3DKOA

Complex between the kinase domain of human ephrin type-a receptor 7 (epha7) and inhibitor alw-ii-49-7
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
275
Chain Sequence
TYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 7
publication title Kinase domain of human ephrin type-a receptor 7 (epha7) in complex with ALW-II-49-7
rcsb
source organism Homo sapiens
total genus 85
structure length 275
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dkoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dkoA01
3ZBXA 4L01A 5AWMA 4EK8A 3FQHA 2BTSA 2JAVA 5BMSA 3FMJA 4TZRA 3UOLA 5CEOA 4EHZA 5D12A 4BDKA 2EXCX 4D2PA 2H96A 4E3CA 1MRUA 3GQIA 2XNGA 2YJSA 3WYYA 1Q41A 3TTJA 2WMQA 3LVPA 3MY5A 2JDRA 4G9CA 4BC6A 5CU3A 4CKJA 1OIUA 2R7IA 3A8WA 5GINE 5IQAA 5CEKA 4DFBA 3F3UA 2SRCA 4QMMA 3CQWA 3KL8A 5G6VA 3MFRA 1LEZA 1SNUA 2X9EA 2R4BA 4FT9A 2GHLA 2XNEA 4C8BA 4YZBA 4GU6A 3EH9A 3W32A 1Q8WA 3ZXZA 4WNOA 3BELA 1YI4A 4AWIA 5AUYA 5LJJA 2P4IA 4IZ5A 2OXDA 4P5QA 4ZS4A 2UW9A 4CLJA 2BUJA 3EQDA 2GSFA 5HBHA 3ORNA 2BFXA 3CBLA 3NLBA 5D11A 1E9HA 2Z02A 1OL7A 4Y5HA 3W2PA 3QFVA 2WTVA 4C3FA 1YXUA 3QCQA 5CAPA 5GIOE 3UYTA 3MW1A 3PJ3A 3C13A 5CQUA 2WQEA 1OKYA 4JIAA 3O2MA 4HZSA 3PP1A 2YACA 3UVQA 5CF5A 1PF8A 4GK2A 4C62A 1SVEA 3KFAA 2ZV8A 3ZO4A 3PY1A 4E6QA 4GCJA 2F7XE 3UOHA 2J51A 4G5PA 3VW6A 5HE2A 4RWIA 4M14A 4OTFA 2R5TA 3PSDA 5A6OA 4LM5A 2F57A 2VTHA 2PULA 4AU8A 2WQBA 3NUSA 5LQFA 1H01A 5L4QA 3QBNA 3ORZA 2HZNA 4MD8E 1Q62A 2J6MA 4QP6A 1UU7A 3MJ2A 4TWOA 4K9YA 3ET7A 4JG6A 4NCTA 3IDPA 4BHZA 3T3UA 4D2RA 4U80A 4KIKA 1FINA 3R1SA 2C5VA 3D0EA 4B9DA 2X7OA 3L8XA 4AA5A 3D9VA 4X2GA 4OBPA 3LIJA 2Q0NA 4EJ7A 1R78A 2QOIA 3RZBA 4O7TA 1JNKA 2IW9A 3C5UA 3LFEA 5J9YA 3MVMA 2O2UA 3TUBA 4QMWA 4LRMA 4NFNA 3VN9A 2QG5A 3W18A 3P7CA 1GZNA 3BLHA 4QMOA 4AZSA 4DH3A 3VRYA 3F69A 3MBLA 2CCIA 2QOOA 4IFCA 3E8EA 3BZ3A 3D7TB 4WRSA 2OK1A 5HLWA 5IA2A 5E91A 3PIZA 1WVWA 4QO9A 2Z7LA 2IW8A 2RFEA 3EHAA 4XG4A 5EOBA 4CFWA 4HVSA 3PWYA 4FV5A 4ZTLA 2UW0A 5H8EA 1XWSA 2W06A 2C68A 4B0GA 2PZ5A 2JLDA 2OGVA 4QPMA 1NVSA 5CTPA 3PP0A 4QNAA 4AW1A 3ATTA 3C5IA 3TL8A 4OTDA 2G2IA 5DFPA 2JFLA 3OT8A 4L45A 5FTGA 4MNFA 5ANGA 3UO6A 3W2OA 5AUUA 3VQHA 5HU9A 4X2KA 2XJ1A 5HE0A 3OFMA 1ZYLA 3MH3A 3HX4A 3BGQA 2UW6A 3KA0A 2XUUA 3OT3A 2WMXA 3PXFA 5I5ZA 3CS9A 4DEHA 4IHPA 5BUEA 1AD5A 3NUYA 5CVHA 4QT1A 4ZMEA 4AZVA 3DBFA 4OGRA 1BLXA 2FVDA 2C5XA 3U6IA 3UPZA 2RG5A 5EHYA 4X2JA 4DEAA 5IU2A 4IXPA 5CQWA 5L2IA 4TWPA 3ITZA 4BTKA 3SX9A 2YDJA 1B38A 2OH0E 3TDVA 3NNXA 3UNJA 3IGGA 3FXWA 2X8EA 5H9BA 4EOPA 4DTKA 4AGUA 2CKEA 5FRIA 4YO4A 4RX5A 4X2NA 1UWHA 3UMXA 1OL6A 1R0EA 1NVRA 5HNBA 3UO5A 1JOWB 3Q2MA 3TNHA 3NDMA 4ZTRA 1VYZA 4ZJIA 4ZTHA 2Y7JA 3W33A 4KNBA 1MRYA 4QD6A 3U6JA 4DT8A 3DXNA 3JVSA 3EN5A 1G8SA 4IVAA 2XYUA 2Z60A 3ELJA 5JGAA 3QRUA 3EFLA 3GQLA 4LRKA 4BN1A 2UZUE 4BR3A 4V01A 1YWRA 4CMOA 5DEYA 5HO8A 3S95A 2QOQA 4FG9A 4FKUA 2CKOA 3FL4A 3H3CA 4QMYA 4O7LA 2R9SA 3FI4A 5FBNC 2FSTX 4PMTA 3MA6A 3LCSA 1SZMA 4K1BA 2VN9A 5DPVA 3KXXA 5T3QA 3QALE 5CVGA 5LWNA 3K2LA 4ANQA 4BCMA 2V62A 4EZ3A 3OXIA 3UZTA 4N57A 4ZZMA 1W84A 2XRUA 3TDWA 2B0QA 5KMNA 4D9UA 4O7NA 3DXQA 4D2SA 3MYGA 3TACA 1LEWA 3ORLA 3W1FA 4GV1A 4A06A 4EH9A 4QMXA 4AAAA 2JDTA 4I92A 4CYIA 4DAWA 3UBDA 3AT2A 4AGCA 4OAUC 2F7ZE 3AD5A 3OHTA 3VUKA 5AA8A 5J1WA 3OC1A 3KMWA 3E5AA 4AW0A 5EKNA 4EEVA 4FKGA 3KY2A 4M84A 4I6FA 2HWOA 2WMBA 4CTBA 2VWIA 4Z7GA 3P5KA 3WF7A 1KUTA 2BTRA 4LGDA 4FOCA 4F64A 1CDKA 4ZAUA 2PZPA 3G0FA 5HNIX 4LQMA 5J9ZA 3RGFA 5DE2A 2Y0AA 2JKOA 5AUTA 1ND4A 3PY3A 4TNBA 4K2RA 4DCAA 3QTRA 4Q2AA 4U41A 2GS7A 4KBCA 4QMPA 3TZ7A 5E8VA 3MH0A 5TE0A 2PK9A 4JDKA 2PVLA 3R8LA 4C0TA 2BIKB 5CF8A 1WBTA 2A19B 4O7YA 2HELA 3QD0A 3P1AA 2RF9A 3R7YA 3NAYA 1XH4A 4GW8A 3ULZA 4BYIA 2OF4A 3HAVA 5AR2A 1QMZA 4GK3A 2X6EA 4DITA 3CY2A 5AV1A 1FGKA 3V6SA 5DT3A 3AG9A 3IPHA 3KXHA 5K5NA 2WQOA 4BDEA 4RJ5A 3R7IA 2HY81 3I5NA 3IS5A 2A4LA 4YPDA 3VUDA 3V6RA 5CEMA 2QURA 1OECA 2ONLA 5G1XA 5M51A 4RLKA 3FSKA 5I9WA 1Z9XA 4IAFA 3C0IA 4RJ8A 4U7ZA 4F99A 2HW6A 4DC2A 1BKXA 3PVGA 4HYIA 3P08A 3FMMA 2QOFA 3TV6A 4XOZA 2YDIA 3QLFA 3QUPA 5TF9A 2GTNA 4R7BA 3CD3A 3UZRA 2VU3A 2J5FA 2ETKA 5A46A 3BRBA 4FT7A 4YLKA 4DHFA 3C1XA 4QP7A 5DLSA 4EQCA 1X8BA 2X4FA 3VNTA 2VWUA 3AXWA 3PPKA 1WBSA 4UYAA 3ZLSA 4TWCA 2QD9A 4GJ2A 3HP2A 4QYYA 2GPHA 1STCE 1AGWA 2FSLX 3BCEA 4YUQA 5HIEA 1MP8A 4NKSA 3U4UA 3BGZA 3RHKA 4DGMA 5J1VA 2C4GA 4RLLA 3FC2A 1EH4A 4HCUA 4A4LA 4USEA 4XG2A 5AV3A 3DOGA 3R00A 4KBAA 3TG1A 3FBVA 1BYGA 1BL7A 1OPJA 4NIFA 4ALUA 5J5TA 2UZEA 4RA5A 3TEIA 2RG6A 3IDCA 1QCFA 1UVRA 5DG5A 2R3NA 5CSVA 4YJOA 2I7QA 4FKSA 4BDIA 3LM0A 4G6NA 3A60A 5K3YA 3ZONA 1OI9A 2WHBA 5L2WA 3RI1A 4NCTC 4XRLA 2WTJA 1UV5A 3MH2A 3E63A 3G6GA 3KULB 4J96A 2HENA 2W1IA 4BCKA 1H28A 4YJUA 1OBGA 4GU9A 3POZA 2FO0A 4YNEA 3BWFA 2CKQA 1SVGA 3E7VA 3EQGA 4NEUA 3OY3A 3RHXA 3GCQA 2JDOA 2OG8A 2XKCA 4U43A 3DV3A 1OITA 4QMUA 1M2PA 5AR4A 2ITPA 3S2PA 3R8VA 4GFOA 4I4FA 3QCYA 4C38A 2WTIA 4ZZNA 3I1AA 2X2MA 5KKRC 1LR4A 4DFXE 2XMYA 5C1QB 3FKLA 3WF5A 2W5HA 4IWPA 4YJNA 4NK9A 4U42A 3K5UA 3LJ1A 5D9HA 5FEEA 3GU6A 4IC8A 