4QTAA

Structure of human erk2 in complex with sch772984 revealing a novel inhibitor-induced binding pocket
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
349
structure length
335
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique inhibitor binding site in ERK1/2 is associated with slow binding kinetics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 111
structure length 335
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qtaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qtaA01
4QP8A 4RJ5A 4O91A 3E3BX 3OWLA 3ZONA 4L52A 3VUIA 5K4IA 4FTAA 4FYOA 4Z7GA 1YI4A 2C5YA 3KMMA 3IDCA 2GDOA 3C5UA 2YCQA 4ANMA 4C4HA 1PXKA 3M1SA 4CRSA 5D12A 4DEDA 3ZFXA 2DYLA 5DI1A 1PMNA 3IW5A 4X3FA 4PDOA 4JG8A 1H26A 2OSCA 3FI3A 2C30A 2ZOQA 5ETFA 3Q6WA 4IHPA 1LEZA 4BZNA 4Q9ZA 4OBPA 5HKMA 4AT5A 3C0HA 3KGAA 5IG1A 1A48A 4FTIA 4PWNA 5AR4A 4JBPA 2X81A 2PUUA 4FKLA 3QTQA 2JFLA 5IUGA 4BCQA 2W1CA 2J90A 2X8DA 3MIYA 4LMUA 3VBTA 4W4VA 4U3YA 3RNIA 2IZSA 2JDSA 2B0QA 2WEIA 2WMSA 1R0PA 4IC7A 3KVWA 2LGCA 3G6HA 4D9UA 4BFMA 2IVSA 3GENA 4IW0A 2UW4A 4JDIA 3TEIA 2J50A 2VTIA 4FI1A 4UV0A 5DH3A 1Y91A 4FODA 3N9XA 3NYOA 4FV5A 4L8MA 3ZU7A 1URWA 4D1ZA 1F0QA 1V0PA 2VAGA 2VZ6A 2QG7A 4KD1A 3DGKA 4LV5A 2WMBA 3I6UA 4TWNA 5DNRA 4FSWA 4BTFA 3OW4A 3R1NA 2ITVA 4XP2A 5AR5A 3D0EA 2V7OA 3OTVA 5CEMA 3RAWA 3WZJA 4IMYA 3DBEA 4X2JA 3MJ2A 1H24A 4LMNA 3NNUA 3VHKA 3RK5A 1OITA 4DFLA 1AGWA 3JR1A 2R3NA 1OL5A 2E9UA 2PVKA 3WYYA 3BHYA 3MVMA 4QMTA 4TKSA 5ANDA 1YHVA 3AGLA 1Z5MA 4FBXA 4D5HA 4DG3E 3LE6A 3QTWA 4O0XA 4HGEA 3PSCA 5EKOA 5CF6A 3UOJA 1UA2A 2J0IA 4HGSA 5CYIA 5E91A 3NYVA 3KK8A 3TN8A 3UC4A 2BCJA 1BI7A 5CWZA 5AX9A 5FDPA 5HCYA 3RAHA 3V8SA 4KBAA 4ALWA 2YAKA 4FTRA 4FOCA 1H07A 4U44A 5IEXA 4R1VA 3EQFA 3HYHA 5EM8A 4A4XA 3PXKA 3O0GA 4D2TA 5JGDA 3UOKA 4FNZA 4U0IA 3EN4A 5D41A 1DM2A 3PPKA 3EN6A 2ITXA 2ZMCA 4G34A 4WNPA 2YDIA 3NW7A 2XRUA 4OTDA 5IQGA 4FUYA 3QXOA 1JSUA 3QRUA 3ZLWA 4G16A 3GU4A 3LFQA 3D5UA 4I23A 4AP7A 3TKHA 3ZSGA 5L6OA 2OIBA 3AOXA 3TUCA 2YDKA 2JKKA 5E8XA 5TKDA 4CSVA 4L53A 3ZCLA 4RFYA 5I9ZA 1M14A 2H96A 1K2PA 5AP5A 4XLIA 2IW9A 2W05A 2W1GA 4XUFA 3NVKI 4EHGA 3VBWA 4JOAA 4F0IA 1ZMVA 2O0UA 3OEZA 4AX8A 4GVJA 4O7YA 1YWNA 4R5YA 4E8AA 4O82A 3Q32A 1GIJA 3ORTA 3G9LX 3WF9A 1KE5A 2OFUA 4YGAA 4ZSAA 1FMOE 3CCNA 2XNNA 5DIAA 4CZTA 2ITUA 4PTEA 3P1AA 2W1ZA 3W33A 3F5UA 3IONA 2Y6OA 2YA9A 4RJ4A 4BCFA 3CTQA 3IQ7A 3OY1A 5E8YA 5HOAA 4I4FA 4IB0A 4TXCA 3WE8A 4M67A 4ACDA 5EI8A 4YZCA 1LUFA 5KMIA 3DLZA 4MXOA 3BV2A 2QOOA 1OBDA 3UVQA 4CV9A 2JITA 4MBIA 4C62A 5D7AA 3PVBA 3A61A 4HYHA 1PXIA 3ODYX 2X9FA 3HP5A 4EOPA 2EUFB 4EEVA 4CG9A 4TWOA 3EJ1A 3FHRA 3FSKA 3FY0A 2W1HA 3OBGA 5FTQA 3ZUUA 4HOKA 2C6LA 4I6BA 3ZTXA 4NM5A 5EHYA 4JR7A 2XNMA 3MH2A 4N0SA 4RJ8A 4NL0A 4J8NA 4MK0A 1GOLA 2IPXA 2XJ1A 3U6HA 3FXWA 3Q4UA 3IPHA 4TYEA 3ALNA 4FSNA 3GGFA 1YQJA 2CMWA 2ZV7A 3KXHA 4TT7A 3UMXA 3W16A 4PF4A 5C1QB 4MD9E 5CS6A 5EDPA 2OI4X 1W98A 4NK9A 5AADA 4APCA 4PMMA 5B0XA 3DFAA 3AD5A 3MFRA 5FRIA 4USFA 2QHMA 5F4NA 3R8MA 3G33A 5CT7A 4BDFA 5KO1A 4DH1A 1OVEA 5JRSA 4U79A 5CNNA 2R3QA 2QI8A 1CM8A 3QBNA 4IVDA 4BTMA 2YM4A 3U8WA 3RCJA 5IISA 3AMYA 4GG7A 4K9YA 3PXFA 5KMLA 2JDVA 3R00A 4AZWA 3L8VA 3TDWA 2WKMA 3PIYA 5IU2A 3VBVA 5GZ8A 4OAVB 3DB6A 5DR2A 3R7EA 3EMGA 4UYAA 3UZTA 4GKIA 5FWKK 3UQFA 5IQHA 4YTFA 1QMZA 3V5PA 4D2RA 1J7LA 4H36A 3DDQA 1WMKA 5IA2A 4FKUA 2CCIA 1U4DA 2UVZA 3R83A 1YXVA 4S33A 3L9LA 4GVAA 4FTJA 2QLQA 2IVUA 4O22A 1XH8A 3BBTB 4AXAA 4D2WA 4KKEA 4HPUE 1PXJA 4PL4A 1LR4A 5E8ZA 2BIYA 4MXAA 4R3PA 2Y8OA 3BBWA 2UZWE 3MVLA 4FZ7A 3FZPA 4UYNA 5CXHA 1OBGA 3I0OA 4BBEA 1H08A 2XBJA 3CTHA 1IG1A 2R3MA 3BPRA 5EOBA 1I44A 1OPJA 2W4OA 4H1MA 5AP6A 4O84A 3AT2A 3BGZA 2C5XA 3OXZA 3PSBA 3C4ZA 4O7ZA 2AC5A 3W2QA 4OT5A 4E5WA 3Q60A 2I0HA 4ZLYA 2YM3A 4O86A 3DFCB 3FV8A 4I21A 2OXYA 5IQAA 3SX9A 4CQGA 4K8AA 4X2NA 2ONLA 3VULA 2RG5A 3LJ2A 4FIIA 2UZDA 3KMWA 3R7OA 4F9YA 4EK4A 5HTCA 4MXZA 3A60A 1VR2A 4F7LA 3VS0A 3H0YA 3EB0A 5GZ9A 2C6EA 4UMTA 3LFFA 3HV7A 4YTIA 2SRCA 4L3LA 5HLPA 2F7XE 3H9OA 3QALE 4YNEA 3ZZEA 3Q04A 1L3RE 4CCBA 3FI8A 4FL2A 5EI6A 2YLEA 3MB6A 2W0JA 3HA8A 2HYYA 5CU3A 5J8IA 5HTIA 2XYNA 4WUAA 4ASXA 2WTKB 2WTCA 3R9DA 5FQDC 4FKJA 4PMPA 4IE9A 3Q53A 5GJFA 2VGOA 4AT3A 5CF5A 4EK8A 3QQHA 1U54A 1PYEA 4H3BA 3DJ7A 4LRJA 1JOWB 2XM8A 4JVGA 2HXLA 3UOHA 5BVDA 3NEWA 5G1XA 4KBKA 1Q3DA 4KRCA 5B2LA 3U6IA 3G6GA 3OT8A 1QPDA 3HUBA 3HV3A 2XMYA 4FX3A 5E8VA 4CD0A 1ZY5A 4FV0A 3HECA 4IADA 4NFNA 2PUNA 4F7JA 4OTRA 3PXRA 4LRKA 3QUEA 4JIAA 5ETAA 3VJOA 4CMOA 1R39A 1FVRA 3FZOA 4E1ZA 4UN0C 1NW1A 3P23A 4OW8A 1T45A 4RJ6A 2Q0NA 3R2BA 2Z2WA 3QKMA 4J1RA 4GH2A 3R8UA 4HYUA 2VWIA 4RIWA 4D4SA 1SNXA 4UWBA 4X7QA 3JYAA 4ANQA 3ACJA 4ZTRA 2G01A 1TKIA 3DBFA 4GU6A 4O2ZA 2YACA 3GVUA 3I1AA 3PVWA 4LFIA 4F9AA 3G9NA 1KE7A 3D2IA 2GHLA 3GCVA 3GQIA 1OZ1A 4EJ7A 4LI5A 1MQ4A 1NVSA 3FYKX 1E1XA 4IX5A 3VS5A 3C0GA 3FQHA 4ITHA 3KFAA 3PZEA 5KHXA 2GCDA 4L46A 2HW6A 2RFNA 4WNMA 3CSVA 3OW3A 4BCOA 3QZGA 1J1CA 4F9WA 3HGKA 2UVYA 2EB3A 4BDJA 3JVRA 2J2IB 3H0ZA 3BEGA 2WMTA 3GUBA 3BV3A 2W96B 2VD5A 4UXQA 4XRJA 5K9IA 4MBLA 3GU6A 3W2RA 1PMEA 3PLAE 