4EH5A

Human p38 map kinase in complex with np-f4 and rl87
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
351
structure length
329
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 103
structure length 329
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh5A01
2V62A 4EH8A 5LCKA 2OI4X 1KE7A 4DEBA 2VTOA 3NCZA 4UV0A 4DBNA 1H1QA 1VR2A 3ZRMA 1OPKA 3FLYA 4L8MA 1UU8A 2FSTX 2ITZA 5HTBA 2C6LA 3MJ1A 2CPKE 3ZFXA 4GIHA 4WKQA 5TOZA 5CXZA 1ATPE 4IAAA 3KVXA 2HZ0A 3CBLA 4E6AA 4FEUA 2G01A 4KSPA 3WF8A 5HO7A 4FT9A 3AGLA 3OWLA 4GU6A 4Z9LA 2BROA 2QR8A 3NYOA 4JQ7A 5A4LA 4IJ9A 1Q8WA 1W8CA 4FTOA 5KBQA 5K3YA 3KQ7A 3GCVA 1JKKA 1Q8TA 2F9GA 3D0EA 1H00A 2X7OA 3KN6A 4MTAA 5FP6A 4N6YA 4NJ3A 2BFXA 3RZBA 3BPRA 3R8ZA 4E6CA 1U54A 4MD7E 4V01A 2JDVA 2QLQA 3CPCA 4OTRA 4EOQA 2VTHA 3F9NA 4YJSA 4KUJA 4QMYA 4K2RA 3EB0A 3ZEWA 4D4YA 1FVVA 3N4VA 4EH5A 1BL7A 3IW6A 4FOBA 4WRGA 4UMUA 2W1HA 4D4SA 4IDVA 4M15A 4DH5A 4APCA 3H0ZA 3E8DA 2FSMX 2FSLX 2XBAA 3OY1A 4RA5A 4TN6A 2RFEA 5HG9A 3QZIA 2ITYA 4BDHA 2IW8A 5CI7A 4BIBA 1HCKA 4O7TA 4EZ7A 3PA4A 4HNIA 4LRKA 4YZMA 3OVVA 2H34A 3BE2A 3BQRA 3ODYX 1GZNA 4I6BA 5DA3A 1WFCA 4G3EA 5DH3A 3R7YA 2V7AA 5I3OA 3VBVA 4QQJA 4RC3A 4AT4A 5IUGA 5E9EA 2NPQA 1H24A 2HENA 5E8YA 4YHFA 4BTKA 4DAWA 5FUTA 1UNGA 5LVPA 5E1SA 2VWWA 4RX9A 5FEDA 3QWKA 2PE2A 4CG9A 2ITWA 2H8HA 3NYVA 4BWPA 2J0KA 3IDCA 4XG7A 2PMLX 3NRMA 5JGDA 2XUUA 3LCSA 4JDHA 3H30A 1NT2A 3UJGA 3NVKI 4C4IA 2HZIA 5HVKA 3R73A 1PYEA 2FGIA 3W18A 4MNFA 2FH9A 4XG4A 3LHJA 3KXZA 2GS6A 4A9SA 4TWCA 3IPHA 4FL2A 3BKBA 5CX9A 3UG1A 3GXLA 3GQLA 3SHEA 2BAJA 4FZAB 4XOZA 2BAQA 3AOXA 2PL0A 3UDBA 3K5UA 4LRJA 3C5UA 3D5WA 4LGDA 3JYAA 2CSNA 1JPAA 4IVAA 5KBRA 3B2TA 4HYUA 5T68A 1GIHA 4N57A 5HEZA 3RM6A 4O0UA 3FMEA 3Q04A 3UVPA 4OTHA 2PVNA 3RAIA 2C6TA 3EFLA 3P86A 2HOGA 4EOIA 5HLNA 4ZTSA 5H9BA 4M66A 3MPTA 3AT2A 2W9ZB 4X2KA 5FXRA 4L3LA 2BPMA 3DBFA 3R21A 2Z60A 1KOBA 3U6HA 4YJTA 4GKHA 3QBNA 2PVYA 3LE6A 4FSTA 4CZTA 3VO3A 3TNPC 4ZMEA 1JSUA 3MFUA 1OIRA 3OW4A 3SW7A 4IWOA 3U87A 2UVYA 3QTSA 4G3GA 2JIUA 3N4UA 3E87A 5IEXA 2R2PA 3DQWA 3BI6A 5IG1A 1GY3A 4RX5A 2C3IB 4W9WA 3DXPA 4HJOA 3HMMA 1QCFA 3DLZA 1Z57A 4CFNA 4EOMA 3MPMA 3NAYA 1FMOE 2E9NA 3ANQA 3F2AA 1ZXEA 3HV5A 2OXXA 3ZUUA 4O7ZA 3VRYA 1R78A 4DTBA 5AV3A 1CKPA 3KXGA 4U43A 2YIQA 4CMUA 4QOXA 3CQUA 5I9XA 5A4QA 5AV2A 5ICPA 1XBBA 3PUPA 3OOGA 3WZEA 1G3NA 3QCQA 4DC2A 4B4LA 5HESA 4RZWA 4AACA 4IAYA 5E4HA 2XNEA 3C1XA 3I5NA 3EIDA 5IUHA 5L6PA 3FE3A 4MXAA 2VTAA 1JLUE 4IEBA 4IM3A 4L3PA 4RVTA 4FKQA 4WSYA 4F9AA 3UOJA 4DTAA 2UZDA 3S0OA 2VTNA 4XNEA 5FXQA 1MRVA 3UYTA 4Z3VA 5LCJA 4UMTA 1R0PA 2X7GA 1CKJA 2R3LA 5T6KA 5EOLA 3EZRA 3TJDA 2J90A 4UWYA 4OTFA 1TKIA 4IB1A 3I79A 4RGJA 1WAKA 2Z7RA 5A3XA 2C3JA 4DINA 5KMJA 1H27A 5HO6A 3LVPA 3MVJA 3RJCA 1P4FA 2VO3A 3GT8A 2VWIA 1Z9XA 4TRLA 3ITZA 3ORNA 4NIFB 4DH1A 5CF8A 2QU5A 2XIKA 1P2AA 5IF1A 4FEWA 4PF4A 2Y7JA 3ZZWA 1IR3A 1O6LA 4BHNA 3VUDA 2GS7A 4LI5A 3KY2A 3QQUA 4J71A 5J9LA 4CD0A 1WVWA 3ALNA 2HW7A 5CVHA 3RWPA 4L67A 2YM6A 4GCJA 4TYGA 1WBSA 3UIUA 3UOKA 1YDTE 4CG8A 3MVMA 3B8RA 5DRDA 1NVQA 1XBAA 3FUPA 5JGAA 3PP0A 5HU9A 3P4KA 3ZONA 3I0OA 4O6EA 3SGCA 1H08A 4NM5A 5AR5A 2ETKA 4FEXA 1O6YA 5CQUA 3UOHA 5EQEA 3MFTA 5CI6A 1SZMA 2Z8CA 3P7AA 4BGQA 5HIBA 3BU5A 5EYDA 5IMEA 3Q60A 3HV6A 3DY7A 2F2CB 5BQ0A 4GMYA 2JEDA 4IH8A 4BBEA 4KBCA 2PVJA 3EN9A 4GJ3A 4DGNA 4UB7A 3ORMA 2XIXA 3GC8A 1XBCA 3O7LD 3OTUA 2UZOA 3FXZA 2XKFA 1CDKA 4GFMA 5E8XA 4D5KA 4E73A 5L8LA 1Y91A 3TEIA 3V5WA 2J50A 2ZV2A 1DS5A 3E64A 2JC6A 2F7XE 3GC0A 3O0GA 1FOTA 1GAGA 2VN9A 3FI8A 1YHVA 2XM8A 3C7QA 2E9OA 3HRBA 4DG0E 4F08A 3RK5A 4O0WA 5ITAA 4DYMA 2HY0A 4I0TA 3BGZA 5E8WA 3IOPA 3H9OA 5AADA 4XG9A 1BUHA 3UVRA 1H01A 3BLQA 3C4EA 4W8EA 1JSVA 4IB0A 3PJ3A 4AOIA 4DE4A 4R77A 2UZNA 2C5OA 2HWPA 2QD9A 4C4FA 3LCTA 3ORXA 4GRBA 1Q8UA 3PXZA 4J97A 3KMUA 1ZYCA 4TKSA 3DBEA 3VQUA 2JAMA 2YHVA 5M4UA 4IB3A 2OLCA 2V22A 5EOBA 2IZSA 1ZYSA 3HL7A 2WAJA 3HLLA 4BWKA 5CALA 3D7TB 3P1AA 5G1XA 4A07A 4I6HA 2NP8A 4L9IA 3WE8A 4CGAA 4ZY5A 3GU4A 4EBWA 3M2WA 4RSSA 2BRNA 2HELA 3F69A 4EH7A 3C4XA 3K3IA 4F6WA 2GQSA 4WBBB 4PDYA 5LQFA 3JVRA 3PVUA 5BYZA 4C4JA 4BI1A 3S00A 3AC5A 4LOOA 4MVFA 2C4GA 1PMUA 3N9XA 4V05A 1U59A 2QOOA 1FVRA 4EWHA 4JR7A 4AWIA 2R64A 3LFDA 4FBXA 3V01A 4NIFA 4EQCA 2JBOA 4ACHA 3PZEA 2GNHA 4R8QA 4AF3A 4FTNA 5M4CA 4FTAA 2X2MA 4CKJA 1VJYA 3TTIA 5BYYA 1UVRA 4F0IA 4FUXA 4GVJA 4P2KA 4TW9A 3UTOA 3R04A 4G9RA 2C6DA 5CSVA 1M17A 3ZXZA 4X6QC 2HWOA 3KA0A 1KE5A 3QU0A 2OFUA 3SA0A 3UE4A 3SG8A 1Y8YA 3QQKA 2B54A 2C5VA 3F3ZA 5AR3A 4AOJA 4C3RA 2W1FA 3UIBA 4BICA 5BX0A 4GG5A 4V0GB 3SOCA 2BRBA 2IVSA 2Q83A 1FBNA 1TQPA 2G15A 4TWPA 4GSBA 2F57A 2YISA 4DTKA 4ZSAA 4C02A 4C3FA 4G3DA 3QKLA 4NCTC 2XK4A 1E9HA 4FIJA 3NSZA 4BRXA 4FTLA 4IE9A 1FINA 4IWDA 5LVLA 2OU7A 3BRBA 3WYYA 3W8LA 2IN6A 3Q3BA 2W1IA 3QX2A 5C9CA 3QXPA 4TYEA 3QL8A 5H8GA 3FZPA 3UQCA 4WBOA 4CQEA 4II5A 2BDWA 2XNGA 3BYSA 4OTIA 5BVEA 2QOKA 3PDTA 2C0IA 4MXCA 4LYNA 4YJNA 4HYHA 3U6JA 5M53A 4C34A 4UWBA 4XJ0A 4D2SA 5HU3A 4O83A 1PXPA 5AFVA 1GJOA 3QYZA 1V0PA 3VF9A 3BE9A 2P2HA 4IIRA 1X8BA 4F63A 2B9FA 