4LFIA 1P5EA 1W7HA 2VTLA 3P86A 4GYIA 2WIPA 1GIHA 4F9YA 1YWNA 1Q3WA 5BMMA 3Q5ZA 1YWVA 3FMHA 4BCQA 2XBJA 2CKPA 4C2WA 1OMWA 4WKQA 5HTBA 3CC6A 2WQMA 4KRCA 1H1RA 3FV8A 4J8NA 4RG0A 3ZC6A 4FUYA 4DG2E 2I1MA 4O91A 4QMSA 3TV7A 4AQCA 3C4FA 5EI8A 5E8YA 2AC5A 4ZEGA 3NMUF 4UMRA 4JX3A 3CQEA 4EK3A 3BBWA 2C6DA 2XYNA 3QRTA 4KS7A 2Y4IC 2VO0A 2B9FA 2OIQA 2X8DA 4J53A 5EHOA 1ZY4A 2XEZA 2QO7A 3O0GA 4C4FA 4QQJA 3R2BA 3QRJA 5ICPA 4WG3A 3EIDA 4PQNA 3R73A 5JN2A 4FI1A 4X3FB 3LFBA 4LOPA 5TR6A 3SAYA 4EUTA 3OCSA 3DLZA 5M55A 3LCOA 1A48A 4BBMA 2G15A 4MF0A 5HHWA 3KRLA 2ZM4A 1PRYA 3DY7A 3DJ6A 3G51A 3I4BA 4FKOA 3IG7A 3LLAA 2JAMA 2OIDA 2PVHA 3ZEPA 2G2HA 2VO3A 3FHIA 5BVEA 3RMFA 5J95A 4CD0A 5FGKA 4JXFA 4D55A 4Z55A 1H27A 4BBEA 2WOUA 2VTPA 4TW9A 3UOJA 4O21A 4TL0A 2UVZA 3WILA 4YPSA 2C6EA 3GENA 2F2CB 4WRGA 2H34A 4IFGA 2CJMA 2W1EA 5BVWA 3HRBA 4RIOA 3CCNA 2DYLA 3DNDA 5A4TA 5FXRA 2IVUA 3F2AA 3EZRA 4CFFA 2WXVA 3S00A 4P2KA 2XIYA 3EJ1A 4LOOA 5L2TA 2VUWA 2CMWA 3DKOA 3I79A 3UIBA 2JIUA 1OPKA 4DT9A 3LXKA 4E6CA 5E1SA 2XEYA 4UMQA 4L3PA 5L8JA 4RQVA 3V5PA 4L42A 2J0IA 1OVEA 5CSXA 3JS2A 3W2QA 3ZXTA 4HW7A 5CALA 4C57A 1J7LA 1UNHA 4MNEB 1SMHA 4U45A 5A9UA 4XH6A 4EQUA 1L3RE 4XEYA 2UZLA 4RGJA 2YCSA 3R30A 2J2IB 2WMTA 2C47A 3I81A 3VS6A 4DEDA 2HW7A 3VBWA 4YZDA 3PJ1A 1DI9A 3R01A 4FYOA 2J90A 4QP4A 3UMWA 3OVVA 4FIJA 3QC9A 1P14A 1ZLTA 3ORPA 4IVCA 3NUUA 4DCEA 5D10A 2GHGA 5D41A 4FEQA 3PUPA 3WZDA 3PLSA 3VVHA 5A54A 3C9WA 3KXMA 2PE1A 3SG8A 5C01A 4RJ3A 3DAEA 4EHEA 4XG8A 5FLFA 1XJDA 3UQCA 4G3DA 1CSNA 4WD5A 1UWJA 3KKVA 4IACA 5AUZA 4BL1A 3G5DA 1FVVA 2IW6A 1ERKA 1DAWA 4A07A 1J3HA 1V0OA 4IC7A 3FI2A 1ATPE 4N0SA 2V5QA 1OKVA 2BHHA 4L46A 1WFCA 3NPCA 3ODYX 4I23A 4N6YA 3CY3A 2W4JA 3UDBA 4DGOA 5AIRA 3SW7A 4NW6A 3R7OA 2X9FA 5T6KA 1K3AA 3HMIA 3OWLA 2YIQA 3R8UA 4KINA 3TKUA 2LAVA 2BRGA 5M56A 4IWOA 4RFYA 4O38A 4FT3A 2F4JA 2ONLC 5TOZA 2XNNA 3AC5A 3VHKA 3GC9A 3MA3A 4YTFA 5JFWA 2E9NA 2BFYA 2ITNA 4DEIA 4JDJA 5HGIA 4FSUA 3EL7A 3ATSA 3BE2A 3O8PA 4BIDA 2NRYA 3F61A 3PG3A 4UN0C 3ZLYA 5IEYA 2JKKA 2YM6A 3QXPA 4OLIA 1FQ1B 4EC9A 2ITXA 2WMWA 3MVLA 3RAWA 2C6MA 1HCLA 2YLFA 5AV0A 4EUUA 3SVVA 2ITVA 4MQ2A 4ZK5A 3H30A 3VBQA 5JZJA 2PE0A 5KUPA 4U6RA 5HNGA 5E9EA 4D2WA 4M12A 3AOXA 1K9AA 4PPAA 4BBFA 5DH3A 2Y4PA 3L1SA 2CN8A 3ODZX 3VUIA 2XZSA 3C4XA 3C4WA 1KE5A 5JQ5A 2R3GA 4XX9A 4OW8A 4W4WA 2WTCA 3QGYA 5ETAA 5L2QA 3FWQA 2PMIA 4IZ7A 5HESA 4KD1A 1JPAA 3MDYA 3MIAA 2C6OA 4IAYA 4RX9A 1H0WA 4D1XA 4H39A 3SLSA 3VIDA 4BWPA 1XBAA 2WPAA 3FZ1A 4M66A 4PNIA 2CSNA 3R8MA 3ZOSA 4D58A 5A3XA 4YTCA 1YKRA 4Y46A 3ANRA 3UODA 3N4VA 3DK6A 1IR3A 1XKKA 3F3WA 1F5QA 3DKGA 3KEXA 3LFDA 3L8VA 4AA4A 4OT6A 1SM2A 4USFA 4HYHA 2GQSA 3DTWA 4O6LA 3D2IA 4FG7A 4W9WA 5CS6A 5BYLA 2PUUA 4IZYA 4E1ZA 2ACXA 2XIZA 1I44A 5GHVA 3BIZA 3KXGA 3HV5A 4FL1A 4UMTA 1APME 2YIXA 3HZTA 1YI6A 3QTZA 2I0HA 1DS5A 2BDWA 1H08A 2ZV7A 2HYYA 4R78A 5HG8A 3PA3A 2DWBA 3BV2A 3RPVA 4DYMA 5A4CA 5AUVA 2V55A 4YSMA 4AT5A 3PXZA 4G2FA 1GY3A 4I41A 1WZYA 4H3BA 5ANDA 3MJ1A 2X6DA 4JIKA 2R3KA 4XG3A 1Q8TA 2XB7A 4UWCA 3R7VA 1A06A 1PXKA 4FV9A 3R8ZA 4Z16A 3KC3A 5F9EA 5KHXA 3EL8A 3NSZA 2P55A 4RJ6A 4WSQA 4ZTNA 3AMAA 1K2PA 2WTWA 4DTAA 3E62A 2WTKC 4AZWA 3R22A 5AP7A 1BUHA 3ZRMA 2W05A 5AMNA 3Q53A 4O27B 4CRSA 3MESA 5J9LA 3DA6A 5FEDA 3IW8A 1L8TA 4OBQA 4KWPA 4NW5A 3ZRLA 1PKGA 4DFNA 3OUNB 2Q83A 3K5VA 2A1AB 2R3IA 3LW0A 3QF9A 5CI6A 5ACBC 1Q97A 5HQ0A 4PWNA 4Y95A 3VUTA 2UZNA 2WKMA 3KF7A 2GNIA 3KREA 1H1PA 1OGUA 4FK3A 4FSRA 3CPCA 4JAIA 5AM7A 3OXZA 5CEQA 4QYEA 4BCHA 1URCA 2R3OA 3DBEA 4QMZA 1J7IA 3KXNA 3R28A 5ETFA 2C5YA 5FEQA 4RVKA 4B4LA 4BDJA 4MF1A 3RAKA 1W83A 5AAFA 5ANEA 5KO1A 2CDZA 2XVDA 5IH6A 3QQFA 3L8SA 3BU3A 4ZP5A 3GUBA 2GQGA 4X3JA 3FJQE 4L53A 5CASA 3T3VA 5LVOA 3FMDA 3OW3A 3NUPA 5DOSA 2OFUA 4CSVA 3PVUA 4FVPA 4BTMA 2CGWA 3VF8A 1ZOHA 3SC1A 1H07A 2V0DA 4X21A 4G6OA 4WIHA 3CKXA 5F20A 2ZAZA 3I0QA 5HE1A 1YRPA 2B7AA 3C4ZA 4RBLA 1WCCA 2JBPA 4IX6A 3NYVA 3AD4A 4L52A 5DVRA 4QP1A 4WHZA 3UIMA 4KAOA 5IZFA 4M67A 4AOIA 5GIPE 4R5YA 4FKLA 2QQ7A 4I6BA 2JIIA 3TN8A 5AM6A 4ID7A 2HXQA 4J99A 1Q3DA 4RFZA 5JRQA 5LCJA 3Q3BA 3R9RA 2YAKA 5HLNA 4L7SA 1P4OA 3A62A 3FMEA 3LAUA 1JSUA 4BCPA 3DNEA 4O96A 4RC3A 5FDPA 5LMBA 5LOHA 3G33A 5A14A 2EUFB 4WBOA 4YZMA 4CMTA 4O7RA 3A7GA 4ORKA 4FTQA 3KN5A 3RNYA 2YM4A 5BPYA 5EM5A 1URWA 4O83A 1WBWA 3SRVA 3CP9A 3PXKA 3Q6UA 4C3PA 4GRBA 4MXXA 1WBNA 4RSSA 3JXWA 4HYUA 4CMUA 3GT8A 1Y8GA 3CE3A 4A4XA 4DEGA 4E20A 4L3LA 4MCVA 4FTLA 4GMYA 2C3LA 4IEBA 3HV3A 4X0MA 2RL5A 3MTLA 4QTCA 4DH5A 4O1PA 5CNNA 1WVYA 2V22A 1M7QA 3R1QA 3Q04A 4OTQA 1W8CA 2C5NA 4QYFA 5F1ZA 3GI3A 3QKKA 1KE6A 3DS6A 5TO8A 3TUDA 5BVKA 1OZ1A 3LFQA 3N51A 5D7VA 2E9UA 3WI6A 3V3VA 4AP7A 2B9HA 3HMMA 4FZ7A 5HX6A 4EHVA 5HVKA 5E8SA 3ROCA 1SVHA 4H36A 4EJNA 3V8TA 2BRMA 2YIRA 4HZRA 5J8IA 4AN9A 3E8CA 4YBKA 3WZJA 2J0MB 3UZPA 3BYMA 4D28A 4JBOA 3ORIA 3RM7A 3EQCA 4HVHA 3ZSGA 3QRKA 2HAKA 2QHNA 2JBOA 4FIGA 5K5XA 1QPCA 4MHAA 2C6LA 2I0EA 1MUOA 1H25A 3KVWA 4APCA 5HLPA 4XP3A 4EORA 1B39A 3UG2A 5JEBA 4IDVA 4RZVA 3GBZA 3EYGA 4R3PA 5E1EA 4ZTSA 3SOAA 2A27A 2YAAA 3KCKA 3GC0A 3HYHA 2UW4A 2GNFA 