4JAIA 2R7IA 4E7WA 4FK6A 2QKWB 3BWFA 5LVNA 2X6EA 3KB7A 2HIWA 1BL7A 2BRMA 4O21A 4D2PA 2HCKA 4DYMA 4ZK5A 3F7WA 5L2TA 3I0QA 4IJPA 2BPMA 4DF3A 1H1QA 1TQIA 3PYYA 3QFVA 4BBFA 4ZJIA 4N57A 2OF2A 4C36A 4FTNA 3BYMA 1Y6AA 4C7TA 3GCPA 4XBRA 4PNKA 4EL9A 2VO6A 4QNAA 5CI7A 4BCIA 4M14A 5HBJA 2Y4IB 1F3MC 3O71A 2PZPA 3ZLSA 2YIWA 2BILB 5AA9A 4XG2A 4ASZA 3K3JA 3HV4A 4R7BA 2PUIA 4DH5A 2QONA 4QP9A 2ZDUA 4XYFA 2FSTX 5CY3A 5FGKA 5KZIA 3ZHPC 3NWWA 2QO7A 3ZYAA 2YCSA 4MF0A 4RQVA 3UYSA 4KB8A 2R3LA 3GU7A 4DC2A 2PVJA 3SD0A 1URCA 4GK4A 2UZVA 3TKUA 3LZBA 4BCMA 1VZOA 2C6TA 3EFJA 5CEKA 2WU7A 3PG3A 5AA8A 2BZKB 5EQEA 3WILA 3E7OA 5LVMA 1RQQA 2P33A 5A4LA 5KHWA 3S1HA 4DT9A 3DTWA 4U43A 5FEDA 4NWMA 4A4OA 5CXZA 2NO3A 1Q8YA 2V5QA 3SOAA 4GK2A 5KMMA 4GFOA 3EKKA 3HUCA 4S2ZA 1E9HA 2Z60A 4JRNA 5EW9A 4FKIA 5M4UA 4HVGA 1Q61A 5C4LA 4OTWA 3ACKA 4WG3A 2PVMA 3U9CA 4XRLA 3C7QA 2EXEA 4U7ZA 3TV6A 2FGIA 1KWPA 3NUYA 5HZNA 3NCGA 3BU6A 3AC5A 5AR8A 3E88A 3KK9A 2XRWA 4BGGA 3ZBXA 5K5NA 2VTTA 4DE4A 2QO9A 4L00A 3VW8A 3FPQA 3PP0A 3RZBA 4EH7A 1XQZA 3C4EA 4XG3A 1OL7A 2R7BA 4HCVA 4BDIA 3UP2A 4ANLA 5HE3A 2C0OA 5LCKA 3NR9A 4CZYB 3QWJA 3FI2A 3V6SA 4F0GA 3ZO4A 2I0YA 5AV4A 3HRCA 4GCJA 4QP1A 3OOMA 4PPBA 2A27A 2EVAA 4YP8A 1ZARA 2HZNA 5HE0A 3TZ8A 5T3QA 3G15A 1PXNA 1SMHA 5E8UA 4BGQA 4TPTA 3HMPA 2FUMA 2O3PA 3UJGA 3O8PA 2XH5A 5B2KA 1YW2A 2HOGA 2JAVA 4CFVA 1FQ1B 2XF0A 4FZFB 2X2KA 4XOYA 4DGNA 1V0OA 3PJ8A 3VS6A 4DINA 4BDKA 1YOMA 5EH0A 5IH4A 3L9NA 4NZWB 4TNDA 2OJJA 3LMGA 4NIFA 1IAHA 5EI2A 4EOMA 3RAKA 5EQYA 2C4GA 3WZDA 2RG6A 2CHLA 3CD3A 2CKPA 2QOQA 4D2SA 2PMIA 4C35A 4IWPA 1PW2A 3KRWA 2WU6A 4P4CA 5JFWA 3NMUF 3ELJA 2VNWA 3EYGA 4Q9SA 4PPCA 5KCVA 3MBLA 4O7NA 3PRFA 4JI9A 5FDXA 4IANA 5CENA 2F2CB 2VU3A 5BVKA 2HELA 3EQDA 4TWPA 3SRVA 3VUTA 5CSWA 3DKGA 4O2PA 1M2QA 2OFVA 2W9FB 4G9CA 5A6OA 1B39A 3OT3A 2XCKA 4EKKA 4J99A 4PPAA 2F4JA 2WTDA 3N4TA 4WUNA 2HZ4A 2W1EA 4C33A 4D58A 4RPVA 4JX7A 2BKZA 3FKNA 3F5PA 4ZJVA 2OK1A 4PL5A 4FA2A 2B1PA 2QOCA 3OTUA 4C34A 2G2HA 4QQJA 3QTUA 4X3JA 2WTIA 3SW7A 2WB8A 5JSMA 2E2BA 4GW8A 4JNWA 2QO2A 5L8KA 2PY3A 3ORZA 3IO7A 4J7BA 1T46A 4X3FC 2OU7A 3FC1X 5CAVA 1DS5A 4TN6A 3CKWA 4RX9A 2BTRA 2RFSA 4R6VA 4E4NA 5CT0A 5I9XA 3QCYA 4FIFA 4X0MA 3NRMA 2C0TA 5M56A 3KXMA 2XS0A 4HNFA 1PXMA 3FLWA 2WTJA 1TQMA 4A06A 5DR6A 5M55A 5KX8A 3H10A 4QMSA 5EW8A 2BDFA 5D1JA 3KU2A 3SXFA 4G3DA 5KMJA 3O7LB 2R9SA 2OJIA 2C5VA 2VO3A 3DQWA 3PIXA 4H58A 4YJOA 5L6PA 5LWMA 5KNJA 5CU2A 4V0GB 2W4JA 5A46A 4RLKA 3DXPA 5KE0A 4EJNA 3AT3A 3KREA 4FICA 4O7LA 2HW7A 3DQXA 1NVRA 5AR2A 2OKRA 3QTRA 1PRYA 5AM7A 5E90A 3PA4A 4K0YA 4P7EA 2WQOA 3PXQA 4XG7A 4Z16A 2WOUA 4S34A 2WMRA 4FV4A 2PZ5A 4O38A 2RSVA 3W2CA 4A9RA 4JX3A 4AGWA 3K2LA 2F9GA 2W1DA 4RG0A 4MXXA 4RQKA 5ACBC 4QMNA 2O5KA 1NVQA 3GFEA 3UIXA 4D28A 3UQCA 4HGTA 4TRLA 5KMNA 2Y4PA 3NNWA 3IKAA 4J98A 4LQMA 3KRJA 2VWZA 2O63A 4I5CA 2GTMA 4MWIA 1XWSA 3SDJA 2FSOX 4XP0A 2RF9A 1G8AA 3ZZWA 2ITWA 1QPEA 4ENYA 2CCHA 4I5PA 2V7AA 2OJGA 3WF8A 1FMKA 5A4TA 2QQ7A 5J87A 3TV4A 2G1TA 5KMOA 2GQSA 3BWJA 5IH5A 5CZHA 3DBDA 2QOBA 1P4FA 2PE2A 4QPAA 4DN5A 2XNPA 4ZLZA 5CSXA 2RFDA 5BMSA 3B2TA 4BC6A 2PZIA 2R3JA 4I24A 3MPAA 3UIBA 4OTFA 1ZYJA 3COHA 4RSSA 1ZZ2A 3TACA 4H39A 4BCKA 1W8CA 4E26A 1ZYSA 5FTOA 3MVJA 3E5AA 1Q62A 2HWPA 4DFXE 4FIJA 3HEGA 4PDYA 2J5EA 3O8TA 5AV1A 4CRLA 3W8LA 5AAGA 2UW9A 4V0GA 2XK8A 3M11A 1P14A 2B55A 4NH1A 4U6RA 1NT2A 4RC3A 5AV0A 4EC8A 4EKLA 3RP9A 1KSWA 3MVHA 1HOWA 3WIKA 3UPZA 2C5NA 1Q4LA 4QMLA 2HZ0A 4IZYA 3QHWA 2UZOA 4RC4A 3TNPC 1H25A 4EH4A 4ERWA 3CE3A 2WELA 4G3EA 5HO7A 4EZ5A 4DAWA 3N51A 2Z8CA 4G9RA 3BLRA 5FBNC 3SHEA 4F6WA 4KRDA 5AP1A 1YVJA 3R73A 2XP2A 3CLYA 4AF3A 3ORPA 2XKCA 4C59A 3PFQA 5G6VA 2ITQA 4BBMA 4L3JA 2BTSA 4UEUA 1YXUA 4X2GA 4UX9A 2X7GA 4RWJA 3VS2A 5H8GA 2PZRA 3FUPA 2PZYA 2J4ZA 3MGYA 5HD4A 4FG8A 3CGOA 3JPVA 5BVFA 1M7QA 4O1PA 1UKIA 4DGMA 4FTLA 2EB2A 4RWIA 1VJYA 1Z9XA 1Q8ZA 4A4LA 4CKRA 5HX8A 3DKOA 4QTDA 3F3TA 3FDNA 3DAKA 2GFSA 5L2QA 2JIIA 3DOGA 4GS6A 2CN5A 4O27B 5DLSA 2ZJWA 4PX6A 4FV9A 4NJ3A 2WMUA 2WQBA 2E9VA 4FKTA 1PHKA 1YHSA 1Q8TA 2C69A 2VTHA 5AP0A 4E6AA 2O65A 4ZTHA 3MFUA 4E20A 4BDAA 3LCDA 4QYYA 4JDKA 1YDRE 3V8WA 2CJMA 3EIDA 3HMIA 1WVXA 5FM2A 4BICA 3VW6A 3JXWA 3KULA 3LFSA 2WMWA 4D4VA 1R0EA 4EI4A 1OIQA 3QCXA 4BI0A 2YABA 3OCBA 3ORLA 2X1NA 3VUKA 4QNYA 3LFNA 3VBYA 2GNGA 1H4LA 3R21A 1OIRA 3T8OA 2JEDA 3IECA 3RINA 4AZVA 4J96A 1AD5A 2CNQA 3PLSA 2ZM1A 5A4EA 5GZAA 4FV3A 3GFWA 1CSNA 3Q52A 4ID7A 4OTGA 2X7OA 3L8XA 3RJCA 4D5KA 5BYLA 2X6DA 4CTCA 3ORIA 3ULZA 2R3KA 3WE4A 2BDJA 4O96A 5CSVA 2W5AA 2XNOA 4QP3A 4FTQA 3HV6A 3VC4A 3WF7A 3F66A 5M51A 2A4LA 3PPJA 4L42A 4UB7A 5CX9A 5BYYA 1UU9A 5J9YA 3OUNB 2GNFA 2CKQA 2WQNA 2BFXA 3PJ3A 1WBPA 3W10A 4ASDA 3GQLA 4TNBA 4A9TA 3JY9A 1RJBA 1BUHA 4I0RA 1PYXA 1GNGA 3MH1A 5HVJA 3TCPA 3RPYA 2GNHA 3C4WA 1UU7A 4DG0E 2FVDA 1BKXA 4RX5A 1G8SA 2R4BA 4O7TA 4FKVA 4XV2A 5HG5A 4Z55A 4EQMA 4IFGA 3OMVA 5CI6A 5GJGA 5HNIX 4L6QA 3R63A 4EZ7A 1REKA 5CQUA 3CJGA 2IW8A 5M08A 4W9WA 2C3IB 3AD4A 2CGVA 4FTUA 5GHVA 3R8LA 2E9OA 3Q4CA 2X9EA 4II5A 1ERKA 5HBEA 2XKFA 2O8YA 4ZSJA 3LPBA 4BKZA 4IAKA 4B8LA 4QMWA 5KKRC 4RJ7A 4MHAA 