1WVXA 4B6LA 3IECA 5GZ8A 4FVPA 2BZHB 4YMJA 4RJ6A 2JDOA 3QA0A 4ZJVA 3NS9A 3W2RA 3A8XA 3GU8A 3A7HA 4BGGA 4FSYA 1GZKA 4OTGA 3WE4A 3KL8A 2OZAA 3BX5A 2OIQA 3QGYA 2O64A 4EYJA 3NAXA 2R3NA 4G31A 4I92A 4MCVA 4I41A 4UMPA 2YA9A 1JNKA 5HLWA 2X4FA 4FZ6A 3GEQA 3EHAA 3LFQA 4U42A 5AP7A 5IA2A 3F5UA 3R2BA 3VHEA 4BWXA 1QPEA 2Q0BA 3D14A 2GSFA 4JQEA 4WNMA 2BFYA 3SKCA 3KCKA 4QMVA 2XCHA 3TUCA 4BFMA 1YRPA 3O8TA 3QZFA 4S2ZA 4CMTA 3ENMA 4YNEA 3M42A 4E5BA 4DH8A 3DOGA 4LG4A 2GU8A 3ZUVA 3RGFA 5JRQA 3ZSIA 4RIWB 5A14A 3TNHA 3GVUA 4EK8A 4U40A 3V51A 2BRMA 1A06A 3BELA 3D7TA 1URCA 5CU2A 3O2MA 2CN8A 4JX3A 3LIJA 3L8SA 5CAPA 5EQYA 4XS2A 2GQGA 4QQ5A 3FY0A 4M67A 4KA3A 2JFMA 4K9YA 4J96A 4PL5A 4PPBA 2YZAA 3AQVA 3DFCB 4X0MA 5AEPA 4L01A 3V5PA 3PA5A 4NK9A 2UZEA 4BCIA 3EYHA 1KUTA 3VIDA 3ZU7A 3SXFA 3D2IA 4EQUA 2VWZA 3EQCA 4TT7A 4M68A 4TPTA 4G34A 1ZMWA 5CXHA 3S2PA 5KHXA 4WOVA 4DA5A 2X4ZA 4U3ZA 3EH9A 4AGCA 2I0EA 1ZZ2A 4K18A 3DGKA 3K54A 4D0WA 4RPVA 5JMSA 2Z2WA 4F65A 4CLJA 1Y6AA 5AUTA 4XG8A 3RALA 1PXOA 4CZUA 3C4CA 3CS9A 5DEWA 5HQ0A 3VVHA 2VTLA 4UYNA 5ANKA 2WQMA 4FGRA 5DNRA 1GOLA 4KBAA 5EW8A 2YIYA 2XK6A 3CY2A 3IOKA 3OFMA 2J7TA 4KKEA 2F7ZE 5HCXA 2BILB 3MA6A 2O2UA 2HCKA 3QTXA 3CLYA 3COKA 2RL5A 4ACCA 3Q9XA 2CNVA 4ZTMA 4CFMA 4ZJIA 5EHYA 3QQJA 4WRSA 3FC2A 4YSJA 4AW2A 1BMKA 4LM5A 3WZUA 2ACXA 4MKCA 4TTHB 2CKQA 2O3PA 5IQEA 3TV4A 4O91A 5DRBA 3ACKA 1U5RA 4RFZA 4G9CA 4MD9E 4XG6A 2IVUA 4XLIA 5HI2A 4RVLA 5M07A 2A2AA 5KX8A 2R4BA 5EI2A 4CT2A 4F7JA 2XIRA 2ZMDA 3E3BX 4P5ZA 4FV4A 3P9JA 2GTMA 1YW2A 4GG7A 3Q9WA 4JR3A 2XRUA 3DBQA 4GYIA 5FGKA 4O7RA 4WNPA 2QG5A 4U41A 2OJIA 2VTTA 3PY1A 1J91A 2C6IA 3QC4A 2WNTA 4O22A 3R8PA 4QMOA 4FTTA 5HCYA 1M7QA 4E6DA 4G2FA 2C68A 4IM0A 5CAVA 2V5QA 5HBJA 3PLSA 1LR4A 3QCXA 3SV0A 1WBTA 1KV1A 3ROCA 4A7CA 4EH2A 2ZB1A 5J5SA 4QP7A 3V04A 3BWFA 2X81A 4TNBA 4L53A 1MRUA 2QOBA 3CIKA 3BGQA 4X2FA 4JG8A 4ASEA 4PNKA 3UOLA 3ORIA 4AFEA 3ZLXA 2WIHA 4FK3A 5DN3A 2CNQA 3GU5A 3MW1A 3VN9A 3MI9A 3ZYAA 5ANDA 5CANA 1V1KA 4EOJA 5HX6A 1KOAA 2PZ5A 4AW1A 3NUAA 1BX6A 4QTCA 4RIWA 4O0VA 2JKOA 4N70A 4D2PA 4TL0A 2YWVA 5JQ5A 4ENYA 5EKOA 1SMHA 4FKIA 3DXNA 4HPTE 4MF1A 4HVGA 4CTBA 5DE2A 4FI1A 4RJ4A 5EDRA 3FJQE 3FQSA 3PXKA 4F9YA 3QGWA 1AD5A 4FKRA 4MYGA 3TJCA 4WUNA 2OXDA 4MBIA 3NUUA 2BIKB 4UZDA 2G2IA 2X8IA 2QG7A 2W96B 4ARKA 4OTWA 3GP0A 5EK7A 4UZHA 3U8WA 4JDIA 3TN8A 5AR4A 2EWAA 4YJOA 4MXYA 3LXLA 2YM3A 5KKRC 2VX0A 4D2TA 3PVBA 5F95A 4BIEA 3E8EA 2WMVA 4C7TA 5IQIA 5ACKA 4BC6A 3T9IA 3B8QA 2WTIA 4R5SA 3SAYA 3CC6A 1JQHA 2I40A 4QMPA 4RVMA 1O6KA 2VTQA 2ZB0A 3R1QA 2IJMA 2J51A 4AG8A 2W0JA 3KMWA 1H1WA 1XQZA 2XYUA 1OI9A 4JRNA 4O27B 3WIKA 5AMNA 4PL4A 5JN2A 2XNNA 4NFNA 2YLEA 3I5ZA 4KABA 5JKGA 2OK1A 3PSBA 4DEIA 4EK3A 1Y8GA 4OT5A 3H9RA 5AIKA 4DCEA 2YWPA 2B53A 2IVTA 3EZVA 2XJ2A 3PPKA 3Q9ZA 5IA5A 5M56A 4GL9A 2O5KA 4C57A 2A27A 4FICA 5H3QA 1ZZLA 2R3QA 3NUXA 3V5TA 1PRYA 5AR8A 4S33A 5FTQA 4W8DA 3VS3A 4JIKA 2QQ7A 4TWNA 2CHLA 5AAFA 3EQRA 4I5CA 4ZEGA 3TG1A 2IW6A 3MIYA 3R7VA 3QX4A 3AT3A 3QRUA 2E9VA 2JLDA 3A7IA 3O8UA 4JJRA 4AN9A 2ZV9A 4E6QA 3WILA 4FSMA 2X0GA 4FIHA 3R7UA 4J53A 3P78A 4JS8A 4QRCA 1M7NA 2YJRA 4L46A 5HE0A 2RKUA 2W7XA 4FTRA 4HGTA 4QYGA 4EEVA 2Z7SA 2W99B 4Y83A 3T9TA 1J1BA 3R8UA 2YJSA 1J3HA 3PP1A 4DT9A 4EYMA 2W5HA 2I0YA 1PW2A 4IB5A 5ACBC 2BZJA 1J7LA 4AX8A 3ZO4A 1XO2B 4UMRA 5E8SA 2FSOX 5FQDC 3QHRA 3QC9A 3R63A 3G0EA 4G6OA 1OIYA 3FXXA 3QCSA 3ACJA 2EU9A 4L6QA 4O96A 5HKMA 1VYZA 2X39A 5JZJA 5AP4A 2QKWB 3NLBA 4XV1A 4OTQA 4OTPA 2PY3A 4RG0A 1YDSE 2YM4A 3AD5A 2W1GA 3F7WA 2O0UA 3E8NA 3QTIA 4J8MA 4QP4A 4E7WA 2WXVA 3DT1A 3NUPA 2BDJA 1TQIA 3DZQA 3KVWA 4IAKA 3EKNA 4X3JA 2CGXA 4YJUA 4W4YA 5HD7A 3W1FA 4QYEA 4BTMA 4BVUA 4DH7A 2BRHA 4AZFA 1QPDA 4KIKB 3EFWA 3TWJA 4GT4A 3DK7A 5DMZA 3I0QA 4IZ5A 3RPYA 2XNOA 2QHMA 4K0YA 4DEEA 3W10A 1OUKA 4LUEA 3M1SA 4EJ7A 4PMSA 3FSKA 3VBYA 4LV5A 3HV4A 1ZRZA 3AC1A 3DJ7A 3K5VA 4FTKA 5CU3A 4I4FA 2QOCA 4RWLA 2WTWA 5BMMA 3S4QA 3BV2A 5BUJA 4M84A 5K4IA 4IM2A 4PMTA 2Q0NA 4IWPA 3EQHA 2X1NA 4KD1A 1JKLA 3MESA 2PZRA 1F3MC 4JG7A 3FDNA 3RVGA 4ALUA 3ORPA 2XKEA 2C3LA 2IWIA 2W4KA 3NZ0A 4ZTLA 3PLAE 5HE2A 3DAKA 2P4IA 3SLSA 3W8QA 3G2FA 4FA2A 4MXXA 5HD4A 4ENXA 2CKPA 4D2WA 1XH8A 2ITUA 4NZWB 1MQ4A 5CVFA 3DNDA 5CY3A 1G5SA 5HE3A 4BCHA 4QQTA 5IEYA 4EHEA 3NYXA 4BZDA 5CEPA 4DH3A 2XIYA 5BPYA 3HNGA 3ZTXA 5J7HA 3P23A 2ITPA 4M97A 4D9UA 3DTWA 5AIRA 3BEGA 1PY5A 4ERWA 3OXIA 2F4JA 4AS0A 4DGOA 1WZYA 2VTSA 4MEDA 4NH1A 3W16A 5LWNA 1J7UA 5EHLA 5BVWA 3EQPA 5F9EA 4H3PA 3ZSHA 4AZTA 3V5LA 1SVEA 3PJ2A 2QKRA 4AGUA 4PMMA 4HOKA 4YHTA 2UUEA 4OAUC 3BZ3A 1GZOA 5HCZA 2XKDA 2V7OA 3FMHA 5I4NA 3IGOA 3UMWA 2QC6A 5ANJA 5I5ZA 2YIRA 4FSNA 2BKKA 1YWRA 3PPJA 4EH6A 4DG3E 5LWMA 2OJGA 3H3CA 4W4VA 1BL6A 3ZLSA 3FYKX 2PUNA 3IGGA 4ZTRA 4ASDA 3AMBA 1FGIA 4FC0A 3V3VA 3SQQA 5AUXA 4AOTA 5JGBA 2Y6OA 3ORTA 3G51A 3EOCA 4GU9A 5FBNC 4I93A 3CTQA 3CD8A 1K2PA 1YXVA 3UGCA 4ALWA 4DLIA 4K8AA 3GGFA 4IDTA 4LL0A 5TE0A 5I9UA 4I20A 4ID7A 4FYNA 1OECA 4FZFB 2XKCA 4GK4A 4RA4A 3RNIA 3MVLA 2CGVA 3QLGA 4E5AX 1TVOA 4GS6A 2CLQA 4IACA 4HYIA 4A9UA 4ZP5A 4EH9A 1XKKA 3FKLA 3FQEA 4V04A 