2RKUA 3TM0A 2PVFA 1GZ8A 1S9JA 3VBVA 1Y91A 4FGBA 4XOYA 3LCTA 4Y83A 5CT0A 4EH3A 2PUNA 2P3GX 4ZS0A 1ZYSA 4F4PA 3WF9A 2WEIA 5HI2A 4G34A 4H58A 3FY0A 5AV4A 2P0CA 4DH7A 5CAOA 3HDMA 4NM0A 4J95A 2C6IA 2NNWB 4NKAA 4RJ4A 1H0VA 5L8LA 3U4WA 4FIIA 4AA0A 4V04A 4AACA 5KKRB 4H05A 4PRJA 4WNKA 5CAQA 1NXKA 2EXEA 3POOA 2VTMA 2R7BA 4EONA 3FLNC 1IA8A 4ZMFA 2FSOX 2QNJA 5CSHA 2E9OA 4MD9E 3QKLA 3WARA 2ITWA 5AA9A 2BZIB 4G5JA 1S9IA 3OOGA 2J0KA 3L9MA 4MEDA 3ZDIA 1VZOA 2QOBA 4ZOGA 4CFMA 3EN4A 2WMSA 3ALNA 5E8ZA 1YHVA 2GNGA 2EVAA 5DRDA 1ZRZA 1ZAOA 4P5ZA 3TXOA 4ASDA 3EQBA 4TKSA 2OJIA 2GS6A 4FUXA 3TKIA 2Y4IB 2XF0A 2VTJA 4JR3A 4S2ZA 3BHYA 2W9ZB 4EOOA 1H00A 1NVQA 3G9LX 3UVPA 1QPJA 3F88A 4QMVA 4D0WA 2X1NA 5DR9A 2WMRA 3V5JA 4GSBA 3UQFA 5IQBA 1CKPA 2FH9A 3CTQA 2X8IA 5AP6A 4EKKA 4LUDA 2EB3A 3EWHA 1W82A 3QTIA 3ZLXA 4A9RA 2G01A 3T9TA 5AIKA 4CV9A 4XRJA 2BCJA 2XKFA 3TT0A 4IB0A 4O0SA 3UC3A 5I9UA 5C26A 2XIXA 4ACHA 3UTOA 3D7TA 4L9IA 2BRHA 4IX4A 4FTJA 2VGOA 4W8EA 2H8HA 2VNYA 4GK4A 5CI7A 4H1MA 4G3FA 3QTWA 2W1FA 3QU0A 1YDTE 3VC4A 4CKIA 5ETCA 3AC1A 3KB7A 5IQDA 2W99B 4RIYA 1H26A 3IECA 4FICA 4FTIA 5HD7A 4APPA 3ZM9A 4DEBA 3VS0A 4FKIA 2X39A 1U54A 5AX3A 4PTGA 4AF3A 3O96A 3WZEA 2R3JA 4I94A 1XH6A 2PWLA 1GJOA 4L7FA 5CZHA 4IB5A 1JKLA 2W5AA 3MS9A 2C6KA 5FDXA 2W4KA 2CGUA 2YA9A 4LUEA 4XG7A 5DBXA 4GEOA 4USDA 5H8BA 4YMJA 3CD8A 4OTIA 3PZHA 3VF9A 2QO2A 4J71A 2PVNA 3PXRA 4FKVA 3VS4A 4FA2A 2JKMA 4BICA 3COHA 4YJQA 3H0YA 4C35A 4AXAA 5CXHA 1GIIA 3P0MA 5EH0A 3ALOA 4FNWA 4O0TA 1JKTA 2ITTA 4CZUA 3R1NA 3CJFA 3SDJA 5IUGA 3OEFX 4G3CA 4GH2A 4Q9ZA 5L6PA 1T46A 3COKA 2KULA 3HV7A 4H3PA 3QCSA 3ZRKA 2YLEA 3UNKA 1LPUA 3MH1A 3NGAA 4IB1A 2NRUA 3DU8A 3DDPA 1Q8ZA 4Y8DA 2BROA 3O50A 3ZDUA 2VTRA 4DBXA 5CANA 5AR7A 4KABA 5E7RA 3QD4A 5E8XA 4G3GA 3V04A 3FLQA 2YEXA 4TN6A 2YM3A 1VYWA 4AE9A 3FMLA 4AGDA 4PY1A 3LMIA 3FMKA 1H1WA 3NIZA 4M0YA 2GCDA 4Y72A 3DB6A 1H1QA 1YHWA 1XH7A 3EKNA 4OTRA 4C33A 3WIGA 4RIXA 4QTEA 2VGPA 3DCVA 3HV4A 4CTCA 2XKDA 3PJCA 1SYKA 4FMQA 4MKCA 1Q24A 5AAGA 3KU2A 2VAGA 4YC8A 5ETIA 5IQIA 3FLSA 5IG1A 4FZ6A 3O7LB 4XLIA 4E8AA 4ZTMA 3Q9ZA 2B53A 5M4IA 3JUHA 4W8DA 4HGEA 2PUIA 2WMUA 4XYFA 3PTGA 4YJSA 4LMNA 5LVLA 2YN8A 4TWNA 2BKKA 3IW7A 2XCKA 2XNMA 3UOKA 1BX6A 4F0IA 3FZRA 4ERKA 4E5AX 4MBIA 5HORA 3GU4A 3ENMA 4HNIA 3I6WA 3TNQB 3V51A 2RIOA 3Q6WA 4F7LA 4EBWA 3MIYA 4XUFA 1J1BA 4FKWA 3Q52A 1NY3A 3PJ2A 4IX5A 1KV2A 5AR8A 3OOMA 4YTIA 3VS1A 4F08A 3VUHA 3UQGA 2XJ2A 3SXFA 3THBA 4JVGA 2OFVA 5GJGA 5CWZA 1P4FA 3WE8A 4FC0A 2PVRA 4QP9A 1YW2A 5C9CA 4W4VA 4NM5A 4UX9A 5C4LA 3LFFA 4UMPA 4IW0A 4DTBA 3ERKA 3TI1A 3PG1A 3EMGA 4CEGA 4O7ZA 3R04A 4ACDA 2R64A 3LLTA 4HNFA 4NJDA 3LXLA 2VTQA 2J7TA 3UIUA 4CFVA 2BAQA 3QX4A 3SQQA 4KBKA 2XM9A 3ZSHA 4EBVA 3W10A 5C27A 3RBWA 4O0UA 3OBJA 4BY9E 4WT6A 4E6AA 4WBBB 2VZ6A 2BIYA 2UZBA 2OU7A 2R3RA 1CTPE 2XK3A 3OEZA 3RK5A 3F9NA 4CVAA 1PMEA 5IQHA 4UZDA 4NH1A 4JQ7A 2O3PA 4O0RA 4HYSA 3TWJA 4C59A 4F70A 4AOJA 3JY9A 5CF4A 4FT0A 1LUFA 2O63A 4KKEA 3DDQA 4NU1A 4N4SA 3L9PA 4NIFB 4M7IA 4RC2A 3IONA 4RQKA 4YHFA 4YU2A 1YOJA 5EYCA 4AN3A 5CAVA 2C3JA 3ORTA 4MAOA 5EW9A 3QZHA 1XH5A 4FKRA 4P90A 3ZUUA 4F9BA 3VW8A 2J9MA 3W2SA 5EFQA 3KVXA 3M1SA 3QLGA 4FVQA 4KSQA 4ACGA 4EH2A 1OBDA 4ZSLA 3U87A 2GU8A 3R9OA 4C4JA 4X2FA 4K77A 5KNJA 5GNKA 3NRMA 2XKEA 3CLYA 4J8MA 3VUGA 2R3LA 3S1HA 5HOAA 5EK7A 3FPQA 4FT5A 1OB3A 3AC3A 2UVXA 5HIDA 2QLQA 5A4QA 4NL0A 5B2LA 3R7EA 5KCVA 2WIHA 5HTIA 4E7WA 2OH4A 2A0CX 3PPZA 4PP7A 1KWPA 2IVSA 5FBOA 4B8MA 1PMVA 1U5RA 4LV8A 5CX9A 4TYEA 4ITIA 3WOWA 4FZAB 4D4YA 4F1TA 2VO7A 4HCVA 3CXWA 3QQLA 4ANSA 4PNKA 5IQCA 1Z5MA 2WO6A 5FTOA 3FKOA 4MVFA 5HG7A 5D7AA 4EZ7A 2JKQA 2GFCA 3K3IA 4Q5EA 5EI6A 3IO7A 5HVYA 5CSWA 3VAPA 2WTKB 4IMYA 3BEAA 3HMNA 4ANMA 3Q60A 2WMVA 2QI8A 4HCTA 3Q4CA 3HA8A 3ZUTA 4F1MA 1XR1A 4HJOA 2YCRA 3W55A 2PY3A 4WOVA 5HG9A 4DE4A 5IUHA 3KULA 4AN2A 5C03A 3IOPA 4CZYB 3Q4ZA 3FC1X 4XG6A 2OZAA 2X2KA 3EN9A 5IQEA 3NYNA 2X81A 3N4TA 2PVKA 2QONA 2O0UA 3EOCA 5JRSA 4BKZA 4E5BA 4M13A 3NW5A 2VWWA 2WGJA 2W1DA 4OBOA 4S32A 2UZVA 5AX9A 4PP9A 2GQRA 4CG8A 2QC6A 2C0IA 3EFWA 2WFYA 3CGOA 3QQJA 4UEUA 5BVOA 1F0QA 2VWYA 3OCGA 5ITAA 3KK9A 5F4NA 2ZYBA 5LXMA 4FTMA 3SV0A 5IA1A 5M4FA 2JC6A 3F7WA 5AP5A 3PXQA 5JFXA 3M2WA 2DQ7X 2GMXA 3VULA 4G31A 5AP2A 4AT3A 3Q9YA 3RPYA 4LI5A 2ITYA 3NW7A 3H9RA 3CPBA 1KE9A 2VD5A 5EG3A 1M52A 4M3QA 3VRZA 2OJFE 1DI8A 5I0BA 4O6EA 4EH5A 4CKRA 5GZ9A 4XHKB 3QTUA 5JFVA 2OWBA 1REJA 4IQ6A 4GJ3A 5HG5A 3TIZA 4KSPA 3DT1A 2PZRA 4FKJA 5FWKK 5M44A 3BEGA 1YXVA 3U54A 4UMUA 4BTJA 3VHEA 3MTFA 4QTBA 4M69A 3ZZWA 5CYIA 4S34A 2W1ZA 2YCFA 3E92A 3RVGA 4PDYA 1KOBA 2HOGA 2XA4A 3BV3A 4F6WA 5DI1A 3Q9XA 4PL5A 4X6RA 3TCPA 4J98A 2GS2A 4PL4A 4FVRA 4FV0A 4XJ0A 4BYJA 2YISA 3LFSA 5BX0A 5I4NA 1KE8A 3M42A 4KS8A 4RVTA 2C3KA 1R39A 2BAJA 5DHJA 4RJ7A 2WQNA 1IG1A 1UNLA 4YC6A 5DT4A 2WMAA 3MN3A 3QA8A 3FKNA 4LYNA 5EM6A 2UW3A 4TYJA 5IDNA 3R02A 4TPTA 3BGPA 3D5XA 3BYUA 3QTXA 4FTKA 5FXQA 5BVFA 2KTYA 2ITUA 2QKWB 4L6QA 3AQVA 5HE3A 3O23A 3EQPA 2PPQA 2B9JA 2ZVAA 3E64A 3ZFYA 1CKJA 2B54A 2O65A 3ZO2A 3LFNA 3ZC5A 2BILB 4ZY4A 1UU8A 3E7OA 3R9NA 5IA0A 5L8KA 