4CVAA 4E4XA 4IDTA 3OOGA 4QMMA 1YXTA 5AP7A 4TL0A 1WVYA 2BRBA 2PHKA 5HORA 3QL8A 5CU0A 3VNTA 1KUTA 4QMZA 5J79A 2XEZA 1Z57A 2OJ9A 4ZSEA 4RVTA 3W55A 3NUNA 2OIDA 4M84A 4YPDA 3AC1A 3NAXA 4XEYA 2H9VA 3EFWA 3FLSA 2EXMA 2PUPA 5A9UA 3IG7A 3TKIA 4H1JA 2KULA 4AFJA 2REIA 3QF9A 4G5JA 5BUIA 2C68A 2XIYA 2Z7SA 2J7TA 5CAQA 4FG9A 4NW5A 4MXCA 4AOJA 4YPSA 3GU5A 4BDBA 4QO9A 4L9IA 4TYIA 5TOZA 4Y72A 2BDWA 3BHTA 4FSMA 4P5QA 4S32A 2XK6A 3NDMA 2GNLA 5TT7A 4WHZA 2OZAA 2I40A 2VTMA 3PTGA 3VF9A 4ACGA 1JSTA 1Q8UA 1RDQE 3C1XA 3ERKA 3F3UA 4M7IA 4EUTA 3ZSHA 3HZTA 4IX4A 5IMXA 5ANKA 2PVRA 3MH0A 3D94A 3FMLA 2WQEA 3CEKA 3RGFA 4F1OA 2B54A 3QLGA 3BYVA 1M17A 2ITZA 4EOIA 1XH7A 3BX5A 5C8MA 3FLZA 3AC2A 4QPSA 4AZFA 4AZSA 4ZTMA 4G6NA 3F2RA 1MP8A 4RIYA 1H28A 3KRRA 3E8EA 3QX2A 2C3JA 4GIIA 5E8WA 5ETIA 4ITIA 1UNHA 5H8BA 5FEQA 2BAKA 3P0MA 3C4FA 3DCVA 3RHKA 3E63A 2UZUE 4I94A 2YM8A 4WBBB 5HNGA 3KY2A 4RX8A 3GXLA 4B9DA 3QUDA 4DGGA 3ZRMA 5BVNA 1J7IA 4IH8A 5CU6A 1STCE 1GZOA 3CY2A 4P90A 5DN3A 1OMWA 4ZOGA 4EOLA 2CKOA 5DG5A 4EK3A 3GB2A 4NCTA 5JQ5A 3T3UA 4QD6A 4BF2A 4NYEA 5AFVA 3M42A 1PF8A 3HP2A 5FD2A 3ZDIA 2P2HA 3QYWA 3WIGA 5A4QA 4QPMA 4PTCA 5AUVA 5IQFA 4BCNA 4RZVA 1TQPA 4Z3VA 3F3VA 3ZRKA 2FSLX 2UW0A 4UXLA 3O7LD 3UO6A 4F64A 5IQCA 4AAAA 3DKFA 4EQUA 2RIOA 2VGPA 4ZMEA 2ETRA 3ORKA 4IAZA 1W83A 1CTPE 4A9YA 5IMEA 3R01A 2OJFE 3DTCA 3A7GA 4BL1A 5IQIA 4FTCA 4JLCA 3BIZA 3OWPA 4PTGA 2FB8A 5HNBA 4XLVA 3RBWA 4EZ3A 3TNQB 1O6KA 2QOFA 2R5TA 2B4SB 1WFCA 3RM7A 4HYSA 4PV0A 5CZIA 3VQHA 1Y57A 4DTAA 5E1EA 4KINA 3Q9YA 4RIYB 5J5SA 2XKDA 1UWJA 4A9UA 3MDYA 4DG2E 5IDPA 3BU3A 4EORA 2G15A 3ZLYA 2XIKA 4IFCA 4C4GA 3L8PA 4BI2A 4OTPA 4XG6A 5AIRA 5L2IA 4DEBA 2J0LA 2CSNA 3I7CA 4QP2A 4HW7A 4YSMA 4YHTA 5L8LA 3DKCA 3FHIA 4JAJA 4X2KA 4TYHA 1DAYA 1YI6A 1S9IA 2PTKA 4NSTA 4ACMA 4BDCA 4FEXA 4CZUA 1JBPE 4JIKA 3L9PA 3G2FA 2QHNA 4DLIA 3IDBA 5HLWA 3HDNA 3MY5A 3HV5A 5CVHA 2XNBA 1FINA 2PMNX 4C2WA 4O83A 4YHFA 3OCTA 3UNJA 5A6NA 2YITA 3VUMA 3HVCA 2UUEA 1ZRZA 3BYUA 3DAEA 3O23A 3TWJA 3VS3A 4AGUA 5JMSA 5KBRA 4O81A 2LAVA 3VQUA 5C9CA 5EYKA 4EH9A 4CYJA 1BLXA 2WMVA 4G31A 3LAUA 4AZEA 3AMBA 4IZAA 3E62A 3HAVA 3QWKA 2ITNA 2XZSA 1MQBA 5AP2A 3DXQA 3Q6UA 5C8NA 3QQKA 4FZDB 4D1SA 4Z7HA 2ETKA 3V5TA 4FGBA 4KUJA 4BR3A 4R7HA 1PKGA 3D4QA 4F09A 1W82A 1ATPE 1HCKA 3LXPA 5ANGA 4AG8A 5EKNA 3Q9XA 4NT4A 3KULB 4L45A 4WD5A 3VS1A 3QZHA 2RFEA 1WBSA 3QQGA 4FSZA 1WVWA 1VEBA 4GUEA 4LGHA 4X21A 5DPVA 4I5HA 2R0UA 2PU8A 4JBQA 2WXVA 3IGGA 2IZRA 2HWOA 4JDJA 4I6HA 1OPLA 2UZBA 4BKYA 4MNFA 2QR7A 3DNEA 3KCKA 2JBPA 4YJPA 5ETCA 4ENXA 3KA0A 3DK3A 4K6ZA 5HG7A 4CEGA 4USEA 2VV9A 5DBXA 5HQ0A 2QD9A 3ZM9A 3K5UA 4ZIMA 2YIXA 3CJFA 5FXQA 2C6DA 3IW4A 4GU9A 5IUHA 4I6FA 3FYJX 3PG1A 2YEXA 3Q5ZA 2BFYA 2WHBA 5A3XA 4ALUA 3R7VA 5JK3A 3IK3A 2JD5A 2WIHA 3LQ3A 5KZ0A 4XV9A 4XV3A 3H30A 4PL3A 5JGAA 1JKTA 1SVEA 3HX4A 4YZNA 3MY1A 3KF4A 3SXRA 4GKHA 3KEXA 3MV5A 3RI1A 2GSFA 2JDRA 2UZTA 4W8DA 4YJVA 5C4KA 2NRUA 1H0WA 3U54A 4IACA 2ONLC 3HNGA 3D15A 4LUEA 4L67A 5L2SA 3FY2A 3EZVA 3NNXA 1OKZA 4O7SA 4DTKA 4EOKA 1XH5A 4IM3A 4KKGA 3NIEA 5JFVA 3S2PA 4CGAA 4M97A 3DJ5A 3UVPA 4M0ZA 1WBWA 5IEYA 2W5BA 3HL7A 4K2RA 4BVUA 2V22A 4YLKA 3EL7A 4UBAA 4YMJA 4G5PA 3JY0A 4GV1A 3QYZA 3O2MA 4NFMA 5D10A 3FMHA 4N6YA 4AGCA 2GS2A 2PSQA 3TJDA 1SZMA 4KBCA 1OKWA 4ZEGA 4R3CA 1OECA 3HA6A 3TJCA 4CTBA 5J1WA 3C5IA 3W2OA 3SGCA 3GP0A 1LP4A 5JFSA 3C0IA 4GL9A 3GCSA 2W99B 4FMQA 4NM0A 5H3QA 2ESMA 3R8VA 3LFAA 2RL5A 4M12A 4G3GA 5BMMA 1ZYDA 2YJSA 3AXWA 2VX3A 3PA3A 3FLNC 3KVXA 1H1PA 2XB7A 4PMSA 5HLNA 3SRVB 3L9MA 5IPJA 3BGPA 4IX6A 3IS5A 5CASA 2GQRA 4A7CA 4UY9A 3RWPA 3MYGA 3ZXZA 3F2AA 5I3RA 1WCCA 3FWQA 4FIHA 3NLBA 3W18A 4DGLC 2JAMA 3R22A 4MEDA 3OHTA 3EOCA 2AC3A 3QCQA 3POZA 5AX3A 2ZVAA 2Y6MA 3FZTA 1Q24A 2UVXA 4RIOA 3QX4A 3SC1A 1O6LA 5M07A 4OR5A 4GEOA 4E93A 4TWCA 1Y6BA 4F6UA 2GPHA 5FXSA 4FGRA 2C5OA 4KIQA 2EWAA 4RMZA 2ITYA 4S30A 3ZC5A 1XKKA 1M2PA 3QUPA 4O0WA 2PVFA 1UWHA 4HYIA 4AE6A 3BQRA 5J1VA 4DT8A 3H9RA 3PUPA 4JBOA 5KMKA 2VTJA 4AS0A 2NP8A 4Y73A 4CV8A 4EUUA 4NJDA 5I9UA 2GS6A 3WZUA 2QCSA 5LMKC 2PE1A 3A7FA 4ZSLA 2OO8X 4RIWB 2X4FA 3OEFX 5LXMA 5JZJA 3FLYA 4YUQA 2PE0A 2JC6A 2XM9A 3ZOSA 3UIMA 3AG9A 4FKPA 4DCEA 5IEVA 2GS7A 1GY3A 4C37A 3BGQA 4ZAUA 1L8TA 4FEWA 5EM5A 4IXPA 4N4SA 5CF4A 3CR0A 2YIYA 4I0TA 4Y8DA 3RNYA 4EWHA 5AUZA 3ZDUA 2ZAZA 3C4XA 4LM5A 3FMMA 3I81A 1KOAA 3ZUVA 4BB4A 4QMVA 4IM2A 4L7FA 2YERA 2ZV8A 5CSPA 5FLFA 2I0EA 5BPYA 3V5LA 4KNBA 3KMUA 2CKEA 4Q5EA 2CGUA 2JFMA 4OT6A 4BIEA 2WMAA 1A9UA 1P4OA 4D0WA 2PYWA 3JUHA 3ZC6A 4BHZA 3A99A 4ZY4A 2Z02A 4GT3A 5J9LA 2XJ2A 1W0XC 1JAMA 3ITZA 4EBWA 4BDEA 1JQHA 3NIZA 2QU6A 4FV2A 3A7IA 2R2PA 1KOBA 3D7ZA 4U97A 4D2VA 4DGOA 4F7SA 3BI6A 4U41A 4IB3A 3V5WA 2ZDTA 3IW6A 1APME 1CKPA 3KRLA 3BEAA 4IVCA 4QTAA 4YZDA 5T68A 3RK9A 1ZZLA 2J0KA 3F61A 3R0TA 2O2UA 4IB1A 3CY3A 5I3OA 1OIYA 3DB8A 5HI2A 3RWQA 3Q96A 3TNWA 2Y4IC 1IEPA 3Q3BA 5JN2A 3TTIA 4RA4A 4YU2A 1QCFA 4DBNA 1CKJA 2ETMA 3D14A 1OIUA 4WKQA 4L7SA 4QMUA 5ITAA 5I0BA 3BU5A 3R1QA 4JDHA 5HG9A 4DFUA 1KE8A 2CN8A 2HK5A 3UVRA 3EZRA 4FIEA 4AE9A 3MSSA 2CLQA 5IKWA 4FR4A 4KSPA 3QD0A 5CLPA 3O51A 4RIXA 4C38A 