2JFLA 3IDBA 4O7VA 2WMAA 3EQIA 2JKQA 2H9VA 4ZSLA 1R39A 3QFVA 4YC8A 4ZZMA 3LXPA 2ZDTA 3AC3A 5K0XA 3D15A 5KMLA 2O63A 2WELA 1NVSA 3OMVA 4H1MA 3NR9A 2PVFA 3UO5A 1YXTA 4I5HA 5CEOA 4ZLOA 4G5JA 4TYIA 4KIKA 3ZM9A 5IQGA 2WGJA 5J79A 3MH2A 3ORKA 3OROA 3LQ3A 4PNIA 3E3PA 4I5PA 3LOKA 3TIYA 3Q4CA 4BBFA 4QNYA 4E8AA 4CLIA 4XG3A 5K0KA 3ZC5A 4EK6A 2J4ZA 3QTQA 5AUUA 4FNXA 4YPDA 3AG9A 3FZSA 4OR5A 4WUAA 1QPCA 5IQBA 4DEDA 4ZS4A 5JFXA 3M11A 1V0OA 2QU6A 2WU7A 4QQCA 1OIUA 5FEQA 2QI8A 4QMLA 2X7FA 4AGDA 3DXQA 4ZXTA 4DN5A 4O7NA 3F2NA 3LJ0A 3EQBA 3PVGA 4TYJA 5AP0A 3R7OA 2A19B 1OKZA 4MHAA 5IQAA 5I9VA 2OG8A 1DM2A 1PMVA 3D2KA 5D11A 5IEVA 4U7ZA 3QLFA 2LGCA 2WMWA 3ZFMA 2DYLA 4G5PA 4KBKA 4AT5A 5GIPE 4BCPA 1ZOHA 5CU0A 3QA8A 3ZRLA 1STCE 3F61A 2JKKA 2OJ9A 3MBLA 3MGYA 3VC4A 4CFXA 3SC1A 3I60A 3OUNB 1CSNA 1OPLA 4WIHA 2VTRA 2VTJA 1XHAA 2R3PA 4XEYA 4RWJA 4RIXB 3IW5A 3QWJA 5CSHA 1OKWA 2CJMA 4HCUA 4O38A 4JBQA 5DR6A 5FWKK 3KB7A 3ZDIA 5IH4A 1EH4A 5DI1A 4ANMA 4EOLA 4YR8A 4FE2A 4B8LA 3R71A 5GJFA 1OVEA 5J5TA 3ZHPC 5EW3A 3VBXA 4FV7A 3FLQA 4ITIA 3LQ8A 2RSVA 4HNFA 5GZ9A 1UWHA 4ZLYA 2PMIA 4X2JA 4JQ8A 4CKRA 3OEZA 2XK3A 2WPAA 3OWKA 4XRLA 2CGUA 5IZFA 1AGWA 4Y46A 4QMWA 3HGKA 4GYGA 3MPAA 4YLLA 5HBHA 4EOOA 1BI8A 3KKVA 2OJFE 3HDNA 1OITA 2WIPA 4KAOA 4PPCA 3UNKA 4BCFA 2PUPA 3Q6UA 5EQPA 3KGAA 3R9RA 4XP2A 4YBKA 3OG7A 2C5YA 3NNVA 4I24A 4FL1A 2XIZA 4KB8A 2B7AA 4TWOA 4A9RA 1XH5A 4USEA 5JT2A 3KRXA 5KHWA 4KIQA 2VTMA 1IRKA 3LMGA 4WHZA 4ANSA 5CAOA 3OP5A 4YC6A 3Q6WA 3BLRA 4S30A 4HYSA 3U9CA 1APME 4W4XA 4QMQA 4S31A 2YCFA 4O0RA 4NYEA 1PF8A 5KMNA 5CQWA 4AZWA 3NEWA 5KNJA 5JFWA 2A0CX 4FIIA 4HCTA 2QURA 2PZYA 3PJCA 3Q4ZA 4U0IA 4YZNA 2UW0A 3F6XA 5T3QA 4K77A 2WMXA 4E3CA 3C13A 3E88A 3ATTA 4LOPA 4QMZA 2OFVA 1PHKA 3OBGA 1JOWB 1Q3WA 4NL0A 5E8ZA 5KCVA 2PZIA 2YDKA 3EYGA 4XRJA 5AWMA 4WT6A 5DR2A 4N4SA 1PYXA 4A4OA 4JAJA 2W1ZA 3OCTA 4FKVA 4DT8A 4BDIA 4FSRA 4IZAA 4WG5A 3SDJA 3RI1A 5DLSA 2RG5A 4JLCA 4EC9A 4DEGA 2PE0A 2R3OA 2R3GA 4FT5A 2PMOX 4YP8A 5AP6A 4RQVA 2XA4A 3R1NA 4UALA 4Y5HA 4WSQA 3VBWA 5E8VA 5TR6A 4EJNA 3NGAA 3AC2A 3PJ8A 1H1PA 3GCPA 4KIPA 5A4CA 3DKFA 4RWKA 2J0MB 4E4NA 1H0VA 3FSFA 1Y57A 4GUEA 5HTCA 4J52A 4EHVA 1Q61A 1MUOA 3UO4A 4ZY4A 4RJ5A 1W82A 1M14A 3OUKA 4HZSA 3NUNA 4FYOA 4PUZA 2NNWB 1OUYA 3GNIB 4C8BA 2OZAB 5E91A 2WQEA 3FZTA 4LMUA 4DFNA 1ZYLA 3HAMA 3CKXA 4RIXA 3R0TA 4GIIA 3UYSA 2WD1A 5JFVA 4O84A 5M06A 5AUZA 3UODA 5TO8A 1PXIA 3RZFA 2OO8X 4Z7GA 1JVPP 4XP0A 5FDXA 1PMNA 1H4LA 2J0IA 1KWPA 4I6QA 2XRWA 4R1YA 1M2RA 2YFXA 3LW0A 1UKIA 4OGRA 5CLPA 5GJDA 2ZYBA 2W1EA 4Q5EA 4U9AA 1YVJA 1YWNA 3WIGA 1YI3A 1XH7A 4GKIA 4IJPA 3GC7A 2J5EA 2C1AA 3TCPA 1IA8A 3DJ5A 3ERKA 3HMOA 4L7SA 3VW6A 3UO6A 3NNWA 4KS8A 3TTJA 1R0EA 4LMNA 1IA9A 2B4SB 4AN3A 4UYAA 3BHUA 4EWQA 3COIA 3GCQA 1OL5A 3IKAA 3QQFA 4K6ZA 5FM2A 4F09A 1Z5MA 4TY1A 4Y8DA 4JBPA 4R6VA 5HNBA 4RC2A 3NVMB 5AV4A 4RFYA 4R7BA 4RIYB 2QO2A 3E7VA 3MY0A 4QPSA 3UC4A 3KRRA 3FMLA 3IDPA 3IS5A 4IVCA 5H8EA 3BYUA 3NW6A 3FPQA 5CEKA 3N4TA 3ID6C 3HP2A 2ONLA 5D10A 3ZFYA 5E7RA 4PY1A 3WBLA 4J98A 4O6LA 3R1SA 1ZYDA 3ENHA 3L9PA 2XJ1A 2DQ7X 2YIXA 2R3JA 5FP5A 3POZA 3RM7A 3U9NA 4S32A 1IAHA 4PDOA 2VUWA 3HECA 3TZ7A 2OSCA 4AQCA 4F9WA 5DOSA 3UZRA 4FKTA 4YO6A 2ZOQA 4JDJA 1AQ1A 3AGMA 4XV3A 4L52A 2J5FA 3MH1A 4YTCA 3LAUA 4N0SA 4Y72A 1SNXA 4L44A 2XEYA 3HVCA 4QMMA 3VUMA 2C47A 4RLLA 2C30A 1BI7A 4FKLA 4EONA 3LM5A 3PIZA 2WZJA 5CU4A 1CM8A 2WTVA 1E1XA 1ZOEA 4EORA 4IVBA 3F82A 3FXWA 4R7HA 4O0SA 3MB6A 4FF8A 5IA4A 2I6LA 3BLHA 4U81A 5BVDA 3QF9A 4OBOA 3BBWA 2BALA 2VWUA 3LJ1A 3OCBA 1FPUA 1P5EA 4ACGA 4QMNA 4E93A 3MH0A 3QD3A 4CYJA 3FZOA 3PG1A 4J1RA 4C38A 3NW7A 5G6VA 3HP5A 2CN5A 4LOQA 4P4CA 2LAVA 2ZM4A 3D9VA 4M3QA 1OMWA 2OGVA 2ZVAA 4GW8A 3W33A 5KZIA 3R30A 4Q5HA 2HK5A 4F99A 2WMSA 4ANNA 3IONA 2X9FA 5AP1A 3ZXTA 2XK9A 5E8UA 2PWLA 2VNWA 5JEBA 2WOTA 4ZOGA 5HIDA 5JK3A 2XM9A 5GINE 2PK9A 4AE6A 5AA8A 1YI6A 2ZAZA 2GS2A 5BNJA 1ND4A 5DHJA 2YERA 5A6NA 4ZTNA 3LJ2A 4MF0A 4U97A 1KE8A 4KNBA 3RK7A 2X6EA 3JXWA 5M4FA 2C3KA 4HCVA 3HYHA 3RPOA 3NUSA 3KN5A 1RQQA 4R7IA 3TI1A 2C6OA 4C37A 5I9ZA 5IA0A 4M0ZA 5ETCA 4XMOA 2HY81 4LQMA 5DFPA 3BIZA 3UNZA 5KUPA 3O7LB 2PHKA 2BZIB 3F88A 3H0YA 3H4JA 4HVHA 1S9IA 2QOFA 3PJ1A 4NEUA 4XBUA 4XV2A 5EI8A 4GT5A 4RJ8A 5L8KA 4ORKA 3PA3A 2OH0E 3NIEA 4NW6A 4YLKA 4C3PA 3HV3A 4CV8A 2YDIA 4YTHA 4AP7A 3RAWA 3HMIA 4L7FA 3HZTA 3KK8A 3OD6X 4GT3A 1GZ8A 2NRUA 3L9LA 4FEVA 2F2UA 1Q3DA 2UW9A 3PPZA 4FL3A 1PXKA 2Y6MA 3DK3A 5A4EA 5L2TA 3LXNA 4RIYA 3HDMA 4IX3A 4F7SA 3CXWA 5FRIA 4Q9ZA 5GZAA 3DB8A 1NXKA 2BZKB 2GNLA 4JRVA 5L4QA 3NCGA 5IA1A 2RFSA 1T46A 3U4UA 4ZS0A 4D4VA 3WF9A 3WZJA 3KRJA 4XCUA 1V0BA 4XUFA 4O7LA 3TZ8A 2ITXA 4ANBA 2CLXA 5F94A 4HVSA 1OZ1A 4IANA 1XH9A 2WMQA 3MIAA 3ZRKA 4P7EA 4E4XA 4G1WA 5IQCA 1M52A 3TKHA 3ZM4A 4OTDA 4AZVA 3H9FA 4G16A 4C2VA 3DLSA 4G3FA 1UA2A 3K2LA 4S34A 2H6DA 4DFLA 1J1CA 3CY3A 2W5BA 3GB2A 3SXRA 4D9TA 1IG1A 4OT6A 3VULA 3KRWA 4FKOA 4F1TA 4DF3A 4L68A 5LMAA 2BHEA 3QD0A 3VQHA 2J6MA 2EVAA 4JI9A 2YLFA 3DQXA 3PSDA 2Y4IB 2BCJA 2PVLA 2DUVA 4GH2A 4DITA 4JAIA 1G8SA 4AUAA 3LLAA 2UZVA 4IZ7A 2G2HA 3O23A 3BGPA 