4O22A 4Y8DA 3R00A 5AX9A 1OM1A 4X0MA 4ZSJA 4YHJA 3UO4A 4AX8A 2ETMA 5BQ0A 3FL5A 5AIRA 3IGOA 4QDEA 4FICA 3VBXA 4HNFA 5CSXA 3DZOA 4P5QA 3REPA 4IX6A 2FVDA 2GNGA 4JAIA 3D7ZA 2GS6A 4TW9A 4BL1A 4UBAA 4A4XA 4YJQA 2PSQA 2ERKA 4RSSA 2XVDA 3CQEA 3HZTA 3R8VA 4ENXA 3R1QA 5C1QB 5IU2A 3OEFX 4FV7A 4K77A 3DBCA 4TXCA 5LCJA 4BVUA 3ENHA 4YLKA 3MN3A 4JDIA 5ICPA 3C4ZA 1J91A 3LCTA 4MNEB 2WTVA 1MRVA 3M11A 3UOHA 3TUDA 4PMPA 3DS6A 2ITXA 3KKVA 1STCE 3DTCA 4R1YA 4ZMFA 3FY0A 1ZZ2A 3C0IA 2E9UA 4MWIA 4FEXA 2BDFA 3OXZA 5HI2A 4O7TA 3FI8A 3SGCA 4HCTA 3QKKA 5C9CA 3R7OA 4YO4A 5JZNA 2Z7LA 2CKPA 1RE8A 4XHKB 4O0UA 4FKRA 4BKJA 4RQVA 5D7VA 3EH9A 1TVOA 3OMVA 5LWMA 3L9LA 2WHBA 4USEA 3AKKA 1GIHA 3NAXA 2J5FA 3M1SA 4H3PA 3V8WA 3LMHA 5HIDA 2VX1A 2JDTA 2ZYBA 3UNKA 3P86A 4FTKA 3BL7A 4FV3A 3TG1A 1W8CA 3CQUA 1XBBA 4ANOA 5CEQA 3BHTA 3CLYA 5JGDA 4Z7HA 4NIFB 1BL7A 3TACA 3I60A 2J90A 3PA5A 3H4JA 4XUFA 3B8QA 5BUIA 4MUQA 1JLUE 2YCFA 2NNWB 5T68A 3LMIA 2QOKA 3UODA 4DG3E 5IQIA 5AAGA 4K18A 2E9PA 3MFRA 3EIDA 4V04A 5AUXA 3RBWA 4EOMA 5E7RA 2R3GA 3DXQA 1H1SA 1UU9A 4PV0A 2Z60A 5ANOA 2Z7SA 3W2PA 2R3RA 2OJGA 3TV6A 3VRZA 5F9EA 3PVBA 4KIOA 4UX9A 1OL1A 4QP2A 1PF8A 5IPJA 4JX7A 3OVVA 4EHEA 4NM3A 5DA3A 4FNYA 4O27B 3VUMA 3UP2A 3TKUA 1V1KA 3RPYA 1V0OA 2O5KA 5EDRA 2HENA 2XNOA 4O0WA 3W0NA 2O8YA 4DEBA 2A98A 4KA3A 4XLIA 1ZMWA 2QC6A 4TNBA 1APME 2V5QA 3PWYA 2R3LA 3IK3A 2JDVA 3PXFA 4FBXA 4I0TA 5IA4A 5EQYA 5LVNA 3QZFA 2AEGA 2PUPA 4ZLYA 2VWIA 3FQEA 4O4FA 4WA9A 5E8TA 3DGKA 2BFXA 3Q4TA 5ETCA 3ITZA 3HX4A 2WU7A 3DV3A 3WI6A 5IQCA 4FVPA 5IZFA 4MH7A 4C37A 3RK9A 3LKMA 3V5PA 2W96B 4IM2A 4RIYA 5D10A 3N4TA 2IVVA 1OECA 2YIQA 4JIAA 5DGZA 1OIYA 4XX9A 