4FL3A 5D9HA 5BQ0A 4O7WA 4CT2A 3K54A 1DI8A 2WNTA 2YCRA 4FV1A 4WRGA 4J8MA 3Q2MA 4KA3A 2VTRA 3PJCA 4RX7A 4UWCA 4AW1A 4DEAA 4FT0A 5DRDA 1KV2A 4ERKA 1YI3A 3VWAA 4AN3A 5AP4A 2GNIA 2H6DA 5HIEA 3IW7A 4MCVA 3FEGA 4CMUA 4IM0A 3R9RA 3TM0A 4X3FB 5DT3A 3D5XA 3P7AA 5AJQA 1YWRA 4J53A 3ZMMA 3SLSA 2YHVA 4E4LA 1ZOEA 3FPMA 4CFNA 1UNLA 3DY7A 2IWIA 3LFCA 3NUXA 1R78A 5DE2A 3NYNA 1PXOA 3QTXA 4OGRA 4BHNA 5LCJA 2Z7LA 4R1YA 4YO6A 3OVVA 3SG9A 4G2FA 4OTIA 2JIUA 2ERZE 3I6WA 2NRYA 4V05A 1JVPP 4AT4A 3OS3A 3REPA 1G3NA 2IVVA 3D2KA 3I7BA 3FQEA 4QRCA 3R7UA 4EYMA 2R3HA 4JG6A 5M4CA 1YWVA 3OC1A 3MTLA 3CXWA 1M2RA 1W84A 5HE2A 3UIUA 2CGWA 3SV0A 4O7VA 4ZLOA 2GNJA 3LIJA 4RWLA 3R9HA 4W4YA 2BZJA 2XCHA 3F3ZA 2VRXA 4YBJA 2QR8A 4MVFA 5BUEA 3FL5A 3WBLA 3QAME 3E8DA 4PUZA 3G90X 5AP3A 3ZO3A 3MESA 1O9UA 5IH6A 2JDOA 2BRGA 2XYUA 3R1SA 3R7IA 4YTHA 4BWPA 1J91A 4RVMA 5HIBA 3TZ9A 3ZFYA 3NVMB 4CYIA 4ZY6A 3HMNA 1XBCA 2UZEA 3ZS5A 5JEBA 2OH0E 2OXDA 3QQJA 4FZ6A 3CS9A 3LM5A 4HVDA 2WEVA 4MWHA 2WGJA 5EYCA 5K3YA 1CMKE 3PZHA 1MRVA 1Q41A 2E9PA 4ZZMA 2OIQA 1BMKA 3U4UA 1ZOHA 3P7BA 2GMXA 1ZY4A 4YZ9A 3R04A 3DBQA 4C3RA 4EC9A 4K18A 3ALOA 4GRBA 4UALA 4WRSA 4AZTA 4WOVA 3ATTA 4FV6A 4U8ZA 5EHLA 4KIOA 3F69A 3TNHA 4F70A 4K1BA 2XJ0A 3AT4A 3D9VA 2X8EA 4G3CA 5CANA 5M53A 2JKQA 5EM6A 2BR1A 5H8EA 3MPTA 2UW5A 4CQEA 4M8TA 4MKCA 1E1VA 3ET7A 5E92A 4CKJA 4MNEB 4F4PA 3KRXA 3MTFA 4GYGA 3VVHA 1BL6A 3PSDA 4QQ5A 2NNWB 3OCGA 3P86A 5F94A 3RHXA 3MPMA 3RMFA 3TNIA 2UV2A 4O7RA 4AA5A 1Q8WA 3LQ5A 1A06A 4EOQA 1ZMUA 2QKRA 3QC4A 4C2VA 2FO0A 3M2WA 3WYXA 5GJDA 4BN1A 1JWHA 4XG4A 3BYSA 5I5ZA 1B6CB 2Y0AA 3WOWA 4O1OA 4EOSA 4MAOA 4F9CA 3KN5A 1GIIA 3RPRA 2WPAA 2OXXA 3O50A 2VTLA 4APPA 2W5HA 5GNKA 1V0BA 2BHEA 2VUWA 3A4OX 3Q9ZA 4FYNA 3LMIA 2YM5A 3TUBA 3KF7A 3U51A 3EN7A 4IX3A 4GUBA 3BLQA 4FEVA 3G0FA 4DLJA 1IA9A 4LOQA 4RJ3A 2IG7A 4GJ3A 3LJ0A 3L8SA 1UU8A 3KC3A 1NA7A 4C4IA 2B52A 3KXNA 3MW1A 3DDPA 3RM6A 3KL8A 3ZO1A 4YJUA 4R78A 2A2AA 2A0CX 1YKRA 5IA3A 4EHZA 2OZOA 4MF1A 4JRVA 5LVOA 3I5NA 2XIXA 1H8FA 3N4VA 4FIGA 4YJTA 1X8BA 2ZB1A 4BYJA 5DGZA 3DV3A 3GBZA 4RWKA 1KV1A 3PXZA 3OBJA 4MX9A 5AUXA 5KBQA 5M09A 2WMQA 2X7FA 5AMNA 3NW6A 3R9NA 1Y8YA 4C3FA 5F1ZA 4JG7A 3EQGA 5CQWA 2C3KA 4BWXA 1FVVA 3NUUA 4IWOA 4XP3A 3GT8A 3B8RA 4XG9A 5H9BA 5HHWA 5J7BA 3NUAA 2B9HA 4H3PA 2EXCX 2OW3A 3CPBA 3DLSA 4CFWA 5GINE 4QP4A 2CGXA 4FNWA 4X2FA 4Y46A 2Z7RA 2R0IA 2HXQA 5I9VA 1KE6A 4I1ZA 1CKIA 3GCQA 4RVLA 5AEPA 4QMYA 3GOPA 4R3RA 3VS7A 4FTOA 2OF4A 2F7ZE 4MQ2A 4E6DA 1H1SA 4BRXA 5KKRB 1YXXA 4GMYA 2PVNA 4JT3A 2X8IA 4YLJA 1TVOA 3OD6X 3VS4A 2VTOA 4JR3A 1R3CA 4XG8A 3ATSA 4S31A 2NPQA 5JFXA 1LPUA 5GIOE 2YDJA 1MRUA 1U5QA 2IVTA 3LVPA 4EH5A 5HTBA 4OAUC 3G51A 2ITTA 3ENHA 3EYHA 2VX1A 4YR8A 2VWWA 4YZBA 3F6XA 3VIDA 2YCFA 4IC8A 3FMEA 1YOLA 5CALA 3N4UA 5HG8A 2ERKA 4FKSA 4D4RA 1U5RA 3LCTA 3UE4A 5E9EA 3QGWA 4YSJA 3KKVA 1P5EA 3R6XA 5HVYA 2OICA 2C6MA 1QPCA 3JS2A 3CP9A 2IZTA 2P0CA 4C4JA 4AW0A 5FBOA 5IA5A 3NGAA 4QYEA 4I4EA 2WMXA 4IQ6A 3B2WA 2WAJA 3OZ6A 2C6IA 2YM6A 5CU4A 3IDPA 3EN9A 3F5XA 1M7NA 5EM7A 3S00A 3QRJA 4HCTA 4FG7A 1H0VA 2FSMX 2WTVA 1JSVA 3D7TA 5HICA 3RALA 3UYTA 5IA4A 2F49A 3MH3A 4QMPA 1WBOA 2RKUA 3Q4TA 4IAAA 4ANSA 5DYJA 5ANOA 3I79A 4AACA 3EFKA 2QOKA 2AUHA 5LWNA 3S0OA 5HGIA 3F5GA 1O6YA 2CDZA 4G1WA 4RFMA 3QRIA 4DFYA 3KXZA 3LFEA 4USDA 4ZJJA 1REJA 1SNUA 3ZM4A 5ANJA 4BIDA 2XIZA 3SA0A 5TO8A 4R8QA 3W1FA 3GOKA 1G5SA 4UMQA 2Q0BA 5EYDA 4HJOA 5AM6A 3SG8A 2B7AA 3ZEPA 4EK6A 5IQDA 3WZKA 3DBCA 3R7YA 4TTHB 4M13A 3SXSA 3GI3A 4IVBA 4OBOA 1J1BA 4EH3A 3DT1A 3QXPA 5AUTA 4G6OA 4DH3A 3A8XA 1NXKA 3HLLA 4KWPA 4OBQA 3QD4A 3CPCA 4FNYA 3QQFA 4LL0A 5HEZA 4HZSA 2VTPA 5HX6A 2YZLA 3DK7A 4CFMA 2C6KA 2YAAA 4HGLA 4V04A 2FA2A 3RPVA 3R1YA 2QOHA 3HMOA 5CAOA 4KS7A 3ZSIA 2BZHB 2UZNA 3RZFA 2DS1A 1PXLA 5M44A 3A7JA 4WA9A 3MFTA 3PWDA 1UNGA 5F20A 3MA3A 5HE1A 4EH2A 4DEHA 3LHJA 5BVWA 3VBXA 5AUYA 3LM0A 3NPCA 2JKMA 3QQUA 3EHAA 2C6OA 3PIZA 4C58A 1SM2A 3ORXA 4O0SA 2H34A 3FKLA 2BAQA 1YRPA 3BKBA 2YFXA 2XK9A 4U45A 4H05A 3HDMA 4K33A 3BHHA 4FT3A 4AQCA 2X0GA 1QL6A 4ZSGA 1W7HA 3UNKA 4MBJA 5K0XA 1FOTA 3EWHA 1XJDA 2G2FA 1YHWA 3AQVA 2ZV2A 4FVPA 4IZ5A 4J95A 4QTBA 4QQTA 3E64A 3GC7A 3R71A 4HPTE 3RPOA 4F08A 2QOIA 3Q9WA 3A2CA 1OUKA 5EQPA 3DPKA 4CT1A 4DTBA 5HO6A 2GHMA 3IOPA 4PY1A 3PVGA 2R3GA 2P55A 4LGGA 4FKGA 4W9XA 2RGPA 4O0RA 4V01A 4BZDA 1H00A 1LEWA 1M52A 3E87A 3PPZA 5FXRA 4D1XA 4IVAA 4BY9E 4IB5A 3TTJA 4OTQA 4BDGA 4KS8A 3RVGA 2VWUA 3L1SA 3LCSA 1IRKA 3GC9A 3UC3A 3OROA 3QD2B 5HBHA 3UNZA 5GIPE 3UO5A 4ZTNA 2YIRA 5HO8A 4MD8E 1BYGA 4FL1A 2W1IA 4GT4A 2W7XA 4I0SA 4OUCA 4Q2AA 3U87A 2OBJA 3HKOA 4FEQA 3ZUTA 2V62A 4D0XA 5A54A 5IDNA 2BRNA 4AU8A 4IEBA 2VO0A 4O6LA 3GEQA 3THBA 4XBUA 3GNIB 4XV1A 5TR6A 2PWLA 3CIKA 3RPSA 3UODA 4N70A 3V01A 5IA0A 3CD8A 1Q5KA 4LUDA 2C1AA 2BZIB 3BHVA 2F2UA 5C01A 3WI6A 4GFGA 4C02A 3KXXA 4WSQA 4C4EA 3PVUA 2CLXA 5C8KA 4I93A 3UZPA 1UV5A 3TIZA 4E4MA 3F7ZA 3MJ1A 4XX9A 3QCSA 4YC6A 3F82A 3DK6A 4Y85A 2VX0A 4F1MA 4YJRA 3ZLXA 1XO2B 3LMHA 3POOA 1UKHA 4PP9A 4ZXTA 4BCPA 5M4FA 2WFYA 4DITA 1S9JA 2VN9A 3DJ6A 3MFSA 4IZ7A 3UP7A 5FP5A 2PL0A 3ZFMA 2V0DA 4U81A 1H27A 2XKEA 