4CGAA 3IKAA 3SGCA 1WMKA 4YBJA 3E93A 3PSCA 3UGCA 5J7BA 4V0GA 5I9ZA 4AW2A 2FA2A 4QPSA 3L8PA 4E26A 4O7WA 4KRDA 5IEXA 3EFJA 5AR5A 4PMPA 4FTTA 1TQMA 3F5UA 3LXPA 3QAME 4L3JA 2ZM3A 3FAAA 5DR2A 3ZSIA 4IIRA 2OICA 2JFMA 4CCUA 3Q32A 4I5HA 5CVFA 4TYHA 5AJQA 4CT1A 4IVDA 3HGKA 4F09A 4O0XA 2VTTA 2P2HA 5DGZA 4YHJA 3BKBA 4EH6A 1VR2A 4ANBA 4K33A 1XBCA 4BCFA 5BVNA 3T9IA 5J79A 4O2PA 2IZUA 4MK0A 2BDFA 4MXOA 4O7SA 4O86A 5C8NA 1XH9A 3O17A 4RC4A 4ZSEA 3BHTA 3R9HA 1PXJA 4AX8A 4EOQA 3FMNA 4FV1A 2GDOA 2ZDTA 4QQ5A 3UP7A 2PMOX 3P23A 1V0BA 4FV7A 4EK4A 3ENHA 2J5EA 5KBQA 4NM7A 4R77A 2X7GA 3EN7A 5KHWA 2H9VA 3NCGA 1Y57A 4MX9A 1R0PA 3WZUA 4D4VA 2PVYA 5HVJA 4RRVA 3RM6A 2HCKA 4D0XA 2Z7SA 5EOLA 4M68A 4IAIA 4BDHA 1GZOA 4EOSA 4R5SA 4E5WA 5GZAA 4DFYA 4NWMA 2VTAA 3BQCA 4JDHA 4C37A 3VO3A 1IAHA 4Z3VA 4ARKA 4XMOA 5EQYA 3I5ZA 4XNEA 4K0YA 3HRFA 3BPRA 4EYMA 2C0OA 3HP5A 4JQEA 3DZQA 3BX5A 4PV0A 4OAVB 4GKIA 4I0TA 4IWDA 4FGRA 1ZWSA 3AC8A 3KQ7A 1PXOA 2R0UA 2W1GA 2O64A 2W4OA 3RPRA 2B1PA 4K8AA 2YDKA 3LXNA 4RVMA 4JBVA 1ZARA 1W0XC 4PDSA 2Z2WA 3QD2B 3VS3A 1DAYA 4MQ1A 4FYNA 4UZHA 2XIKA 4PL3A 4R8QA 3MWUA 4IM3A 4Z7HA 2C69A 4MWIA 2A2AA 3D2KA 2B9IA 3PA4A 5KMMA 3GCSA 3MI9A 2Q0BA 3R0TA 3JVRA 2C3IB 3NUNA 4LGGA 4ZSJA 3W2CA 3QCXA 4QMQA 5GZ8A 5IEVA 3CGFA 3H9FA 4D4RA 2QKRA 3FY2A 4ENYA 1E1VA 4DINA 4ZJVA 2I6LA 3FHRA 1KE7A 3R71A 3E8DA 4LRJA 3FI3A 1YVJA 4JBQA 4KIPA 5IF1A 2YCQA 3Q2JA 3EN6A 5IKWA 2Z8CA 2W1CA 3BQRA 3QX2A 4RZWA 4AT4A 5LVPA 4I21A 4DF3A 3FL5A 2ZB1A 5H8GA 2R3FA 1ZMUA 4FTAA 3UIXA 3OCBA 3KRRA 1XO2B 1JAMA 3MFTA 2BR1A 4GKHA 4JQ8A 4C7TA 3OZ6A 4FBXA 1RQQA 2YM8A 2H6DA 1ZZ2A 3QUEA 5CEIA 4FZFB 4I5PA 3PE2A 4EH4A 3D5WA 4PUZA 2WD1A 3QA0A 4MD7E 5HO6A 2YABA 3KCFA 3PZEA 3NVKI 1BMKA 3I7BA 4R7IA 2QOHA 2X2LA 4IX3A 4F65A 4RIWA 3RZFA 4RMZA 3SHEA 5M57A 2C6TA 4L67A 4W4YA 1U59A 2EXMA 4FTUA 4YC3A 3V5TA 3V8WA 3F7ZA 3WF6A 5FXSA 4XP2A 4YZNA 4FSZA 4I3ZA 4O2ZA 1JBPE 3KXZA 3RAIA 4A4OA 3F2NA 3V5QA 3AC4A 2GNLA 3HLLA 4F9AA 4QP2A 4RA4A 5C8KA 4UV0A 4FNYA 4YP8A 2ZJWA 5KMKA 3RKBA 2Y8OA 3DAKA 4FKPA 5IH4A 5M06A 4TRLA 4HPTE 1WBOA 4AZEA 4C4EA 2C0TA 2ETRA 1OUKA 2BDJA 2NP8A 3BYSA 3HMOA 1ZOGA 3NYOA 5E90A 2CN5A 5CT7A 4IJPA 3Q96A 1BI8A 1OUYA 4UXLA 2XS0A 3EKKA 1Q5KA 2YZAA 4ENXA 5L2SA 3DBCA 1Q8UA 3FUPA 4WA9A 2QHMA 3F3TA 4M15A 4BTFA 4E73A 2W5BA 3DZOA 4JLCA 2XBAA 5FD2A 2CHLA 3D94A 4FIHA 2NO3A 3KRWA 4DN5A 5C4KA 2CNQA 2F49A 5DIAA 4OTWA 4B8LA 2X7FA 2BZKB 3TZ8A 2PTKA 3GEQA 5AP3A 3GGFA 3FE3A 3GCPA 3FEGA 4GUBA 1OL1A 1JVPP 3OCTA 4FL3A 4R6VA 5JGDA 5LMKA 2OSCA 2PMLX 3DAJA 4FKTA 2REIA 3AD6A 5B0XA 4U5JA 4D2TA 3TZ9A 4AZFA 3HV6A 4O81A 4LOQA 3PVWA 2EB2A 4GT5A 4F7SA 1OKWA 2CNVA 4DBNA 1UKHA 3LKMA 2IG7A 2HZ0A 4I0RA 1Q99A 1IASA 4ANOA 5HEZA 4WG5A 4ZXTA 2OLCA 4ACMA 4BCOA 5IMXA 5JZNA 5J5SA 3CKWA 4FSWA 1A9UA 3SOCA 1IAJA 1RJBA 5I3RA 2PMNX 3C4EA 3NAXA 3EQFA 4B6LA 4ZY5A 4JJRA 3ZHPC 5M07A 3ZO1A 3DPKA 1JSVA 3CTJA 2PU8A 1WAKA 4U0IA 3H10A 1Q61A 2RFSA 4ASZA 4CNHA 3E87A 3HVCA 3JPVA 3N9XA 5E8TA 4U3ZA 2XM8A 2WAJA 3PA5A 2PVJA 3LQ8A 4UYNA 3FZTA 5KMLA 5L6OA 4YHTA 4IZAA 4CZTA 3P9JA 1FOTA 4BZDA 4FODA 4FL2A 3A4OX 1PXPA 4DG3E 1OL5A 5EQPA 4UALA 4C36A 4EYJA 1M2RA 3DJ5A 3F2RA 5I9YA 1XBBA 3ORKA 5JKGA 4IWQA 2GTMA 4PF4A 3TJDA 4AUAA 4R3RA 4H3QA 3RWPA 5E8WA 5AUXA 3B8QA 3C51A 4CQGA 5JK3A 3FYJX 4K18A 2YITA 4BRXA 2WOTA 4Z9LA 3F66A 3RCDA 2ZMDA 5EDRA 3HNGA 4G17A 1FBNA 2LGCA 2ZV9A 2PZIA 5DEWA 4RPVA 3E3PA 5EKOA 2E2BA 5FUTA 4QOXA 5JMSA 2BPMA 1OIRA 3QUDA 4BGGA 5CAUA 4A9TA 1ZY5A 2BALA 2O8YA 4NZWB 3NNWA 1PXMA 4DGNA 5KX8A 4FSMA 3TUCA 4C34A 2CNUA 2VWZA 3JY0A 3F82A 1U46A 1OM1A 4BCNA 3WYXA 3AC2A 5L3AA 4JS8A 3GVUA 4HGTA 4JAJA 3NIEA 4MWHA 4QMLA 1FGIA 4IAZA 1Z57A 1YXSA 4LL5A 5FM2A 4GVAA 2ZMCA 4FE2A 4FV3A 4CFNA 4U81A 4FTRA 3LJ0A 4CFXA 3ORXA 3S0OA 3PY0A 2VTOA 3C4CA 3U8WA 3S4QA 4EHGA 4KIKB 4WNMA 5BYZA 4DA5A 3GOPA 5GJFA 3FZOA 4UY9A 4BCJA 4E4XA 1PXNA 3ZH8A 2AC3A 4S30A 3RPSA 3DK3A 1VJYA 2JD5A 4QMTA 4DEEA 3QD3A 3AMYA 1OPLA 4EK6A 3D7ZA 4IDTA 5HO7A 2F9GA 3CJGA 2BKZA 5D1JA 5DWRA 1ZYDA 3TV4A 4WNPA 4FG8A 5K0XA 2X0GA 4LV5A 1GNGA 4KKHA 4BDGA 2JGZA 3HECA 4D5KA 4EC8A 5J7HA 3U9NA 4EOIA 3HEGA 3UC4A 4MTAA 2XJ0A 1FPUA 3BYVA 4NM3A 2QCSA 3P7BA 3VBXA 3REPA 3QHRA 2UW7A 4GIIA 4A9SA 4JDIA 4OTHA 4CT2A 2JEDA 3C7QA 3F6XA 3OG7A 3FLWA 4J1RA 5M4CA 1J7UA 4O0WA 2UZTA 2BZHB 3A61A 3ETAA 2YM5A 4NUSA 4F7NA 1YOMA 3B2WA 2OW3A 2XCHA 3IK3A 4R1VA 2YJRA 4RWKA 2WB8A 3JYAA 2CPKE 2IZRA 3KRJA 2BHEA 4I24A 4E93A 3QZIA 4FF8A 4XV3A 3TNIA 4KB8A 2VX0A 4TYIA 3ZM4A 2HWPA 3A7IA 4AZTA 4FEXA 4II5A 5CNOA 1UU9A 4XG9A 4BHNA 3A7HA 3GOKA 2UW8A 2ZM1A 4FTCA 4MYGA 4U44A 5ANIA 5FM3A 5IA5A 5JFSA 1MRVA 1YI3A 3EZVA 4YZ9A 1I09A 3VJNA 4ANLA 4B7TA 4D9TA 5FTQA 5HICA 4YR8A 3LZBA 4CYJA 4R1YA 1V1KA 1GZKA 4AS0A 3OF0A 2V7AA 3A2CA 5JH6A 2OIBA 2VTIA 4RIYB 2UZDA 3FZPA 4EOJA 4F7JA 4HOKA 4I5MA 4O0VA 3CEKA 4GG5A 4RWLA 5DR6A 4NTTA 4HVIA 2VTSA 3MVHA 2V7OA 3TNWA 1U54B 3HDNA 4JNWA 3RPOA 2WZJA 4CQEA 1ZZLA 4FKQA 5HCXA 4RT7A 1Y8YA 3NR9A 4BKJA 4D4SA 5HX8A 5JQ8A 4EZ5A 1U4DA 2IWIA 4ITHA 3R21A 1O6YA 3PFQA 5EHLA 4BZOA 3PSBA 1YDRE 5AR3A 3DB8A 3HUBA 5H3QA 5EM7A 4FNXA 