4ZP5A 2VZ6A 4OTGA 1SM2A 4UEUA 4LUDA 1HOWA 4XV1A 3MVJA 4TTHB 1PYEA 4U97A 3C5UA 3FMDA 3KY2A 5E8ZA 5AUUA 4FTIA 4IVBA 4BCIA 1X8BA 4LOQA 4QMVA 1B38A 4XLVA 3RGFA 4D9UA 4EH8A 5HO7A 3ZO4A 3ULIA 3Q5ZA 3ERKA 2IZSA 4XV9A 5HESA 5GJFA 5IUIA 2P0CA 3W2OA 5FP5A 3TKHA 5AP7A 4MXXA 3PUPA 3R73A 3TJCA 3C4CA 3NCGA 3ZRMA 2WQOA 3F3WA 3FHRA 3KRRA 4S32A 5AP5A 4BCGA 4QMNA 5A9UA 3GC9A 4YNEA 4C38A 3DJ6A 1H0WA 1BLXA 3NUSA 1JQHA 4LRJA 2EXCX 5BPYA 2XM9A 4BI2A 5F4NA 4WIHA 4G2FA 3HEGA 2OXYA 1DAYA 3O23A 3PWDA 1LUFA 5ETAA 5L2IA 1WCCA 4IE9A 4R6VA 4RIXA 2WMUA 5CSWA 2JKMA 4GKIA 4KABA 1SVHA 1U59A 5HVYA 5EKNA 3DNDA 1AD5A 5L2SA 1L8TA 2JKQA 5CU2A 3LJ0A 4IX4A 4CGAA 3VUHA 3FBVA 5E9EA 4HGTA 4Y72A 2E2BA 3W0QA 3NIEA 2BPMA 4LOPA 3PSDA 5HORA 1AGWA 4FSNA 2BRNA 3AXWA 4Y73A 4IHPA 3WE4A 4ZAUA 4O2ZA 2XIKA 3Q6UA 3MBLA 2Y6MA 1XKKA 3RALA 3KL8A 5EG3A 4M13A 5IDPA 5GZAA 2XAOA 4O7YA 3R9RA 2G15A 4NFMA 4DFLA 2IZRA 5AP3A 5CEIA 4IDTA 3KRJA 4EBVA 1FVRA 2O63A 3HMNA 4I4EA 3BU3A 1A06A 4YBJA 3SA0A 3CY3A 4M84A 4KBKA 4W8DA 1UKHA 3C4EA 3OWJA 5IQBA 2R3QA 2FYSA 3C51A 4QOXA 3HAMA 2VX3A 4FT3A 3QQLA 3OW4A 2VWXA 3UNJA 2VTTA 4BHZA 1KUTA 5IQFA 4EZ5A 3OXTA 2NRYA 3P23A 4LV7A 2XBAA 2BILB 4L00A 4NJ3A 5A46A 3UTOA 5ANGA 1T45A 1PXPA 4OTWA 2Z2WA 3VS6A 5DG5A 4GVJA 4CTBA 3KIOC 3UNZA 4G3DA 1GIJA 1PKDA 3ZSIA 5IA1A 1QL6A 3RNIA 4I3ZA 5DFPA 3R8LA 4ZK5A 4AZSA 3BYOA 3U6JA 4QEBA 3EQGA 4LL5A 5E8VA 4D55A 1WMKA 3A99A 3ID6C 4RRVA 4O82A 4DLJA 4FKQA 5FG8A 1UU8A 5A54A 3OZ6A 4FGBA 4LG4A 1XQZA 4ACMA 3MI9A 1OMWA 4CT1A 2VWBA 4GIIA 4MTAA 4RX8A 4M97A 4OTQA 5KMIA 2R3JA 3PJ8A 4G34A 4RWIA 2CCIA 4BCOA 4QMSA 3JVSA 3LW0A 4TYEA 3R7VA 2ZAZA 4FSRA 3QXPA 2PTKA 4EQMA 3QLGA 1OITA 