4ANBA 3BRBA 4LL5A 4MQ1A 3VHEA 4RLLA 3AC8A 4KKHA 3PJ1A 3EH9A 3UG2A 4PP7A 4EH6A 3DS6A 5M57A 5EYMA 5E1SA 3FMKA 4I3ZA 4QYGA 4DH8A 3VRZA 1OGUA 5JKGA 2PVYA 4MYGA 3T9IA 4OLIA 4D4YA 4AW5A 2XIRA 3MA6A 5DWRA 1R1WA 1OM1A 2XEYA 3NZ0A 3T9TA 2J0MB 5J5TA 4DFNA 1XHAA 2WQMA 4AA0A 4O6EA 4FUXA 2ZM3A 2X2MA 2BHHA 3NSZA 5BVOA 4FT9A 3IOKA 2VTSA 4G17A 4WNOA 4ZTQA 5CSHA 3TV7A 1H1RA 1U59A 5FTGA 3BZ3A 5L6WL 2WO6A 3VF8A 2QLUA 3SKCA 4C3PA 2ACXA 4M0YA 1FGKA 2C47A 4CKIA 4TZRA 4RA5A 1IASA 5E8TA 3HAMA 2CNUA 4RZWA 5J7HA 3CBLA 4AA4A 5F95A 2QVSE 3FJQE 3NUSA 4FTTA 2Y9QA 2ZB0A 4NUSA 4CNHA 2VTAA 2BMCA 2J0JA 3OWJA 3VJNA 4AOIA 3P4KA 3H4JA 4CXAA 5FP6A 2R3OA 4HVHA 5LMAA 2P4IA 3F88A 4TYHB 5FEEA 4IDVA 3VAPA 3D5VA 3BCEA 4KIPA 4Z9LA 5TE0A 3FMNA 4U5JA 5C27A 4KAOA 4F7NA 1FBNA 1GZ8A 2XVDA 3FQSA 4ZTSA 3BELA 4I20A 2BRHA 4DEEA 2OG8A 4EHEA 4O0UA 1JKLA 1WBVA 2VWVA 2ZV9A 3G0EA 3NNVA 4HVSA 1WZYA 2UW3A 3CKXA 3QLFA 4XS2A 2XUUA 3PWYA 4NCTC 2I1MA 3T3VA 3CQEA 2I6LA 4BCHA 1K9AA 2J5FA 3ZBFA 4UZHA 4KABA 2J6MA 3DU8A 3H9FA 5K0KA 3RCDA 5HU3A 2YWPA 4M15A 4G3FA 3K5VA 2FYSA 2X2LA 5DEWA 4WBOA 5ANIA 4WO5A 3V5QA 4MD7E 2XK7A 3S4QA 1AQ1A 2J51A 5LMBA 4O0YA 3LCOA 4QP6A 5AV2A 3WARA 2QURA 4CFFA 4NEUA 1PJKA 3PJ2A 3TL8A 4AGDA 4ANNA 5DHJA 3ZXTA 3E8NA 4IIRA 3V3VA 1ZWSA 1JKKA 1FVTA 5LQFA 1FPUA 3FC2A 3IGOA 2QG5A 4C8BA 4GG5A 4YO4A 2PULA 3FZSA 3TIYA 4QQCA 4MTAA 3KXGA 3U6JA 2F7EE 1V1KA 4HZRA 4NTTA 4KIKB 4BDDA 3C50A 3F9NA 4QTEA 4XOZA 1OUYA 4WIHA 3EQIA 2I0VA 4JQEA 1MUOA 5HVKA 5IQEA 3NCZA 1OPKA 3NX8A 2ZM4A 4P5ZA 3LFDA 1IA8A 1DAWA 3LXNA 4QOXA 1PKDA 2G9XA 2GFCA 5CEIA 1GZKA 4Y95A 4BGHA 5CEPA 4ZS4A 1J7UA 4H3QA 3D7TB 2F57A 3TG1A 3D83A 3V6RA 1K3AA 3A8WA 5AV3A 3ROYA 5DRBA 2UW8A 2O64A 2PK9A 2XNEA 4A9SA 3ID6C 4NKSA 4KSQA 3MWUA 3UTOA 5DR9A 3R8PA 3R8ZA 4MH7A 3P79A 5AIKA 5TF9A 5JGBA 2R3RA 3ETAA 4YZMA 4AN9A 2IJMA 2X39A 4ZTLA 4RFZA 3LQ8A 5LVPA 3I4BA 4QMOA 5CNOA 5EDQA 3UO4A 4YURA 2PMOX 2YISA 4IAYA 3VN9A 1JKSA 4BCJA 3W2PA 3HMMA 4W4WA 4B0GA 1XBAA 3A7HA 3FMJA 5AUWA 3W2SA 3QHRA 4ITJA 2JDTA 2AYPA 3G5DA 1OB3A 2Z7QA 4LYNA 3SW4A 1JLUE 3UBDA 3VUHA 4PDPA 3QU0A 4HCUA 2DWBA 5T6KA 1ZMWA 3EKNA 5L2WA 2B9IA 4ZZOA 4QP7A 4I6QA 1Q99A 2VNYA 2IO6A 4I22A 4FC0A 5CAUA 3R9OA 2B9JA 1VYZA 3MB7A 4Y5QA 3OUKA 4F99A 4DA5A 2Q83A 1PY5A 3QRKA 4FTKA 2HAKA 4EYJA 3EQBA 3PDTA 3V51A 1UVRA 1SYKA 4CFXA 1ZXEA 3QTSA 5L4QA 4XNEA 3U9NA 5LVLA 3GCUA 2Y7JA 5HCXA 5FM3A 3GC8A 4PMTA 3ROCA 1YDSE 1DI9A 4FV8A 3NS9A 5EK7A 4L44A 4XJ0A 4Y5HA 5HCZA 4YJSA 2WOTA 2UZLA 5E8SA 5A4CA 4ANOA 5I9WA 3SAYA 3UZRA 3I5ZA 2VWXA 3QGYA 4FSTA 4FSUA 3UMWA 5H2UA 5E7RA 2XK4A 1WBNA 3NAYA 3O96A 4M69A 4DBXA 1Q3WA 3QZFA 5AR7A 5JZNA 4WSYA 3V8TA 3W8QA 5IF1A 1ZYCA 2BKKA 3FMDA 2W9ZB 4OTHA 4RIXB 4B4LA 2BVAA 3V04A 4CLIA 4E5BA 5C26A 3FXXA 3PA5A 4I41A 1KE9A 3DAJA 1PXPA 1Y8GA 2YLFA 1OKYA 3R02A 3OXTA 4J71A 4XCUA 2QODA 5JRQA 3DZQA 4L68A 4C0TA 4Q5HA 3ULIA 3COKA 4L01A 4ARKA 2IZUA 3TDVA 4NM3A 4YNOA 3TZMA 4I5MA 3KCFA 3Q4ZA 4E6CA 5LMKA 5IA1A 2X4ZA 2R3FA 3QC9A 3UG1A 3QTZA 3VUDA 3EQHA 2EU9A 1ZLTA 3BE2A 2YJRA 5AAEA 4YLLA 5L3AA 1RE8A 2KTYA 2HY0A 4EOJA 2P3GX 3OG7A 3DA6A 3FI4A 4B6LA 3C51A 3FZ1A 3HRFA 4QYFA 1I09A 2WZJA 2WIPA 1RW8A 3LCKA 1JNKA 2BIKB 3UPXA 5LJJA 3R30A 3KQ7A 3CC6A 1SVGA 3P5KA 4B99A 2QC6A 3PY0A 4FV7A 4BZOA 4NIFB 3S3IA 4AUAA 4B8MA 3EQCA 3BQCA 4QMXA 5AR3A 5HESA 1UU3A 5FUTA 4CCUA 2W1FA 3HRBA 4O0VA 4BIBA 3P9JA 4GSBA 5DFPA 3H3CA 4QT1A 1H1WA 3COIA 2YWVA 3O17A 5EOLA 1OL1A 4CFUA 1GAGA 4IWDA 4B7TA 2GU8A 4FF8A 3CGFA 4M68A 4YC3A 1MRYA 2VWYA 4ACCA 1NY3A 4ASEA 4O0TA 4D55A 2QU5A 4JXFA 5EFQA 3TT0A 3OXIA 5EW3A 3R7GA 4U3ZA 5I4NA 4DCAA 1SVHA 3NYXA 3E3PA 4PRJA 4R7IA 1WBTA 1VYWA 4IJ9A 2R64A 3GC0A 4AOTA 3OFMA 4BI1A 3D5WA 4EBVA 3U55A 1PMUA 4XMOA 3TXOA 3FE3A 3II5A 3VO3A 4EH8A 4WG5A 4JS8A 4PDSA 1ND4A 4GYIA 3OWKA 4C57A 4WG4A 2HENA 3I60A 1OI9A 4F0FA 3EQPA 3SVVA 3P08A 4WNKA 1ZAOA 1GZNA 2DQ7X 2WTKC 3V5JA 2VO7A 3OY3A 4ORKA 2BUJA 3ODZX 2I7QA 4JL9A 3R2YA 3FZRA 4TY1A 3BE9A 3AC4A 4E6QA 3LKMA 4FEUA 3F3WA 4NKAA 2QNJA 5JT2A 4QTCA 4L43A 2P2IA 3AD6A 2YM7A 5LARA 5BUJA 4F63A 2BALA 4RVKA 1XH9A 5CAPA 5LOHA 5EDRA 4HNIA 5DA3A 5K5XA 4F9BA 3ZEWA 3B8QA 2UW6A 4NW6A 1ZYLA 4LRMA 3AC3A 4ALVA 3LLTA 3DNDA 4ACHA 5HU9A 4QMQA 5DEYA 4DH7A 2C0IA 2YZAA 4DFBA 3FLQA 2VTNA 4E5AX 2PVHA 3QKLA 3QRTA 4BKJA 4YTCA 3GU8A 2R3IA 4M3QA 2CNVA 5AWMA 3UQGA 3IW8A 3COMA 4XHKB 5D11A 2VTQA 4FSRA 3QD3A 3UDBA 4LG4A 3PY3A 2E9NA 3EL8A 1B38A 1U46A 4FOBA 2WTWA 4JQ8A 4FKRA 2A1AB 2W06A 2C3LA 4LOOA 4R77A 1IAJA 4ZP5A 4E3CA 4FKOA 3LOKA 3C4CA 1F5QA 3PXYA 4UZDA 5IQBA 3ZO2A 1Q97A 1OL2A 4FNXA 2CPKE 2BROA 5DT4A 4CMTA 3CTJA 2OZAB 5AUUA 2OGVA 3QTIA 4W8EA 4FE2A 3TZ7A 1P2AA 3FSFA 4F6SA 4D9TA 3E8CA 3K3IA 4FT5A 3FKOA 3RKBA 5B7VA 4TYGA 4C4FA 4AW2A 4UMRA 3E93A 4I92A 4JJRA 2DUVA 2GHGA 4FZAB 4WT6A 3BHUA 3EFLA 4ZS0A 3CQWA 4MXYA 3OF0A 2PMLX 4P2KA 4BDHA 4AFEA 5BYZA 4NTSA 3S95A 2UW7A 4KIKA 3QKKA 4J52A 4UWYA 1H01A 4RBLA 5IUIA 1HCLA 4QYHA 3PE1A 4U9AA 2VWBA 5E4HA 3JVSA 1IR3A 4GK3A 3OCSA 3OP5A 3QQLA 5IZFA 2PPQA 3ANQA 5J95A 4FT7A 4DEIA 4RRVA 4BWKA 2HZIA 4IAFA 4FVRA 1WAKA 4LGDA 2XNGA 4BTJA 2ITPA 4TW9A 4F65A 2JGZA 4AN2A 5B2MA 1GIHA 