3NEWA 3Q4UA 2FB8A 3W8LA 1MQ4A 1CMKE 3BBTB 2IZSA 4F63A 5A4EA 2IJMA 5KZ0A 4GFGA 1SNXA 3SD0A 1JKSA 4I0SA 3GFWA 4BGQA 4IH8A 4QQCA 2VV9A 3KRXA 1BL6A 3NWWA 4L68A 2HY0A 3I6UA 3F5GA 1R3CA 3A99A 2XK9A 4FV6A 4FNZA 4I4EA 3HA6A 3QXOA 5B2MA 3PIYA 4YZCA 1M14A 3K54A 4WG4A 4YTHA 4I6QA 4YO6A 4EI4A 1J1CA 5TT7A 2XNPA 1Q8YA 4O22A 4I5CA 2YWVA 5AP0A 3FZSA 4ANNA 3OROA 5IUIA 5IQGA 3OY1A 3PVBA 2EU9A 1G8AA 4I1ZA 2GFSA 5LARA 3IW4A 5EI2A 3WF8A 2PL0A 4L8MA 5BVDA 4E4LA 4FEWA 3UYSA 2OJ9A 4JOAA 4IM0A 4ONAA 4RIXB 5LMKC 1GOLA 4HPUE 5CZIA 1ZOEA 4DFUA 3Q9WA 4PMMA 5E92A 4BDFA 3IOKA 5EW8A 3RJCA 4LMUA 4YGAA 3GCUA 1HCKA 4RX7A 1BI7A 1QPDA 3C0HA 5ACKA 3R83A 1G5SA 1PYXA 2O5KA 3QTQA 1ZMWA 1JKKA 2IO6A 3QHWA 3D4QA 3DKCA 1H1SA 2CGVA 4UXQA 3U9CA 4GT4A 3R9DA 3RK7A 2HK5A 3FQSA 3F5PA 4U97A 4OTPA 4F0GA 3SG9A 5AFVA 4ALVA 2GNJA 1XQZA 2R3MA 4GS6A 5IPJA 3R6XA 4FZDB 2W9FB 4I6HA 3HKOA 1W98A 4E4NA 2R3PA 2RFDA 4YLLA 3RNIA 3IQ7A 2VX1A 4UB7A 4FV2A 5EW3A 2BRBA 3W2RA 3BHHA 3QRIA 4CXAA 4P4CA 2P2IA 5CU2A 4U9AA 4QQTA 2FUMA 4XV1A 1V0PA 4YLJA 2WELA 1HOWA 3NUAA 3BHVA 3QL8A 4NYEA 3NZ0A 4BWXA 3OTVA 5FG8A 2PSQA 2WTDA 1FMOE 4A7CA 2IVVA 4EH8A 2G2FA 3LOKA 5H2UA 4ZLOA 2QR7A 5K9IA 5A4LA 2XNBA 5I9XA 3OUKA 1O6LA 2OKRA 4QTAA 1RW8A 2B55A 3RAHA 3GP0A 2OI4X 4XP0A 4BDAA 1FVRA 2B4SB 3UJGA 2Z7QA 3QC4A 3SW4A 4O0YA 4FTOA 4B99A 4XCUA 3FYKX 3ZS5A 3O7LD 4Q9SA 1QL6A 4X7QA 2YIWA 3LJ2A 4LL0A 3FSFA 3H4JA 5AP4A 2IVTA 3GB2A 4FOBA 4BI0A 2PZYA 3QTSA 3DQXA 1IA9A 3LMHA 3RWQA 5IH5A 4EOMA 3L9NA 3QYWA 4PTCA 3KGAA 4TTHB 4XBUA 4QTDA 3AT4A 2ETMA 1J91A 2OJJA 5LMAA 3PWDA 5EYMA 3D15A 2Y6OA 4TYGA 3MPAA 3UPXA 5IMEA 4UBAA 4ZIMA 1Y6AA 2OXXA 5HTCA 2X4ZA 4MBJA 4FV4A 5ANKA 3DBQA 1YHSA 4N70A 2WEVA 1WBPA 1MQBA 2OZOA 2UZWE 1QPEA 3NNVA 5AP1A 2VNWA 4JBPA 3ACKA 2EWAA 4FIEA 3VBTA 3E88A 3MY1A 3UO4A 3BLQA 4QPAA 5LWMA 3CQUA 1O9UA 2G9XA 4ZLZA 4WSYA 1H24A 4YSJA 4F6SA 4MXZA 4RFMA 4WO5A 4ZSAA 5A6NA 4GVJA 3AMBA 4G9RA 3FI8A 1KSWA 5CY3A 4O1OA 4NT4A 5K4IA 2ITOA 3C50A 4ZSGA 5KMJA 3H0ZA 4G3EA 4E4MA 4L43A 5KMIA 2QOCA 1Q4LA 2UUEA 2VX3A 1GAGA 4LG4A 3V8SA 5LCKA 1PMUA 2AYPA 4ASEA 2C1AA 4PDOA 3T8OA 3LMGA 2ITQA 2OZAB 3B2TA 2ZV2A 2IN6A 4I93A 3N4UA 4KIQA 5M4UA 4D2VA 1H4LA 3KK8A 3BU5A 3GU8A 1YXXA 1TVOA 4GYGA 4I22A 4RVLA 3ZTXA 4AFEA 4DFZE 4EKLA 4O82A 3NUXA 3BYOA 3GU5A 2XH5A 5AAEA 5IA3A 4AFJA 4CG9A 3IDBA 4BB4A 1CKIA 4AE6A 3CSVA 4H1JA 4G1WA 4IB3A 3G90X 2F2UA 3ORMA 4OTGA 4EH7A 4FSTA 4F9WA 2DUVA 2WU7A 3NCZA 1F3MC 2BZJA 5BUIA 4EOLA 4K6ZA 3RINA 1M2QA 3ROYA 3DGKA 2BAKA 5JT2A 3DXPA 2WU6A 4OT5A 2OF2A 4K11A 5C8MA 4NFMA 4IANA 3M11A 5HU3A 5GJDA 5BYYA 2GNHA 4IVBA 5CF6A 1UU3A 4OUCA 4DH8A 2C1BA 2XRWA 3ZMMA 3QZFA 4MXCA 4EWQA 3R63A 5AUWA 4DG0E 2G1TA 5IA4A 4AW5A 5EDPA 3LM5A 3CIKA 3UG1A 4BF2A 4J97A 2PE2A 1YDSE 4FSQA 4M0ZA 5EYDA 4DLJA 3FXXA 4FK6A 2FSMX 4GIHA 3VWAA 3KF4A 3MFUA 4C4HA 4M69B 1TKIA 2W7XA 2QLUA 4BVUA 2ZB0A 3K3JA 3Q4TA 4TNDA 2R3QA 4C3RA 1IEPA 2RFNA 3VUMA 3MB7A 1FVTA 2YHVA 2OBJA 2GHMA 5AV2A 3RALA 3B8RA 3DFCB 3KMUA 1H8FA 3D5VA 3NYXA 4P7EA 4QRCA 3IW6A 5CENA 3TKHA 4C58A 3H9OA 1OIYA 4BIEA 2UW5A 5M09A 4DGGA 1GIJA 4JG7A 4R7HA 4IAAA 4X3FA 3A7FA 4W4XA 3F3ZA 4RWJA 2W0JA 3A7JA 2Y6MA 4FEUA 4HVDA 2CGXA 1REKA 4MXYA 3GNIB 4FR4A 3EYHA 4J7BA 3QWKA 5IISA 4NTSA 1ZYJA 3FXZA 3WBLA 3NS9A 5DN3A 2JIVA 3CR0A 4FTNA 2QU5A 3I60A 2PUPA 4JL9A 3TTIA 4E6DA 1T45A 5EYKA 4U8ZA 5CU0A 4BWKA 2VWBA 3HAMA 1JLUE 1O6KA 1OIQA 2Y9QA 3A8XA 4A9UA 4IE9A 1JSTA 1ZYCA 2NPQA 5K0KA 4G6LA 3RCJA 5LVMA 3DLSA 5B7VA 5I3OA 5HCZA 3O51A 4YJRA 3PJ8A 3OWPA 5M08A 2XP2A 3R7UA 3LQ5A 3UE4A 1P2AA 3AT3A 4TXCA 4V0GB 3BLRA 1PJKA 2ZOQA 1PKDA 4FSNA 3UP2A 5CEPA 4AG8A 4DFLA 3LHJA 2I0YA 3EQHA 1PYEA 2WNTA 4PMSA 4XV9A 4BCIA 4Q5HA 3G9NA 2JDSA 3ZLWA 3MY0A 1NA7A 4IBMA 3COMA 4GFMA 4BI2A 1LP4A 4XS2A 3WE4A 2HZ4A 3PLAE 3OTUA 1UA2A 2QVSE 2I0VA 3VBYA 5JSMA 4TYHB 1PHKA 3OW4A 5HKMA 1DM2A 1M17A 1KOAA 1YQJA 3R1YA 4PTEA 4XBRA 3UNZA 5EM8A 4WUAA 5BNJA 2W96B 4V05A 3V5LA 3LCKA 2YZLA 3ANQA 1AQ1A 3GFEA 1PW2A 4MNEA 5FP5A 3O8TA 2R2PA 3W8QA 3PRFA 4BKYA 4R3CA 3MGYA 2BRNA 4M97A 3U51A 3KMMA 3P78A 1KV1A 4YJVA 2CLXA 3PRIA 4IAKA 3ID6C 2VO6A 2VWXA 3II5A 3EFKA 2BMCA 2C30A 3VJOA 2OJGA 3GC8A 4FIFA 4UWBA 4DH1A 1CM8A 4CCBA 2ITZA 2YM7A 3DTCA 5HBJA 2RGPA 3FLYA 4I20A 5FP6A 4ZTQA 4ZY6A 1RDQE 2FYSA 3MFSA 5CLPA 5DRBA 4FX3A 4BDDA 4JRNA 4MXAA 4PPBA 1XH8A 3MB6A 2QODA 3ZYAA 4AOTA 1UKIA 2ESMA 1JQHA 2XK7A 4IADA 4F6UA 5KBRA 3E3BX 4ZZOA 2ERZE 3W16A 4PDPA 2PYWA 3WIKA 2QOKA 4C02A 5K4JA 2PHKA 3QYZA 4HGSA 3ACJA 3V5WA 2QU6A 3I7CA 4ASXA 2W17A 1JWHA 2R3HA 1ZXEA 3FLZA 3FPMA 3V01A 3OD6X 5HBEA 3CTHA 4CRLA 2F7EE 4JX7A 4PPCA 3QQKA 3R8PA 5HCYA 4EOKA 4DGLC 4QMNA 3KN6A 4QNYA 2BVAA 3MPMA 4Y73A 3VS2A 2QG7A 3O71A 2J0LA 2J4ZA 4GL9A 2DS1A 3ZU7A 1PY5A 4ACCA 4KUJA 2XIRA 3ZZEA 5KMOA 2JDVA 3AGMA 3HRCA 4BDBA 2CCHA 3R7GA 4EQMA 4YURA 1FMKA 4FSYA 4EWHA 3GU7A 4Y5QA 2PVMA 3D14A 2JITA 1U5QA 1TQIA 2C5OA 5M53A 3JR1A 3EQRA 5JGBA 3ZFMA 3QGWA 2YERA 3FQEA 3TIYA 1M7NA 3RP9A 5DT0A 3IGOA 4QYHA 3D83A 2UZOA 5ANOA 5KE0A 4U3YA 3VS7A 4ZLYA 5BQ0A 4N6ZA 4Y85A 2I40A 5EQEA 3SKCA 3R2YA 3DK7A 2HZIA 2RSVA 3GXLA 5CU4A 1E1XA 4MBLA 