4CNHA 4FTUA 2W1DA 3OEFX 3QAME 3EL8A 1UNLA 4GVAA 4IX4A 1GIJA 4KWPA 5HZNA 5IQFA 3GOKA 3THBA 3TUDA 5C03A 3P5KA 2JGZA 4J95A 1ZARA 3ANRA 5CVGA 4BF2A 4NFMA 3CD3A 3CEKA 3KXHA 3GU6A 3NUYA 3QD4A 4R5YA 5AM6A 5DT3A 5HIEA 4NTTA 1XH6A 3GCSA 5L2WA 2BTRA 3CJFA 2W9FB 5CSWA 4NTSA 4EKKA 5EG3A 3BCEA 4CCBA 3A7FA 3PG3A 4BCKA 2E9PA 5EHOA 2C0OA 3EFJA 2ETMA 4FV8A 4YJRA 3RPRA 4HVIA 3CP9A 4QTEA 4EUTA 2XK7A 4OBPA 3FPMA 3ALOA 3OTVA 3BU6A 4RRVA 4FIFA 4BB4A 3VUIA 2ITTA 1ZY4A 4U45A 4CRSA 5L2SA 4EK5A 2VWXA 4FSUA 5I9WA 3TZ9A 3D5UA 3FHRA 4D4RA 2PVKA 3FHIA 4GEOA 5IH5A 2ITQA 5LJJA 3LCKA 5A54A 3TNIA 4FSWA 2VAGA 3Q5ZA 3D83A 5H8BA 2IG7A 2OZOA 1O9UA 1OB3A 1NY3A 2R0IA 3SX9A 2CKOA 3F5XA 4FTCA 4EI4A 1OL2A 4X3FB 3DPKA 4QMSA 4X7QA 1Q99A 4R1VA 1SVGA 2GQRA 2XP2A 4JIAA 3QHWA 4ANLA 5C8NA 3MFRA 3PY3A 4BZNA 4BCNA 3PRFA 3U51A 3EKKA 2H96A 2W1CA 5J1VA 3ZMMA 2F7EE 3BHVA 4LGGA 4C4GA 2QOIA 4MXZA 1F0QA 3F3TA 3QTUA 3KF7A 3NDMA 3WI6A 3P79A 2VGOA 4MK0A 4B8MA 4I22A 4RC4A 2VO7A 2Y0AA 3PXYA 2WTKB 5TT7A 5K9IA 3NPCA 5C01A 1JKSA 5IKWA 2XNMA 3IW4A 4RLKA 3ZO1A 5DYJA 1UNHA 4D58A 5CAUA 3TM0A 2KULA 1RDQE 2I0VA 2JIIA 3Q4UA 1XH4A 5B0XA 3PYYA 4X6RA 3HRFA 5AX9A 5HLPA 1W83A 1J7IA 5LVOA 5LOHA 3G33A 2HZNA 4CZYB 4Z7HA 4F1MA 4MD8E 3EQGA 4RX7A 2VWYA 2OXYA 1Y6BA 2ERZE 1R3CA 3P0MA 4QP6A 2J0JA 4BDJA 2XMYA 3QUDA 3LFNA 3CE3A 4AFJA 3HMNA 2UW6A 2WQBA 4QNAA 4YZBA 2F49A 5KMIA 3IO7A 5F4NA 2EXCX 5KZ0A 3VUGA 5BYLA 5M09A 3ZDUA 5C4KA 3RAKA 4R3RA 5HG5A 3GBZA 5ANIA 3DFAA 4H39A 3LZBA 4CFWA 3RTPA 1IEPA 1MRYA 3CQWA 4AA0A 1REKA 4UXLA 3L8PA 4I6FA 4I0SA 2B52A 5FLFA 3QQGA 1YHWA 4EBVA 3FLWA 2VTPA 3K3JA 4BTJA 2C6KA 2R3IA 3JR1A 2R9SA 5AUVA 2ITOA 2G9XA 4FKGA 3NX8A 3R83A 5J8IA 2CKEA 2XBJA 3RP9A 3RBWA 3MJ2A 3FY2A 4O0YA 4O1OA 4BDFA 4KSQA 2B55A 4IWQA 3QRIA 2R7IA 3SOAA 1K9AA 3ZO3A 3R01A 1H1SA 2PZPA 3O51A 2QVSE 4ZY6A 2HZ4A 2O8YA 4A9TA 4CVAA 3LLTA 4CEGA 4C4HA 2BVAA 4PRJA 4D0XA 5J87A 4E4MA 4EH4A 2UVZA 3HRCA 4AXAA 3OC1A 3Q4TA 5E1EA 2E2BA 3L8VA 3ZBFA 4ZTHA 1UU9A 4AAAA 1ZYJA 2ERKA 3GFEA 2VWVA 2YEXA 3I4BA 3I7CA 3V8TA 4CMOA 5A6OA 4TXCA 4BKYA 2Z02A 4M69B 4NT4A 3DJ6A 1PKDA 3MV5A 2C1BA 2GNGA 3TXOA 2VD5A 3F7ZA 2GNIA 3FL5A 3AD6A 2YABA 3HUBA 4NSTA 4RJ3A 4AZEA 3PZHA 4BGHA 3C9WA 3NW5A 5DBXA 3V5JA 5B2MA 4FGBA 5EFQA 3R7EA 2JIVA 3OCSA 4DLJA 2G2FA 2XS0A 3HA6A 4C2WA 1JAMA 3PIXA 4BBMA 3PXQA 2W17A 3LMHA 3QRJA 4X3FA 5HO8A 3DZOA 5E90A 4D1XA 1VEBA 3PRIA 5KO1A 3AMAA 3EMGA 4KS7A 3FMKA 4E4LA 1OBDA 5AV1A 1Q97A 3PE1A 4PV0A 3O8PA 3PSCA 3ULZA 2NRYA 3O17A 3PWDA 1T45A 2B9HA 3LPBA 2VZ6A 4NW5A 3W2PA 3OBJA 2XB7A 4QD6A 5CENA 2SRCA 2UW3A 1YOMA 2PVHA 3RAHA 3KFAA 3QTWA 3LM0A 4JXFA 3FV8A 4OW8A 5FBOA 3R9HA 4O0XA 2FYSA 3E62A 4KKGA 2HW6A 4Y5QA 2J9MA 5K5XA 3Q32A 2GHGA 4U8ZA 2QCSA 1YDRE 3F3WA 1U4DA 4YZ9A 4NU1A 1W98A 4I5MA 3A61A 4E20A 3BYVA 4FTIA 3LFEA 4BYJA 2JDRA 3EQFA 1Q5KA 3VUKA 3QKKA 4FT0A 1Q4LA 3JS2A 3SRVB 2KTYA 1W84A 2P55A 1U5QA 4MX9A 1JWHA 3PY0A 4NWMA 5AP3A 4EC8A 3Q53A 3UIMA 3BYOA 1YXXA 5KMOA 5AV0A 4I21A 4O86A 3FMMA 3VWAA 5CEIA 3L1SA 3VBTA 5HG7A 4EOPA 4JT3A 5AR2A 3W2SA 3FMDA 3KCFA 4BY9E 2QNJA 2CNUA 4AT3A 2UV2A 5C27A 3R7IA 3UMXA 4WG4A 4PX6A 2WHBA 3UP7A 1YWVA 4FKUA 4B7TA 2PMNX 2GMXA 2EUFB 3KXXA 3VUHA 2B9IA 4D5HA 4KIOA 4N6ZA 5HTIA 3R8LA 3LMIA 3O71A 3NIZA 3OY3A 4FKWA 4MAOA 4K1BA 4YNOA 4GFOA 4FSQA 3DBCA 4R3CA 3R8MA 4E1ZA 3MTFA 1UU7A 2CCHA 2EB3A 2QO9A 3HKOA 3QALE 2IZTA 4RZVA 3VHKA 3VS5A 4D55A 3HUCA 4G6NA 5HG8A 4USFA 3RMFA 2DWBA 4QTDA 4JBOA 1ZWSA 3HAVA 2WTDA 2XJ0A 4BI2A 4D1SA 1FVTA 4FIEA 3TL8A 3D5XA 4RWIA 3C50A 5HICA 4BCOA 5L2QA 4QT1A 2I1MA 5FTGA 2OKRA 2VX1A 4OBQA 5ETIA 4I0RA 4H36A 3UPXA 2WEVA 2XEZA 2JAVA 2Y4PA 4ZLZA 4PWNA 5GIOE 4BL1A 4BKJA 3IW7A 3G5DA 2FVDA 1E1VA 5IQDA 1FQ1B 2UZTA 4YSMA 3R9NA 4BYIA 4EOSA 3VS7A 4QP8A 4QYHA 5AAGA 1OL7A 2OH4A 4Q9SA 3QD2B 2R3KA 1JSTA 5JZNA 2VGPA 2O65A 1KE9A 3RCJA 4JVGA 5C26A 2PYWA 4M69A 5GHVA 5DIAA 5EYKA 2PE1A 4DGMA 4NKSA 3F5PA 4IADA 4PTEA 2WTJA 1SNUA 1A48A 4BDDA 2R7BA 3TKIA 3UBDA 1VZOA 4EH3A 2QOQA 3FEGA 4USDA 2P0CA 2B1PA 3UZPA 4O7SA 3ZOSA 2OWBA 4DG2E 4O81A 3EFKA 2ONLC 4CCUA 3V5QA 4FR4A 5L6WL 4ZMFA 2A4LA 5BVFA 3IG7A 3ATSA 4QYYA 3C4WA 2WMRA 5D12A 4HVDA 3PVWA 3FLNC 2GCDA 4EZ5A 2BDFA 2XK8A 5AP5A 1KV2A 2QHNA 3OF0A 5DWRA 4QPMA 4A9YA 4B99A 3LFCA 3RNYA 1I09A 5J95A 5EDPA 3NMUF 3I1AA 5LMKA 3LFSA 3KF4A 3Q52A 4JL9A 4MQ2A 5HVJA 3DDQA 3R00A 3KEXA 2HIWA 4C61A 4FTQA 4CTCA 2X9EA 2AYPA 2VO0A 4PQNA 3WYXA 3PFQA 3C4FA 4FTJA 1MQBA 3FYJX 4U80A 5EM6A 4BTFA 5CF4A 2RFDA 4O82A 1H1RA 1SVHA 4M13A 3I6WA 3E92A 5L2IA 2P2IA 2YCQA 1JBPE 1WBNA 2VNYA 1B6CB 3A8WA 4M8TA 4QPAA 5HGIA 2C5NA 3TZMA 5BVOA 3IW8A 2JDSA 3QCYA 4ZTQA 3SRVA 4IAFA 4U5JA 2BTSA 4XH6A 5D9HA 4QP2A 2R5TA 1A9UA 2Y9QA 4IXPA 3VS4A 2XNBA 3FKOA 3DK6A 3U4WA 3DKOA 4L3JA 5CZHA 2CGWA 5BVNA 5CT0A 5EM7A 3PE2A 5C8KA 2IZRA 5C4LA 1P14A 1U46A 3MH3A 2ZV8A 5TKDA 4O7YA 4O7WA 4BCJA 3A62A 2UZLA 5CWZA 4QMTA 3DTCA 5AA9A 2YAAA 1H25A 4XG2A 3ZLWA 3LFAA 4GFGA 2FO0A 3OXTA 5CNOA 4F9CA 2WO6A 4UEUA 3C51A 3VBQA 3S1HA 1QMZA 5M44A 3C4ZA 4XP3A 2QLUA 3GU7A 5A9UA 5FM3A 3REPA 3V8SA 3QZHA 1DAWA 3QZGA 1FGKA 4C0TA 4EHZA 4WA9A 4YGAA 