4QTAA

Structure of human erk2 in complex with sch772984 revealing a novel inhibitor-induced binding pocket
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
349
structure length
335
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title A unique inhibitor binding site in ERK1/2 is associated with slow binding kinetics.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 335
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qtaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qtaA01
5L2SA 4L52A 4LI5A 4X3FC 2XKCA 4BCPA 4BFMA 4RIWB 4M12A 4CQEA 2R3IA 2XJ1A 3AMAA 4FUXA 3UZTA 2BDFA 2IJMA 4NM5A 4BVUA 5LVOA 5LARA 3UIMA 3Q9WA 4LOOA 3ZFMA 3UYTA 3QYWA 4LL0A 2WMBA 2VX0A 4DLIA 5A6OA 1E1XA 3KXNA 3NNXA 4TWNA 4CSVA 2OFUA 1M7QA 4OTWA 2R4BA 4X2FA 1A06A 4BDJA 3S4QA 4YBJA 4EYJA 3BQCA 3NUXA 4C7TA 3HZTA 1U54B 4F9WA 4C34A 4IVDA 5IU2A 5C1QB 3QKLA 4MNEA 4HGLA 4ZJJA 3ERKA 2PYWA 4BIEA 4C59A 1ZYLA 2BIKB 3FMDA 3PZHA 1T45A 3R28A 3MGYA 4L42A 3QWJA 5CANA 3GBZA 4QYGA 4FV0A 3U4WA 3PFQA 2QI8A 1W0XC 3UMWA 3R9HA 4Z9LA 2YIQA 4UWBA 4QMLA 3ZSHA 4A9YA 4TTHB 3EH9A 2JFMA 2WQNA 3I5NA 3IW6A 3FWQA 3GGFA 3NVMB 2UZEA 2W17A 4AAAA 3L8PA 3VUMA 1MQ4A 3VS6A 2R3QA 5D7AA 3G0EA 5E8YA 4NJDA 4F9AA 2VN9A 2Y7JA 3ATSA 2XEYA 4GIIA 4KD1A 2B9FA 4G2FA 3NYXA 4BCIA 3OW4A 3P23A 1UNLA 4TPTA 1ZZ2A 2E9PA 3E8NA 3BHVA 3ACKA 2DYLA 4DGNA 1OB3A 3NSZA 3TKHA 4C3FA 4JBVA 3BV2A 2ITNA 2C69A 4ZK5A 3HMOA 3DBEA 4CMOA 4YTHA 4RIXB 1FBNA 2CKEA 5LJJA 4WRSA 4PY1A 5BUIA 4BN1A 4DT8A 1BI7A 5AR8A 3MW1A 4FSUA 4QQTA 4FSRA 3VC4A 3ZCLA 5I3RA 2YCQA 2W9ZB 2VWYA 3ORZA 1JPAA 4NM7A 4RPVA 2CNUA 2ZV9A 4FTIA 4BWPA 1OPLA 1SMHA 3SG8A 5KZIA 2J7TA 2DWBA 4EH9A 5AUVA 4BWXA 3SRVA 2IVUA 4F9BA 3ZO2A 2BTSA 4UWCA 3BYOA 4LGHA 3VUGA 3U55A 2BKKA 5DH3A 4OTDA 4PL4A 2WTIA 2C6MA 4AG8A 2HELA 5CF6A 3QTZA 5J1WA 2Z8CA 2HCKA 3RM7A 4FKVA 3QRJA 4TN6A 5TF9A 3PWDA 4O0VA 4UB7A 2C30A 5C27A 4RX7A 4EBVA 3F61A 2XIKA 4JDJA 4IX3A 3NYVA 1U4DA 4QMUA 2OXXA 3IK3A 1W7HA 4YJQA 5G1XA 3VBXA 3OWLA 3UOKA 2YDKA 2XUUA 3KY2A 4RWKA 4EUTA 3ZS5A 2OLCA 3ELJA 2UZWE 3NCGA 4FTAA 5HO6A 3WZJA 3BI6A 5HZNA 3VS5A 1O6YA 5HI2A 4F99A 2ZYBA 4ERKA 3PRIA 3R8UA 3CLYA 4L6QA 4B9DA 3OZ6A 4G6LA 3R9RA 4HNFA 2Y4IB 5HIBA 5CEMA 4EH4A 4DF3A 2BTRA 3VVHA 3PPKA 4IVAA 1Z57A 4XUFA 4EZ3A 1M2RA 1YWRA 4YO6A 4NU1A 5FGKA 4AN9A 2BFXA 1MRYA 3OWJA 4WIHA 1H0WA 4XV3A 5HNGA 4R3CA 4A9RA 2W4JA 5B7VA 3EN5A 3BHHA 2WO6A 3I1AA 4YJVA 4MXZA 2WTVA 3LXLA 3PYYA 5HBHA 3R71A 4ZZNA 2BAQA 5F94A 3V5PA 3GC0A 3GU7A 2A27A 2R7BA 2PUIA 1KE5A 5E8VA 3ZZEA 4QP9A 4QNAA 5DE2A 5EOLA 5E91A 3KCKA 4FTQA 3ZLXA 4AUAA 4I3ZA 2X4ZA 4DYMA 1Q99A 1NVQA 1V0OA 3B2WA 2Y8OA 3FI8A 1ZZLA 1QPCA 5JGAA 3FAAA 2YA9A 2XP2A 3QHWA 4AW2A 2J0KA 1UU7A 1STCE 3Q96A 3UBDA 3MFTA 3V8TA 1H0VA 1YI3A 2BUJA 5KMOA 2ZM4A 2OXYA 5EG3A 3HRBA 2QG7A 4CGAA 5HICA 4QTCA 4ACHA 2OJGA 4MF0A 3GP0A 3V5QA 3ZUTA 4AT5A 3UIBA 2PK9A 1LUFA 4F65A 2PSQA 4FV6A 4E5AX 2F7XE 2WEVA 4MCVA 5HOAA 3I79A 1FPUA 3V6SA 2PE0A 1UNHA 4IM3A 4YR8A 5KKRB 5M56A 2J0LA 3PP1A 5DG5A 4BRXA 4B8LA 2QG5A 4IH8A 3PJ3A 2PUUA 3F2RA 4XG7A 3MYGA 4X6RA 4ZZMA 2WMXA 3BYSA 4BKYA 4L7FA 5I9ZA 3DK7A 3DTCA 5HD7A 3LJ2A 3UZPA 2JDTA 4L8MA 4C02A 1OI9A 3QQHA 3KMMA 3NUYA 4FV8A 1WMKA 4NM3A 4DFZE 1TQPA 4QYHA 5FWKK 4U3ZA 5B2LA 4AF3A 4BIDA 2QOKA 3R63A 2V62A 1R78A 3LXPA 2IG7A 3VUDA 2OO8X 3MVLA 2Z7SA 3P4KA 3GQIA 5AUWA 4BCKA 5IEXA 2OIBA 4HVSA 1TVOA 1RE8A 4IWQA 1FINA 2GDOA 3V6RA 3PIXA 4I6QA 4QP7A 5AP2A 5HE2A 3RWPA 5ANOA 5AR4A 2GSFA 3NZ0A 3FC1X 4GIHA 3E88A 3EQFA 4XYFA 3P0MA 3QTRA 4AA5A 5IQIA 1ZLTA 2NRUA 4W4YA 3U6HA 4BR3A 3DY7A 3HL7A 2Y4PA 2PUPA 3C0HA 4ACMA 2PVMA 4KKEA 1GOLA 4S33A 2QU6A 2IVTA 3PVBA 2UW4A 4M67A 4IFGA 3VO3A 1M14A 2GNGA 3LMIA 2A0CX 4O0WA 5BMSA 2W5HA 4U45A 5FBNC 2QOBA 1JKLA 3KULA 3ZUUA 1S9JA 5HU3A 3MVHA 4EHZA 4AFJA 4BTKA 2R0IA 3REPA 5KX8A 2UW6A 4MBJA 1P4FA 2SRCA 2WKMA 4DITA 4ANOA 3OCBA 3Q52A 3N4UA 1FMKA 3EQRA 1YOJA 5CX9A 3D5UA 5AIKA 3QA8A 3F5XA 3MY5A 4W4XA 4ZTMA 3C4ZA 3SLSA 2VZ6A 4UMQA 2FSOX 4I24A 4C4GA 2WGJA 3WZEA 3NNWA 4PDOA 5AUZA 2W5AA 5IQHA 1PY5A 4WA9A 5CAQA 5J9YA 4GH2A 4U5JA 4PX6A 2V7AA 3VBYA 1IAHA 5AR7A 2PVLA 3FMHA 4L43A 3VJNA 4O0TA 1REJA 3F3UA 3FE3A 3GU5A 4CKIA 2R3KA 4H1JA 4BL1A 4KBKA 4DGLC 3AOXA 5HTBA 4II5A 5DR6A 2EB2A 4E6AA 3DJ7A 3NAYA 4ZP5A 5IQBA 3PVUA 2J0MB 5E8ZA 3RINA 2PVKA 3FY2A 3P86A 5JGBA 3BBWA 4JL9A 4RWLA 2WMTA 2HENA 3MA3A 4FL1A 4NFNA 4ALUA 4FT7A 3O8PA 5E92A 5HKMA 2VNWA 5ETAA 2W4OA 4YU2A 1PXPA 4DG0E 2CGVA 4O21A 4YLKA 4HGEA 5CT7A 4B6LA 4A9TA 5IA1A 4ITJA 2E9UA 2QKRA 3R2YA 4CFWA 4BI1A 5LWNA 4FNWA 3F3VA 3W2PA 3EB0A 3HMIA 3LCTA 3V8WA 5J1VA 1CKPA 2F49A 2JKOA 4UZHA 4XOYA 4BB4A 5JK3A 3FL4A 3KVWA 5BVDA 2IW9A 3FMJA 4DEBA 2PVHA 1JSUA 2BAKA 3R1SA 5H8GA 2VTPA 3QUDA 2UV2A 4OGRA 4DEDA 4E1ZA 2AYPA 4TNBA 4IZ5A 1YWNA 3FXXA 5AP5A 4DGGA 3G51A 3D83A 3GCVA 5BYLA 1P14A 2PVNA 4KIPA 3K5VA 4XOZA 4RGJA 2OF4A 4LRJA 1J91A 3BGZA 5HE1A 5C4LA 3PDTA 3W8QA 4D2PA 4L45A 5AFVA 3EZVA 3VRYA 5F20A 3CE3A 4C4IA 2GHLA 1GZOA 3K3IA 5KMJA 4FTKA 2X2LA 5EI6A 4EK4A 3PY0A 4RC4A 4YC8A 4BI2A 4CV8A 4Y5HA 1JKTA 3MPAA 3DXQA 2B9JA 3KL8A 3OEZA 5HG8A 2VWIA 1GNGA 3I0QA 