2VTNA 4XLVA 1OL2A 4JT3A 4C4GA 4F9CA 3MSSA 1OKZA 5L6WL 5B2KA 5HD4A 2E9PA 3QWJA 3PXYA 1YXTA 5ANJA 3PE1A 3E8NA 3LQ3A 4BDCA 3A4PA 4C4IA 3P4KA 3QKMA 3G6HA 4M8TA 2UVYA 3DBDA 4U79A 3ULIA 5LVNA 1R1WA 2YIYA 3BWJA 3OBGA 3PPJA 5CU6A 3VS5A 4RIWB 3OWKA 4HGLA 2UV2A 1UNGA 2P33A 4TY1A 4EK5A 5T68A 2XK6A 3COIA 4QP8A 3F5XA 2ERKA 3BE9A 5F94A 1Y6BA 4YJPA 3S3IA 4RX8A 3NVMB 4IJ9A 4QYGA 1XHAA 4S33A 4O7VA 4JG8A 3TJCA 4CLIA 4F0FA 4GG7A 3G15A 3IW5A 3SXSA 1G3NA 2CLQA 3GCVA 2R0IA 3OP5A 4PX6A 1NT2A 3BHUA 5IQFA 3PDTA 3MPTA 5TKDA 3U6HA 2QO9A 3PYYA 4BFMA 4BI1A 4ALWA 2J50A 3EQIA 3LPBA 4G16A 3L9LA 1B6CB 3P7AA 2OXYA 3DFAA 4GT3A 4L44A 3TNPC 3FDNA 3ZCLA 4YJTA 4EL9A 3OMVA 1NW1A 4LGHA 2IPXA 3LFAA 4X6QC 4O84A 3SXRA 5I9VA 2VWVA 1PMNA 3I0OA 3RTPA 3C0GA 3MV5A 3EB0A 3BI6A 4L00A 4XV2A 4QP3A 4UWYA 5FQDC 3PIXA 2QR8A 2HXLA 4KKGA 3WZKA 1VEBA 4J52A 3GC7A 3G2FA 3O8UA 2XK4A 3NW6A 2QOLA 2Z7RA 2OO8X 2AUHA 3G0EA 3HMPA 3OXTA 4JR7A 3OS3A 3QQUA 4ZJJA 4C2VA 4D1SA 3OWJA 3NNUA 4BGHA 1ZMVA 2ZDUA 3AGLA 3F3VA 4OR5A 3ZEWA 4BCGA 4CFUA 1IRKA 4GUEA 5HIBA 5KZIA 4D5HA 5CSPA 3D5UA 5DNRA 4D1ZA 4KIOA 1WVXA 3DJ7A 3LFCA 3MVJA 3P79A 4MH7A 2YFXA 3BU6A 4JI9A 3ZBFA 2XK8A 1WBVA 2IZTA 4W9XA 4WUNA 3SA0A 4FV8A 4X3FC 2W1HA 3HL7A 4NJ3A 4NSTA 4BIBA 2J0JA 4ERWA 1PXIA 4F1OA 3QQGA 3LE6A 2XNOA 3ZO3A 3QZGA 1YOLA 5E8UA 4DLIA 4TT7A 5EDQA 5DYJA 3ZFXA 2HIWA 3DKFA 3NX8A 3Q5IA 4A9YA 5AADA 5DMZA 5E4HA 3U55A 4U40A 1PXLA 3DQWA 2YWPA 3LCDA 3SRVB 3UVRA 5J87A 5CXZA 2VRXA 4HVGA 2E9VA 1RE8A 3VQUA 2B52A 2FGIA 5AEPA 4IM2A 4S31A 3TZMA 5DA3A 4BZNA 5BUJA 5HZNA 5IDPA 3HUCA 4JRVA 5F95A 4CV8A 1TQPA 3QQHA 3RK9A 4YNOA 3ZUVA 4FEVA 4AGWA 4ITJA 4C61A 4KA3A
chains in the Genus database with same CATH superfamily
3ZBXA 2NYAA 4L01A 5AWMA 4EK8A 3FQHA 2BTSA 2JAVA 5BMSA 3FMJA 4TZRA 3UOLA 5CEOA 4EHZA 5D12A 4BDKA 2EXCX 4D2PA 2H96A 4O4EA 4E3CA 1MRUA 3GQIA 2XNGA 2YJSA 3WYYA 1Q41A 3TTJA 2WMQA 3LVPA 3MY5A 2JDRA 4G9CA 4BC6A 5CU3A 4CKJA 1OIUA 2R7IA 3A8WA 5GINE 5IQAA 5CEKA 4DFBA 3F3UA 2SRCA 4QMMA 3CQWA 3KL8A 5G6VA 3MFRA 1LEZA 1SNUA 2X9EA 2R4BA 4FT9A 2GHLA 2XNEA 4C8BA 4YZBA 4GU6A 3EH9A 3W32A 1Q8WA 3ZXZA 4WNOA 4AXDA 3BELA 1YI4A 4AWIA 5AUYA 5LJJA 2P4IA 4IZ5A 2OXDA 4P5QA 4ZS4A 2UW9A 4CLJA 2BUJA 3EQDA 2GSFA 5HBHA 3ORNA 2BFXA 3CBLA 3NLBA 5D11A 1E9HA 2Z02A 1OL7A 4Y5HA 3W2PA 3QFVA 2WTVA 4C3FA 1YXUA 3QCQA 5CAPA 5GIOE 3UYTA 3MW1A 3PJ3A 3C13A 5CQUA 2WQEA 1OKYA 4JIAA 3O2MA 4HZSA 3PP1A 2YACA 3UVQA 5CF5A 1PF8A 4GK2A 4C62A 1SVEA 3KFAA 2ZV8A 3ZO4A 3PY1A 4E6QA 4GCJA 2F7XE 3UOHA 2J51A 4G5PA 3VW6A 5HE2A 4RWIA 4M14A 4OTFA 2R5TA 3PSDA 5A6OA 4LM5A 2F57A 2VTHA 2PULA 4AXCA 4AU8A 2WQBA 3NUSA 5LQFA 1H01A 5L4QA 3QBNA 3ORZA 2HZNA 4MD8E 1Q62A 2J6MA 4QP6A 1UU7A 3MJ2A 4TWOA 4K9YA 3ET7A 4JG6A 4NCTA 3IDPA 4BHZA 3T3UA 4D2RA 3UDSA 4U80A 4KIKA 1FINA 3R1SA 2C5VA 3D0EA 4B9DA 2X7OA 3L8XA 4AA5A 3D9VA 4X2GA 4OBPA 3LIJA 2Q0NA 4EJ7A 1R78A 2QOIA 3RZBA 4O7TA 1JNKA 2IW9A 3C5UA 3LFEA 5J9YA 3MVMA 2O2UA 3TUBA 4QMWA 4LRMA 4NFNA 3VN9A 2QG5A 3W18A 3P7CA 1GZNA 3BLHA 4QMOA 4AZSA 4DH3A 3VRYA 3F69A 3MBLA 2CCIA 2QOOA 4IFCA 3E8EA 4O4DA 3BZ3A 3D7TB 4WRSA 2OK1A 5HLWA 5IA2A 5E91A 3PIZA 1WVWA 4QO9A 2Z7LA 2IW8A 2RFEA 3EHAA 4XG4A 5EOBA 4CFWA 4HVSA 3PWYA 4FV5A 4ZTLA 2UW0A 5H8EA 1XWSA 2W06A 2C68A 4B0GA 2PZ5A 2JLDA 2OGVA 4QPMA 1NVSA 5CTPA 3PP0A 4QNAA 4AW1A 3ATTA 3C5IA 3TL8A 4OTDA 2G2IA 5DFPA 2JFLA 3OT8A 4L45A 5FTGA 4MNFA 5ANGA 3UO6A 3W2OA 5AUUA 3VQHA 5HU9A 4X2KA 2XJ1A 5HE0A 3OFMA 1ZYLA 3MH3A 3HX4A 3BGQA 2UW6A 3KA0A 2XUUA 3OT3A 2WMXA 3PXFA 5I5ZA 3CS9A 4DEHA 4IHPA 5BUEA 1AD5A 3NUYA 5CVHA 4QT1A 4ZMEA 4AZVA 3DBFA 4OGRA 1BLXA 2FVDA 2C5XA 3U6IA 3UPZA 2RG5A 5EHYA 4X2JA 4DEAA 5IU2A 4IXPA 5CQWA 5L2IA 4TWPA 3ITZA 4BTKA 3SX9A 2YDJA 1B38A 2OH0E 3TDVA 3NNXA 3UNJA 2XARA 3IGGA 3FXWA 2X8EA 5H9BA 4EOPA 4DTKA 4AGUA 2CKEA 5FRIA 4YO4A 4RX5A 4X2NA 1UWHA 3UMXA 1OL6A 1R0EA 1NVRA 5HNBA 3UO5A 1JOWB 3Q2MA 3TNHA 3NDMA 4ZTRA 1VYZA 4ZJIA 4ZTHA 2Y7JA 3W0QA 3W33A 4KNBA 1MRYA 4QD6A 3U6JA 4DT8A 3DXNA 3JVSA 3EN5A 1G8SA 4IVAA 2XYUA 2Z60A 3ELJA 5JGAA 3QRUA 3EFLA 3GQLA 4LRKA 4BN1A 2UZUE 4BR3A 4V01A 1YWRA 4CMOA 5DEYA 5HO8A 3S95A 2QOQA 4FG9A 4FKUA 2CKOA 3FL4A 3H3CA 4QMYA 4O7LA 2R9SA 3FI4A 5FBNC 2FSTX 4PMTA 3MA6A 3LCSA 1SZMA 4K1BA 2VN9A 5DPVA 3KXXA 5T3QA 3QALE 5CVGA 5LWNA 3K2LA 4ANQA 4BCMA 2V62A 4EZ3A 3OXIA 3UZTA 4N57A 4ZZMA 1W84A 2XRUA 3TDWA 2B0QA 5KMNA 4D9UA 4O7NA 3DXQA 4D2SA 3MYGA 3TACA 1LEWA 3ORLA 3W1FA 4GV1A 4A06A 4EH9A 4QMXA 4AAAA 2JDTA 4I92A 4CYIA 4DAWA 3UBDA 3AT2A 4AGCA 4OAUC 2F7ZE 3AD5A 3OHTA 3VUKA 5AA8A 5J1WA 3OC1A 3KMWA 3E5AA 4AW0A 5EKNA 4EEVA 4FKGA 3KY2A 4M84A 4I6FA 2HWOA 2WMBA 4CTBA 2VWIA 2ZFYA 4Z7GA 3P5KA 3WF7A 1KUTA 2BTRA 4LGDA 4FOCA 4F64A 1CDKA 4ZAUA 2PZPA 3G0FA 5HNIX 4LQMA 5J9ZA 3RGFA 5DE2A 2Y0AA 2JKOA 5AUTA 1ND4A 3PY3A 4TNBA 4K2RA 4DCAA 3QTRA 4Q2AA 4U41A 2GS7A 4KBCA 4QMPA 3TZ7A 5E8VA 3MH0A 5TE0A 2PK9A 4JDKA 2PVLA 3R8LA 4C0TA 2BIKB 5CF8A 1WBTA 2A19B 4O7YA 2HELA 3QD0A 3P1AA 2RF9A 3R7YA 3NAYA 1XH4A 4GW8A 3ULZA 4BYIA 2OF4A 3HAVA 5AR2A 1QMZA 4GK3A 2X6EA 4DITA 3CY2A 5AV1A 1FGKA 3V6SA 5DT3A 3AG9A 3IPHA 3KXHA 5K5NA 2WQOA 