4BKZA 3RINA 2BAKA 3FI2A 3G15A 3KU2A 4F6UA 3ZEPA 2EXMA 2ZMCA 4IAIA 1WBOA 4K33A 4QO9A 5FXSA 4D28A 3PXFA 1SM2A 4IFCA 3G9NA 3MTLA 4YJQA 4EHGA 5CSXA 4FNWA 2YM8A 3QRKA 5IDNA 3QQHA 4RIOA 3CKWA 5ANOA 2OICA 3OW3A 2PUUA 3EWHA 3FBVA 1GNGA 1LEWA 4FNZA 4M7IA 4AA5A 3IK3A 1GIIA 5AP2A 5BUIA 1M2PA 3A99A 3HMPA 5FEEA 2W06A 5J1WA 2JD5A 4Y95A 5AX3A 4Z16A 3OT3A 2OJJA 5DEYA 2YM5A 4HGEA 3RPVA 3OXZA 2C0TA 4EZ3A 2R0UA 4ALVA 3TDWA 3V6SA 3OCGA 4DFBA 4X2GA 3CGOA 3NWWA 4AW0A 3Q5IA 1RJBA 4FT3A 4L45A 4RJ7A 3N51A 3A7GA 4X21A 5HORA 3HEGA 4MQ1A 3U55A 4O2PA 4G17A 5FG8A 2BUJA 3EN6A 4ZSGA 3SD0A 4IBMA 4XYFA 4F64A 1G8AA 4U3YA 4YO4A 2FB8A 3F2RA 4YLJA 4DBXA 1ZY5A 2C5XA 4C58A 4YU2A 3W2QA 4XOYA 3JY9A 3S3IA 4PMPA 3AXWA 1B38A 4P5QA 4QP1A 2J2IB 3CR0A 1W0XC 3UZTA 3Q96A 3R1YA 5CAQA 2QONA 3E93A 4FNYA 3I7BA 4LUDA 3FWQA 3I6UA 3TV7A 3KRLA 4BCMA 5A46A 4DGLC 1BKXA 1YHSA 4FIGA 4ONAA 4E5WA 2PVMA 3ZS5A 4PPAA 4ACMA 4QP9A 1UKHA 4A06A 3R9DA 5CS6A 1CKIA 2XYNA 2RG6A 4QYFA 4J99A 5DT4A 3UQGA 4DFXE 5AAEA 1BLXA 5IQHA 3ZH8A 4O0TA 2UW8A 2WFYA 1ZOGA 5CEQA 3LFFA 5I0BA 1I44A 1UU3A 5FTOA 4U79A 3KC3A 4H3BA 2YAKA 4HZRA 4F4PA 4YZDA 2C6MA 3WZDA 4D2RA 5L6OA 2GFSA 2OIDA 2RIOA 3U6IA 3UVQA 3MA3A 4APPA 4NJDA 1ZMVA 4YHJA 2P3GX 5CZIA 3MYGA 3D5VA 4IFGA 4QTAA 4XBRA 4QP3A 4MH7A 1H0WA 3BYMA 3VAPA 4FVQA 1RE8A 5AUWA 4F7NA 3O50A 4OAVB 3TDVA 2EXEA 5B2KA 2XZSA 3UIXA 4AGWA 4AU8A 2VTIA 2AUHA 3BEAA 4DHFA 4YBJA 1YI4A 3KMMA 4H3QA 4Q2AA 2YITA 3MWUA 4IZYA 3QTZA 4ANQA 5IDPA 3O96A 5D41A 3KK9A 1URWA 4GUBA 4ZJJA 1IAJA 4CSVA 3T3VA 3RPSA 3KXNA 2X8EA 3DDPA 2XH5A 5GJGA 2OBJA 3G6GA 4OLIA 2JITA 2GFCA 4FKJA 5B7VA 3G6HA 3VNTA 4ZZNA 1ZAOA 1YKRA 1ZLTA 3R8VA 1P4OA 2I7QA 3OWPA 5CU6A 1XJDA 2BRGA 4IAZA 5HOAA 3VF8A 4IHPA 3POOA 2OW3A 4ZSJA 4YJPA 2R3FA 1RW8A 4UY9A 4YTFA 3TNQB 4DFYA 3MN3A 3ZZEA 2W05A 4MWHA 3RWQA 1H28A 2GHMA 4IC7A 3A60A 4C36A 2B9JA 1WVYA 5LXMA 2BR1A 3AT4A 3CTHA 3PXRA 4YTIA 3MY5A 4PTGA 4F6SA 5IA3A 5AR7A 1OBGA 3R6XA 3FAAA 4BCQA 3DNEA 1VYWA 4FX3A 2R3RA 3LCOA 2QODA 2WQOA 2YCSA 3KXMA 3V8WA 3OOMA 2W4OA 1PKGA 3COMA 3GCUA 3T8OA 3B2WA 4ANOA 4BZOA 5EDQA 4TZRA 3COHA 4JG6A 4CT1A 3TUBA 5CEMA 2BKZA 4NM7A 3QXOA 2B0QA 1LP4A 3WZKA 4CFVA 5L3AA 5JSMA 4FTMA 3IQ7A 5EM8A 2OIBA 3L9MA 3FZRA 2QR7A 3BV3A 5HE1A 3CSVA 3W2CA 4FEQA 2ZM1A 3WF5A 4UXQA 4C4EA 2W5AA 4AN2A 3F5GA 5IH6A 3TNWA 4FG7A 2RGPA 3G0FA 5ANGA 3ELJA 2PVRA 4D1ZA 3ZBXA 4CKIA 2Y4IC 4ITHA 3E7OA 4RX8A 3EL7A 2Y8OA 4O21A 4GK3A 2ZJWA 4O2ZA 1OL6A 2VWBA 2X2KA 4C33A 4RVKA 5IMXA 2C69A 1LUFA 4GJ2A 3MSSA 5IPJA 5J7BA 4GK2A 4TYHB 5D1JA 4BI0A 3SG9A 4ASZA 3ORLA 4A4LA 2GNFA 2ZDUA 4BR3A 2RF9A 4B9DA 3V6RA 3I81A 5CTPA 4IC8A 1Q8ZA 3DA6A 1DI8A 3MB7A 4KKHA 1PXLA 3RK9A 3FI4A 2Z7QA 2WOUA 3GENA 5DG5A 4BDGA 5FDPA 1UWJA 1PXNA 5D7AA 4BHZA 5BUEA 4UX9A 4MNEB 2CMWA 3G9LX 3Q2MA 5K5NA 3H10A 3HV7A 5DVRA 3ZSGA 4LRMA 4YZCA 4O1PA 4PDPA 1HCLA 5ETFA 5EYCA 1WBVA 4DFUA 4EQMA 2EB2A 5LVNA 4IQ6A 3GI3A 1SYKA 5ETAA 5CSPA 1K3AA 3FZ1A 3TKUA 1OM1A 3W55A 1ZMUA 3HA8A 2IZUA 3WF6A 4DCAA 1KE6A 2WMTA 3A2CA 5HBEA 4IX6A 4IX5A 4PP7A 3VS2A 1S9JA 4FZ7A 4X3FC 5C8MA 4G3CA 4BCGA 1OKVA 2PTKA 3L9NA 3QKMA 1TQMA 3FMJA 3GQIA 3TACA 1JKTA 3CTJA 3FLZA 1L8TA 2YM7A 4NM3A 2XVDA 5BMSA 3VS6A 5I9YA 2I0HA 5FD2A 4JOAA 2FA2A 3E5AA 1IASA 3R7GA 4XHKB 4CQGA 5AUYA 2X6DA 4CYIA 4PDSA 1Q62A 2A1AB 3Q9YA 4PP9A 4MBJA 1WMKA 3FLSA 4L42A 4PL3A 4E26A 4F0FA 5J9YA 3AC8A 2RFNA 1WBWA 2WTKC 3QUEA 3GC9A 2PUIA 1PXJA 1WBPA 1WCCA 4EL9A 1R1WA 2WTCA 2BIYA 4L00A 3DB6A 3E63A 3R02A 4XLVA 3TT0A 2WKMA 3CJGA 2ETRA 2YCRA 3BHHA 3QUPA 5EH0A 2GTNA 4HPUE 3AD4A 1OL1A 4XV9A 5EYMA 5CYIA 5H2UA 3BQCA 3LFBA 5CF6A 4KRDA 3WF7A 4CFUA 4G6LA 4FMQA 5HNIX 5B2LA 4ZZOA 4CFFA 2ZM3A 2FUMA 2AC5A 2OF4A 2GHLA 3EN7A 4LL5A 4QMXA 5LMBA 5DPVA 3G90X 3LXKA 4FV6A 2YDJA 4M14A 4Y85A 4RT7A 4EOKA 2Z7LA 3CCNA 4LFIA 5F20A 1H07A 2NO3A 2GDOA 3MFSA 3NNXA 5IU2A 2JKMA 3EN4A 1UV5A 2BHHA 4RBLA 4V0GA 4ASXA 4AW5A 4PTCA 2PULA 4EUUA 4YUQA 2R3HA 4NKAA 4F9BA 3C0GA 5JQ8A 4ACDA 1PMEA 5D7VA 4FV1A 4CXAA 4EKLA 2WMBA 3Q2JA 5J9ZA 5HHWA 4IMYA 2ITVA 4BDAA 1PJKA 3EJ1A 4GV1A 2WMUA 4TYHA 4FOCA 5HNGA 5KMMA 2VV9A 5M57A 3CPBA 4FT7A 4BDKA 2UW4A 2J0LA 5DT0A 3BWJA 2VRXA 2VU3A 4L43A 2UW7A 4B0GA 4DFZE 4I94A 1FMKA 1YOJA 4YC3A 5E8TA 5CF5A 4FG8A 5F1ZA 3DS6A 4WNKA 3R22A 4P90A 4W9XA 4NM0A 3FC1X 3NNUA 4MNEA 3VS0A 3JPVA 4YPSA 1YQJA 2IO6A 3JY0A 4KINA 4WO5A 5L8JA 4TNDA 1DI9A 4UWCA 3ROYA 4F70A 5TF9A 2IW9A 2IPXA 5JRSA 5EM5A 2JDTA 5M55A 4EK4A 4F7LA 5EKNA 3DBDA 3UC3A 3AMYA 3ZLYA 4H1JA 2X2LA 3DAJA 3JUHA 4FODA 3KULB 3UQFA 1LPUA 3GFWA 3T3UA 3C0HA 5AJQA 5HX8A 2C6EA 5JFSA 5M4IA 3PTGA 1DAYA 1H8FA 3VS1A 3VW8A 4BDBA 4C62A 4BN1A 5BVKA 1LEZA 3P08A 4WG3A 3UNJA 3C5IA 5KE0A 1CMKE 4MXOA 4FV0A 4FVRA 3PWYA 2ITNA 1CTPE 1Q41A 2UZBA 3OT8A 3P7CA 5A4TA 3P7BA 2JBPA 5GNKA 3UP2A 2CDZA 4FV5A 3QYWA 4FG9A 4M0YA 3RKBA 3A7JA 4Y73A 3LCDA 1F5QA 1M2QA 4JX7A 5KMKA 3KREA 5LMKC 2QO7A 4QMUA 2XNPA 3E8CA 3GUBA 4YURA 2UZWE 4X2NA 2AC3A 4ERKA 4FV9A 3FL4A 2UW5A 2YN8A 1YXSA 2HAKA 4KRCA 2V0DA 4AA4A 5M08A 4D2VA 2ZV7A 2WB8A 4ITJA 3BHYA 5E92A 3TV6A 3D94A 3CQEA 3DKCA 3ETAA 1XWSA 3FKNA 3MVHA 5I3RA 2YIWA 