4FK3A 3QZIA 2H8HA 4A07A 3ANRA 4U42A 2IW6A 4G6LA 3FL4A 2XK3A 4CLJA 1GJOA 1BX6A 3VBQA 1ZOGA 4LV8A 3ZRLA 4DFZE 5CVGA 1PMVA 4HVIA 2XA4A 3E7VA 4XH6A 1YOJA 3A62A 4RGJA 4ZY5A 3UGCA 5D7VA 2JIVA 3PE2A 3O8UA 5KUPA 5BVEA 3LXKA 4GJ2A 3P78A 4FVQA 3ENMA 4CG8A 5FG8A 3LFBA 3RTPA 3WF5A 4F1TA 5JH6A 2QOLA 3VUGA 3C9WA 2ZYBA 4K77A 3MIAA 3EQRA 3SQQA 3TUDA 3FAAA 4YJNA 4EWQA 4FKQA 4YC8A 3SOCA 2J9MA 3NUPA 4RT7A 4BCGA 5A14A 5JQ8A 3A4PA 2OLCA 2PVLA 5CEQA 4MNEA 2GQGA 4M66A 2G2IA 1CDKA 4PNIA 5CF8A 4RC2A 3MY0A 5HIDA 1J3HA 4FTMA 4E73A 1EH4A 4LOPA 2WD1A 2YIQA 2YN8A 4FSQA 3RAIA 3QA8A 4N6ZA 5M06A 2V55A 4FKWA 2GTNA 4YHJA 4W4XA 5ACKA 3AMAA 3KN6A 4JBVA 3FXZA 3U4WA 3NW5A 4R5SA 3EN5A 4Y83A 2OWBA 2ZMDA 3BYOA 2B53A 2HY81 5DT0A 2BAJA 3RK7A 3P7CA 5BNJA 3LW0A 4IBMA 5CTPA 1BI8A 5HD7A 4U80A 5AAFA 4AWIA 3UOLA 4BYIA 4M69B 3WZEA 4BTKA 4GT5A 5EHOA 3PRIA 4ZMFA 5EG3A 4K11A 5M4IA 3WF6A 4IWQA 4YBKA 1OL6A 2JBOA 1XH6A 1YDTE 4L3PA 1U54B 4X6RA 5C03A 5BX0A 3MI9A 4NU1A 5ANEA 2A19B 2R3PA 3W32A 3Q2JA 2IN6A 5DOSA 2JKOA 4EK5A 2W17A 3FBVA 4C61A 4EHVA 4FSYA 4J97A 3LJ1A 4JQ7A 1YXSA 2B9FA 2C1BA 4PQNA 1OKVA 3LXLA 4TYJA 4DHFA 3Q5IA 4X6QC 5I9YA 4UMUA 3ORNA 1QPJA 2ITOA 1JPAA 1FGIA 1XH4A 3MN3A 3VRYA 1XR1A 5CEOA 5DMZA 2XBAA 3QA0A 4IAIA 2FH9A 3ZH8A 3DXNA 3AGMA 3BLHA 5ICPA 3F2NA 4GFMA 1XBBA 3DZOA 3E92A 4EONA 4UMPA 3LLAA 3TI1A 5K4JA 2JLDA 4U40A 3PP1A 4ONAA 5L8JA 5DVRA 2W4KA 4YJQA 3ORMA 3PY1A 4NM7A 5CVFA 5J9ZA 4GIHA 3R28A 4DEGA 4EOOA 2OH4A 3C13A 3MS9A 5F9EA 4EQCA 4ZZNA 3CQUA
chains in the Genus database with same CATH superfamily
4QP8A 4RJ5A 4O91A 3E3BX 3OWLA 3ZONA 4L52A 3VUIA 5K4IA 4FTAA 4FYOA 4Z7GA 1YI4A 2C5YA 3KMMA 3IDCA 2GDOA 3C5UA 2YCQA 4ANMA 4C4HA 1PXKA 3BLAA 3M1SA 4CRSA 5D12A 4DEDA 3ZFXA 2DYLA 5DI1A 1PMNA 3IW5A 4X3FA 4PDOA 4JG8A 1H26A 2OSCA 3FI3A 2C30A 2ZOQA 5ETFA 3Q6WA 4IHPA 1LEZA 4BZNA 4Q9ZA 4OBPA 1W2FA 5HKMA 4AT5A 4JMQA 3C0HA 3KGAA 5IG1A 1A48A 4FTIA 4PWNA 5AR4A 4JBPA 2X81A 2PUUA 4FKLA 3QTQA 2JFLA 5IUGA 4BCQA 2W1CA 2J90A 2X8DA 3MIYA 4LMUA 3VBTA 4W4VA 4U3YA 3RNIA 2IZSA 2JDSA 2B0QA 2WEIA 2WMSA 1R0PA 4IC7A 3KVWA 2LGCA 3G6HA 4D9UA 4BFMA 2IVSA 3GENA 4IW0A 2UW4A 4JDIA 3TEIA 2J50A 2VTIA 4FI1A 4UV0A 5DH3A 1Y91A 4FODA 3N9XA 3NYOA 4FV5A 4L8MA 3BL9A 3ZU7A 1TZDA 1URWA 4D1ZA 1F0QA 1V0PA 2VAGA 2VZ6A 2QG7A 4KD1A 3DGKA 4LV5A 2WMBA 3I6UA 4TWNA 5DNRA 4FSWA 4BTFA 3OW4A 3R1NA 2ITVA 4XP2A 5AR5A 3D0EA 2V7OA 3OTVA 4O4EA 5CEMA 3RAWA 3WZJA 4IMYA 3DBEA 4X2JA 3MJ2A 1H24A 4LMNA 3NNUA 3VHKA 3RK5A 1OITA 4DFLA 1AGWA 3JR1A 2R3NA 1OL5A 2E9UA 2PVKA 3WYYA 3BHYA 3MVMA 4QMTA 4TKSA 5ANDA 1YHVA 3AGLA 1Z5MA 4FBXA 4D5HA 4DG3E 3LE6A 3QTWA 4O0XA 4HGEA 3PSCA 5EKOA 5CF6A 3UOJA 1UA2A 2J0IA 4HGSA 5CYIA 5E91A 3NYVA 3KK8A 3TN8A 3UC4A 2BCJA 1BI7A 5CWZA 5AX9A 5FDPA 5HCYA 3RAHA 3V8SA 4KBAA 4ALWA 2YAKA 4FTRA 4FOCA 3W0NA 1H07A 4U44A 5IEXA 4R1VA 3EQFA 3HYHA 5EM8A 4A4XA 3PXKA 3O0GA 4D2TA 5JGDA 3UOKA 4FNZA 4U0IA 3EN4A 5D41A 1DM2A 3PPKA 3EN6A 2ITXA 2ZMCA 4G34A 4WNPA 2YDIA 3NW7A 2XRUA 4OTDA 5IQGA 4FUYA 2X0PA 3QXOA 1JSUA 3QRUA 3ZLWA 4G16A 3GU4A 3LFQA 3D5UA 4I23A 4AP7A 3TKHA 3ZSGA 5L6OA 2OIBA 3AOXA 3TUCA 2YDKA 2JKKA 5E8XA 5TKDA 4CSVA 4L53A 3ZCLA 4RFYA 5I9ZA 1M14A 2H96A 1K2PA 5AP5A 4XLIA 2IW9A 2W05A 2W1GA 4XUFA 3NVKI 4EHGA 3VBWA 4JOAA 4F0IA 1ZMVA 2O0UA 3OEZA 4AX8A 4GVJA 4O7YA 1YWNA 4R5YA 4E8AA 4O82A 3Q32A 1GIJA 3ORTA 3G9LX 3WF9A 1KE5A 2OFUA 4YGAA 4ZSAA 1FMOE 3CCNA 2XNNA 5DIAA 4CZTA 2ITUA 4PTEA 3P1AA 2W1ZA 3W33A 3F5UA 3IONA 2Y6OA 2YA9A 4RJ4A 4BCFA 3CTQA 3IQ7A 3OY1A 5E8YA 5HOAA 4I4FA 4IB0A 4TXCA 3WE8A 3KIOC 4M67A 4ACDA 5EI8A 4YZCA 1LUFA 5KMIA 3DLZA 4MXOA 3BV2A 2QOOA 1OBDA 3UVQA 4CV9A 2JITA 4MBIA 4C62A 5D7AA 3PVBA 3A61A 4HYHA 1PXIA 3ODYX 2X9FA 3HP5A 4EOPA 2EUFB 4EEVA 4CG9A 4TWOA 3EJ1A 3FHRA 3FSKA 3FY0A 2W1HA 3OBGA 5FTQA 3ZUUA 4HOKA 2C6LA 4I6BA 3ZTXA 4NM5A 5EHYA 4JR7A 2XNMA 3MH2A 4N0SA 4RJ8A 4NL0A 4J8NA 4MK0A 1GOLA 2IPXA 2XJ1A 3U6HA 3FXWA 3Q4UA 3IPHA 4TYEA 3ALNA 4FSNA 3GGFA 1YQJA 2CMWA 2ZV7A 3KXHA 4TT7A 3UMXA 3W16A 1XMMA 4PF4A 5C1QB 4MD9E 5CS6A 5EDPA 2OI4X 1W98A 4NK9A 5AADA 4APCA 4PMMA 5B0XA 3DFAA 3AD5A 3MFRA 5FRIA 4USFA 2QHMA 5F4NA 3R8MA 3G33A 5CT7A 4BDFA 5KO1A 4DH1A 1OVEA 5JRSA 4U79A 5CNNA 2R3QA 2QI8A 1CM8A 3QBNA 4IVDA 4BTMA 2YM4A 3U8WA 3RCJA 5IISA 3AMYA 4GG7A 4K9YA 3PXFA 5KMLA 2JDVA 3R00A 4AZWA 3W0MA 3L8VA 3TDWA 2WKMA 3PIYA 5IU2A 3VBVA 5GZ8A 4OAVB 3DB6A 5DR2A 3R7EA 3EMGA 4UYAA 3UZTA 4GKIA 5FWKK 3UQFA 5IQHA 4YTFA 1QMZA 3V5PA 4D2RA 1J7LA 4H36A 3DDQA 1WMKA 5IA2A 4FKUA 2CCIA 1U4DA 2UVZA 3R83A 1YXVA 4S33A 3L9LA 4GVAA 4FTJA 2QLQA 2IVUA 4O22A 1XH8A 3BBTB 4AXAA 4D2WA 4KKEA 4HPUE 1PXJA 4PL4A 1LR4A 2XAMA 5E8ZA 2BIYA 4MXAA 4R3PA 2Y8OA 3BBWA 2UZWE 3MVLA 4FZ7A 3FZPA 4UYNA 5CXHA 1OBGA 3I0OA 4BBEA 1H08A 2XBJA 3CTHA 1IG1A 2R3MA 3BPRA 5EOBA 1I44A 1OPJA 2W4OA 4H1MA 5AP6A 4O84A 3AT2A 3BGZA 2C5XA 3OXZA 3PSBA 3C4ZA 4O7ZA 2AC5A 3W2QA 4OT5A 4E5WA 3Q60A 2I0HA 4ZLYA 2YM3A 4O86A 3DFCB 3FV8A 4I21A 2OXYA 5IQAA 3SX9A 4CQGA 3ML1A 4K8AA 4X2NA 2ONLA 3VULA 2RG5A 3LJ2A 4FIIA 2UZDA 3KMWA 3R7OA 4F9YA 4EK4A 5HTCA 4MXZA 3A60A 1VR2A 4F7LA 3VS0A 3H0YA 3EB0A 5GZ9A 2C6EA 4UMTA 4MUQA 3LFFA 