1FGKA 2JC6A 3KRJA 4YLJA 4IEBA 2ITQA 2B52A 3C0GA 4AQCA 2IW6A 1R3CA 3I60A 1M2PA 5L3AA 2YITA 3FHIA 2YLEA 4KIQA 5HNBA 2WNTA 3W55A 5KHWA 2CNQA 3ZO3A 4EUUA 4FKUA 4O0SA 2F7EE 3PSCA 4XLVA 1KWPA 2VWWA 3PE1A 4OTQA 5DI1A 1PHKA 2WQMA 3DBCA 4IE9A 5EDQA 4XG3A 4D9UA 1PF8A 4E6QA 1OPJA 4RJ5A 3IG7A 1J7UA 5M4UA 4YTFA 4PRJA 5BUJA 2X0GA 5BNJA 3DLZA 3LZBA 5ITAA 4YJTA 3FPMA 5BMMA 3R2BA 4XRJA 3VIDA 3V5JA 4DTKA 3CXWA 3F66A 3ZDUA 3RHXA 4I0SA 2Q83A 1Q24A 2GHMA 5KBQA 3VBVA 1OVEA 4NW5A 4FV2A 4GCJA 4XHKB 2EWAA 2GQGA 4RX9A 4HPTE 1WBVA 4JBQA 5CSPA 2VGOA 4FKIA 4QTDA 4L67A 4QMNA 5JRSA 1Q5KA 4I6FA 3A7FA 1XH5A 5I0BA 1Q8TA 1JQHA 2GFSA 4TYHA 4FZ7A 4D4RA 5CZHA 3GEQA 2XYNA 4AZVA 4CLIA 1SZMA 2B54A 4JR3A 1H1WA 1SNUA 2WQEA 1OGUA 1FMOE 3D15A 3EYGA 3GU4A 4FTUA 1TQIA 3ALNA 4MAOA 1ZAOA 1XBBA 1TQMA 5CVHA 3OWPA 3QTUA 3FKOA 3W16A 1Y57A 5F1ZA 2YAKA 3QUEA 4ZXTA 4H1MA 3BE9A 4Y72A 1IG1A 5ANDA 5JFWA 1PMNA 2B7AA 4U3YA 2PUNA 4FV4A 5A3XA 4MF1A 2JEDA 2WELA 4Q9SA 4R5YA 1GZ8A 4RT7A 4RWIA 4D28A 1BMKA 3QD4A 4UN0C 4DFBA 2FYSA 4EC8A 1QPDA 4MTAA 4UYAA 5BVEA 4TWOA 1U5QA 4E3CA 4E73A 4JBOA 3SXFA 4X3FB 1Y6BA 2BAJA 3LM5A 3O50A 4YP8A 2OGVA 5C26A 3JPVA 3MVMA 4J99A 4MXCA 4XP2A 4YC6A 1FOTA 5DEYA 4AT3A 4EKLA 3LE6A 2CNVA 3DKGA 2YM8A 5EKNA 5H8BA 4QMZA 4UMRA 4F6UA 2X9FA 4S32A 4WUAA 4JVGA 4RJ4A 3NRMA 3UO6A 4F1OA 3PG1A 4D2VA 2C68A 2H8HA 2WU6A 3A7IA 2W1ZA 5ETFA 4ZMEA 2BZHB 2ETMA 3FZRA 4J98A 5HE0A 2PULA 5FP5A 3D2IA 4USFA 2Y0AA 3WYXA 3O2MA 3SOAA 5AV1A 4J71A 5H9BA 2C6TA 3E64A 3KMWA 3VUTA 5M44A 3QTQA 4MBLA 5IH6A 2NPQA 2OZAA 4D5KA 2XB7A 3LQ8A 4WHZA 1YXTA 3UIXA 4MXOA 5CLPA 2C5XA 4GVAA 5EW9A 4Z7GA 5IPJA 1IA9A 4B0GA 3MPTA 2QVSE 4I22A 5K0KA 3FZOA 4RG0A 5AIRA 3VS1A 5JFXA 5FTGA 3ZRKA 5HEZA 5CT0A 4CFFA 1IA8A 2VO7A 4FTJA 5DA3A 2WMUA 3AC1A 2CN8A 2B9HA 4YNOA 1I09A 4BGQA 4DC2A 1OKYA 4NTTA 2O64A 4NIFB 4BTJA 1YXUA 4P7EA 4BBMA 4DH1A 4AFEA 4E5WA 1NA7A 3OOGA 2VX1A 1LEZA 2JKMA 4QNYA 4Y95A 4IFCA 4M69A 4EOLA 1Q3DA 4HVIA 4HYUA 4P5ZA 4PMPA 3DKCA 2C6IA 2XK3A 2JDOA 2YIYA 2YIXA 3COIA 4MYGA 1PXJA 4NFMA 3QZGA 5HVYA 5IA0A 5IH5A 3LCSA 1KE9A 4O7TA 2RFDA 4TYIA 5ANGA 3HUCA 2UUEA 3Q9ZA 2XKFA 4BI0A 3L8SA 4G1WA 4FT5A 4O81A 4JS8A 4JRNA 5HVKA 4IZAA 4WSYA 3KCFA 1H4LA 4NEUA 5IMXA 2CGXA 3VF8A 2OIDA 4D1ZA 5E1EA 1VZOA 3DFCB 4HZSA 1Y8YA 3QF9A 3SD0A 1YHVA 3FZ1A 3SQQA 4LRMA 2WXVA 3ZSGA 3EL8A 5AJQA 5KMIA 2ZOQA 4F0GA 3QCYA 5K4IA 3R22A 2UZVA 5AV4A 3PPJA 4WG4A 4BYJA 3R8PA 4FSTA 3HX4A 4UWYA 3CS9A 4F7JA 3OXZA 3IDCA 3D5WA 4TWCA 2V0DA 3KN5A 4NCTC 4W8DA 4EH8A 5J5SA 4FVPA 3MIYA 4KS7A 4S34A 3K54A 5A14A 2PVFA 5FEEA 4BDAA 2P55A 2W1GA 4RLLA 1BL6A 4EJ7A 2XEZA 4R1VA 5DVRA 4R7IA 4C35A 4ZMFA 2JBPA 4WG5A 3RM6A 3Q3BA 4E4LA 1H1PA 1X8BA 2X8EA 2XA4A 3HLLA 4ORKA 3NAXA 1ATPE 4EH5A 3UODA 3FXWA 4BBEA 4QMQA 5HTCA 2GNHA 4N6YA 1IAJA 3TIZA 3CY2A 1KE7A 3VHKA 3T9IA 5BVWA 4EOMA 5JSMA 3LFSA 5FUTA 2YISA 1PMEA 3Q4CA 3Q6WA 4G34A 4WNMA 4BDCA 3OBGA 4IWPA 4KRDA 5AA8A 2QO9A 4DH7A 1BI8A 5HX6A 3LFQA 4IXPA 3S0OA 4FR4A 1YWVA 2QOLA 4RIWA 5FQDC 3VS3A 3DA6A 1W84A 4FKJA 5DN3A 5A4QA 4BDKA 4TNDA 1ZYCA 3E62A 4O22A 2BRNA 2IVVA 4FX3A 3R7VA 4M84A 4BGHA 2X8IA 2BZJA 2YFXA 4JDIA 3FUPA 4F9YA 2Z7RA 4WG3A 1URWA 2HWPA 5CNOA 4YLLA 4BBFA 3CEKA 4C62A 4DN5A 4GKIA 4MWIA 3ZO4A 1APME 3BQRA 2Y9QA 4EORA 1H1SA 5EM8A 5L6OA 2CCHA 4RC3A 2E9NA 1U54A 3SAYA 5EFQA 4ZTNA 2VO6A 3NNUA 4NTSA 4QMXA 4DGMA 2BPMA 2HIWA 3H10A 4ARKA 2QLUA 3UG2A 4FSYA 5C8NA 2CCIA 3IKAA 4KA3A 2UW9A 4IB1A 4YUQA 2YM4A 3JUHA 2X7FA 2WMVA 4FTNA 4Q9ZA 4IACA 2REIA 5IQFA 3MY1A 4JDHA 4M97A 5A6NA 2OW3A 4BICA 3HNGA 5TE0A 4FC0A 4FV5A 4F09A 1W98A 2I0VA 1XH6A 2B4SB 1CTPE 4AE9A 4NM0A 4ASDA 2R9SA 4D0WA 5AX9A 3O51A 3U4UA 4P4CA 1MUOA 4FK6A 3LLTA 4K1BA 3ACJA 4N57A 3RPSA 3WOWA 3LM0A 3CJGA 2V22A 3DBDA 4XX9A 2EU9A 3DNDA 4MQ1A 3BE2A 5DIAA 4FG9A 4N0SA 2OJIA 4BCHA 5KHXA 3Q53A 5CWZA 3QRIA 3TNQB 3U54A 3ORIA 4KSPA 4RIXA 1XJDA 1PKDA 3DQXA 5HBEA 2XIYA 2XNBA 4FV1A 2DUVA 3MWUA 1RJBA 4MNFA 5CASA 4FT0A 3TIYA 4DBXA 3VNTA 2OWBA 4GT3A 5FXRA 5M4CA 4MHAA 4ZSEA 3EFWA 4C0TA 4CFMA 3V01A 5H2UA 4FSZA 2XF0A 1H25A 4EHVA 2OKRA 4HYSA 2JIIA 2XH5A 3TT0A 5FEDA 3HDNA 4FKWA 3PUPA 3WZDA 1F0QA 2RFEA 4KBAA 3ZMMA 5EI2A 2XK7A 4I41A 3WIKA 4RQVA 4PDPA 3GC7A 4Y85A 1ZYDA 2GMXA 3RPYA 1H01A 2BMCA 5ANIA 2G1TA 1IRKA 1KE8A 3PJ1A 4EZ7A 5IA3A 2VD5A 4WRGA 4NUSA 4L9IA 1XBCA 2JDVA 4NWMA 4RX8A 4I4EA 3DOGA 2VWZA 4KSQA 4FIGA 4FIEA 4C37A 3CSVA 5M08A 4BCFA 1KOAA 2WMRA 3QYZA 5B2MA 4G31A 2HY0A 4FV3A 5M06A 1WBSA 1YXSA 5CF5A 2XJ0A 3H0YA 4IAYA 3IOPA 5EW8A 4GG5A 4O38A 4C8BA 3R9DA 5L6WL 5LMBA 3BLHA 4TYJA 1BKXA 3MPMA 2QHNA 3RPVA 3P78A 5EYDA 1UWJA 5C9CA 3RALA 2ZVAA 1YDTE 3KF4A 2G2IA 3HV6A 5L8JA 4B99A 2YZLA 2HY81 4LMNA 1JVPP 4O7WA 3PY3A 4P5QA 1ZMVA 5E8XA 1OUYA 3R7GA 4FNYA 3WILA 3V8SA 3ORLA 4AZWA 3CR0A 2VTIA 4YZMA 5EYMA 5IG1A 3DDQA 4ZTHA 2CLXA 1WBOA 3QQFA 2J0IA 4KABA 4FL3A 3UGCA 3UQCA 3F6XA 3ALOA 5CYIA 4BDDA 3WE4A 2I7QA 1UVRA 4FNZA 2A2AA 1U59A 5KMLA 1MRUA 2YHVA 2GTMA 2YN8A 4QP4A 1VJYA 2UW0A 2JD5A 4YNEA 3CTJA 4G5PA 1FVRA 3GFEA 2C5VA 4KB8A 4ZZOA 4IQ6A 3MFSA 4BZNA 3RWQA 3TCPA 3Q4ZA 5IA5A 2X39A 4LMUA 4XV9A 1H28A 3OC1A 4FODA 4BDFA 3QC4A 3KKVA 