3A4PA 5IUIA 3ET7A 4AZSA 1ERKA 2V55A 2YZLA 3QQLA 3BHTA 4A4XA 5HVYA 5CT7A 1XR1A 4RQKA 1Q8YA 1REJA 2BMCA 5DGZA 3MS9A 3ODZX 2WQNA 4JNWA 4FKSA 5AM7A 3FI3A 2HXLA 4MWIA 1YOLA 2PSQA 3DKGA 5ANEA 4AE9A 3WOWA 3C0IA 3F3UA 4FV3A 2P33A 4BDEA 3R9OA 3ORZA 2HXQA 2OF2A 3NYNA 4LV8A 4NCTA 3RHKA 3W32A 1HOWA 4JBVA 4H58A 3ZO2A 3CGFA 5IISA 4ZIMA 1U54B 4IVDA 4WNOA 2G1TA 3MY1A 4K11A 1L3RE 3MDYA 3VJNA 4DEHA 3R28A 1NA7A 2REIA 3L8XA 3GOPA 1NVRA 4QTBA 2QOHA 3JVSA 3UPZA 4YJVA 4FKPA 5JH6A 3VJOA 3OHTA 3TIZA 3BBTB 4BIDA 4DEAA 5M51A 3QTRA 3F3VA 4ZAUA 4FUYA 1OKYA 4UBAA 1OIQA 1B39A 4CV9A 3WARA 2HYYA 4UN0C 4OUCA 3EQDA 3VRZA 2R3MA 2W4JA 1BYGA 3UG2A 3SW4A 3ULIA 4C59A 4C35A 4FSZA 4FZDB 3LKMA 4J8NA 1PXMA 3BU3A 3AC4A 3ZCLA 4H05A 2VX3A 4U6RA 2ESMA 1Q24A 2WEIA 3FQHA 4U44A 3RCDA 4W4WA 4F0GA 5C1QB 3HX4A 3PIYA 3ZC6A 4NUSA 4RFMA 4UMQA 2XF0A 3OWJA 2GPHA 2X8DA 5CNNA 3RHXA 3II5A 2VO6A 2PPQA 3U54A 2E9UA 4M12A 4I4EA 2UZUE 2DS1A 5EI6A 1NW1A 4DGGA 2GNJA 3LQ5A 3DAEA 2QOLA 3DCVA 3OS3A 2WU6A 2UVXA 4ZK5A 4ZSEA 4BDCA 4Z55A 4I1ZA 1YXUA 3DV3A 3KULA 1W7HA 4I3ZA 4MBLA 5CASA 3EN5A 2IVVA 3W2OA 5EW9A 2CCIA 4FK6A 1OPJA 2YACA 4HGLA 5DR9A 3ZUTA 1QPJA 4LGHA 4F1OA 3FMNA 4FV2A 4I23A 4WD5A 4R78A 4J7BA 4R3PA 1QL6A 3F66A 5LARA 1KSWA 4JDKA 4XX9A 1OGUA 3DU8A 3OZ6A 4RMZA 3D4QA 3SXSA 1MP8A 3A4OX 3R2YA 4IW0A 4CRLA 5KKRB 3SVVA 4HW7A 5K4JA 1H26A 5LVMA 4HGSA 3D7ZA 3QRTA 2PU8A 3VUTA 2XCKA 3S95A
chains in the Genus database with same CATH superfamily
2V62A 4EH8A 5LCKA 2OI4X 1KE7A 4DEBA 2VTOA 3NCZA 4UV0A 4DBNA 1H1QA 1VR2A 3ZRMA 1OPKA 3FLYA 4L8MA 1UU8A 2FSTX 2ITZA 5HTBA 2C6LA 3MJ1A 2CPKE 3ZFXA 4GIHA 4WKQA 5TOZA 5CXZA 3W0MA 1ATPE 4IAAA 3KVXA 2HZ0A 3CBLA 4E6AA 4FEUA 2G01A 4KSPA 3WF8A 5HO7A 4FT9A 3AGLA 3OWLA 4GU6A 4Z9LA 2BROA 2QR8A 3NYOA 4JQ7A 5A4LA 4IJ9A 1Q8WA 1W8CA 4FTOA 5KBQA 5K3YA 3KQ7A 3GCVA 1JKKA 1Q8TA 2F9GA 3D0EA 1H00A 2X7OA 3KN6A 4MTAA 5FP6A 4N6YA 4NJ3A 2BFXA 3RZBA 3BPRA 3R8ZA 4E6CA 1U54A 4MD7E 4V01A 2JDVA 2QLQA 3CPCA 4OTRA 4EOQA 2VTHA 3F9NA 4YJSA 4KUJA 4QMYA 4K2RA 3EB0A 3ZEWA 4D4YA 1FVVA 3N4VA 4EH5A 1BL7A 3IW6A 4FOBA 4WRGA 4UMUA 2W1HA 4D4SA 4IDVA 4M15A 4DH5A 4APCA 3H0ZA 3E8DA 2FSMX 2FSLX 2X0QA 2XBAA 3OY1A 4RA5A 4TN6A 2RFEA 5HG9A 3QZIA 2ITYA 4BDHA 2IW8A 5CI7A 4BIBA 1HCKA 4O7TA 4EZ7A 3PA4A 4HNIA 4LRKA 4YZMA 3OVVA 2H34A 3BE2A 3BQRA 3ODYX 1GZNA 4I6BA 5DA3A 1WFCA 4G3EA 5DH3A 3R7YA 2V7AA 5I3OA 3VBVA 4QQJA 4RC3A 4AT4A 5IUGA 5E9EA 2NPQA 1H24A 2HENA 5E8YA 4YHFA 4BTKA 4DAWA 5FUTA 1UNGA 5LVPA 5E1SA 2VWWA 4RX9A 5FEDA 3QWKA 2PE2A 4CG9A 2ITWA 2H8HA 3NYVA 4BWPA 2J0KA 3IDCA 4XG7A 2PMLX 3NRMA 5JGDA 2XUUA 3LCSA 4JDHA 3H30A 1NT2A 3UJGA 3NVKI 4O4FA 2HZIA 4C4IA 5HVKA 3R73A 1PYEA 2FGIA 3W18A 4MNFA 2FH9A 4XG4A 3LHJA 3KXZA 2GS6A 4A9SA 4TWCA 3IPHA 4FL2A 3BKBA 5CX9A 3UG1A 3GXLA 3GQLA 3SHEA 2BAJA 4FZAB 4XOZA 2BAQA 3AOXA 2PL0A 3UDBA 3K5UA 4LRJA 3C5UA 3D5WA 4LGDA 3JYAA 2CSNA 1JPAA 4IVAA 5KBRA 3B2TA 4HYUA 5T68A 1GIHA 4N57A 5HEZA 3RM6A 4O0UA 3FMEA 3Q04A 3UVPA 4OTHA 2PVNA 3RAIA 2C6TA 3EFLA 3P86A 2HOGA 4EOIA 5HLNA 4ZTSA 5H9BA 4M66A 3MPTA 3AT2A 2W9ZB 4X2KA 5FXRA 4L3LA 2BPMA 3DBFA 3R21A 2Z60A 1KOBA 3U6HA 4YJTA 4GKHA 3QBNA 2PVYA 3LE6A 4FSTA 4CZTA 3VO3A 3TNPC 4ZMEA 1JSUA 3MFUA 1OIRA 3OW4A 3SW7A 4IWOA 3U87A 2UVYA 3QTSA 4G3GA 2JIUA 3N4UA 3E87A 5IEXA 2R2PA 3DQWA 3BI6A 5IG1A 1GY3A 4RX5A 2C3IB 4W9WA 3DXPA 4HJOA 3HMMA 1QCFA 3DLZA 1Z57A 4CFNA 4EOMA 3MPMA 3NAYA 1FMOE 2E9NA 3ANQA 3F2AA 1ZXEA 3HV5A 2OXXA 3ZUUA 4O7ZA 3VRYA 1R78A 4DTBA 5AV3A 1CKPA 3KXGA 4U43A 2YIQA 4CMUA 4QOXA 3CQUA 5I9XA 5A4QA 5AV2A 5ICPA 1XBBA 3PUPA 3OOGA 3WZEA 1G3NA 3QCQA 4DC2A 4B4LA 1OGYA 5HESA 4RZWA 4AACA 4IAYA 5E4HA 2XNEA 3C1XA 3I5NA 3EIDA 5IUHA 5L6PA 3FE3A 4MXAA 2VTAA 1JLUE 4IEBA 4IM3A 4L3PA 4RVTA 4FKQA 4WSYA 4F9AA 3UOJA 4DTAA 2UZDA 3S0OA 2VTNA 4XNEA 5FXQA 1MRVA 3UYTA 4Z3VA 5LCJA 4UMTA 1R0PA 2X7GA 1CKJA 2R3LA 5T6KA 5EOLA 3EZRA 3TJDA 2J90A 4UWYA 4OTFA 1TKIA 4IB1A 3I79A 4RGJA 1WAKA 2Z7RA 5A3XA 2C3JA 4DINA 5KMJA 1H27A 5HO6A 3LVPA 3MVJA 3RJCA 1P4FA 2VO3A 3GT8A 2VWIA 1Z9XA 4TRLA 3ITZA 3ORNA 4NIFB 4DH1A 5CF8A 2QU5A 2XIKA 1P2AA 5IF1A 4FEWA 1W2FA 4PF4A 2Y7JA 3ZZWA 1IR3A 1O6LA 4BHNA 3VUDA 2GS7A 4LI5A 3KY2A 3QQUA 4J71A 5J9LA 4CD0A 1WVWA 2AQXA 3ALNA 2HW7A 5CVHA 4DHIB 3RWPA 4L67A 2YM6A 4GCJA 4TYGA 1WBSA 3UIUA 3UOKA 1YDTE 4CG8A 3MVMA 3B8RA 5DRDA 1NVQA 1XBAA 3FUPA 5JGAA 3PP0A 5HU9A 3P4KA 3ZONA 3I0OA 4O6EA 3SGCA 1H08A 4NM5A 5AR5A 2ETKA 4FEXA 1O6YA 5CQUA 3UOHA 5EQEA 3MFTA 5CI6A 1SZMA 2Z8CA 3P7AA 4BGQA 5HIBA 3BU5A 5EYDA 5IMEA 3Q60A 1TFFA 3HV6A 3DY7A 2F2CB 5BQ0A 4GMYA 2JEDA 4IH8A 4BBEA 4KBCA 2PVJA 3EN9A 4GJ3A 4DGNA 4UB7A 3ORMA 2XIXA 3GC8A 1XBCA 3O7LD 3OTUA 2UZOA 3FXZA 2XKFA 1CDKA 4GFMA 5E8XA 4D5KA 4E73A 5L8LA 1Y91A 3TEIA 4AQKA 3V5WA 2J50A 2ZV2A 1DS5A 3E64A 2JC6A 2F7XE 3GC0A 3O0GA 1FOTA 1GAGA 2VN9A 3FI8A 1YHVA 2XM8A 3C7QA 2E9OA 3HRBA 4DG0E 4F08A 3RK5A 4O0WA 5ITAA 4DYMA 2HY0A 4I0TA 4JMQA 3BGZA 5E8WA 3IOPA 3H9OA 5AADA 4XG9A 1BUHA 3UVRA 1H01A 3BLQA 3C4EA 4W8EA 1JSVA 4IB0A 3PJ3A 4AOIA 4DE4A 4R77A 2UZNA 2C5OA 2HWPA 2QD9A 4C4FA 3LCTA 3ORXA 4GRBA 1Q8UA 3PXZA 4J97A 3KMUA 1ZYCA 