1G8JA 3HV7A 4YTIA 2SRCA 4L3LA 5HLPA 2F7XE 3H9OA 3QALE 4YNEA 3ZZEA 3Q04A 1L3RE 4CCBA 3FI8A 4FL2A 5EI6A 2YLEA 3MB6A 2W0JA 3HA8A 2HYYA 5CU3A 5J8IA 5HTIA 2XYNA 4WUAA 4ASXA 2WTKB 2WTCA 3R9DA 5FQDC 4FKJA 4PMPA 4IE9A 3Q53A 5GJFA 2VGOA 4AT3A 5CF5A 4EK8A 3QQHA 1U54A 1PYEA 4H3BA 3DJ7A 4LRJA 3W0SA 1JOWB 2XM8A 4JVGA 2HXLA 3UOHA 5BVDA 3NEWA 5G1XA 4KBKA 1Q3DA 4KRCA 5B2LA 3U6IA 3G6GA 3OT8A 1QPDA 3HUBA 3HV3A 2XMYA 4FX3A 5E8VA 4CD0A 1ZY5A 4FV0A 3HECA 4IADA 4NFNA 2PUNA 4F7JA 4OTRA 3PXRA 4LRKA 3QUEA 4JIAA 5ETAA 3VJOA 4CMOA 1R39A 1FVRA 3FZOA 4E1ZA 4UN0C 1NW1A 3P23A 4OW8A 1T45A 4RJ6A 2Q0NA 3R2BA 2Z2WA 3QKMA 4J1RA 4GH2A 3R8UA 4HYUA 2VWIA 4RIWA 4D4SA 1SNXA 4UWBA 4X7QA 3JYAA 4ANQA 3ACJA 4ZTRA 2G01A 1TKIA 3DBFA 4GU6A 4O2ZA 2YACA 3GVUA 3I1AA 3PVWA 4LFIA 4F9AA 3G9NA 1KE7A 3D2IA 2GHLA 3GCVA 3GQIA 1OZ1A 4EJ7A 4LI5A 1MQ4A 1NVSA 3FYKX 1E1XA 4IX5A 3VS5A 3C0GA 3FQHA 4ITHA 3KFAA 3PZEA 5KHXA 2GCDA 4L46A 2HW6A 2RFNA 4WNMA 3CSVA 3OW3A 4BCOA 3QZGA 1J1CA 4F9WA 3HGKA 2UVYA 2EB3A 4BDJA 3JVRA 2J2IB 3H0ZA 3BEGA 2WMTA 3GUBA 3BV3A 2W96B 2VD5A 4UXQA 4XRJA 5K9IA 4MBLA 3GU6A 1ST4A 3W2RA 1PMEA 3PLAE 4JAIA 2R7IA 4E7WA 4FK6A 2QKWB 3BWFA 5LVNA 2X6EA 3KB7A 2HIWA 1BL7A 2BRMA 4O21A 4D2PA 2HCKA 4DYMA 4ZK5A 3F7WA 5L2TA 3I0QA 4IJPA 2BPMA 4DF3A 1H1QA 1TQIA 3PYYA 3QFVA 4BBFA 4ZJIA 4N57A 2OF2A 4C36A 4FTNA 3BYMA 1Y6AA 4C7TA 3GCPA 4XBRA 4PNKA 4EL9A 2VO6A 4QNAA 5CI7A 4BCIA 4M14A 5HBJA 2Y4IB 1F3MC 3O71A 2PZPA 3ZLSA 2YIWA 2BILB 5AA9A 4XG2A 4ASZA 3K3JA 3HV4A 4R7BA 2PUIA 4DH5A 2QONA 4QP9A 2ZDUA 4XYFA 2FSTX 5CY3A 5FGKA 5KZIA 3ZHPC 3NWWA 2QO7A 3ZYAA 2YCSA 4MF0A 4RQVA 3UYSA 4KB8A 2R3LA 3GU7A 4DC2A 2PVJA 3SD0A 1URCA 4GK4A 2UZVA 3TKUA 3LZBA 4BCMA 1VZOA 2C6TA 3EFJA 5CEKA 2WU7A 3PG3A 5AA8A 2BZKB 5EQEA 3WILA 3E7OA 5LVMA 1RQQA 2P33A 5A4LA 5KHWA 3S1HA 4DT9A 3DTWA 4U43A 5FEDA 3BL7A 4NWMA 4A4OA 5CXZA 2NO3A 1Q8YA 2V5QA 3SOAA 4GK2A 5KMMA 4GFOA 3EKKA 3HUCA 4S2ZA 1E9HA 2Z60A 4JRNA 5EW9A 4FKIA 5M4UA 4HVGA 1Q61A 5C4LA 4OTWA 3ACKA 4WG3A 2PVMA 3U9CA 4XRLA 3C7QA 2EXEA 4U7ZA 3TV6A 2FGIA 1KWPA 3NUYA 5HZNA 3NCGA 3BU6A 3AC5A 5AR8A 3E88A 3KK9A 2XRWA 4BGGA 3ZBXA 5K5NA 2VTTA 4DE4A 2QO9A 4L00A 3VW8A 3FPQA 3PP0A 3RZBA 4EH7A 1XQZA 3C4EA 4XG3A 1OL7A 2R7BA 4HCVA 4BDIA 1OGYA 3UP2A 4ANLA 5HE3A 2C0OA 5LCKA 3NR9A 4CZYB 3QWJA 3FI2A 3V6SA 4F0GA 3ZO4A 2I0YA 5AV4A 3HRCA 4GCJA 4QP1A 3OOMA 4PPBA 2A27A 2EVAA 4YP8A 1ZARA 2HZNA 5HE0A 3TZ8A 3W0RA 5T3QA 3G15A 1PXNA 1SMHA 5E8UA 4BGQA 4QEBA 4TPTA 3HMPA 2FUMA 2O3PA 3UJGA 3O8PA 2XH5A 5B2KA 1YW2A 2HOGA 2JAVA 4CFVA 1FQ1B 2XF0A 4FZFB 2X2KA 4XOYA 4DGNA 1V0OA 3PJ8A 3VS6A 4DINA 4BDKA 1YOMA 5EH0A 5IH4A 3L9NA 4NZWB 4TNDA 2OJJA 3LMGA 4NIFA 1IAHA 4AXEA 5EI2A 4EOMA 3RAKA 4O4FA 5EQYA 2C4GA 3WZDA 2RG6A 2CHLA 3CD3A 2CKPA 2QOQA 4D2SA 2PMIA 4C35A 3AKLA 4IWPA 1PW2A 3KRWA 2WU6A 4P4CA 5JFWA 2NYAA 3NMUF 3ELJA 2VNWA 3EYGA 4Q9SA 4PPCA 5KCVA 3MBLA 4O7NA 3PRFA 4JI9A 5FDXA 4IANA 5CENA 2F2CB 2VU3A 5BVKA 2HELA 3EQDA 4TWPA 3SRVA 3VUTA 5CSWA 4F78A 3DKGA 4O2PA 2A98A 1M2QA 2OFVA 2W9FB 4G9CA 5A6OA 1B39A 3OT3A 2XCKA 4EKKA 4J99A 4PPAA 2F4JA 2WTDA 3N4TA 4WUNA 2HZ4A 2W1EA 4C33A 4D58A 4RPVA 4JX7A 2BKZA 3FKNA 3F5PA 4ZJVA 2OK1A 4PL5A 4FA2A 2B1PA 2QOCA 3OTUA 4C34A 2G2HA 4QQJA 3QTUA 4X3JA 2WTIA 3SW7A 2WB8A 5JSMA 2E2BA 4GW8A 4JNWA 2QO2A 5L8KA 2PY3A 3ORZA 3IO7A 4J7BA 1T46A 4X3FC 2OU7A 3FC1X 5CAVA 1DS5A 4TN6A 3CKWA 4RX9A 2BTRA 2RFSA 4R6VA 4E4NA 5CT0A 5I9XA 3QCYA 4FIFA 4X0MA 3NRMA 2C0TA 5M56A 3KXMA 2XS0A 4HNFA 1PXMA 3FLWA 2WTJA 1TQMA 4A06A 5DR6A 5M55A 5KX8A 3H10A 4QMSA 5EW8A 2BDFA 5D1JA 3KU2A 3SXFA 4G3DA 5KMJA 3O7LB 2R9SA 2OJIA 2C5VA 2VO3A 3DQWA 3PIXA 4H58A 4YJOA 5L6PA 5LWMA 5KNJA 5CU2A 4V0GB 2W4JA 5A46A 4RLKA 3DXPA 5KE0A 4EJNA 4DHZA 3AT3A 3KREA 4FICA 4O7LA 2HW7A 3DQXA 1NVRA 5AR2A 2OKRA 3QTRA 1PRYA 5AM7A 5E90A 3PA4A 4K0YA 4P7EA 2WQOA 3PXQA 4XG7A 4Z16A 2WOUA 4S34A 2WMRA 4FV4A 2PZ5A 4O38A 2RSVA 3W2CA 4A9RA 4JX3A 4AGWA 3K2LA 2F9GA 2W1DA 4RG0A 4MXXA 4RQKA 5ACBC 4QMNA 2O5KA 1NVQA 3GFEA 3UIXA 4D28A 3UQCA 4HGTA 4TRLA 5KMNA 2Y4PA 3NNWA 3IKAA 4J98A 4LQMA 3KRJA 2VWZA 2O63A 4I5CA 2GTMA 4MWIA 1XWSA 3SDJA 3PFYA 2FSOX 4XP0A 2RF9A 1G8AA 3ZZWA 2ITWA 1QPEA 4ENYA 2CCHA 4I5PA 2V7AA 2OJGA 3WF8A 1FMKA 5A4TA 2QQ7A 5J87A 3TV4A 2G1TA 5KMOA 2GQSA 3BWJA 5IH5A 5CZHA 3DBDA 2QOBA 1P4FA 2PE2A 4QPAA 4DN5A 2XNPA 4ZLZA 5CSXA 2RFDA 5BMSA 3B2TA 4BC6A 2PZIA 2R3JA 4I24A 3MPAA 3UIBA 4OTFA 1ZYJA 3COHA 4RSSA 1ZZ2A 3TACA 4H39A 4BCKA 1W8CA 4E26A 4O4DA 1ZYSA 5FTOA 3MVJA 3E5AA 1Q62A 2HWPA 4DFXE 4FIJA 3HEGA 4PDYA 2J5EA 3O8TA 5AV1A 4CRLA 3W8LA 5AAGA 2UW9A 4V0GA 2XK8A 3M11A 1P14A 2B55A 4NH1A 4U6RA 1NT2A 4RC3A 5AV0A 4EC8A 4EKLA 3RP9A 1KSWA 3MVHA 1HOWA 3WIKA 3UPZA 2C5NA 1Q4LA 4QMLA 2HZ0A 4IZYA 3QHWA 2UZOA 4RC4A 3TNPC 1H25A 4EH4A 4ERWA 3CE3A 2WELA 4G3EA 5HO7A 4EZ5A 4DAWA 3N51A 2Z8CA 4G9RA 3BLRA 5FBNC 3SHEA 4F6WA 4KRDA 5AP1A 1YVJA 3R73A 2XP2A 3CLYA 4AF3A 3ORPA 2XKCA 4C59A 3PFQA 5G6VA 2ITQA 4BBMA 4L3JA 2BTSA 4UEUA 1YXUA 4X2GA 4UX9A 2X7GA 4RWJA 3O5AA 3VS2A 5H8GA 2PZRA 3FUPA 2PZYA 2J4ZA 3MGYA 5HD4A 4FG8A 3CGOA 3JPVA 5BVFA 1M7QA 4O1PA 1UKIA 4DGMA 4FTLA 2EB2A 4RWIA 1VJYA 1Z9XA 1Q8ZA 4A4LA 