5HX8A 4PTCA 5DGZA 3ANRA 4CYIA 2W1DA 4GUBA 4O0RA 5J8IA 3V5LA 4O86A 4YJSA 5EQPA 4JNWA 3TM0A 1ZMUA 4FA2A 4YJNA 5AV3A 2OBJA 3QD0A 2UZUE 3B8QA 4EK8A 1SVHA 3PA5A 4EI4A 2PMIA 4I1ZA 4IWOA 4MQ2A 4RX5A 2CDZA 4NW6A 4GV1A 3R8VA 3FI2A 3BV3A 2PMOX 4Y5QA 3UC3A 2VO3A 3CKWA 3TN8A 5I9YA 4O1OA 4U6RA 5EQEA 3IW8A 3TZ9A 4C61A 3VS7A 3KRLA 3A7HA 3UPXA 4D2RA 2WFYA 4R3PA 2AUHA 3FZSA 4OTPA 4JIAA 4LL5A 2FSMX 2ITOA 3N4VA 4GEOA 1GZNA 4FKRA 1FVVA 2Z60A 3M11A 3IS5A 4IZ7A 5M53A 2G01A 5E8UA 2VRXA 4F70A 4FKGA 3A62A 3HAMA 3MN3A 3VRZA 3ZRMA 2RL5A 3MS9A 4DH8A 3C51A 4D0XA 3LOKA 3T8OA 5A46A 2HXLA 2B55A 2BALA 2Z2WA 5D12A 3CD8A 1DM2A 2UVXA 2XBJA 3I6WA 2R3PA 1Q3WA 2VTJA 3OCTA 1Q97A 4I5PA 2QR8A 1YVJA 3MFRA 4IDVA 4YPDA 4EBWA 4JAIA 5AMNA 4DFYA 3ANQA 1H1QA 1UNGA 2O0UA 2I40A 4AE6A 4CXAA 3HVCA 1XH4A 4AW1A 3A60A 5CY3A 4ZSGA 4EJNA 3DKFA 3KRXA 3MBLA 2VNYA 3MTFA 2ZMCA 1H08A 3LXKA 2VAGA 4TWPA 3TUDA 1R1WA 3H4JA 4PTEA 5BQ0A 5JQ8A 2GNJA 5KO1A 5AM7A 3UNJA 4UXLA 4ANQA 5D10A 4DH5A 3F7WA 5JGDA 4RIYB 2C6KA 3R9NA 3THBA 3DPKA 5KMKA 2JITA 4BGGA 1G8SA 4OT6A 3BWFA 3KGAA 2EB3A 1NY3A 2PHKA 3PXQA 5D11A 2OICA 1UKHA 3JVRA 3Q5ZA 4FTOA 1H07A 4K6ZA 1Q4LA 1YI6A 4MXAA 4RA5A 5FTOA 3MSSA 4QP2A 3TNPC 3NLBA 1CDKA 2VO0A 5JRQA 2O2UA 5HCZA 3KN6A 3DBFA 1ZOHA 2CMWA 5FM2A 3AC4A 3ZM4A 1A48A 4RVMA 2HZ0A 2WMSA 3FMEA 4FV7A 3UQGA 4F64A 3OVVA 2QO2A 4CFNA 3QBNA 5E8SA 3LQ3A 4CYJA 4H3PA 1JSTA 4JIKA 5GNKA 4CD0A 3VW8A 2ETRA 4Y83A 4FTLA 2PY3A 2WAJA 4BIBA 5J87A 3UOJA 2G2FA 2R2PA 3GCQA 3F9NA 4Y46A 2YCSA 3BPRA 5HIEA 2QHMA 2WOTA 4E8AA 3PSBA 4FUYA 3CGFA 3BZ3A 4DFNA 3QCQA 5HO7A 4PPAA 3LJ1A 3EKNA 5HE3A 2O8YA 2OJFE 4ITHA 3WZUA 4WBBB 5BYYA 4EH7A 4EKKA 1PXOA 5BX0A 5KMMA 4QRCA 4L68A 4V0GB 3OROA 4KAOA 4XV2A 4RSSA 4U8ZA 5AUTA 3BCEA 3DK3A 4CVAA 4FYOA 4I21A 2W1HA 3AC8A 4U97A 4W9XA 4FTRA 4ANBA 3UNZA 1G5SA 3BHUA 5HO8A 4O96A 3ZLSA 1WBPA 4ZLZA 3JY9A 4B7TA 2EXMA 1QL6A 2RF9A 4WNPA 3QQKA 3LFEA 4X6QC 4F7SA 5HG9A 4BCQA 3FLYA 2O63A 4FL2A 3QC9A 4BCNA 2XIRA 1Y91A 1ZYJA 3ENMA 5E1SA 4TZRA 5ETIA 2PWLA 3D2KA 3FQHA 3MIAA 4U43A 3DZOA 3ZYAA 4X3JA 4JX7A 2X4FA 3E87A 3SVVA 2PVRA 3FLNC 3G2FA 1ZYSA 3NCZA 4A9UA 5CAVA 3DBQA 5FDXA 1G3NA 4HGTA 1OIYA 2GS2A 2GFCA 4XJ0A 3MV5A 2KTYA 5CQWA 1PXLA 2UZBA 2VTQA 1M2QA 2XK9A 2W1FA 4EOIA 2Y6MA 3O0GA 2ZV8A 2IW8A 4HVDA 3EKKA 3NIZA 2QLQA 3OOMA 4IB0A 4U7ZA 4AT4A 4AZFA 3NYOA 3EFLA 1KE6A 4M8TA 4C38A 2BKZA 3C13A 3KFAA 3PA3A 5G6VA 5CAOA 4UZDA 3OHTA 2VWVA 3HEGA 3EQDA 4U0IA 5LQFA 4CRLA 1KV1A 4ACGA 3CC6A 3KK9A 4N6ZA 3FYJX 4C4JA 4R7HA 2XBAA 3CGOA 4EH6A 1XH8A 2IWIA 4W4VA 2OJJA 3DXPA 5IQDA 4NH1A 3LXNA 4B8MA 3C4EA 2HK5A 3QD2B 4PP9A 4RFYA 3WIGA 1QMZA 1BLXA 3VJOA 5CU0A 3IPHA 4USDA 4I0RA 5J79A 5GINE 4FZFB 2R5TA 2CHLA 1GIHA 3F69A 3QGYA 3NIEA 2JLDA 4KIKB 4DFUA 3ZFXA 5AR3A 4YZNA 4NT4A 2BRGA 3SOCA 4BZOA 2P0CA 3V3VA 2WPAA 4CTCA 2ZV2A 3IQ7A 2JDRA 4FKQA 3ROCA 4DINA 3S3IA 3R7UA 3N51A 2X7GA 2W7XA 2WMWA 3HDMA 5KCVA 2CKPA 4X2NA 4M0YA 2JIUA 3IW7A 4Y8DA 2W06A 5GIOE 2JAVA 5E90A 2PE1A 3KMUA 2PVYA 4KNBA 3P1AA 5GZAA 3V5WA 3TDWA 4FIJA 2BZKB 3QCSA 3IOKA 4IAAA 2G9XA 2R3OA 3K3JA 2C6DA 2Y6OA 5F95A 3AD5A 3ZXZA 5FBOA 3LCKA 2YAAA 3PXKA 3QAME 4IW0A 4H3BA 1H27A 2XK8A 3JXWA 4LUEA 2QD9A 2XZSA 5AUUA 4BDHA 4YHFA 2ZB1A 1YOMA 2WIPA 3MA6A 2VTRA 5JKGA 5K9IA 3MJ1A 4PQNA 3OF0A 3KRRA 4HCTA 3PJ8A 3UP2A 4XMOA 4X3FA 4LOQA 5DT3A 2P4IA 3ZDIA 4EQCA 1O9UA 5CF8A 1JKSA 2F2CB 4FTMA 5CI7A 3KXHA 2HYYA 3DFAA 4ITIA 4Q2AA 3TV4A 5M07A 3F5GA 4GU9A 5TT7A 4FEVA 4HCVA 3W2CA 3H0ZA 3OEFX 5HQ0A 3L8VA 5LMKC 2Z7QA 3UQFA 1XH9A 4Z55A 4ZEGA 5J9ZA 4FZ6A 4I20A 4UMUA 5AAFA 2QU5A 3IECA 3ZXTA 5IMEA 3L9LA 2VU3A 3FQEA 3POOA 3A8WA 3TJDA 2XIXA 3T9TA 4WO5A 2NP8A 3CBLA 3QLGA 3LAUA 3QQUA 4EOSA 3RAHA 2CLQA 5IQAA 1WAKA 4NK9A 5KMNA 5LWMA 2VTNA 3UO5A 3RCJA 5IISA 2JKQA 4O7ZA 4O6EA 2I1MA 4XH6A 2GU8A 3KK8A 2O65A 4IWDA 3IO7A 2QODA 5AV2A 1J7IA 1Z5MA 3FBVA 2A4LA 3FDNA 2H96A 4R1YA 4K8AA 4S31A 3O96A 4A06A 3DS6A 2XCHA 2GNLA 4PNIA 3W1FA 5CXHA 3H3CA 4MVFA 4DCAA 1XKKA 3EN7A 5AR5A 3SV0A 4ZLYA 4FNXA 3BU6A 4O0YA 3OD6X 4GJ3A 3G6GA 1NT2A 3SHEA 3W2RA 4NIFA 3PXRA 3OT8A 3JYAA 2GQRA 5AAGA 4C4FA 2VWBA 1OL6A 2ZDUA 3QQLA 4AZTA 3OMVA 2C3LA 4EWQA 2XIZA 4IB5A 4JJRA 3OCGA 1YXVA 3QALE 2X6DA 2YIRA 1MQBA 2OIQA 4EYMA 5CVFA 1AGWA 1ZWSA 1FGIA 3TI1A 4MEDA 3F5PA 1UWHA 3Q2MA 4OAVB 4FG7A 3OFMA 5A4CA 3FSFA 4FVRA 4DBNA 4PF4A 3QXPA 4A4OA 4BYIA 4G6NA 3OY1A 4DTBA 5EOBA 4APPA 3OG7A 3AT3A 2RKUA 3NUSA 4YHJA 3R01A 1XH7A 3M2WA 3RPOA 4ZSAA 1OBDA 2HZNA 2PE2A 3E7OA 2R64A 3GQLA 3IGOA 3ZRLA 3OTUA 2NO3A 4F0IA 5IA4A 2QONA 5T3QA 2JAMA 1R0EA 5CEIA 4BWKA 1R0PA 1ZRZA 4JRVA 2YM3A 4O2ZA 4QPMA 2UZOA 3F2NA 3KB7A 3CTQA 4P2KA 5AX3A 3DGKA 3UJGA 3DKOA 2PU8A 4HNIA 2V55A 5CTPA 3W18A 4BTFA 2C0TA 3AGLA 3G5DA 5CAUA 3B8RA 4EHEA 4F08A 1U5RA 5BVKA 4FZAB 2YACA 3WF8A 4YMJA 1JSVA 3IDPA 4X2GA 1YXXA 5J7HA 3E63A 4ZTQA 4KKHA 2C6LA 5CAPA 4NKAA 3VW6A 2Q0NA 4E4NA 5LVLA 2IN6A 2Z7LA 4RFZA 4LYNA 4O84A 4XV1A 5K0XA 4EQMA 2FH9A 4CTBA 3TUCA 4ZSLA 2C1AA 3R7IA 3O7LD 1OUKA 3RCDA 1XHAA 4AZEA 1SM2A 4L3LA 1B38A 3AMBA 3NYNA 3U6JA 3C5IA 2ITPA 2ZM1A 2F9GA 3CD3A 4PPCA 5C01A 2VTMA 4GS6A 4U40A 4F7NA 5HGIA 3AMYA 4IVCA 5JT2A 