3A2CA 1W83A 4ZTMA 4GFOA 2I6LA 4NYEA 1KOBA 4IZ5A 2ITVA 4FTCA 4F0IA 4J7BA 4MNFA 4ZIMA 4U41A 1OUYA 4BN1A 2CKEA 3GBZA 4KKHA 4AQCA 4AG8A 5LVPA 3W0SA 2YM5A 3G0EA 2GNFA 4BTJA 4DG2E 2YISA 1YWVA 4AXEA 3UOJA 3PXZA 3FKOA 5AP6A 4O91A 3SW7A 3DXPA 4IC8A 4QYHA 4CYIA 3NVMB 3OCSA 2CGVA 4WBOA 2I0HA 5JN2A 4AZTA 3FKNA 3IONA 3FLWA 3W0RA 3MY0A 4JI9A 3TT0A 3FMMA 4OT6A 5EKOA 3KMUA 4X2JA 1F0QA 3EQBA 3L8PA 2CNUA 4FKTA 5EDPA 4C02A 2G1TA 2OLCA 3Q2JA 3PTGA 4MXOA 2FGIA 3ANRA 1BX6A 1SNXA 3GQLA 3F7WA 3R8ZA 4E93A 1ZOGA 4FTQA 4BICA 3OCBA 1H8FA 1W7HA 2HYYA 4QMUA 3R71A 3FQSA 2OFUA 3A7HA 4U7ZA 4YTHA 5BVOA 3EQIA 4FIJA 2YDJA 5D9HA 4E4XA 5CU0A 3HGKA 4UWBA 3TL8A 4O0XA 3WIKA 4FSTA 4AGWA 2BIYA 2Z8CA 4II5A 4OTRA 2J0MB 3POZA 3ALOA 2GFSA 2WEIA 3UJGA 5C01A 3GU4A 4JBOA 2W4OA 2J0IA 4M68A 3E88A 4X2GA 5HOAA 3MVMA 4FT0A 4YHTA 4HVHA 5CEKA 2ZOQA 5DT0A 5AUWA 4I5CA 5HD4A 4AW5A 3RWQA 2B0QA 3PG3A 2PE2A 3IKAA 3QZHA 2J5EA 3PJ3A 4NUSA 4A06A 2WMXA 5AP2A 5T6KA 3PP1A 3A4OX 3R7GA 4IWDA 4RFZA 1O6LA 3QKMA 3QCYA 4XOYA 3VRYA 1G5SA 2XNEA 4E6DA 2UZDA 5I3RA 4AZWA 4IJ9A 4BBEA 3OT8A 1Q24A 4J8MA 4RC3A 3E93A 4DCAA 3OTVA 4IACA 3UDZA 4XOZA 4HGEA 4WG4A 2B52A 2OIQA 1XH5A 2YIWA 1OPLA 3SG8A 2J4ZA 3MV5A 4MBJA 2PUUA 1OKVA 2OW3A 1CMKE 3KREA 2H34A 2AC5A 2PVNA 3D7TB 3DAKA 1UVRA 5AMNA 4AXAA 2BTRA 5EM6A 5CZIA 2V22A 3Q4ZA 2BZHB 1Z9XA 5JT2A 4D2WA 4L43A 3A7GA 4EK3A 3DDPA 2XANA 2GPHA 4TYIA 4F09A 2OJ9A 1XO2B 2NYAA 3IOKA 4ASEA 4B4LA 4GU9A 3EN5A 4L46A 1XHAA 1WFCA 4YTCA 3OBJA 5EH0A 3ZXZA 4DEEA 2QOIA 4ITIA 4LFIA 4MKCA 5M4CA 2UZLA 4V05A 4P5ZA 3LFDA 3KA0A 3TM0A 1J1BA 4EYMA 5C03A 4GYGA 1P5EA 4EWHA 4FGRA 4JG6A 4O0TA 2Y7JA 3QU0A 2BRBA 5JZJA 3PXQA 4BJJA 