4BDEA 4RJ5A 3R7IA 2HY81 3I5NA 3IS5A 2A4LA 4YPDA 3VUDA 3V6RA 5CEMA 2QURA 1OECA 2ONLA 5G1XA 5M51A 4RLKA 3FSKA 5I9WA 1Z9XA 4IAFA 3C0IA 4RJ8A 4U7ZA 4F99A 2HW6A 4DC2A 1BKXA 3PVGA 4HYIA 3P08A 3FMMA 2QOFA 3TV6A 4XOZA 2YDIA 3QLFA 3QUPA 5TF9A 3TMOA 2GTNA 4R7BA 3CD3A 3UZRA 2VU3A 2J5FA 2ETKA 5A46A 3BRBA 4FT7A 4YLKA 4DHFA 3C1XA 4QP7A 5DLSA 4EQCA 1X8BA 2X4FA 4DHIB 3VNTA 2VWUA 3AXWA 3PPKA 1WBSA 4UYAA 3ZLSA 4TWCA 2QD9A 4GJ2A 3HP2A 4QYYA 2GPHA 1STCE 1AGWA 2FSLX 3BCEA 4YUQA 5HIEA 1MP8A 4NKSA 3U4UA 3BGZA 3RHKA 4DGMA 5J1VA 2C4GA 4RLLA 3FC2A 1EH4A 4HCUA 4A4LA 4USEA 4XG2A 5AV3A 3DOGA 3R00A 4KBAA 3TG1A 3FBVA 1BYGA 1BL7A 1OPJA 4NIFA 4ALUA 5J5TA 2UZEA 4RA5A 3TEIA 2RG6A 3IDCA 1QCFA 1UVRA 5DG5A 2R3NA 5CSVA 4YJOA 2I7QA 4FKSA 4BDIA 3LM0A 4G6NA 3A60A 5K3YA 3ZONA 1OI9A 2WHBA 5L2WA 3RI1A 4NCTC 4XRLA 2WTJA 1UV5A 3MH2A 3E63A 3G6GA 3KULB 4J96A 2HENA 2W1IA 4BCKA 1H28A 4YJUA 1OBGA 4GU9A 3POZA 2FO0A 4YNEA 3BWFA 2CKQA 1SVGA 3E7VA 3EQGA 4NEUA 3OY3A 3RHXA 3GCQA 2JDOA 2OG8A 2XKCA 4U43A 3DV3A 1OITA 4QMUA 1M2PA 5AR4A 2ITPA 3S2PA 3R8VA 4GFOA 4I4FA 3QCYA 4C38A 2WTIA 4ZZNA 3I1AA 2X2MA 5KKRC 1LR4A 4DFXE 2XMYA 5C1QB 3FKLA 3WF5A 2W5HA 4IWPA 4YJNA 4NK9A 4U42A 3K5UA 3LJ1A 5D9HA 5FEEA 3GU6A 4IC8A 4LFIA 1P5EA 1W7HA 2VTLA 3P86A 4GYIA 2WIPA 1GIHA 4F9YA 1YWNA 1Q3WA 5BMMA 3Q5ZA 1YWVA 3FMHA 4BCQA 2XBJA 2CKPA 4C2WA 1OMWA 4WKQA 5HTBA 3CC6A 2WQMA 4KRCA 1H1RA 3FV8A 4J8NA 4RG0A 3ZC6A 4FUYA 4DG2E 2I1MA 4O91A 4QMSA 3TV7A 4AQCA 3C4FA 5EI8A 5E8YA 2AC5A 4ZEGA 3NMUF 4UMRA 4JX3A 3CQEA 4EK3A 3BBWA 2C6DA 2XYNA 3QRTA 4BJJB 4KS7A 2Y4IC 2VO0A 2B9FA 2OIQA 2X8DA 4J53A 5EHOA 1ZY4A 2XEZA 2QO7A 3O0GA 4C4FA 4QQJA 3R2BA 3QRJA 5ICPA 4WG3A 3EIDA 4PQNA 3R73A 5JN2A 4FI1A 4X3FB 3LFBA 4LOPA 5TR6A 3SAYA 4EUTA 3OCSA 3DLZA 5M55A 3LCOA 1A48A 4BBMA 2G15A 4MF0A 5HHWA 3KRLA 2ZM4A 1PRYA 3DY7A 3DJ6A 3G51A 3I4BA 4FKOA 3IG7A 3LLAA 2JAMA 2OIDA 2PVHA 3ZEPA 2G2HA 2VO3A 3FHIA 5BVEA 3RMFA 5J95A 4CD0A 5FGKA 4JXFA 4DHJA 4D55A 4Z55A 1H27A 4BBEA 2WOUA 2VTPA 4TW9A 3UOJA 4JMQA 4O21A 4TL0A 2UVZA 3WILA 4YPSA 2C6EA 3GENA 2F2CB 4WRGA 2H34A 4IFGA 2CJMA 2W1EA 5BVWA 3HRBA 4RIOA 3CCNA 2DYLA 3DNDA 5A4TA 5FXRA 2IVUA 3F2AA 3EZRA 4CFFA 2WXVA 3S00A 4P2KA 2XIYA 3EJ1A 4LOOA 5L2TA 2VUWA 2CMWA 3DKOA 3I79A 3UIBA 2JIUA 1OPKA 4DT9A 3LXKA 4E6CA 5E1SA 2XEYA 4UMQA 4L3PA 5L8JA 4RQVA 3V5PA 4L42A 2J0IA 1OVEA 5CSXA 3JS2A 3W2QA 3ZXTA 4HW7A 5CALA 4C57A 1J7LA 1UNHA 4MNEB 1SMHA 4U45A 5A9UA 4XH6A 4EQUA 1L3RE 4XEYA 2UZLA 4RGJA 2YCSA 3R30A 2J2IB 2WMTA 2C47A 3I81A 3VS6A 4DEDA 2HW7A 3VBWA 4YZDA 3PJ1A 1DI9A 3R01A 4FYOA 2J90A 4QP4A 3UMWA 3OVVA 4FIJA 3QC9A 1P14A 1ZLTA 3ORPA 4IVCA 3NUUA 4DCEA 5D10A 2GHGA 5D41A 4FEQA 3PUPA 3WZDA 2XAOA 3PLSA 3VVHA 5A54A 3C9WA 3KXMA 2PE1A 3SG8A 5C01A 4RJ3A 3DAEA 4EHEA 4XG8A 5FLFA 1XJDA 3UQCA 4G3DA 1CSNA 4WD5A 1UWJA 3KKVA 4IACA 5AUZA 4BL1A 3G5DA 4QDEA 1FVVA 2IW6A 1ERKA 1DAWA 4A07A 1J3HA 1V0OA 4IC7A 3FI2A 1ATPE 4N0SA 2V5QA 1OKVA 2BHHA 4L46A 1WFCA 3NPCA 3ODYX 4I23A 4N6YA 3CY3A 2W4JA 3UDBA 4DGOA 5AIRA 3SW7A 3O5AA 4NW6A 3R7OA 2X9FA 5T6KA 1K3AA 3HMIA 3OWLA 2YIQA 3R8UA 4KINA 3TKUA 2LAVA 2BRGA 5M56A 4IWOA 4RFYA 4O38A 4FT3A 2F4JA 2ONLC 5TOZA 2XNNA 3AC5A 3VHKA 3GC9A 3MA3A 4YTFA 5JFWA 2E9NA 2BFYA 2ITNA 4DEIA 4JDJA 5HGIA 4FSUA 3EL7A 3ATSA 3BE2A 3O8PA 4BIDA 2NRYA 3F61A 3PG3A 4UN0C 3ZLYA 5IEYA 1XMLA 2JKKA 2YM6A 3QXPA 4OLIA 1FQ1B 4EC9A 2ITXA 2WMWA 3MVLA 3RAWA 2C6MA 1HCLA 2YLFA 5AV0A 4EUUA 3SVVA 2ITVA 4MQ2A 4ZK5A 3H30A 3VBQA 5JZJA 2PE0A 5KUPA 4MUQA 4U6RA 5HNGA 5E9EA 4D2WA 4M12A 3AOXA 1K9AA 4PPAA 4BBFA 5DH3A 2Y4PA 3L1SA 2CN8A 3ODZX 3VUIA 2XZSA 3C4XA 3C4WA 1KE5A 5JQ5A 5BV3A 1W2FA 2R3GA 4XX9A 4OW8A 4W4WA 2WTCA 3QGYA 5ETAA 5L2QA 3FWQA 2PMIA 4IZ7A 5HESA 4KD1A 1JPAA 3MDYA 3MIAA 2C6OA 4IAYA 4RX9A 1H0WA 4D1XA 4H39A 3SLSA 3VIDA 4BWPA 1XBAA 2WPAA 3FZ1A 4M66A 4PNIA 2CSNA 3R8MA 3ZOSA 4D58A 5A3XA 4YTCA 1YKRA 4Y46A 3ANRA 3UODA 3N4VA 3DK6A 1IR3A 1XKKA 3F3WA 1F5QA 3DKGA 3KEXA 3LFDA 3L8VA 4AA4A 4OT6A 1SM2A 4USFA 4HYHA 2GQSA 3DTWA 4O6LA 3D2IA 4FG7A 4W9WA 5CS6A 5BYLA 4QEBA 2PUUA 4IZYA 4E1ZA 2ACXA 2XIZA 1I44A 5GHVA 3BIZA 3KXGA 3HV5A 4FL1A 4UMTA 1APME 2YIXA 3HZTA 1YI6A 3QTZA 2I0HA 1DS5A 2BDWA 1H08A 2ZV7A 2HYYA 4R78A 5HG8A 3PA3A 2DWBA 3BV2A 2IF8A 3RPVA 4DYMA 5A4CA 5AUVA 2V55A 4YSMA 4AT5A 3PXZA 4G2FA 1GY3A 4I41A 1WZYA 4H3BA 5ANDA 3MJ1A 2X6DA 4JIKA 2R3KA 4XG3A 1Q8TA 2XB7A 4UWCA 3R7VA 1A06A 1PXKA 4FV9A 3R8ZA 4Z16A 3KC3A 5F9EA 5KHXA 3EL8A 3NSZA 2P55A 4RJ6A 4WSQA 4ZTNA 3AMAA 1K2PA 2WTWA 4DTAA 3E62A 2WTKC 4AZWA 3R22A 5AP7A 1BUHA 3ZRMA 2W05A 5AMNA 3Q53A 4O27B 4CRSA 3MESA 5J9LA 3DA6A 5FEDA 3IW8A 1L8TA 4OBQA 4KWPA 4NW5A 3ZRLA 1PKGA 4DFNA 3OUNB 2Q83A 3K5VA 2A1AB 2R3IA 3LW0A 3QF9A 5CI6A 5ACBC 1Q97A 5HQ0A 4PWNA 4Y95A 3VUTA 2UZNA 2WKMA 3KF7A 2GNIA 3KREA 1H1PA 1OGUA 4FK3A 4FSRA 3CPCA 4JAIA 5AM7A 3OXZA 5CEQA 4QYEA 4BCHA 1URCA 2R3OA 3DBEA 4QMZA 1J7IA 3KXNA 3R28A 5ETFA 2C5YA 5FEQA 4RVKA 4B4LA 4BDJA 4MF1A 3RAKA 1W83A 5AAFA 5ANEA 5KO1A 2CDZA 2XVDA 5IH6A 3QQFA 3L8SA 3BU3A 4ZP5A 3GUBA 2GQGA 4X3JA 3FJQE 4L53A 5CASA 3T3VA 5LVOA 3FMDA 3OW3A 3NUPA 5DOSA 2OFUA 4CSVA 3PVUA 4FVPA 