1DAWA 4IC7A 4QOXA 3QTIA 4DLJA 2CGUA 4MK0A 3OXIA 3FSKA 3OP5A 4JLCA 3TWJA 1YDRE 2CN5A 3JVSA 3ORXA 3BYMA 2YLFA 5EYCA 3NUAA 5K3YA 1E9HA 2ITZA 1AD5A 2EXEA 2QO7A 3LPBA 4IDTA 4Q5HA 4FV9A 2OH0E 5HBJA 3QKKA 3P7CA 3HP2A 2XNNA 3MH0A 3ROYA 2WEIA 4RZWA 1V0BA 2F57A 4PV0A 5JH6A 1M7NA 5L8KA 5EQYA 4ANSA 5IQCA 3Q04A 3TV7A 4O6LA 5HNIX 4RQKA 2FB8A 5JFVA 5IA2A 4V01A 3PIZA 3MY0A 4LQMA 3R8ZA 3R83A 5M55A 5C4KA 2QQ7A 4CFXA 5EYKA 3R7OA 4PMTA 2C6OA 2YM5A 3HV7A 3I5ZA 2J50A 2W4KA 3IW4A 4D1SA 2CGWA 3E8CA 4YHTA 4NKSA 4PL5A 2O5KA 4WUNA 4D2WA 4A4LA 4NYEA 2JBOA 3HKOA 3ZHPC 4C4HA 5C8MA 4ERWA 3BELA 5DHJA 4RVLA 3RZBA 4K11A 4RVTA 3KF7A 1OM1A 4HGSA 2J0JA 4EHGA 4D55A 4X0MA 3VBQA 5HLNA 1YI4A 2J90A 5DLSA 2VGPA 3ETAA 3UIUA 3QZIA 3SGCA 1B6CB 1DS5A 4M0ZA 4PMSA 5IUIA 4F6WA 3KRWA 5CSHA 2R3GA 4I5HA 1W83A 4NL0A 3EOCA 2OSCA 3E8DA 4YBKA 4EONA 4FTCA 2UVZA 1UU3A 4AA0A 4E93A 1VEBA 3GU6A 1ZY5A 2RG6A 3D7TB 3COHA 3VUKA 5LCKA 5I9XA 4AU8A 1ERKA 4D4VA 4ID7A 5JMSA 4EC9A 5AP0A 3P7BA 3A4OX 3P5KA 1UA2A 3AG9A 3CJFA 3C5UA 4ACDA 4DFLA 3LLAA 2C3JA 5CS6A 3L1SA 2YCRA 4AOIA 3EWHA 4ZS4A 2BR1A 2C5NA 3UTOA 5AP1A 2NRYA 5GZ9A 2PZ5A 3DB8A 4FYNA 2W0JA 3RK9A 3VUIA 1NW1A 1GIIA 5K4JA 4XG8A 4ASEA 4AX8A 4QYYA 4BDEA 3I6UA 1DAYA 1SVGA 1BUHA 3LFFA 3ODZX 4M3QA 4A4XA 4O27B 4G3FA 1PYXA 4GG7A 1JLUE 3F82A 3AT2A 2ZM3A 4H05A 2O3PA 4FEXA 3OS3A 1UV5A 1GAGA 3EN9A 3PXZA 4ZAUA 1VYWA 3RNIA 5AP6A 4YJUA 2R3HA 3WE8A 3CKXA 5IDPA 2ZJWA 4DG3E 1H26A 1PXNA 1YW2A 4C36A 3S00A 3DJ5A 3NW5A 5A54A 5EDPA 1M52A 2OU7A 1OL7A 4L3PA 4UV0A 4L46A 5C8KA 5JEBA 2ACXA 4I6BA 2ETKA 2HOGA 2HW6A 2XK6A 4G3GA 2F4JA 4EK5A 2IZTA 3R1QA 4H58A 4YJPA 4ASXA 3DTWA 2FO0A 5CNNA 3ZLYA 5EKOA 1CSNA 3ODYX 4CRSA 3EIDA 1Y8GA 4ASZA 1Y6AA 4C58A 4JXFA 3HMNA 5AP4A 3CQEA 4E5BA 4KUJA 2E2BA 1T46A 2EVAA 1V1KA 2ZDTA 3TG1A 3VQUA 3BYVA 5TKDA 4QQCA 3SXRA 2I0YA 4OR5A 2YJRA 3GCUA 4FOCA 5IDNA 4V04A 3R8MA 3AGMA 2NNWB 2W1EA 1RW8A 4GK2A 2BHHA 4HPUE 3S2PA 1HCKA 3DAEA 4DHFA 1GZKA 4TY1A 4L3JA 4FGRA 4EEVA 3QX2A 4MWHA 3RK7A 4FKTA 3C4CA 5DT0A 2RFSA 2WU7A 2GHGA 2BRMA 5L2WA 3AT4A 4RMZA 2YERA 4AOTA 5E4HA 4IB3A 4KINA 3FKLA 4NSTA 3FKNA 3ULIA 4ZY4A 4E6CA 1QPJA 2IZUA 2G2HA 4D4SA 1TKIA 3NUUA 3A99A 1O6LA 1R39A 2F2UA 5BYZA 2JIVA 3N4TA 3NWWA 1Q8YA 2YCFA 4X2JA 4EL9A 4UYNA 5HD4A 4O83A 4QMTA 3HGKA 4QP3A 5J95A 1P2AA 5KBRA 2F7ZE 3DAKA 2IZRA 2PVJA 2C1BA 5T68A 4Z16A 3FXZA 2ESMA 1GY3A 4IADA 4K33A 1SYKA 1JOWB 2C5OA 2QURA 3A7GA 4EOKA 1K3AA 1OKVA 1OKWA 3V04A 3KQ7A 3GXLA 3DV3A 4X7QA 4K9YA 4JAJA 5EK7A 3H30A 3I4BA 5HVJA 3QZFA 4FSWA 3GNIB 3EQIA 5IKWA 3QRKA 3QCXA 4BTMA 4Y73A 4ZTRA 3UO4A 5GJGA 4CFUA 3BBTB 3C4WA 1W8CA 3COKA 3ORPA 4O82A 1BL7A 3KXGA 3UOHA 2W96B 2YDJA 4OBQA 4KKGA 3MFUA 3PIYA 4RLKA 4APCA 3CCNA 3H9RA 3PG3A 5I3OA 5AAEA 2YJSA 4GJ2A 5E7RA 3PJ2A 1ZMWA 3QGWA 1UU8A 3FL5A 5A4TA 4DT9A 5KUPA 5LVNA 4FI1A 3FMKA 4GYGA 3RHKA 4M68A 1Q41A 3HMMA 4FBXA 4JDKA 4BDBA 5B2KA 3ZH8A 4BHZA 4KBCA 1IASA 4ANMA 5M4FA 4GT5A 5FM3A 2XJ2A 2BFYA 4O7YA 1JWHA 2P3GX 2X6EA 4YJOA 4TRLA 5HCYA 2RG5A 3UVRA 3D4QA 4FIIA 5FXQA 3VUHA 3OUKA 4QQJA 3RGFA 3DXNA 5TOZA 3TEIA 3VS4A 3JS2A 3FMMA 4CZYB 2P2HA 1SVEA 4ENYA 3G9NA 3EQCA 4QP6A 5M09A 2BRHA 2PTKA 2H6DA 4OTGA 1B39A 2X81A 3PTGA 4M13A 4QMVA 3UPZA 3KEXA 1OZ1A 2LAVA 3W2SA 3IW5A 2AC3A 2I0HA 3PLSA 3O23A 5GJFA 2UW5A 2XCKA 4JQ7A 4XP0A 4AACA 4UBAA 4IJ9A 3L9NA 4BKJA 4EOPA 1E1VA 3GI3A 5ACBC 5GIPE 4O0XA 3LFAA 4ZY6A 5B0XA 1WVXA 1Q8ZA 4GK3A 5D9HA 4IC8A 5CU3A 3F88A 3I7BA 4IMYA 5FLFA 3I7CA 4G3DA 3LCDA 4RIYA 3EZRA 4K0YA 2QKWB 3KU2A 4YZDA 1CKIA 3D7ZA 4EOOA 1K2PA 1G8AA 3G15A 5IQEA 3ATTA 4FEWA 5L8LA 3GB2A 5F4NA 4JG7A 3G90X 3C4FA 3LVPA 3U6IA 2C3KA 1W82A 1YOLA 3FPQA 4D5HA 3FHRA 4KS8A 3GCPA 2ITVA 1PJKA 3FI4A 5CSVA 4RBLA 5I9VA 4QO9A 4FZDB 4QMSA 4X2KA 4HYHA 2J9MA 3OCSA 4J7BA 3WI6A 3E3PA 5E9EA 4TYEA 2JKKA 3R9OA 4M14A 3VF9A 4F0FA 5CQUA 3BYUA 3EHAA 4QTBA 5GHVA 4DCEA 5JFSA 5JZJA 4GUEA 4FGBA 2W1IA 3CQUA 3PXFA 1PXIA 2XNEA 2FGIA 3RVGA 4EQUA 4KIOA 3ULZA 4D2SA 4EH3A 3SX9A 4CMTA 2FA2A 3BRBA 5CEQA 3TZ8A 3MB6A 4UXQA 4ZLOA 3CY3A 1VYZA 2H9VA 2X7OA 4K18A 3ZBFA 3EQHA 1KOBA 4Z7HA 3HV5A 4FIFA 4AN2A 3RP9A 4DEEA 4CZUA 5IEVA 2WIHA 5FRIA 4L53A 3R1YA 2R3JA 2W99B 4QP8A 2WMAA 3BKBA 4V0GA 4W8EA 4O7RA 3MB7A 3KXZA 4BCMA 1GJOA 1LP4A 5H3QA 1YQJA 3CTHA 3LMGA 3K2LA 3QD3A 3IONA 2QOIA 3PWYA 3ZO1A 3QQJA 2DS1A 1AQ1A 1QCFA 4GRBA 5ANKA 3UZRA 5LVMA 4CLJA 2H34A 2UZNA 3EN6A 2J2IB 1BYGA 3OUNB 4C4EA 4CKRA 3BGQA 2I0EA 3O17A 3OWKA 3R73A 3LFDA 4LM5A 3DCVA 2J5FA 3VS0A 5CU6A 2WQBA 2XYUA 3TKUA 1ZARA 3ZTXA 5JZNA 1P5EA 3DNEA 3E5AA 3NUPA 3QQGA 3RPRA 4IX6A 3W2OA 4O7SA 2CKQA 5J5TA 3U9CA 4MD7E 3LQ5A 5DPVA 4QD6A 4EWHA 1NVRA 4OTFA 1PW2A 3GOPA 4NZWB 4MNEB 2PL0A 4HVHA 3VBWA 2HXQA 2BZIB 3RKBA 4YZCA 4TYGA 3EJ1A 4PP7A 5KZ0A 3SDJA 3BEGA 1YKRA 3VAPA 3T3UA 4ZS0A 5CU4A 4CCUA 2QOQA 4N70A 1L3RE 1HCLA 3T3VA 3KVXA 4XEYA 1XWSA 2BHEA 3ORTA 4MXYA 2V5QA 5IH4A 3R21A 4FK3A 3PY1A 2ONLC 5DOSA 4BCGA 3QUPA 3NPCA 2RIOA 4UMTA 4GYIA 4M7IA 3TZMA 3VS2A 4GVJA 5HORA 4AN3A 5HHWA 3W10A 3BWJA 5ANEA 4KRCA 5F9EA 2QC6A 3AD6A 4QTAA 4QMYA 2R3LA 5L4QA 3IDBA 3B2TA 4XBUA 3RMFA 4O1PA 3QZHA 1WBTA 4J97A 4GKHA 4A7CA 4AOJA 1PYEA 