3MFTA 4EK6A 2W99B 2W1CA 4O7WA 2CDZA 3VS7A 2E9OA 3OUNB 5TT7A 4ZSEA 1R1WA 3LXPA 4EBWA 3WARA 2JBPA 2WO6A 4KNBA 4ZTQA 5KMMA 2GQRA 2GU8A 2EB3A 3DTWA 3GENA 4WRGA 4FL2A 3ZUVA 3PE1A 2W5BA 4DCEA 5HVJA 2XH5A 3H9FA 3NYNA 4U44A 3W18A 2GQSA 2IPXA 1JSTA 5BMMA 3PFYA 5HVKA 3FC2A 4RFYA 5AV0A 1FGKA 4FZ7A 5AV3A 1BUHA 3L9MA 4RJ5A 3OG7A 4IH8A 5HBHA 4P90A 3GU6A 1URWA 2GHGA 3COIA 2WMWA 3VVHA 4NKAA 2ZV7A 5TR6A 3UE4A 3W1FA 5F94A 4EOOA 3R9OA 1G8KA 3A7IA 1Q97A 3Q4CA 1EH4A 2ZB0A 3Q60A 4C61A 3BYUA 3HUBA 5GHVA 2JKOA 1PJKA 3EYGA 3UDBA 2EXMA 5AR5A 4F63A 4BIEA 5BVWA 4BDEA 1YHSA 4BWXA 2ITNA 3LVPA 3E8EA 2FSLX 4MQ2A 2X0OA 4I5HA 5D11A 2W05A 4RVTA 4GSBA 4YJNA 3TZ9A 3LCSA 2R3OA 4G5PA 3OOGA 3UIMA 3RWPA 2BKKA 4Y85A 1SVGA 2YABA 3LLTA 3RAKA 4WG5A 1H00A 3V3VA 3NMUF 3FC1X 3LFCA 2HXLA 4RZVA 3S00A 3KULB 2PVKA 4PUZA 5CAVA 4NJDA 1W0XC 2PVFA 3PFQA 2UZWE 4FG9A 3AC5A 3P7BA 4GJ3A 2BRGA 2R0IA 3TV7A 2BHEA 4FKVA 2B9IA 3P5JC 4QDVA 4NEUA 2OIBA 2W06A 4EI4A 2WMSA 4F0GA 3BHHA 1OPKA 4I6HA 3ZS5A 3W2RA 2PUNA 4LRMA 4D4RA 4N70A 4DINA 1JKKA 3PA3A 4EC8A 4GUEA 2ONLC 4NWMA 4BI0A 3TYKA 4IWPA 4ZZOA 2VTNA 2V62A 3KXMA 5EFQA 4AA4A 3VBTA 4CQGA 5CASA 3R01A 2PU8A 5IQGA 3FLZA 2PMIA 2X0GA 4HCVA 5HIBA 5CU6A 4S30A 4J95A 3HMPA 1R0EA 3OTUA 4MBIA 2X2LA 3K2LA 4RWKA 3DBQA 1LPUA 4QQ5A 2W1HA 2AYPA 2IVSA 5DE2A 4USFA 5DR2A 2VTSA 3ZLSA 3MPTA 4L01A 4DH5A 2Q0BA 5A4LA 5CAUA 1HCKA 2W4KA 2XKFA 5AUZA 4EH5A 5EM7A 4F6WA 4EEVA 2BTSA 2C0IA 4JIKA 1Z5MA 1O9UA 3DXNA 2KTYA 2I0YA 4XJ0A 4FV8A 4FV4A 2X7FA 2C30A 4JDKA 2PPQA 4RVKA 2PE0A 4KKEA 4PTCA 1NVSA 4J99A 4FV1A 5FGKA 3UVRA 2XIZA 3JYAA 4R1VA 3N4VA 4F0FA 2P3GX 3S4QA 4NTTA 4X6QC 3D5UA 3NUAA 1IASA 1M52A 2IEWA 4FKSA 