4CKRA 5HX8A 3DKOA 4QTDA 3F3TA 3FDNA 3DAKA 2GFSA 5L2QA 2JIIA 3DOGA 4GS6A 2CN5A 4O27B 5DLSA 2ZJWA 4PX6A 4FV9A 4NJ3A 2WMUA 2WQBA 2E9VA 4FKTA 1PHKA 1YHSA 1Q8TA 2C69A 2VTHA 5AP0A 4E6AA 2O65A 4ZTHA 3MFUA 4E20A 4BDAA 3LCDA 4QYYA 4JDKA 1YDRE 3V8WA 2CJMA 3EIDA 3HMIA 1WVXA 5FM2A 4BICA 3VW6A 3JXWA 3KULA 3LFSA 4FRFA 2WMWA 4D4VA 1R0EA 4EI4A 1OIQA 3QCXA 4BI0A 2YABA 3OCBA 3ORLA 2X1NA 3VUKA 4QNYA 3LFNA 3VBYA 2GNGA 1H4LA 3R21A 1OIRA 3T8OA 2JEDA 3IECA 3RINA 4AZVA 4J96A 1AD5A 2CNQA 3PLSA 2ZM1A 5A4EA 5GZAA 4FV3A 3GFWA 1CSNA 3Q52A 4ID7A 4OTGA 2X7OA 3L8XA 3RJCA 4D5KA 5BYLA 2X6DA 4CTCA 3ORIA 3ULZA 2R3KA 3WE4A 2BDJA 4O96A 5CSVA 2W5AA 2XNOA 4QP3A 4FTQA 3HV6A 3VC4A 3WF7A 3F66A 5M51A 2A4LA 3PPJA 4L42A 4UB7A 5CX9A 5BYYA 1UU9A 5J9YA 3OUNB 2GNFA 2CKQA 2WQNA 2BFXA 3PJ3A 1WBPA 3W10A 4ASDA 3GQLA 4TNBA 4A9TA 3JY9A 1RJBA 1BUHA 4I0RA 1PYXA 1GNGA 3MH1A 5HVJA 3TCPA 3RPYA 2GNHA 3C4WA 1UU7A 4DG0E 2FVDA 1BKXA 4RX5A 1G8SA 2R4BA 4O7TA 4FKVA 4XV2A 5HG5A 4Z55A 4EQMA 4IFGA 3OMVA 5CI6A 5GJGA 5HNIX 4L6QA 3R63A 4EZ7A 1REKA 5CQUA 3CJGA 2IW8A 5M08A 4W9WA 2C3IB 3AD4A 2CGVA 4FTUA 5GHVA 3R8LA 2E9OA 4LDTA 3Q4CA 2X9EA 4II5A 1ERKA 5HBEA 2XKFA 2O8YA 4ZSJA 3LPBA 4BKZA 4IAKA 4B8LA 4QMWA 5KKRC 4RJ7A 4MHAA 4CVAA 4E4XA 4IDTA 3OOGA 4QMMA 1YXTA 5AP7A 4TL0A 1WVYA 2BRBA 2PHKA 5HORA 3QL8A 5CU0A 3VNTA 1KUTA 4QMZA 5J79A 2XEZA 1Z57A 2OJ9A 4ZSEA 4RVTA 3W55A 3NUNA 2OIDA 4M84A 4YPDA 3AC1A 3NAXA 4XEYA 2H9VA 3EFWA 3FLSA 2EXMA 2PUPA 5A9UA 3IG7A 3TKIA 4H1JA 2KULA 4AFJA 2REIA 3QF9A 4G5JA 5BUIA 2C68A 2XIYA 2Z7SA 2J7TA 5CAQA 4FG9A 4NW5A 4MXCA 4AOJA 4YPSA 3GU5A 4BDBA 4QO9A 4L9IA 4TYIA 5TOZA 4Y72A 2BDWA 3BHTA 4FSMA 4P5QA 4S32A 2XK6A 3UDZA 3NDMA 2GNLA 5TT7A 4WHZA 4QDEA 2OZAA 2I40A 2VTMA 3PTGA 3VF9A 4ACGA 1JSTA 1Q8UA 1RDQE 3C1XA 3ERKA 3F3UA 4M7IA 4EUTA 3ZSHA 3HZTA 4IX4A 5IMXA 1VLRA 5ANKA 2PVRA 3MH0A 3D94A 3FMLA 2WQEA 3CEKA 3RGFA 4F1OA 2B54A 3QLGA 3BYVA 1M17A 2ITZA 4EOIA 1XH7A 3BX5A 5C8MA 3FLZA 3AC2A 4QPSA 4AZFA 4AZSA 4ZTMA 4G6NA 3F2RA 1MP8A 4RIYA 1H28A 3KRRA 3E8EA 3QX2A 2C3JA 4GIIA 5E8WA 5ETIA 4ITIA 1UNHA 5H8BA 5FEQA 2BAKA 3P0MA 3C4FA 3DCVA 3RHKA 3E63A 2UZUE 4I94A 2YM8A 4WBBB 5HNGA 3KY2A 4RX8A 3GXLA 4B9DA 3QUDA 4DGGA 3ZRMA 5BVNA 1J7IA 4IH8A 5CU6A 1STCE 1GZOA 3CY2A 4P90A 5DN3A 1OMWA 4ZOGA 4EOLA 2CKOA 5DG5A 4EK3A 3GB2A 4NCTA 5JQ5A 3T3UA 4QD6A 4BF2A 4NYEA 5AFVA 3M42A 1PF8A 3HP2A 5FD2A 3ZDIA 2P2HA 3QYWA 3WIGA 5A4QA 4QPMA 4PTCA 5AUVA 5IQFA 4BCNA 4RZVA 1TQPA 4Z3VA 3F3VA 4AQKA 3ZRKA 2FSLX 2UW0A 4UXLA 3O7LD 3UO6A 4F64A 5IQCA 4AAAA 3DKFA 4EQUA 2RIOA 2VGPA 4ZMEA 2ETRA 3ORKA 4IAZA 1W83A 1CTPE 4A9YA 5IMEA 4AXDA 3R01A 2OJFE 4O4BB 3DTCA 3A7GA 4BL1A 5IQIA 4FTCA 4JLCA 3BIZA 3OWPA 4PTGA 2FB8A 5HNBA 4XLVA 3RBWA 4EZ3A 3TNQB 1O6KA 2QOFA 2R5TA 2B4SB 1WFCA 3RM7A 4HYSA 4PV0A 5CZIA 3VQHA 1Y57A 4DTAA 5E1EA 4KINA 3Q9YA 4RIYB 5J5SA 2XKDA 1UWJA 4A9UA 3MDYA 4DG2E 5IDPA 3BU3A 4EORA 2G15A 3ZLYA 2XIKA 4IFCA 4C4GA 3L8PA 4BI2A 4OTPA 4XG6A 5AIRA 5L2IA 4DEBA 2J0LA 2CSNA 3I7CA 4QP2A 4HW7A 4YSMA 4YHTA 5L8LA 3DKCA 3FHIA 4JAJA 4X2KA 4TYHA 1DAYA 1YI6A 1S9IA 2PTKA 4NSTA 4ACMA 4BDCA 4FEXA 4CZUA 1JBPE 4JIKA 3L9PA 3G2FA 2QHNA 4DLIA 3IDBA 5HLWA 3HDNA 3MY5A 3HV5A 5CVHA 2XNBA 1FINA 2PMNX 4C2WA 4O83A 4YHFA 3OCTA 3UNJA 5A6NA 2YITA 3VUMA 3HVCA 2UUEA 1ZRZA 3BYUA 3DAEA 3O23A 3TWJA 3VS3A 4AGUA 5JMSA 5KBRA 4O81A 2LAVA 3VQUA 5C9CA 5EYKA 4EH9A 4CYJA 1BLXA 2WMVA 4G31A 3LAUA 4AZEA 3AMBA 4IZAA 3E62A 3HAVA 3QWKA 2ITNA 2XZSA 1MQBA 5AP2A 3DXQA 3Q6UA 5C8NA 3QQKA 4FZDB 4D1SA 4Z7HA 2ETKA 3V5TA 4FGBA 4KUJA 4BR3A 4R7HA 1PKGA 3D4QA 4F09A 1W82A 1ATPE 1HCKA 3LXPA 5ANGA 4AG8A 5EKNA 3Q9XA 4NT4A 3KULB 4L45A 4WD5A 3VS1A 3QZHA 2RFEA 1WBSA 3QQGA 4FSZA 1WVWA 1VEBA 4GUEA 4LGHA 4X21A 5DPVA 4I5HA 2R0UA 2PU8A 4JBQA 2WXVA 3IGGA 2IZRA 2HWOA 4JDJA 4I6HA 1OPLA 2UZBA 4BKYA 4MNFA 2QR7A 3DNEA 3KCKA 2JBPA 4YJPA 5ETCA 4ENXA 3KA0A 3DK3A 4K6ZA 5HG7A 4CEGA 4USEA 2VV9A 5DBXA 5HQ0A 2QD9A 3ZM9A 3K5UA 4ZIMA 2YIXA 3CJFA 5FXQA 2C6DA 3IW4A 4GU9A 5IUHA 4I6FA 3FYJX 3PG1A 2YEXA 3Q5ZA 2BFYA 2WHBA 5A3XA 4ALUA 3R7VA 5JK3A 3IK3A 3W0QA 2JD5A 2WIHA 3LQ3A 5KZ0A 4XV9A 4XV3A 3H30A 4PL3A 3TYKA 5JGAA 1JKTA 1SVEA 3HX4A 4YZNA 3MY1A 3KF4A 3SXRA 4GKHA 3KEXA 3MV5A 3RI1A 2GSFA 2JDRA 2UZTA 4W8DA 4YJVA 4O4CA 5C4KA 2NRUA 1H0WA 3U54A 4IACA 2ONLC 3HNGA 3D15A 4LUEA 4L67A 5L2SA 3FY2A 3EZVA 3NNXA 3AKJA 1OKZA 4O7SA 4DTKA 4EOKA 1XH5A 4IM3A 4KKGA 3NIEA 5JFVA 3S2PA 4CGAA 4M97A 3DJ5A 3UVPA 4M0ZA 1WBWA 5IEYA 2W5BA 3HL7A 4K2RA 4BVUA 2V22A 4YLKA 3EL7A 4UBAA 4YMJA 4G5PA 3JY0A 4GV1A 3QYZA 3O2MA 4NFMA 5D10A 3FMHA 4N6YA 4AGCA 2GS2A 2PSQA 3TJDA 1SZMA 4KBCA 1OKWA 4ZEGA 4R3CA 1OECA 3HA6A 3TJCA 4CTBA 5J1WA 3C5IA 3W2OA 3SGCA 3GP0A 1LP4A 5JFSA 4DHIB 3C0IA 4GL9A 3GCSA 2W99B 4FMQA 3W0PA 4NM0A 5H3QA 2ESMA 3R8VA 3LFAA 2RL5A 4M12A 4G3GA 5BMMA 1ZYDA 2YJSA 2IF8A 3AXWA 2VX3A 3PA3A 3FLNC 3KVXA 1H1PA 2XB7A 4PMSA 5HLNA 3SRVB 3L9MA 5IPJA 3BGPA 4IX6A 3IS5A 5CASA 2GQRA 4A7CA 4UY9A 3RWPA 3MYGA 3ZXZA 3F2AA 5I3RA 1WCCA 3FWQA 4FIHA 3NLBA 3W18A 4DGLC 2JAMA 3R22A 4MEDA 3OHTA 3EOCA 2AC3A 3QCQA 3POZA 5AX3A 2ZVAA 2Y6MA 3FZTA 1Q24A 2UVXA 4RIOA 3QX4A 3SC1A 1O6LA 5M07A 4OR5A