4CCBA 3FLQA 3PZEA 2XVDA 4PWNA 1UKIA 2CJMA 2XNPA 4LV5A 3BX5A 5FXSA 1FQ1B 2WTKC 3FC2A 5DFPA 4J52A 4CZTA 4Q5EA 2GS7A 4RJ7A 4U44A 2B0QA 3QHRA 1F3MC 5I5ZA 4R5SA 3A8XA 5L2TA 2AC5A 1YDSE 3QRUA 4KIKA 4NCTA 2WQOA 1Q61A 4FOBA 4HJOA 5ACKA 2PZIA 3SRVB 3PSDA 4QMWA 3NS9A 3TXOA 5BUEA 3R1NA 4MX9A 4XCUA 4AW5A 4LG4A 2XKDA 4IANA 3GCSA 3QX4A 4JG8A 4XS2A 5EHYA 4FKLA 1ZOEA 1WBWA 2I6LA 3LFBA 3P79A 3OT3A 4IAKA 2EUFB 4WOVA 3LKMA 5CEKA 2C5YA 1JBPE 2FUMA 3RAKA 3TNIA 5I9WA 4PL3A 1H24A 3AXWA 2GCDA 3Q60A 4MH7A 4I93A 4C57A 3H9OA 3TUBA 3CIKA 4FSNA 4QMOA 4AGDA 3A7JA 4YTCA 3HV4A 2FSLX 3CP9A 3ORMA 1IR3A 4ZSJA 5L2QA 3D94A 3ZOSA 3M42A 3NNVA 2EXCX 2B53A 4RJ3A 4DA5A 3LFNA 3BGPA 4ZJIA 3ZONA 2IPXA 1WFCA 2ITTA 3QKMA 3MVJA 3UVPA 1CMKE 3D9VA 5DT4A 3RAIA 4FE2A 3NVKI 2A1AB 4C2WA 2VX3A 2LGCA 5AR2A 4UY9A 3JR1A 2VTAA 4M66A 2X2KA 2XKEA 4TW9A 1J7LA 2HAKA 4JQ8A 5EM7A 5J7BA 1NXKA 5M4IA 4ZTSA 2YM7A 3F5UA 5DRDA 5HESA 1XO2B 4WSQA 5H8EA 4O7VA 4FVQA 4IAZA 1CM8A 2UW7A 4L44A 5CU2A 5EW3A 2WTJA 2UZLA 5E8WA 5AP7A 5HG5A 3RBWA 3FJQE 3HECA 4C33A 1OITA 3TTIA 1OKZA 4RRVA 3WARA 3G6HA 3R7YA 3R8LA 4TKSA 5AP3A 4J8NA 5K5NA 3DK6A 3Q32A 2VTTA 2WMQA 4UEUA 1EH4A 3E3BX 4CG9A 5IUGA 4G3CA 1ZY4A 1OL1A 5EM5A 4WNKA 3PVGA 1A9UA 4G5JA 3DB6A 4H3QA 4ZJVA 4XG4A 4ENXA 3Q2JA 4G6OA 2R3NA 4DE4A 2GNFA 3LCOA 2YDIA 2J4ZA 5LXMA 3G33A 5FD2A 1IEPA 4U81A 3UVQA 3LMHA 3HRCA 4YTIA 4G16A 3FMNA 1QPEA 3MTLA 3NDMA 4QMPA 4IIRA 4E4XA 2X9EA 4F1MA 2YIWA 4BC6A 3GC8A 3WF5A 5CSXA 4UX9A 4I0TA 4K77A 1VR2A 5FEQA 3R00A 3NUNA 5CF4A 2R3MA 4GFGA 4D58A 3GOKA 3WF9A 3GFWA 3E8EA 2XNOA 4DEAA 2Q0BA 3ZBXA 2JGZA 3MH2A 2W05A 4C3PA 4LV8A 3UOLA 4O7NA 3FLSA 3MJ2A 3TACA 3BU3A 3A61A 3RK5A 4TT7A 1XBAA 4G3EA 3P08A 3PLAE 3DT1A 5DBXA 1PXMA 2YABA 4RIOA 1UU9A 4TL0A 3NMUF 3PPZA 3BLQA 4BDIA 2RGPA 3VBTA 3QXOA 4NJ3A 4E4MA 4FEUA 1LEWA 3UYSA 3A4PA 3U8WA 2ERZE 5DR9A 4G9RA 1S9IA 2OXDA 3EN4A 3UG1A 4AXAA 2WOUA 2VWUA 3M1SA 3SXSA 2ITXA 4DFXE 2WTWA 1P4OA 1WCCA 3Q9YA 2V7OA 5HG7A 5AA9A 5M57A 2WB8A 3JY0A 2C0OA 2YEXA 1KV2A 4DTAA 3BEAA 3QA0A 1Z9XA 2WD1A 4BF2A 1LR4A 5AADA 2BVAA 4OAUC 4N4SA 3PXYA 4P90A 5EDRA 2XM8A 2C3IB 3L9MA 4GL9A 3ZZWA 4J53A 1URCA 3R30A 4X21A 1NVSA 4D2TA 4F7LA 3R7EA 2R7IA 4Z3VA 3KULB 1PMVA 3UP7A 3TV6A 4HCUA 1J3HA 4I4FA 4DEHA 4R6VA 1LPUA 4RC2A 3RTPA 4E26A 3AQVA 3F3WA 3LW0A 3FMLA 3LIJA 4J1RA 4K2RA 4U42A 4F9CA 2YWVA 4R77A 1DI9A 4GK4A 4V05A 4AWIA 2VTOA 2RSVA 2OI4X 2WZJA 5FG8A 1WBNA 4XLIA 5EI8A 3ORNA 4USEA 3CPCA 4XRLA 1M17A 3HV3A 4QYEA 2BDWA 5J9LA 3TTJA 3LHJA 5HTIA 4IM0A 3ZU7A 2YM6A 3TL8A 4F63A 4S2ZA 1PMUA 3HAVA 4YPSA 3ZM9A 1OMWA 4EK3A 3C9WA 2OF2A 3U51A 4BCOA 3OW3A 4YZ9A 4FG8A 3L9PA 4I5MA 3RNYA 3SKCA 5JQ5A 5CI6A 2QR7A 3O8UA 2XNMA 4LUDA 4W4WA 4ZIMA 4IAIA 3TKIA 3RJCA 4PDYA 2OZOA 3ZUVA 3II5A 3K5UA 4FSMA 1OBGA 2WHBA 3VN9A 5DR2A 2R0UA 3QRTA 5TR6A 5DMZA 1H00A 1Q8UA 2CPKE 3UDBA 5FDPA 4JOAA 2VTLA 3BHYA 2BDJA 2Y4IC 3DZQA 2QCSA 4OTIA 3NGAA 3NX8A 3ID6C 1V0PA 3COMA 2XRWA 5CZIA 3EMGA 3KA0A 1WVYA 2P33A 3N9XA 3C50A 2QOCA 3SW4A 3HRFA 4DAWA 5A4LA 2QOFA 5DRBA 1WZYA 3FYKX 3RZFA 1MP8A 4IX5A 3BU5A 3W33A 3C7QA 3NW7A 1BX6A 4WD5A 3OY3A 4HOKA 2BILB 3SA0A 4QT1A 3SG9A 2XS0A 4IX4A 5JN2A 1KSWA 4ALWA 4GU6A 3GU8A 2E9OA 5A9UA 3FZPA 2CKOA 3S1HA 3SW7A 4OTHA 3V51A 4AP7A 4HVGA 2J5EA 4AA4A 1JNKA 3OTVA 1U46A 5AUXA 2BRBA 4HYIA 4JBPA 4EH2A 3DQWA 3O71A 3WZKA 5TO8A 4BY9E 3DAJA 5DNRA 1WVWA 2XMYA 4L00A 4OW8A 5KE0A 5DEWA 2B1PA 2XNGA 5IQGA 4F4PA 5HIDA 2OG8A 1OIUA 3AC3A 4FIHA 4IJPA 3PE2A 4R7BA 3I0OA 4XNEA 3D7TA 4YC3A 4QPSA 5IZFA 5KKRC 4CQGA 5BVFA 5GJDA 4PTGA 3VHEA 4W9WA 3VQHA 3TZ7A 3PA4A 3S95A 2PMNX 4PNKA 4YSMA 1OPKA 2G15A 3ZEPA 4FKOA 1ZOGA 3GC9A 2DQ7X 3NW6A 5EH0A 3TJCA 4BDGA 4RFMA 4YO4A 2YWPA 4FMQA 4GFMA 4MD8E 3D5VA 1XR1A 4EOJA 5HLPA 5E8TA 4U79A 4D4YA 5LMAA 5AWMA 4JI9A 2X8DA 1YHWA 4MBIA 4CV9A 3W32A 2W9FB 4ZOGA 3UC4A 4E7WA 1PXKA 4JR7A 1SNXA 5CSWA 3W8LA 3QTWA 4MXXA 2C4GA 3HA6A 5AM6A 3QWKA 3ENHA 3ZEWA 3KC3A 4WBOA 5EHOA 3ET7A 4FF8A 3FQSA 2VTSA 3F3TA 4AZSA 2UW3A 5L2IA 1ND4A 3MI9A 4QYFA 2VWXA 4XP3A 3EL7A 2HW7A 3H9FA 4RVKA 5AEPA 3ORKA 4IBMA 3E93A 5A4EA 4S30A 2B9IA 2XM9A 2WTDA 4FICA 2RFNA 3Q4UA 2GQSA 1PKGA 2ONLA 3D5XA 3LFCA 3FLWA 3R6XA 4TYHB 2GS6A 3OBJA 4O91A 3WF6A 3Q5IA 4DEIA 3EQGA 2C47A 3FLZA 4H36A 4I94A 3TNHA 4AW0A 3W2QA 1MRVA 4ZY5A 3VULA 5ICPA 2HZIA 2QOOA 3AD4A 4CG8A 4AGUA 1OIQA 2R3RA 4O7LA 3ZSIA 4QP1A 2PZYA 4OBOA 4YURA 3CQWA 4A9SA 3G9LX 3F7ZA 3CPBA 3D0EA 1K9AA 3Q9XA 4BZDA 3BIZA 4JQEA 2ZMDA 2W1CA 5CEPA 4GT4A 5D1JA 3WYYA 5D41A 5D7VA 3QTSA 5LOHA 4R78A 3V5TA 2GTNA 3AC2A 2UW8A 3C1XA 4XBRA 4F1TA 1J1CA 1REKA 4XG2A 4KWPA 5LCJA 4FT9A 4YJRA 3I81A 3FY0A 4U9AA 1CKJA 4LGGA 2IO6A 2IZSA 3RI1A 2PMLX 4QMMA 4WT6A 1HOWA 5ANJA 4R3RA 4RWJA 2WTCA 3A2CA 2J51A 4G17A 4GFOA 3VWAA 5CVGA 4CNHA 3E7VA 4LGDA 5AV0A 3UNKA 3AC5A 3NR9A 2XRUA 3FI3A 4QTEA 2BROA 2C0IA 2ITUA 2OJ9A 1H8FA 1ZXEA 3KXMA 4BKZA 2P2IA 3BHTA 3R04A 4J8MA 4E6DA 5IEYA 4WKQA 3WBLA 4UMPA 3QLFA 4GSBA 2UVYA 3FV8A 4WNOA 4O2PA 2JFLA 3EFKA 3NEWA 5ETCA 2C6EA 1OIRA 1YRPA 4TXCA 2X1NA 4DEGA 4L7SA 2KULA 4RJ6A 2PPQA 5L6PA 3HUBA 4I6HA 4PPBA 4QQ5A 2OZAB 4I5CA 3DDPA 4H39A 4A07A 4LRKA 4YZBA 