3NUXA 4O4BB 4KWPA 3N9XA 4C58A 4GG5A 5BYZA 3F5GA 4DFUA 4UN0C 2FUMA 5M09A 2QOBA 2YM7A 3P5KA 4YLLA 1VR2A 4DGOA 3F2RA 5M08A 1YW2A 1W98A 4FSMA 4IFCA 3FYKX 4FIFA 4LUEA 3UBDA 4PNIA 5L6WL 3QHWA 4BFMA 2ZDUA 5EYMA 4FV0A 4I6QA 3SW4A 3EMGA 4KS7A 1W2DA 5J1VA 4PDSA 3ZLXA 3KRWA 3JR1A 1W84A 4H3BA 5KMJA 3QA0A 2BIKB 2JKKA 3A7FA 4ITJA 4MXCA 1PKGA 5J8IA 3O71A 1U5RA 4X2NA 4HVSA 3DK3A 3UOKA 5AP4A 4JBQA 4ZLOA 4WNPA 4FE2A 3IOPA 4LDTA 5FEDA 1OL6A 3DKGA 2B7AA 4CKRA 4DG0E 3LM5A 4RFMA 2VWWA 5KCVA 4FZDB 1OGUA 4AXFA 1R3CA 2OZOA 3PZEA 1ND4A 4XS2A 3KC3A 5DEWA 5CI7A 5HCXA 5AFVA 1GZNA 2P4IA 2C6MA 4YJTA 4ARKA 4WSQA 2OI4X 2I1MA 2JGZA 5ACBC 3IG7A 2YLEA 5HG9A 2QO9A 4A7CA 4NM0A 4NZWB 4EHVA 2B9JA 5EM5A 4X21A 1O6KA 3QWJA 4OTIA 4R5SA 1DS5A 3PUFC 4F1TA 2C68A 2PK9A 5E1SA 2QHNA 3OXIA 3ZLYA 4BIBA 3KN5A 2OH0E 3MY1A 4CMUA 5IKWA 4TL0A 1PMUA 1LP4A 4P4CA 3QHRA 4C62A 1FINA 4XG4A 4PDYA 5FXQA 4ZOGA 3PXKA 3ORXA 4IAAA 5H8BA 1K9AA 4FT9A 3TJDA 4CCBA 5JFWA 2OWBA 3LCDA 1I44A 5K0XA 3MW1A 4C57A 4W4YA 1TQPA 3PP0A 5HBEA 3HMOA 3JS2A 3EN6A 3NRMA 4M66A 2YWPA 3NUYA 4XRJA 4TWPA 3VN9A 1XH9A 4OBPA 4L8MA 4U79A 1LEWA 1J3HA 5B2MA 1PY5A 2GNLA 1E9HA 2VD5A 1Q8UA 3MYGA 2QOHA 2UZEA 3DKOA 3QZIA 3CTQA 1SVEA 1E1VA 2QR7A 3VUDA 3W55A 2VU3A 3I1AA 3I4BA 4XV2A 3HRFA 4F7LA 2V0DA 3ROYA 1ZLTA 5G1XA 1VYWA 4OBOA 4EQUA 3MVLA 2YCRA 4UY9A 3FMHA 4WNMA 5K4JA 4FKLA 1Q8WA 2HZNA 4B7TA 3EQHA 3F5PA 5DNRA 2XARA 3MA6A 3UQGA 5J87A 1U5QA 4DT9A 5M4FA 5AR4A 5JQ5A 3ZYAA 3VS1A 2WU6A 1S9IA 3OBGA 4PF4A 3EQDA 4YURA 2JAVA 4ZTNA 4Y46A 4E5AX 5KHWA 3KK9A 4R3PA 2VWUA 2Y9QA 2J2IB 3BBWA 2FH9A 1Q62A 2RSVA 5DOSA 3PLSA 3LCOA 1GNGA 2G2HA 2BHHA 3F7ZA 4OLIA 4ZJVA 4OAVB 4N57A 