4TKSA 3DBEA 3VQUA 2JAMA 2YHVA 5M4UA 4IB3A 2OLCA 2V22A 5EOBA 2IZSA 1ZYSA 3HL7A 2WAJA 3HLLA 4BWKA 5CALA 3D7TB 3P1AA 5G1XA 4A07A 4I6HA 2NP8A 4L9IA 3WE8A 4CGAA 4ZY5A 3GU4A 4EBWA 3M2WA 4RSSA 2BRNA 2HELA 3F69A 4EH7A 3C4XA 3K3IA 4F6WA 2GQSA 4WBBB 4PDYA 5LQFA 3JVRA 3PVUA 5BYZA 4C4JA 4BI1A 3S00A 3AC5A 4LOOA 4MVFA 2C4GA 1PMUA 3N9XA 3NFFB 4V05A 1U59A 2QOOA 1FVRA 4EWHA 4JR7A 4AWIA 2R64A 3LFDA 4FBXA 3V01A 5BV3A 4NIFA 4EQCA 2XANA 3ML1A 2JBOA 4ACHA 3PZEA 2GNHA 4R8QA 4AF3A 4FTNA 5M4CA 3BL9A 4FTAA 2X2MA 4CKJA 1VJYA 3TTIA 5BYYA 1UVRA 4F0IA 4FUXA 4GVJA 4P2KA 4TW9A 3UTOA 3R04A 4G9RA 2C6DA 5CSVA 1M17A 3ZXZA 4X6QC 2HWOA 3KA0A 1KE5A 3QU0A 2OFUA 3SA0A 3UE4A 3SG8A 1Y8YA 3QQKA 2B54A 2C5VA 3F3ZA 5AR3A 4AOJA 4C3RA 2W1FA 3UIBA 4BICA 5BX0A 4GG5A 4V0GB 3SOCA 2BRBA 2IVSA 2Q83A 1FBNA 1TQPA 2G15A 4TWPA 4GSBA 2F57A 2YISA 4DTKA 4ZSAA 4C02A 4C3FA 4G3DA 3QKLA 4NCTC 2XK4A 1E9HA 4FIJA 3NSZA 4BRXA 4FTLA 4IE9A 1FINA 4IWDA 5LVLA 2OU7A 3BRBA 3WYYA 3W8LA 2IN6A 3Q3BA 2W1IA 3QX2A 5C9CA 3QXPA 4TYEA 3QL8A 5H8GA 3FZPA 3UQCA 4WBOA 4CQEA 4II5A 2BDWA 2XNGA 3BYSA 4OTIA 5BVEA 2QOKA 3PDTA 2C0IA 4MXCA 4LYNA 4YJNA 4HYHA 3U6JA 5M53A 4C34A 4UWBA 4XJ0A 4D2SA 5HU3A 4O83A 1PXPA 5AFVA 1GJOA 3QYZA 1V0PA 3VF9A 3BE9A 2P2HA 4IIRA 1X8BA 4F63A 2B9FA 1WVXA 4B6LA 3IECA 5GZ8A 4FVPA 2BZHB 4YMJA 4RJ6A 2JDOA 3QA0A 4ZJVA 3NS9A 3W2RA 3A8XA 3GU8A 3A7HA 4BGGA 4FSYA 1GZKA 3W0SA 4DDIA 4OTGA 3WE4A 3KL8A 2OZAA 3BX5A 2OIQA 3QGYA 2O64A 4EYJA 3BL7A 3NAXA 2R3NA 4G31A 4I92A 4MCVA 4I41A 4UMPA 2YA9A 1JNKA 5HLWA 2X4FA 4FZ6A 3GEQA 3EHAA 3LFQA 4U42A 5AP7A 5IA2A 3F5UA 3R2BA 3VHEA 4BWXA 1QPEA 2Q0BA 3D14A 2GSFA 4JQEA 4WNMA 2BFYA 4AAYA 3SKCA 3KCKA 4QMVA 2XCHA 3TUCA 4BFMA 1YRPA 3O8TA 3QZFA 4S2ZA 4CMTA 3ENMA 4YNEA 3M42A 4E5BA 4DH8A 3DOGA 4LG4A 2GU8A 3ZUVA 3RGFA 5JRQA 3ZSIA 4RIWB 5A14A 3TNHA 3GVUA 4EK8A 4U40A 3V51A 2BRMA 1A06A 3BELA 3D7TA 1URCA 5CU2A 3O2MA 2CN8A 4JX3A 3LIJA 3L8SA 5CAPA 5EQYA 4XS2A 2GQGA 4QQ5A 3FY0A 4M67A 4KA3A 2JFMA 4K9YA 4J96A 4PL5A 4PPBA 2YZAA 3AQVA 3DFCB 4X0MA 4DHJA 5AEPA 4L01A 3V5PA 3PA5A 4NK9A 2UZEA 4BCIA 3EYHA 1KUTA 3VIDA 3ZU7A 3SXFA 3D2IA 4EQUA 2VWZA 3EQCA 4TT7A 4M68A 4TPTA 4G34A 1ZMWA 5CXHA 3S2PA 5KHXA 4WOVA 4DA5A 2X4ZA 4U3ZA 3EH9A 4AGCA 2I0EA 1ZZ2A 4K18A 3DGKA 3K54A 4D0WA 4RPVA 5JMSA 2Z2WA 4F65A 4CLJA 1Y6AA 5AUTA 4XG8A 3RALA 1PXOA 4CZUA 3C4CA 3CS9A 5DEWA 5HQ0A 3VVHA 2VTLA 4UYNA 5ANKA 2WQMA 4FGRA 5DNRA 1GOLA 4KBAA 5EW8A 2YIYA 2XK6A 3CY2A 3IOKA 3OFMA 2J7TA 4KKEA 2F7ZE 5HCXA 2BILB 3MA6A 2O2UA 2HCKA 3QTXA 3CLYA 3COKA 2RL5A 4ACCA 3Q9XA 2CNVA 4F78A 4ZTMA 4CFMA 4ZJIA 5EHYA 3QQJA 4WRSA 3FC2A 4YSJA 3AKKA 4AW2A 1BMKA 4LM5A 3WZUA 2ACXA 4MKCA 4TTHB 2CKQA 2O3PA 5IQEA 3TV4A 4O91A 5DRBA 3ACKA 1U5RA 4RFZA 4G9CA 4MD9E 4XG6A 2IVUA 4XLIA 5HI2A 4RVLA 5M07A 2A2AA 5KX8A 2R4BA 5EI2A 4CT2A 4F7JA 2XIRA 2ZMDA 3E3BX 4P5ZA 4FV4A 3P9JA 3O5AA 2GTMA 1YW2A 4GG7A 3Q9WA 4JR3A 2XRUA 3DBQA 4GYIA 5FGKA 4O7RA 4WNPA 3PFYA 2QG5A 4U41A 2OJIA 2VTTA 3PY1A 1J91A 2C6IA 3QC4A 2WNTA 4O22A 3R8PA 4QMOA 4FTTA 5HCYA 1M7QA 4E6DA 4G2FA 2C68A 4IM0A 5CAVA 2V5QA 5HBJA 3PLSA 1LR4A 3QCXA 3SV0A 1WBTA 1KV1A 3ROCA 4A7CA 4EH2A 2ZB1A 5J5SA 2XARA 4QP7A 3V04A 3BWFA 2X81A 4TNBA 4L53A 1MRUA 2QOBA 3CIKA 3BGQA 4X2FA 4JG8A 4ASEA 4PNKA 3UOLA 3ORIA 4AFEA 3ZLXA 2WIHA 4FK3A 5DN3A 2CNQA 3GU5A 3MW1A 3VN9A 3MI9A 3ZYAA 5ANDA 5CANA 1V1KA 4EOJA 5HX6A 1KOAA 2PZ5A 4AW1A 3NUAA 1BX6A 4QTCA 4RIWA 4O0VA 2JKOA 4N70A 4D2PA 4TL0A 2YWVA 5JQ5A 4ENYA 5EKOA 1SMHA 4FKIA 3DXNA 4HPTE 4MF1A 4HVGA 4CTBA 5DE2A 4FI1A 4RJ4A 5EDRA 3FJQE 3FQSA 3PXKA 4F9YA 3QGWA 1AD5A 4FKRA 4MYGA 3TJCA 4I6LA 4WUNA 2OXDA 4MBIA 3NUUA 2BIKB 4UZDA 2G2IA 2X8IA 2QG7A 2W96B 4ARKA 4OTWA 3GP0A 5EK7A 4UZHA 3U8WA 4JDIA 3TN8A 5AR4A 2EWAA 4YJOA 4MXYA 3LXLA 2YM3A 5KKRC 2VX0A 4D2TA 3PVBA 5F95A 4BIEA 3E8EA 2WMVA 4C7TA 5IQIA 5ACKA 4BC6A 3T9IA 3B8QA 2WTIA 4R5SA 3SAYA 3CC6A 4QEBA 1JQHA 2I40A 4QMPA 4RVMA 1O6KA 2VTQA 2ZB0A 3R1QA 2IJMA 2J51A 4AG8A 2W0JA 3KMWA 1H1WA 1XQZA 2XYUA 1OI9A 4JRNA 4O27B 3WIKA 5AMNA 4PL4A 5JN2A 2XNNA 4NFNA 4BJJB 2YLEA 3I5ZA 4KABA 5JKGA 2OK1A 3PSBA 4DEIA 4EK3A 1Y8GA 4OT5A 3H9RA 5AIKA 4DCEA 2YWPA 2B53A 2IVTA 3EZVA 2XJ2A 3PPKA 3Q9ZA 5IA5A 5M56A 4GL9A 2O5KA 4C57A 2A27A 4FICA 5H3QA 1ZZLA 2R3QA 3NUXA 3V5TA 1PRYA 5AR8A 4S33A 5FTQA 4W8DA 3VS3A 4JIKA 2QQ7A 4TWNA 2CHLA 5AAFA 3EQRA 4I5CA 4ZEGA 3TG1A 2IW6A 3MIYA 3R7VA 3QX4A 3AT3A 3QRUA 2E9VA 2JLDA 3A7IA 3O8UA 4JJRA 4AN9A 2ZV9A 4E6QA 3WILA 4FSMA 2X0GA 4FIHA 3R7UA 4J53A 3P78A 4JS8A 4QRCA 1M7NA 2YJRA 4L46A 5HE0A 2RKUA 2W7XA 4FTRA 4HGTA 4QYGA 4EEVA 2Z7SA 2W99B 4Y83A 3T9TA 1J1BA 3R8UA 2YJSA 1J3HA 3PP1A 4DT9A 4EYMA 2W5HA 2I0YA 1PW2A 4IB5A 5ACBC 2BZJA 1J7LA 4AX8A 3ZO4A 1XO2B 4UMRA 5E8SA 2FSOX 5FQDC 3QHRA 3QC9A 3R63A 3G0EA 4G6OA 1OIYA 3FXXA 3QCSA 3ACJA 2EU9A 4L6QA 4O96A 3BLAA 5HKMA 1VYZA 2X39A 5JZJA 5AP4A 2QKWB 3NLBA 4XV1A 4OTQA 4OTPA 2PY3A 4RG0A 1YDSE 2YM4A 3AD5A 2W1GA 3F7WA 2O0UA 3E8NA 3QTIA 4J8MA 4QP4A 4E7WA 2WXVA 3DT1A 3NUPA 2BDJA 1TQIA 3DZQA 3KVWA 4IAKA 3EKNA 4X3JA 2CGXA 4YJUA 4W4YA 5HD7A 3W1FA 4QYEA 4BTMA 4BVUA 4DH7A 2BRHA 4AZFA 1QPDA 4KIKB 3EFWA 