4IZYA 2X2MA 1I44A 4XG6A 4C2VA 4OBPA 3UE4A 2GNIA 2OFVA 5EHLA 4JX3A 2UZDA 1OL2A 5EM6A 4FKPA 2ZB0A 4LFIA 4EZ5A 4CKJA 5KNJA 4JG6A 1JAMA 3G0FA 3GENA 3QU0A 4FSQA 4OT5A 5CENA 4RZVA 3DJ6A 4GMYA 4FEQA 4AGCA 3U87A 4L01A 4QPAA 3P7AA 3HA8A 4EK6A 1JKKA 3FEGA 3POZA 4HZRA 1DI8A 2QNJA 2J6MA 4PUZA 3RAWA 1GIJA 4ANNA 3EFJA 4IVBA 4AS0A 3TNWA 1Q62A 3MH3A 4U80A 4FTTA 5C03A 5FTQA 4I23A 5FP6A 5AUYA 4CFVA 4M15A 2R3FA 2FVDA 3ZLWA 5HU9A 1J1BA 2WTKB 1O6KA 4M69B 1OECA 2HZ4A 4YGAA 2ZAZA 4B4LA 3Q6UA 5M51A 4UALA 2VV9A 5IF1A 3E92A 4DH3A 3O7LB 5T6KA 5GZ8A 3DLSA 3HP5A 3HYHA 4CT2A 2W5BA 3IGGA 5LVPA 3Q4TA 4MKCA 2GPHA 3MH1A 4OTRA 1FVTA 4R8QA 4ANLA 5K5XA 3OXTA 2FSTX 5CXZA 2OH4A 3GT8A 3R0TA 3U9NA 4DGOA 3PP0A 4EOQA 5DYJA 4O0UA 4BHNA 5BVOA 3WF7A 5DWRA 3LJ0A 2ITYA 4OUCA 1XQZA 4ACCA 3EQBA 3PJCA 4BCJA 4DG2E 5HLWA 4PDSA 4E20A 1H1RA 4J96A 3HMPA 2QOHA 2Z02A 4U41A 1OL5A 1KUTA 4J95A 4OLIA 3P9JA 4CT1A 4D9TA 2ZV7A 4ZTLA 5IUHA 5I9UA 5CEOA 4RA4A 4F6SA 1F5QA 4JT3A 3KXXA 1YHSA 3D14A 4PMMA 2XK4A 3TDVA 4RJ8A 3BLRA 3DU8A 3EQPA 1PRYA 3SC1A 2CSNA 4MD9E 2JDSA 3ZFYA 3QFVA 4G9CA 3UMXA 1RQQA 3MDYA 3QL8A 2IVSA 3ITZA 5CALA 5I4NA 4HW7A 3C0IA 5BPYA 3PRFA 1Q8WA 2E9VA 2ERKA 4CMUA 3L8XA 3GUBA 4C3RA 4IAFA 3ZC5A 3GVUA 4I92A 3KREA 1L8TA 3R02A 4AGWA 3FZTA 4ONAA 3EYHA 4LOPA 3C4XA 2VUWA 4XG9A 4ALVA 5LMKA 2VTHA 4FKSA 2PZPA 2PZRA 4IM2A 4GW8A 4YSJA 3F3ZA 3F2AA 4CEGA 4FT3A 4IHPA 2YZAA 2UZTA 3O8TA 3ZC6A 5BVNA 2BCJA 5HCXA 2ITWA 1RDQE 2A19B 3QTXA 2OK1A 3MESA 2HWOA 2BIYA 4D1XA 3PVWA
chains in the Genus database with same CATH superfamily
5L2SA 4L52A 4LI5A 4X3FC 2XKCA 4BCPA 4AXFA 4BFMA 4RIWB 4M12A 4CQEA 2R3IA 2XJ1A 3AMAA 4FUXA 3UZTA 2BDFA 2IJMA 4NM5A 4BVUA 5LVOA 5LARA 3UIMA 3Q9WA 4LOOA 3ZFMA 3UYTA 3QYWA 4LL0A 2WMBA 2VX0A 4DLIA 5A6OA 1E1XA 3KXNA 3NNXA 4TWNA 4CSVA 2OFUA 1M7QA 4OTWA 2R4BA 4X2FA 1A06A 4BDJA 3S4QA 4YBJA 4EYJA 3BQCA 3NUXA 4C7TA 3HZTA 1U54B 4F9WA 4C34A 4IVDA 5IU2A 5C1QB 3QKLA 4MNEA 1G8JA 4HGLA 4ZJJA 3ERKA 2PYWA 4BIEA 4C59A 1ZYLA 2BIKB 3FMDA 3PZHA 1T45A 3R28A 3MGYA 4L42A 3QWJA 5CANA 3GBZA 4QYGA 4FV0A 3U4WA 3PFQA 2QI8A 1W0XC 3UMWA 3R9HA 4Z9LA 2YIQA 4UWBA 4QMLA 3ZSHA 4A9YA 4TTHB 3EH9A 2JFMA 2WQNA 3I5NA 3IW6A 3FWQA 3GGFA 3NVMB 2UZEA 2W17A 4AAAA 3L8PA 3VUMA 1MQ4A 3VS6A 2R3QA 5D7AA 3G0EA 5E8YA 4NJDA 4F9AA 2VN9A 2Y7JA 3ATSA 2XEYA 4GIIA 4KD1A 2B9FA 4G2FA 3NYXA 4BCIA 3OW4A 3P23A 1UNLA 4TPTA 1ZZ2A 2E9PA 3E8NA 3BHVA 3ACKA 2DYLA 4DGNA 1OB3A 3NSZA 3TKHA 4C3FA 4JBVA 3BV2A 2ITNA 2C69A 4ZK5A 3HMOA 3DBEA 4CMOA 4YTHA 4RIXB 1FBNA 2CKEA 5LJJA 4WRSA 4PY1A 5BUIA 4BN1A 4DT8A 1BI7A 5AR8A 3MW1A 4FSUA 4QQTA 4FSRA 3VC4A 3ZCLA 5I3RA 2YCQA 2W9ZB 2VWYA 3ORZA 1JPAA 4NM7A 4RPVA 2CNUA 2ZV9A 4FTIA 4BWPA 1OPLA 1SMHA 3SG8A 5KZIA 2J7TA 2DWBA 4EH9A 5AUVA 4BWXA 3SRVA 2IVUA 3NFFB 4F9BA 3ZO2A 2BTSA 4UWCA 3BYOA 4LGHA 3VUGA 3U55A 2BKKA 5DH3A 4OTDA 4PL4A 2WTIA 2C6MA 4AG8A 2HELA 5CF6A 3QTZA 5J1WA 2Z8CA 2HCKA 3RM7A 4FKVA 3QRJA 4TN6A 5TF9A 3PWDA 4O0VA 4UB7A 2C30A 5C27A 4RX7A 4EBVA 3F61A 2XIKA 4JDJA 4IX3A 3NYVA 1U4DA 4QMUA 2OXXA 3IK3A 1W7HA 4YJQA 5G1XA 3VBXA 3OWLA 3UOKA 2YDKA 2XUUA 3KY2A 4RWKA 4EUTA 3ZS5A 2OLCA 3ELJA 2UZWE 3NCGA 4FTAA 5HO6A 3WZJA 3BI6A 5HZNA 3VS5A 1O6YA 5HI2A 4F99A 2ZYBA 4ERKA 3PRIA 3R8UA 3CLYA 4L6QA 4B9DA 3OZ6A 4G6LA 3R9RA 4HNFA 2Y4IB 5HIBA 5CEMA 4EH4A 4DF3A 2BTRA 3VVHA 3PPKA 4IVAA 1Z57A 4XUFA 4EZ3A 1M2RA 1YWRA 4YO6A 4NU1A 5FGKA 4AN9A 2BFXA 1MRYA 3OWJA 4WIHA 1H0WA 4XV3A 5HNGA 4R3CA 4A9RA 2W4JA 5B7VA 3EN5A 3BHHA 2WO6A 3I1AA 4YJVA 4MXZA 2WTVA 3LXLA 3PYYA 5HBHA 3R71A 4ZZNA 2BAQA 5F94A 3V5PA 3GC0A 3GU7A 2A27A 2R7BA 2PUIA 1KE5A 5E8VA 3ZZEA 4QP9A 4QNAA 5DE2A 5EOLA 5E91A 3KCKA 4FTQA 3ZLXA 4AUAA 4I3ZA 2X4ZA 4DYMA 1Q99A 1NVQA 1V0OA 3B2WA 2Y8OA 3FI8A 1ZZLA 1QPCA 5JGAA 3FAAA 2YA9A 2XP2A 3QHWA 4AW2A 4F78A 2XANA 2J0KA 1UU7A 1STCE 3Q96A 3UBDA 3MFTA 3V8TA 1H0VA 1YI3A 2BUJA 5KMOA 2ZM4A 2OXYA 5EG3A 3HRBA 2QG7A 4CGAA 5HICA 4QTCA 4ACHA 2OJGA 4MF0A 3GP0A 3V5QA 3ZUTA 4AT5A 3UIBA 2PK9A 1LUFA 4F65A 2PSQA 4FV6A 4E5AX 2F7XE 2WEVA 4MCVA 5HOAA 3I79A 1FPUA 3V6SA 2PE0A 1UNHA 4IM3A 4YR8A 1ST4A 5KKRB 5M56A 2J0LA 3PP1A 5DG5A 4BRXA 4B8LA 2QG5A 4IH8A 3PJ3A 2PUUA 3F2RA 4XG7A 4LV7A 3MYGA 4X6RA 4ZZMA 2WMXA 3BYSA 4BKYA 4L7FA 3AKLA 5I9ZA 3DK7A 3DTCA 5HD7A 3LJ2A 3UZPA 2JDTA 4L8MA 4C02A 1OI9A 3QQHA 3KMMA 3NUYA 4FV8A 1WMKA 4NM3A 4DFZE 4DDGA 1TQPA 4QYHA 5FWKK 4U3ZA 5B2LA 4AF3A 4BIDA 2QOKA 3R63A 2V62A 1R78A 3LXPA 2IG7A 3VUDA 2OO8X 3MVLA 2Z7SA 3P4KA 3GQIA 5AUWA 4BCKA 5IEXA 2OIBA 4HVSA 1TVOA 1RE8A 4IWQA 1FINA 2GDOA 3V6RA 3PIXA 4I6QA 4QP7A 5AP2A 5HE2A 3RWPA 5ANOA 5AR4A 2GSFA 3NZ0A 3FC1X 4GIHA 3E88A 3EQFA 4XYFA 3P0MA 3QTRA 4AA5A 5IQIA 1ZLTA 2NRUA 4W4YA 3U6HA 4BR3A 3DY7A 3HL7A 2Y4PA 2PUPA 3C0HA 4ACMA 2PVMA 4KKEA 1GOLA 4S33A 2QU6A 2IVTA 3PVBA 2UW4A 4M67A 4DHIB 4IFGA 3VO3A 1M14A 2GNGA 3LMIA 2A0CX 4O0WA 5BMSA 2W5HA 4U45A 5FBNC 2QOBA 1JKLA 3KULA 3ZUUA 1S9JA 5HU3A 3MVHA 4EHZA 4AFJA 4BTKA 2R0IA 3REPA 5KX8A 2UW6A 4MBJA 1P4FA 2SRCA 2WKMA 4DITA 4ANOA 3OCBA 3Q52A 3N4UA 1FMKA 3EQRA 1YOJA 5CX9A 3D5UA 5AIKA 3QA8A 3F5XA 3MY5A 4W4XA 4ZTMA 3C4ZA 3SLSA 2VZ6A 4UMQA 2FSOX 4I24A 4C4GA 2WGJA 3WZEA 