4O7ZA 5J5TA 3VUTA 4DN5A 4U5JA 3NWWA 4K2RA 5GZ8A 3RAWA 4F9BA 4N6ZA 3U51A 3MY5A 2YDIA 5EQPA 3ZUUA 4GH2A 1R78A 4IWOA 3R2BA 4IADA 4LOOA 4A4LA 4DEIA 4ZY5A 4KD1A 2C1AA 1IAJA 4LYNA 5EHLA 2UVZA 1NT2A 3U54A 3M2WA 4UXQA 3D4QA 5CYIA 4G3GA 3QC4A 3RAIA 4HOKA 3MDYA 1GIIA 2HZ4A 2Y8OA 2XKCA 3PZHA 2YM8A 3QQKA 4X2KA 5L4QA 3MVHA 4DBNA 4UMTA 2PZ5A 1UWJA 5ETFA 5CAOA 4X3FA 5J95A 4K11A 3AMBA 3EFKA 5H8GA 3TN8A 3ENMA 1K2PA 3OCTA 5DVRA 1A48A 4YZ9A 2C6OA 1F3MC 3DLZA 5ANDA 2R3KA 5C8KA 3HMIA 4OTHA 5HG7A 5AADA 4FOCA 1Y91A 4F4PA 4GS6A 3GC8A 3ODZX 4A9YA 4R5YA 4IXPA 1PYXA 5CXZA 2PL0A 4XP2A 2Z02A 4WKQA 1RDQE 3GCVA 5AA8A 4I93A 4BTFA 1OIRA 4EOIA 5CZHA 4YO6A 4IDVA 3ZOSA 3QTZA 4EORA 1WBWA 4C4JA 5A6OA 5LVMA 5AM7A 1PXMA 3Q32A 4KIKA 4Y83A 3ZM9A 1DI8A 1H1WA 3VJNA 3LFFA 4TYGA 2YCQA 4FUYA 4IZAA 3LQ5A 3EQRA 4I92A 5AM6A 1MQBA 5HCZA 4QYYA 3D94A 3I5NA 1UU3A 4I0SA 3UG2A 4GFGA 4FV9A 3ULZA 5JMSA 5KMKA 1ZXEA 3BCEA 4D5HA 4YR8A 3CEKA 2JEDA 4IAFA 3QLFA 2QONA 1DM2A 3R8UA 2EB2A 2GSFA 2X8IA 4YSJA 1ZOEA 2J6MA 4W9WA 3TDWA 5TE0A 4C33A 5FP6A 4J53A 3HA8A 1J7IA 4DEHA 4Z7GA 3K5VA 4C4GA 2X7OA 3A60A 5LXMA 2QU6A 4M3QA 2X4ZA 4G3CA 3VQHA 1PMNA 2F2UA 4NCTC 3VHKA 3EFJA 4ZMEA 2XF0A 4PPBA 3F88A 3FZPA 4LMUA 5B7VA 3TDVA 3AD5A 1P2AA 3Q9ZA 3KK8A 3QA8A 4FL1A 2XK3A 3UPXA 4ACGA 5FTGA 4EHGA 3O50A 3VUKA 4NKSA 1JBPE 1YOLA 4AACA 4UWYA 3O2MA 4EH2A 1Y6AA 4NCTA 5KHXA 4ANQA 3P0MA 4RC4A 3NR9A 4CV8A 3DNEA 1ST0A 4BTKA 1QPEA 5HIEA 1JAMA 3ROCA 1DAWA 3QUEA 3ORMA 3G9LX 4IX3A 4HW7A 3BLAA 3ZO1A 4E6CA 1IEPA 3QRKA 4QP6A 5TOZA 2LAVA 3ZEWA 2PVJA 3TTJA 4D0XA 4O84A 3JUHA 5JK3A 3TNPC 3ETAA 2W1DA 4M14A 4AGDA 5BYLA 2UW9A 3QRUA 4N0SA 3P9JA 5EYDA 3KCKA 2QOCA 