3TWJA 4GT4A 3DK7A 5DMZA 3I0QA 4IZ5A 3RPYA 2XNOA 2QHMA 4K0YA 4DEEA 3W10A 1OUKA 4LUEA 3M1SA 4EJ7A 4PMSA 3FSKA 3VBYA 3AKJA 3W0RA 4LV5A 3HV4A 1ZRZA 3AC1A 3DJ7A 3K5VA 4FTKA 5CU3A 4I4FA 2QOCA 4RWLA 2WTWA 5BMMA 3S4QA 3BV2A 5BUJA 4M84A 5K4IA 4IM2A 4PMTA 2Q0NA 4IWPA 3EQHA 2X1NA 4KD1A 1JKLA 3MESA 2PZRA 1F3MC 4JG7A 3FDNA 3RVGA 4ALUA 3ORPA 2XKEA 2C3LA 2IWIA 2W4KA 3NZ0A 4ZTLA 3PLAE 5HE2A 3DAKA 2P4IA 3SLSA 3W8QA 3G2FA 4FA2A 4MXXA 5HD4A 4ENXA 2CKPA 4D2WA 1XH8A 2ITUA 4NZWB 1MQ4A 5CVFA 4BJJA 3DNDA 5CY3A 1G5SA 5HE3A 4BCHA 4QQTA 5IEYA 3TMOA 4EHEA 3NYXA 4BZDA 5CEPA 4DH3A 2XIYA 5BPYA 3HNGA 3ZTXA 5J7HA 3P23A 2ITPA 4M97A 4D9UA 3DTWA 5AIRA 3BEGA 1PY5A 4ERWA 3OXIA 2F4JA 4AS0A 4DGOA 1WZYA 2VTSA 4MEDA 4NH1A 1XMMA 3W16A 4AXFA 5LWNA 1J7UA 5EHLA 5BVWA 3EQPA 5F9EA 4H3PA 3ZSHA 4AZTA 3V5LA 1SVEA 3PJ2A 2QKRA 4AGUA 4PMMA 4HOKA 4YHTA 2UUEA 4OAUC 3BZ3A 1GZOA 5HCZA 2XKDA 2V7OA 3FMHA 5I4NA 3IGOA 3UMWA 2QC6A 5ANJA 5I5ZA 2YIRA 4FSNA 2BKKA 1YWRA 3PPJA 4EH6A 4DG3E 5LWMA 2OJGA 3H3CA 4W4VA 1BL6A 3ZLSA 3FYKX 2PUNA 3IGGA 4ZTRA 4ASDA 3AMBA 1FGIA 4FC0A 3V3VA 3SQQA 5AUXA 4AOTA 5JGBA 2Y6OA 3ORTA 3G51A 3EOCA 4GU9A 5FBNC 4I93A 3CTQA 3CD8A 1K2PA 1YXVA 3UGCA 4ALWA 4DLIA 4K8AA 3GGFA 4IDTA 4LL0A 5TE0A 5I9UA 4I20A 4ID7A 4FYNA 1OECA 4FZFB 2XKCA 4GK4A 4RA4A 3RNIA 3MVLA 2CGVA 3QLGA 4E5AX 1TVOA 4GS6A 2CLQA 4IACA 4HYIA 4A9UA 4ZP5A 4EH9A 1XKKA 3FKLA 3FQEA 4V04A 2JFLA 3IDBA 4O7VA 2WMAA 3EQIA 2JKQA 2H9VA 4ZSLA 1R39A 3QFVA 4YC8A 4ZZMA 3LXPA 2ZDTA 3AC3A 5K0XA 3D15A 5KMLA 2O63A 2WELA 1NVSA 3OMVA 4H1MA 3NR9A 2PVFA 3UO5A 1YXTA 4I5HA 5CEOA 4ZLOA 4G5JA 4TYIA 4KIKA 3ZM9A 5IQGA 2WGJA 5J79A 3MH2A 3ORKA 3OROA 3LQ3A 4FJVA 4PNIA 3E3PA 4I5PA 3LOKA 3TIYA 3Q4CA 4BBFA 4QNYA 4E8AA 4CLIA 4XG3A 5K0KA 3ZC5A 4EK6A 2J4ZA 3QTQA 5AUUA 4FNXA 4YPDA 3AG9A 3FZSA 4OR5A 4WUAA 1QPCA 5IQBA 4DEDA 4ZS4A 5JFXA 3M11A 1V0OA 2QU6A 2WU7A 4QQCA 1OIUA 5FEQA 2QI8A 4QMLA 2X7FA 4AGDA 3DXQA 4ZXTA 4DN5A 4O7NA 3F2NA 3LJ0A 3EQBA 3PVGA 4TYJA 5AP0A 3R7OA 2A19B 1OKZA 4MHAA 5IQAA 5I9VA 2OG8A 1DM2A 1PMVA 3D2KA 5D11A 5IEVA 4U7ZA 3QLFA 2LGCA 2WMWA 3ZFMA 2DYLA 4G5PA 4KBKA 4AT5A 5GIPE 4BCPA 1ZOHA 5CU0A 3QA8A 3ZRLA 1STCE 3F61A 2JKKA 2OJ9A 3MBLA 3MGYA 3VC4A 4CFXA 3SC1A 3I60A 3OUNB 1CSNA 1OPLA 4AXCA 4WIHA 2VTRA 2VTJA 1XHAA 2R3PA 4XEYA 4RWJA 4RIXB 3IW5A 3QWJA 5CSHA 1OKWA 2CJMA 4HCUA 4O4CA 4O38A 4JBQA 5DR6A 5FWKK 3KB7A 3ZDIA 5IH4A 1EH4A 5DI1A 4ANMA 4EOLA 4YR8A 4FE2A 4B8LA 3R71A 5GJFA 1OVEA 5J5TA 3ZHPC 5EW3A 3VBXA 4FV7A 3FLQA 4ITIA 3LQ8A 2RSVA 4HNFA 5GZ9A 1UWHA 4ZLYA 2PMIA 4X2JA 4JQ8A 4CKRA 3OEZA 2XK3A 2WPAA 3OWKA 4XRLA 2CGUA 5IZFA 1AGWA 4Y46A 4QMWA 3HGKA 4GYGA 3MPAA 4YLLA 5HBHA 4EOOA 1BI8A 3KKVA 2OJFE 3HDNA 1OITA 2WIPA 4KAOA 4PPCA 3UNKA 4BCFA 2PUPA 3Q6UA 5EQPA 3KGAA 3R9RA 4XP2A 4YBKA 3OG7A 2C5YA 3NNVA 4I24A 4FL1A 2XIZA 4KB8A 2B7AA 4TWOA 4A9RA 1XH5A 4USEA 5JT2A 3KRXA 5KHWA 4KIQA 2VTMA 1IRKA 3LMGA 4WHZA 4ANSA 5CAOA 3OP5A 4YC6A 3Q6WA 3BLRA 4S30A 4HYSA 3U9CA 1APME 4W4XA 4QMQA 4S31A 2YCFA 4O0RA 4NYEA 1PF8A 5KMNA 5CQWA 4AZWA 3NEWA 5KNJA 5JFWA 2A0CX 4FIIA 4HCTA 2QURA 2PZYA 3PJCA 3Q4ZA 4U0IA 4YZNA 2UW0A 3F6XA 5T3QA 4K77A 2WMXA 4E3CA 3C13A 3E88A 3ATTA 4LOPA 2X0PA 4QMZA 2OFVA 1PHKA 3OBGA 1JOWB 1Q3WA 4NL0A 5E8ZA 5KCVA 2PZIA 2YDKA 3EYGA 4XRJA 5AWMA 4WT6A 5DR2A 4N4SA 1PYXA 4A4OA 4JAJA 2W1ZA 3OCTA 4FKVA 4DT8A 4BDIA 4FSRA 2XAOA 4IZAA 4WG5A 3SDJA 3RI1A 5DLSA 2RG5A 4JLCA 4EC9A 4DEGA 2PE0A 2R3OA 2R3GA 4FT5A 2PMOX 4YP8A 5AP6A 4RQVA 2XA4A 3R1NA 4UALA 4Y5HA 4WSQA 3VBWA 5E8VA 5TR6A 4EJNA 3NGAA 3AC2A 3PJ8A 1H1PA 3GCPA 4KIPA 5A4CA 3DKFA 4RWKA 2J0MB 4E4NA 1H0VA 3FSFA 1Y57A 4GUEA 5HTCA 4J52A 4EHVA 1Q61A 1MUOA 3UO4A 4ZY4A 4RJ5A 1W82A 1M14A 3OUKA 4HZSA 3NUNA 4FYOA 4PUZA 2NNWB 1OUYA 3GNIB 4C8BA 2OZAB 5E91A 2WQEA 3VONA 3FZTA 4LMUA 4DFNA 1ZYLA 3HAMA 3CKXA 4RIXA 3R0TA 4GIIA 3UYSA 2WD1A 5JFVA 4O84A 5M06A 5AUZA 3UODA 5TO8A 1PXIA 3RZFA 2OO8X 4Z7GA 1JVPP 4XP0A 5FDXA 1PMNA 1H4LA 2J0IA 1KWPA 4I6QA 2XRWA 4R1YA 1M2RA 2YFXA 3LW0A 1UKIA 4OGRA 5CLPA 5GJDA 2ZYBA 2W1EA 4Q5EA 4U9AA 1YVJA 1YWNA 3WIGA 1YI3A 1XH7A 4GKIA 4IJPA 3GC7A 2J5EA 2C1AA 3TCPA 1IA8A 2IEWA 3DJ5A 3ERKA 3HMOA 4L7SA 3VW6A 3UO6A 3NNWA 4KS8A 3TTJA 1R0EA 4LMNA 1IA9A 2B4SB 4AN3A 4UYAA 3BHUA 4EWQA 3COIA 3GCQA 1OL5A 3IKAA 3QQFA 4K6ZA 5FM2A 4F09A 1Z5MA 4TY1A 4Y8DA 4JBPA 4R6VA 5HNBA 4RC2A 3NVMB 5AV4A 4RFYA 4R7BA 4RIYB 2QO2A 3E7VA 3MY0A 4QPSA 3UC4A 3KRRA 3FMLA 3IDPA 3IS5A 4IVCA 5H8EA 3BYUA 3NW6A 3FPQA 5CEKA 3N4TA 3ID6C 3HP2A 2ONLA 5D10A 3ZFYA 1G8JA 5E7RA 4PY1A 3WBLA 4J98A 4O6LA 3R1SA 1ZYDA 3ENHA 3L9PA 2XJ1A 2DQ7X 2YIXA 2R3JA 5FP5A 3POZA 3RM7A 3U9NA 4S32A 1IAHA 4PDOA 2VUWA 3HECA 3TZ7A 2OSCA 4AQCA 4F9WA 5DOSA 3UZRA 4FKTA 4YO6A 2ZOQA 4JDJA 1AQ1A 3AGMA 4FRFA 4XV3A 4L52A 2J5FA 3MH1A 4YTCA 3LAUA 4N0SA 4Y72A 1SNXA 4L44A 2XEYA 3HVCA 4QMMA 3VUMA 2C47A 4RLLA 2C30A 1BI7A 4FKLA 4EONA 3LM5A 3PIZA 2WZJA 5CU4A 1CM8A 2WTVA 1E1XA 1ZOEA 4EORA 4IVBA 3F82A 3FXWA 4R7HA 4O0SA 3MB6A 4QDVA 4FF8A 5IA4A 2I6LA 3BLHA 4U81A 5BVDA 3QF9A 4OBOA 3BBWA 2BALA 2VWUA 3LJ1A 3OCBA 1FPUA 1P5EA 4ACGA 4QMNA 4E93A 3MH0A 3QD3A 4CYJA 3FZOA 3PG1A 4J1RA