3NNWA 4PDOA 5AUZA 2W5AA 5IQHA 1PY5A 4WA9A 5CAQA 5J9YA 4GH2A 4U5JA 4PX6A 2V7AA 3VBYA 1IAHA 5AR7A 2PVLA 3FMHA 4L43A 3VJNA 4O0TA 1REJA 3F3UA 3FE3A 3GU5A 4CKIA 2R3KA 4H1JA 4BL1A 4KBKA 4DGLC 4O4BB 3AOXA 5HTBA 4II5A 5DR6A 2EB2A 4E6AA 3DJ7A 3NAYA 4ZP5A 5IQBA 3PVUA 2J0MB 5E8ZA 3RINA 2PVKA 3FY2A 3P86A 5JGBA 3BBWA 4JL9A 4RWLA 2WMTA 2HENA 3MA3A 4FL1A 4NFNA 4ALUA 4FT7A 3O8PA 5E92A 5HKMA 4DDIA 2VNWA 5ETAA 2W4OA 4YU2A 1PXPA 4DG0E 2CGVA 4O21A 4YLKA 4HGEA 5CT7A 4B6LA 4A9TA 5IA1A 4ITJA 2E9UA 2QKRA 3R2YA 4CFWA 4BI1A 5LWNA 4FNWA 3F3VA 3W2PA 3EB0A 3HMIA 3LCTA 3V8WA 5J1VA 1CKPA 2F49A 2JKOA 4UZHA 4XOYA 4BB4A 5JK3A 3FL4A 3KVWA 5BVDA 2IW9A 3FMJA 4DEBA 2PVHA 1JSUA 2BAKA 3R1SA 5H8GA 3UDSA 2VTPA 3QUDA 2UV2A 4OGRA 4DEDA 4E1ZA 2AYPA 4TNBA 4IZ5A 1YWNA 3FXXA 5AP5A 4DGGA 3G51A 3D83A 3GCVA 5BYLA 1P14A 2PVNA 4KIPA 4AAYA 3K5VA 4XOZA 4RGJA 2OF4A 4LRJA 1J91A 3BGZA 5HE1A 5C4LA 3PDTA 3W8QA 4D2PA 4L45A 5AFVA 3EZVA 3VRYA 5F20A 3CE3A 4C4IA 2GHLA 1GZOA 3K3IA 5KMJA 4FTKA 5BV3A 2X2LA 5EI6A 4EK4A 3PY0A 4RC4A 4YC8A 4BI2A 4CV8A 4Y5HA 1JKTA 3MPAA 3DXQA 2B9JA 3KL8A 3OEZA 5HG8A 2VWIA 1GNGA 3I0QA 1FGKA 2JC6A 3KRJA 4YLJA 4IEBA 2ITQA 2B52A 3C0GA 4AQCA 2IW6A 1R3CA 3I60A 1M2PA 5L3AA 2YITA 3FHIA 2YLEA 4KIQA 5HNBA 2WNTA 3W55A 5KHWA 2CNQA 3ZO3A 4EUUA 4FKUA 4O0SA 2F7EE 3PSCA 4XLVA 1KWPA 2VWWA 3PE1A 4OTQA 5DI1A 1PHKA 2WQMA 3DBCA 4IE9A 5EDQA 4XG3A 4D9UA 1PF8A 4E6QA 1OPJA 4RJ5A 3IG7A 1J7UA 5M4UA 4YTFA 4PRJA 5BUJA 2X0GA 5BNJA 3DLZA 3LZBA 5ITAA 4YJTA 3FPMA 5BMMA 3R2BA 4XRJA 3VIDA 4AXCA 3V5JA 4DTKA 3CXWA 3F66A 1OGYA 3ZDUA 3RHXA 4I0SA 2Q83A 1Q24A 2GHMA 5KBQA 3VBVA 1OVEA 4NW5A 4FV2A 4GCJA 4XHKB 2EWAA 2GQGA 4RX9A 4HPTE 1WBVA 4JBQA 5CSPA 2VGOA 4FKIA 4QTDA 4L67A 4QMNA 5JRSA 1Q5KA 4I6FA 3A7FA 1XH5A 5I0BA 1Q8TA 1JQHA 2GFSA 4TYHA 4FZ7A 4D4RA 5CZHA 3GEQA 2XYNA 4AZVA 4CLIA 1SZMA 2B54A 4JR3A 1H1WA 1SNUA 2WQEA 1OGUA 1FMOE 3D15A 3EYGA 3GU4A 3P5JC 4FTUA 1TQIA 3ALNA 4MAOA 1ZAOA 1XBBA 1TQMA 5CVHA 3OWPA 3QTUA 3FKOA 3W16A 1Y57A 5F1ZA 2YAKA 3QUEA 4ZXTA 4H1MA 3BE9A 4Y72A 1IG1A 5ANDA 5JFWA 1PMNA 2B7AA 4U3YA 2PUNA 4FV4A 5A3XA 4MF1A 2JEDA 2WELA 4Q9SA 4R5YA 1GZ8A 4RT7A 4RWIA 4D28A 1BMKA 3QD4A 4UN0C 4DFBA 2FYSA 4EC8A 1QPDA 4MTAA 4UYAA 5BVEA 4TWOA 1U5QA 4E3CA 4E73A 4JBOA 3SXFA 4X3FB 1Y6BA 2BAJA 3LM5A 3O50A 4YP8A 2OGVA 5C26A 3JPVA 3MVMA 4J99A 4MXCA 4XP2A 4YC6A 1FOTA 5DEYA 4AT3A 4EKLA 3LE6A 2CNVA 3DKGA 2YM8A 5EKNA 5H8BA 4QMZA 4UMRA 4F6UA 2X9FA 4S32A 4WUAA 4JVGA 4RJ4A 3NRMA 3UO6A 4F1OA 3PG1A 4D2VA 2C68A 2H8HA 2WU6A 3A7IA 2W1ZA 5ETFA 4ZMEA 2BZHB 2ETMA 3FZRA 4J98A 5HE0A 2PULA 5FP5A 3D2IA 4USFA 3W0QA 2Y0AA 3WYXA 3O2MA 3SOAA 5AV1A 4J71A 5H9BA 2C6TA 3E64A 3KMWA 3VUTA 5M44A 3QTQA 4MBLA 5IH6A 2NPQA 2OZAA 4D5KA 2XB7A 3LQ8A 4WHZA 1YXTA 3UIXA 4MXOA 5CLPA 2C5XA 4GVAA 5EW9A 4Z7GA 5IPJA 1IA9A 4B0GA 3MPTA 2QVSE 4I22A 5K0KA 3FZOA 4RG0A 5AIRA 3VS1A 5JFXA 5FTGA 3ZRKA 5HEZA 5CT0A 4DHZA 4CFFA 1IA8A 2VO7A 4FTJA 5DA3A 2WMUA 3AC1A 2CN8A 2B9HA 4YNOA 1I09A 4BGQA 4DC2A 1OKYA 4NTTA 2O64A 4NIFB 4BTJA 1YXUA 4P7EA 4BBMA 4DH1A 4AFEA 4E5WA 1NA7A 4AXEA 3OOGA 2VX1A 1LEZA 2JKMA 4QNYA 4Y95A 4IFCA 4M69A 4EOLA 1Q3DA 4HVIA 4HYUA 4P5ZA 4PMPA 3DKCA 2C6IA 2XK3A 2JDOA 2YIYA 2YIXA 3COIA 4MYGA 1PXJA 4NFMA 3QZGA 5HVYA 5IA0A 5IH5A 3LCSA 3VONA 1KE9A 4O7TA 2RFDA 4TYIA 5ANGA 3HUCA 2UUEA 3Q9ZA 2XKFA 4BI0A 3L8SA 4G1WA 4FT5A 4O81A 4JS8A 4JRNA 5HVKA 4IZAA 4WSYA 3KCFA 1H4LA 4NEUA 5IMXA 2CGXA 3VF8A 2IEWA 2OIDA 4D1ZA 5E1EA 1VZOA 3DFCB 4HZSA 1Y8YA 3QF9A 3SD0A 1YHVA 3FZ1A 3SQQA 4LRMA 2WXVA 3ZSGA 3EL8A 5AJQA 5KMIA 2ZOQA 4F0GA 3QCYA 5K4IA 3R22A 2UZVA 5AV4A 3PPJA 4WG4A 4BYJA 3R8PA 4FSTA 3HX4A 4UWYA 3W0MA 2A98A 3CS9A 4F7JA 3OXZA 3IDCA 3D5WA 4TWCA 2V0DA 3KN5A 4NCTC 4W8DA 4EH8A 5J5SA 4FVPA 4O4CA 3MIYA 4KS7A 4S34A 3K54A 5A14A 2PVFA 5FEEA 4BDAA 2P55A 2W1GA 4RLLA 1BL6A 4EJ7A 2XEZA 4R1VA 5DVRA 4R7IA 4C35A 4ZMFA 2JBPA 4WG5A 3RM6A 3Q3BA 4E4LA 1H1PA 1X8BA 2X8EA 2XA4A 3HLLA 4ORKA 3NAXA 1ATPE 4EH5A 3UODA 3FXWA 4BBEA 4QMQA 5HTCA 2GNHA 4N6YA 1IAJA 3TIZA 3CY2A 1KE7A 3VHKA 3T9IA 5BVWA 4EOMA 5JSMA 3LFSA 5FUTA 2YISA 1PMEA 3Q4CA 3Q6WA 4G34A 4WNMA 4BDCA 3OBGA 4IWPA 4KRDA 5AA8A 2QO9A 4DH7A 1BI8A 5HX6A 3LFQA 4IXPA 3S0OA 4FR4A 1YWVA 2QOLA 4RIWA 5FQDC 3VS3A 3DA6A 1W84A 4FKJA 5DN3A 5A4QA 4BDKA 4TNDA 1ZYCA 3E62A 4O22A 2BRNA 2IVVA 4FX3A 3R7VA 4M84A 4BGHA 2X8IA 2BZJA 2YFXA 4JDIA 3FUPA 4F9YA 2Z7RA 4WG3A 1URWA 2HWPA 5CNOA 4YLLA 4BBFA 3CEKA 4C62A 4DN5A 4GKIA 4MWIA 3ZO4A 4AXDA 1APME 3BQRA 2Y9QA 4EORA 1H1SA 5EM8A 3W0PA 5L6OA 2CCHA 4RC3A 2E9NA 3ML1A 1U54A 3SAYA 5EFQA 4ZTNA 2VO6A 3NNUA 4NTSA 4QMXA 4DGMA 2BPMA 2HIWA 3H10A 4ARKA 2QLUA 3UG2A 4FSYA 5C8NA 2CCIA 3IKAA 4KA3A 2UW9A 4IB1A 4YUQA 2YM4A 3JUHA 2X7FA 2WMVA 4FTNA 4Q9ZA 4IACA 2REIA 2XALA 5IQFA 3MY1A 4JDHA 4M97A 5A6NA 2OW3A 4BICA 3HNGA 5TE0A 4FC0A 4FV5A 4F09A 1W98A 2I0VA 2XAMA 1XH6A 2B4SB 1CTPE 4AE9A 4NM0A 4ASDA 2R9SA 4D0WA 5AX9A 3O51A 3U4UA 4P4CA 1MUOA 4FK6A 3BL9A 3LLTA 4K1BA 3ACJA 4N57A 3RPSA 3WOWA 3LM0A 3CJGA 2V22A 3DBDA 4XX9A 2EU9A 3DNDA 4MQ1A 3BE2A 5DIAA 4FG9A 4N0SA 2OJIA 4BCHA 5KHXA 3Q53A 5CWZA 3QRIA 3TNQB 3U54A 3ORIA 4KSPA 4RIXA 1XJDA 1PKDA 3DQXA 