4FOBA 2PMNX 1J1CA 2CJMA 1NW1A 3JVRA 2CKQA 2JC6A 2R7BA 2IW9A 5AAEA 4E1ZA 3WZUA 4GT4A 3RINA 5CEPA 4L53A 4XG9A 2QOQA 2FSMX 3TMOA 3FMJA 3F6XA 3GOPA 4CRLA 3BHUA 3UYTA 3DQXA 3EHAA 4EOPA 4O7SA 4A9TA 3QCQA 2JD5A 5HQ0A 2OK1A 4RA4A 4AA0A 1WBSA 4L52A 4FKIA 3E63A 4HPTE 4HVGA 4KS8A 3QUDA 5C8MA 3QTSA 5JH6A 3V5QA 4DFBA 3F61A 4N6YA 4RIYB 3AT2A 1R39A 3HDMA 2XYUA 1Q4LA 2F49A 3HV7A 5CLPA 2F7EE 3RMFA 4C4HA 3CPCA 2WB8A 3SXRA 1JKLA 4KINA 2R3PA 4M7IA 3RI1A 2CHLA 2JIUA 3O17A 1ZYCA 3LFEA 4I6FA 4W8EA 4C3PA 5HNIX 3RZFA 4W4VA 4GK3A 4YZBA 2W4JA 4XP3A 5BVKA 3RTPA 2R5TA 3TCPA 3O8PA 4DBXA 2X4FA 2ZM1A 2YIXA 2BDJA 1WVYA 2J9MA 2JFLA 3UIXA 3UVPA 5IQDA 2F2CB 3MH2A 3Q2MA 3R9DA 4I6LA 4E20A 5J9YA 4QMZA 4YNOA 4ZY6A 1H08A 5EHYA 2UZVA 2A1AB 3QAME 3BU5A 3NLBA 4IVCA 5HO8A 5BNJA 2ACXA 2PZYA 3D9VA 4JJRA 4LL0A 3HL7A 3TNQB 4RT7A 1Q3DA 4IX5A 4DH7A 3POOA 3LMGA 4CFVA 2WQBA 3NUPA 2OXXA 3DB6A 4J71A 4L3PA 5GINE 4LV8A 4RWLA 3EL7A 5HG5A 4RBLA 3VAPA 3TNHA 5CALA 4RIXB 3HV6A 2VNWA 3NYOA 4J52A 2X1NA 4R7HA 3NCZA 4ZZMA 3PPZA 4ACDA 4D58A 4I5PA 2XKDA 4R78A 4EUUA 4GK2A 4Z3VA 5CF5A 4IM3A 5DIAA 3CJGA 4HNIA 2DYLA 4JBPA 3NW6A 3ORLA 5FM3A 4CFMA 2ITPA 4RJ4A 3L8XA 4G17A 4BDCA 4CVAA 4MXZA 4FVRA 2XS0A 1RQQA 2UV2A 2WMAA 4O86A 4RIWA 3HNGA 4R77A 2PVRA 3K3JA 5FXSA 3I79A 3AT3A 4NW6A 3SDJA 3ORPA 4D1SA 3V04A 4C0TA 2F9GA 3ZH8A 4L42A 1FBNA 4FNWA 4O0SA 3E64A 4C7TA 4CLIA 3UGCA 4K33A 4CYJA 4D9TA 1XMMA 3F3TA 3GI3A 1Y8YA 4W9XA 1OBDA 2YM4A 5FLFA 3DPKA 4A9SA 2KULA 3KB7A 1J7LA 3LAUA 5I9UA 3V6SA 3DJ7A 4MF0A 1A9UA 2C6EA 3RKBA 4TPTA 2UW3A 3EQCA 4JR3A 2VRXA 5FBOA 3TNWA 5EW9A 3P7AA 3EN7A 4Q5HA 4OGRA 4EK4A 4JMQA 5IA5A 2XMYA 3QKLA 1QCFA 3JY9A 4IAIA 3QD0A 3ZDIA 3ZSGA 4FTNA 3OWPA 1P4FA 4BTMA 3UQFA 3CC6A 4X3JA 2XCHA 1CDKA 2PVHA 3PJ1A 2PE1A 3PPJA 4KIPA 3DBDA 4RMZA 3FKLA 3CCNA 3ZRLA 1ZYSA 4CFFA 3P78A 2VWZA 3W10A 4DH8A 3E8DA 3R83A 2RGPA 1H28A 2RIOA 3D2KA 3VBYA 4FUXA 2H9VA 3RZBA 3FI4A 2XIRA 3BIZA 4NU1A 4CFWA 3CD8A 4GJ2A 4EK8A 2WEVA 1PW2A 2G9XA 2WOTA 3BRBA 1YDSE 5EM8A 2WKMA 3UP7A 4U42A 4FZ6A 1GOLA 4G1WA 5E92A 4RX7A 3ZM4A 5L6PA 4QTCA 4AU8A 1XWSA 4E5BA 3KXHA 4IZYA 4MAOA 2LGCA 5CVHA 4M8TA 5AA9A 3O96A 4QMXA 3CGFA 5CI6A 3QRIA 5AR2A 4FTRA 5CEMA 4RX5A 4DC2A 4MQ1A 3R8MA 4DT8A 3CP9A 1TQMA 2C5OA 1XH8A 2WMQA 3CQWA 1OL5A 4GFMA 4ZY4A 3E3PA 4O7NA 1UNLA 3ZBFA 5JGBA 3RCDA 1VYZA 4X7QA 5H2UA 2VN9A 4J8NA 3AC1A 5BVNA 1SNUA 4M15A 4MYGA 4CQEA 4XCUA 4JRNA 4PL5A 4AXCA 2UZOA 3GVUA 1JKTA 5I9VA 3LCKA 4QMWA 3KXGA 3ZC5A 5KMNA 1ZRZA 2OICA 5CEOA 2QD9A 1M2QA 3GCSA 3OP5A 5IG1A 5KMOA 3GC7A 4E4LA 4FYNA 4CD0A 4MHAA 4QMMA 4FIGA 4QP9A 4FIHA 2Z7RA 3VNTA 4FTTA 1ST4A 5HLNA 3FDNA 4EJ7A 4NTSA 2WTJA 2OZAA 4I21A 5CQWA 4KBCA 3T9TA 4AZFA 3UIBA 4Q2AA 4YZDA 5JGAA 2YZLA 4FKOA 3SC1A 3QD4A 3S2PA 3QTQA 3H0ZA 3BWJA 3RCJA 4H58A 4MBLA 3LHJA 4IANA 4EJNA 2YN8A 4QT1A 3W16A 2UVYA 4DFZE 3GU5A 4F9YA 3DA6A 5LQFA 3FWQA 4Q9ZA 3CE3A 4UZHA 1KE9A 1PXJA 4D0WA 1KE6A 3FLYA 5CWZA 3R8PA 4EKKA 4AFJA 3MGYA 3B8RA 5M4UA 3JY0A 2YDKA 3C0GA 5IEYA 3Q96A 5AWMA 3RHXA 3V5LA 4H05A 1H0VA 4IZ7A 3HYHA 4AZVA 4U80A 5M57A 3V8SA 3DB8A 3VS0A 3F3VA 2WFYA 4G9CA 1U54A 3NW5A 4U43A 3E8CA 4FEUA 1KOAA 3KMMA 4DHJA 4I24A 3R21A 4O0VA 3E5AA 2VTRA 3FLNC 3NNWA 3SRVA 1QPJA 3G9NA 4E7WA 5K4IA 3ZC6A 4QP7A 3U9NA 4OUCA 4EQCA 2R3HA 2XBJA 4G9RA 1BL6A 2FA2A 2HW7A 4B0GA 5B2LA 5C4KA 3AC2A 4D2PA 2CLXA 2UW0A 5DPVA 1T46A 2PVYA 3