5HBEA 2XIYA 2XNBA 4FV1A 2DUVA 3MWUA 1RJBA 4MNFA 5CASA 4FT0A 3TIYA 4DBXA 3VNTA 2OWBA 4GT3A 5FXRA 5M4CA 4MHAA 4ZSEA 3EFWA 4C0TA 4CFMA 3V01A 5H2UA 4FSZA 2XF0A 1H25A 4EHVA 2OKRA 4HYSA 2JIIA 2XH5A 3TT0A 5FEDA 3HDNA 4FKWA 3PUPA 3WZDA 1F0QA 2RFEA 4KBAA 3ZMMA 5EI2A 2XK7A 4I41A 3WIKA 4RQVA 4PDPA 3GC7A 4Y85A 1ZYDA 2GMXA 3RPYA 1H01A 2BMCA 5ANIA 2G1TA 1IRKA 1KE8A 3PJ1A 4EZ7A 5IA3A 2VD5A 4WRGA 4NUSA 4L9IA 1XBCA 2JDVA 4NWMA 4RX8A 4I4EA 3DOGA 2VWZA 4KSQA 4FIGA 4FIEA 4C37A 3CSVA 5M08A 4BCFA 1KOAA 2WMRA 3QYZA 5B2MA 4G31A 2HY0A 4FV3A 5M06A 1WBSA 1YXSA 4O4FA 2XJ0A 5CF5A 3H0YA 4IAYA 3IOPA 5EW8A 4GG5A 4O38A 4C8BA 3R9DA 5L6WL 5LMBA 3BLHA 4TYJA 1BKXA 3MPMA 2QHNA 3RPVA 3P78A 5EYDA 1UWJA 5C9CA 3RALA 2ZVAA 1YDTE 3KF4A 2G2IA 3HV6A 5L8JA 4B99A 2YZLA 2HY81 4LMNA 1JVPP 4O7WA 3PY3A 4P5QA 1ZMVA 5E8XA 1OUYA 3R7GA 4FNYA 3WILA 3V8SA 3ORLA 4AZWA 3CR0A 2VTIA 4YZMA 5EYMA 5IG1A 3DDQA 4ZTHA 2CLXA 1WBOA 3QQFA 2J0IA 4KABA 4FL3A 3UGCA 3UQCA 3F6XA 3ALOA 5CYIA 4BDDA 3WE4A 2I7QA 1UVRA 4FNZA 2A2AA 1U59A 5KMLA 1MRUA 2YHVA 2GTMA 2YN8A 4QP4A 1VJYA 2UW0A 2JD5A 4YNEA 3CTJA 4G5PA 1FVRA 3GFEA 2C5VA 4KB8A 4ZZOA 4IQ6A 1W2DA 3MFSA 4BZNA 3RWQA 3TCPA 3Q4ZA 5IA5A 2X39A 4LMUA 4XV9A 1H28A 3OC1A 4FODA 4BDFA 3QC4A 3KKVA 5HX8A 4PTCA 5DGZA 3ANRA 4CYIA 2W1DA 4GUBA 4O0RA 5J8IA 3V5LA 4O86A 4YJSA 5EQPA 4JNWA 3TM0A 1ZMUA 4FA2A 4YJNA 5AV3A 2OBJA 3QD0A 2UZUE 3B8QA 4EK8A 1SVHA 3PA5A 4EI4A 2PMIA 4I1ZA 4IWOA 4MQ2A 4RX5A 2CDZA 4NW6A 4GV1A 3R8VA 3FI2A 3BV3A 2PMOX 4Y5QA 3UC3A 2VO3A 3CKWA 3TN8A 5I9YA 4O1OA 4U6RA 5EQEA 3IW8A 3TZ9A 4C61A 3VS7A 3KRLA 3A7HA 3UPXA 4D2RA 2WFYA 4R3PA 2AUHA 3FZSA 2X0PA 4OTPA 4JIAA 4LL5A 2FSMX 2ITOA 3N4VA 4GEOA 1GZNA 4FKRA 1FVVA 2Z60A 3M11A 3IS5A 4IZ7A 5M53A 2G01A 5E8UA 2VRXA 4F70A 4FKGA 3A62A 3HAMA 4FJVA 3MN3A 3VRZA 3ZRMA 2RL5A 3MS9A 4DH8A 3C51A 4D0XA 3LOKA 3T8OA 5A46A 2HXLA 2B55A 2BALA 2Z2WA 5D12A 3CD8A 1DM2A 2UVXA 2XBJA 3I6WA 2R3PA 1Q3WA 2VTJA 3OCTA 1Q97A 4I5PA 2QR8A 1YVJA 3MFRA 4IDVA 4YPDA 4EBWA 4JAIA 4BJJB 5AMNA 4DFYA 3ANQA 1H1QA 1UNGA 2O0UA 2I40A 4AE6A 4CXAA 3HVCA 1XH4A 4AW1A 3A60A 5CY3A 4ZSGA 4EJNA 3DKFA 3KRXA 3MBLA 2VNYA 3MTFA 2ZMCA 1H08A 3LXKA 2VAGA 4TWPA 3TUDA 1R1WA 3H4JA 4PTEA 5BQ0A 5JQ8A 2GNJA 5KO1A 5AM7A 3UNJA 4UXLA 4ANQA 5D10A 4DH5A 3F7WA 5JGDA 4RIYB 2C6KA 3R9NA 3THBA 3DPKA 5KMKA 2JITA 4BGGA 1G8SA 4OT6A 3BWFA 3KGAA 2EB3A 1NY3A 2PHKA 3PXQA 5D11A 2OICA 1UKHA 3JVRA 3Q5ZA 4FTOA 1H07A 4K6ZA 1Q4LA 1YI6A 4MXAA 4RA5A 5FTOA 3MSSA 4QP2A 3TNPC 3NLBA 1CDKA 2VO0A 5JRQA 2O2UA 5HCZA 3KN6A 3DBFA 1ZOHA 2CMWA 5FM2A 3AC4A 3ZM4A 1A48A 4RVMA 2HZ0A 2WMSA 3FMEA 4FV7A 3UQGA 4F64A 3OVVA 2QO2A 4CFNA 3QBNA 5E8SA 3LQ3A 4CYJA 4H3PA 1JSTA 4JIKA 5GNKA 4CD0A 3VW8A 2ETRA 4Y83A 4FTLA 2PY3A 2WAJA 4BIBA 5J87A 3UOJA 2G2FA 2R2PA 3GCQA 3F9NA 4Y46A 2YCSA 3BPRA 5HIEA 2QHMA 2WOTA 4E8AA 3PSBA 4FUYA 3CGFA 3BZ3A 4DFNA 3QCQA 5HO7A 4PPAA 3LJ1A 3EKNA 5HE3A 2O8YA 2OJFE 1G8KA 4ITHA 3WZUA 4WBBB 5BYYA 4EH7A 4EKKA 1PXOA 4MUQA 5BX0A 5KMMA 4QRCA 4L68A 4V0GB 3OROA 4KAOA 4XV2A 4RSSA 4U8ZA 5AUTA 3BCEA 3DK3A 4CVAA 4FYOA 4I21A 2W1HA 3AC8A 4U97A 4W9XA 4FTRA 4ANBA 3UNZA 1G5SA 3BHUA 5HO8A 4O96A 3ZLSA 1WBPA 4ZLZA 3JY9A 4B7TA 2EXMA 1QL6A 2RF9A 4WNPA 3QQKA 1TZDA 3LFEA 4X6QC 4F7SA 5HG9A 4BCQA 3FLYA 2O63A 4FL2A 3QC9A 4BCNA 2XIRA 1Y91A 1ZYJA 3ENMA 5E1SA 4TZRA 5ETIA 2PWLA 3D2KA 3FQHA 3MIAA 4U43A 3DZOA 3ZYAA 4X3JA 4JX7A 2X4FA 3E87A 1W2FA 3SVVA 2PVRA 3FLNC 3G2FA 1ZYSA 3NCZA 4A9UA 5CAVA 3DBQA 5FDXA 1G3NA 4HGTA 1OIYA 2GS2A 2GFCA 4XJ0A 3MV5A 2KTYA 5CQWA 1PXLA 2UZBA 2VTQA 1M2QA 2XK9A 2W1FA 4EOIA 2Y6MA 3O0GA 2ZV8A 2IW8A 4HVDA 3EKKA 3NIZA 2QLQA 3OOMA 4IB0A 4U7ZA 4AT4A 4AZFA 3NYOA 3EFLA 1KE6A 4M8TA 4C38A 2BKZA 3C13A 3KFAA 3PA3A 5G6VA 5CAOA 4UZDA 3OHTA 2VWVA 3HEGA 3EQDA 4U0IA 5LQFA 4CRLA 1KV1A 4ACGA 3CC6A 3KK9A 4N6ZA 3FYJX 4C4JA 4R7HA 2XBAA 3CGOA 4EH6A 1XH8A 2IWIA 4W4VA 2OJJA 3DXPA 5IQDA 4NH1A 3LXNA 4B8MA 3C4EA 2HK5A 3QD2B 4PP9A 4RFYA 3WIGA 1QMZA 1BLXA 3VJOA 5CU0A 3IPHA 4USDA 4I0RA 5J79A 5GINE 4FZFB 2R5TA 2CHLA 1GIHA 3F69A 3QGYA 3NIEA 2JLDA 4KIKB 4DFUA 3ZFXA 5AR3A 4YZNA 4NT4A 2BRGA 3SOCA 4BZOA 2P0CA 3V3VA 2WPAA 4CTCA 2ZV2A 3IQ7A 2JDRA 4FKQA 3ROCA 4DINA 3S3IA 3R7UA 3N51A 2X7GA 2W7XA 2WMWA 3HDMA 5KCVA 2CKPA 4X2NA 4M0YA 2JIUA 3IW7A 4Y8DA 2W06A 5GIOE 2JAVA 5E90A 2PE1A 3KMUA 2PVYA 4KNBA 3P1AA 5GZAA 3V5WA 3TDWA 4FIJA 2BZKB 3QCSA 3IOKA 4IAAA 2G9XA 2R3OA 3K3JA 4DHJA 2C6DA 2Y6OA 5F95A 3AD5A 3ZXZA 5FBOA 3LCKA 2YAAA 2X0OA 3PXKA 3QAME 4IW0A 4H3BA 1H27A 2XK8A 3JXWA 4LUEA 2QD9A 2XZSA 5AUUA 4BDHA 4YHFA 2ZB1A 1YOMA 2WIPA 3MA6A 2VTRA 5JKGA 5K9IA 3MJ1A 4PQNA 3OF0A 3KRRA 4HCTA 3PJ8A 3UP2A 4XMOA 4X3FA 4LOQA 5DT3A 2P4IA 3ZDIA 4EQCA 1O9UA 5CF8A 1JKSA 2F2CB 4FTMA 5CI7A 3KXHA 2HYYA 3DFAA 4ITIA 4Q2AA 3TV4A 5M07A 3F5GA 4GU9A 5TT7A 4FEVA 4HCVA 3W2CA 3H0ZA 3OEFX 5HQ0A 3L8VA 5LMKC 2Z7QA 3UQFA 1XH9A 4Z55A 4ZEGA 5J9ZA 4FZ6A 4I20A 4UMUA 5AAFA 2QU5A 3IECA 3ZXTA 5IMEA 3L9LA 2VU3A 3FQEA 3POOA 3A8WA 3TJDA 1XMLA 2XIXA 3T9TA 4WO5A 2ZFYA 2NP8A 3CBLA 3QLGA 3LAUA 3QQUA 4EOSA 3RAHA 2CLQA 5IQAA 1WAKA 4NK9A 5KMNA 5LWMA 2VTNA 3UO5A 3RCJA 5IISA 3W0NA 2JKQA 4O7ZA 4O6EA 2I1MA 4XH6A 2GU8A