4BTMA 2CGWA 3VF8A 1ZOHA 3SC1A 1H07A 2V0DA 4X21A 4G6OA 4WIHA 3CKXA 5F20A 2ZAZA 3I0QA 5HE1A 1YRPA 2B7AA 3C4ZA 4RBLA 1WCCA 2JBPA 4IX6A 3NYVA 3AD4A 4L52A 5DVRA 4QP1A 4WHZA 3UIMA 4KAOA 5IZFA 4M67A 4AOIA 5GIPE 4R5YA 4FKLA 2QQ7A 4I6BA 2JIIA 3TN8A 5AM6A 4ID7A 2HXQA 4J99A 1Q3DA 4RFZA 5JRQA 5LCJA 3Q3BA 3R9RA 2YAKA 5HLNA 4L7SA 1P4OA 3A62A 3FMEA 3LAUA 1JSUA 4BCPA 3DNEA 4O96A 4RC3A 5FDPA 5LMBA 5LOHA 3G33A 5A14A 2EUFB 4WBOA 4YZMA 4CMTA 4O7RA 3A7GA 4ORKA 4FTQA 3KN5A 3RNYA 2YM4A 5BPYA 5EM5A 1URWA 4O83A 1WBWA 3SRVA 3CP9A 3PXKA 3Q6UA 4C3PA 4GRBA 4MXXA 1WBNA 4RSSA 3JXWA 4HYUA 4CMUA 3GT8A 1Y8GA 3CE3A 4A4XA 4DEGA 4E20A 4L3LA 4MCVA 4FTLA 4GMYA 2C3LA 4IEBA 3HV3A 4X0MA 2RL5A 3MTLA 4QTCA 4DH5A 4O1PA 5CNNA 1WVYA 2V22A 1M7QA 3R1QA 3Q04A 4OTQA 1W8CA 2C5NA 4QYFA 5F1ZA 3GI3A 3QKKA 1KE6A 3DS6A 5TO8A 3TUDA 5BVKA 1OZ1A 3LFQA 3N51A 5D7VA 2E9UA 3WI6A 3V3VA 4AP7A 2B9HA 3HMMA 4FZ7A 5HX6A 4EHVA 5HVKA 5E8SA 3ROCA 1SVHA 4H36A 4EJNA 3V8TA 2BRMA 2YIRA 4HZRA 5J8IA 4AN9A 3E8CA 4YBKA 3WZJA 2J0MB 3UZPA 3BYMA 4D28A 4JBOA 3ORIA 3RM7A 3EQCA 4HVHA 3ZSGA 3QRKA 2HAKA 2QHNA 2JBOA 4FIGA 5K5XA 1QPCA 4MHAA 2C6LA 2I0EA 1MUOA 1H25A 3KVWA 4APCA 5HLPA 3VONA 4XP3A 4EORA 1B39A 3UG2A 5JEBA 4IDVA 4RZVA 3GBZA 3EYGA 4R3PA 5E1EA 4ZTSA 3SOAA 2A27A 2YAAA 3KCKA 3GC0A 3HYHA 2UW4A 2GNFA 2RKUA 3TM0A 2PVFA 1GZ8A 1S9JA 3VBVA 1Y91A 4FGBA 4XOYA 3LCTA 4Y83A 5CT0A 4EH3A 2PUNA 2P3GX 4ZS0A 1ZYSA 4F4PA 3WF9A 2WEIA 5HI2A 4G34A 4H58A 3FY0A 5AV4A 2P0CA 4DH7A 5CAOA 3HDMA 4NM0A 4J95A 2C6IA 2NNWB 4NKAA 4RJ4A 1H0VA 5L8LA 3U4WA 4FIIA 4AA0A 4V04A 4AACA 5KKRB 4H05A 4PRJA 4WNKA 5CAQA 1NXKA 2EXEA 3POOA 2VTMA 2R7BA 4EONA 3FLNC 1IA8A 4ZMFA 2FSOX 2QNJA 5CSHA 2E9OA 4MD9E 3QKLA 3WARA 2ITWA 1ST0A 5AA9A 2BZIB 4G5JA 1S9IA 3OOGA 2J0KA 3L9MA 4MEDA 3ZDIA 1VZOA 2QOBA 4ZOGA 4CFMA 3EN4A 2WMSA 3ALNA 5E8ZA 1YHVA 2GNGA 2EVAA 5DRDA 1ZRZA 1ZAOA 4P5ZA 3TXOA 4ASDA 3EQBA 4TKSA 2OJIA 2GS6A 4FUXA 3TKIA 2Y4IB 2XF0A 2VTJA 4JR3A 4S2ZA 3BHYA 2W9ZB 4EOOA 1H00A 1NVQA 3G9LX 3UVPA 1QPJA 3F88A 4QMVA 4D0WA 2X1NA 5DR9A 2WMRA 3V5JA 4GSBA 3UQFA 5IQBA 1CKPA 2FH9A 3CTQA 2X8IA 5AP6A 4EKKA 4LUDA 2EB3A 3EWHA 1W82A 3QTIA 3ZLXA 4A9RA 2G01A 3T9TA 5AIKA 4CV9A 3P5JC 4DDGA 4XRJA 2BCJA 2XKFA 3TT0A 4IB0A 4O0SA 3UC3A 5I9UA 5C26A 2XIXA 4ACHA 3UTOA 3D7TA 4L9IA 2BRHA 4IX4A 4FTJA 2VGOA 4W8EA 2H8HA 2VNYA 4GK4A 5CI7A 4H1MA 4G3FA 3QTWA 2W1FA 3QU0A 1YDTE 3VC4A 4CKIA 5ETCA 3AC1A 3KB7A 5IQDA 2W99B 4RIYA 1H26A 3IECA 4FICA 4FTIA 5HD7A 4APPA 3ZM9A 4DEBA 3VS0A 4FKIA 2X39A 1U54A 5AX3A 4PTGA 4AF3A 3O96A 3WZEA 2R3JA 4I94A 1XH6A 2PWLA 1GJOA 4L7FA 5CZHA 4IB5A 1JKLA 2W5AA 3MS9A 2C6KA 5FDXA 2W4KA 2CGUA 2YA9A 4LUEA 4XG7A 5DBXA 4GEOA 4USDA 5H8BA 4YMJA 3CD8A 4OTIA 3PZHA 3VF9A 2QO2A 4J71A 2PVNA 3PXRA 4FKVA 3VS4A 4FA2A 2JKMA 4BICA 3COHA 4YJQA 3H0YA 4C35A 4AXAA 5CXHA 1GIIA 3P0MA 5EH0A 3ALOA 4FNWA 4O0TA 1JKTA 2ITTA 4CZUA 3R1NA 3CJFA 3SDJA 5IUGA 3OEFX 4G3CA 4GH2A 4Q9ZA 5L6PA 1T46A 3COKA 2KULA 3HV7A 4H3PA 3QCSA 3ZRKA 2YLEA 3UNKA 1LPUA 3MH1A 3NGAA 4IB1A 2NRUA 3DU8A 3DDPA 1Q8ZA 4Y8DA 2BROA 3O50A 3ZDUA 2VTRA 4DBXA 5CANA 5AR7A 4KABA 5E7RA 3QD4A 5E8XA 4G3GA 3V04A 3FLQA 2YEXA 4TN6A 2YM3A 1VYWA 4AE9A 3FMLA 4AGDA 4PY1A 3LMIA 3FMKA 1H1WA 3NIZA 4M0YA 2GCDA 4Y72A 3DB6A 1H1QA 1YHWA 1XH7A 3EKNA 4OTRA 4C33A 3WIGA 4RIXA 4QTEA 2VGPA 3DCVA 3HV4A 4CTCA 2XKDA 3PJCA 1SYKA 4FMQA 4MKCA 1Q24A 5AAGA 3KU2A 2VAGA 4YC8A 5ETIA 5IQIA 3FLSA 5IG1A 4FZ6A 3O7LB 4XLIA 4E8AA 4ZTMA 3Q9ZA 2B53A 5M4IA 3JUHA 4W8DA 4HGEA 2PUIA 2WMUA 4XYFA 3PTGA 4YJSA 4LMNA 5LVLA 2YN8A 4TWNA 2BKKA 3IW7A 2XCKA 2XNMA 3UOKA 1BX6A 4F0IA 3FZRA 4ERKA 4E5AX 4MBIA 5HORA 3GU4A 3ENMA 4HNIA 3I6WA 3TNQB 3V51A 2RIOA 3Q6WA 4F7LA 4EBWA 3MIYA 4XUFA 1J1BA 4FKWA 3Q52A 1NY3A 3PJ2A 4IX5A 1KV2A 5AR8A 3OOMA 4YTIA 3VS1A 4F08A 3VUHA 3UQGA 2XJ2A 3SXFA 3THBA 4JVGA 2OFVA 5GJGA 5CWZA 1P4FA 3WE8A 4FC0A 2PVRA 4QP9A 1YW2A 5C9CA 4W4VA 4NM5A 4UX9A 5C4LA 3LFFA 4UMPA 4IW0A 4DTBA 3ERKA 3TI1A 3PG1A 3EMGA 4CEGA 4O7ZA 3R04A 4ACDA 2R64A 3LLTA 4HNFA 4NJDA 3LXLA 2VTQA 2J7TA 3UIUA 4CFVA 3AKLA 2BAQA 3QX4A 3SQQA 4KBKA 2XM9A 3ZSHA 4EBVA 3W10A 5C27A 3RBWA 4O0UA 3OBJA 4BY9E 4WT6A 4E6AA 4WBBB 2VZ6A 2BIYA 2UZBA 2OU7A 2R3RA 1CTPE 2XK3A 3OEZA 3RK5A 3F9NA 4O4CA 1PMEA 2AQXA 4CVAA 5IQHA 4UZDA 4NH1A 4JQ7A 2O3PA 4O0RA 4HYSA 3TWJA 4C59A 4F70A 4AOJA 3JY9A 5CF4A 4FT0A 1LUFA 2O63A 4KKEA 3DDQA 4NU1A 4N4SA 3L9PA 4NIFB 4M7IA 4RC2A 3IONA 4RQKA 4YHFA 4YU2A 1YOJA 5EYCA 4AN3A 5CAVA 2C3JA 3ORTA 4MAOA 5EW9A 3QZHA 1XH5A 4FKRA 4P90A 3ZUUA 4F9BA 3VW8A 2J9MA 3W2SA 5EFQA 3KVXA 3M1SA 3QLGA 4FVQA 4KSQA 4ACGA 4EH2A 1OBDA 4ZSLA 3U87A 2GU8A 3R9OA 4C4JA 4X2FA 4K77A 5KNJA 5GNKA 3NRMA 2XKEA 3CLYA 4J8MA 3VUGA 2R3LA 3S1HA 5HOAA 5EK7A 3FPQA 4FT5A 1OB3A 3AC3A 2UVXA 5HIDA 2QLQA 5A4QA 4NL0A 5B2LA 3R7EA 5KCVA 2WIHA 5HTIA 4E7WA 2OH4A 2A0CX 3PPZA 4PP7A 1KWPA 2IVSA 5FBOA 4B8MA 1PMVA 1U5RA 4LV8A 5CX9A 4TYEA 4ITIA 3WOWA 4FZAB 4D4YA 4F1TA 2VO7A 4HCVA 3CXWA 3QQLA 4ANSA 4PNKA 5IQCA 1Z5MA 3BL9A 2WO6A 5FTOA 3FKOA 4MVFA 5HG7A 5D7AA 4EZ7A 2JKQA 2GFCA 3K3IA 4Q5EA 5EI6A 3IO7A 5HVYA 5CSWA 3VAPA 2WTKB 4IMYA 3BEAA 3HMNA 4ANMA 3W0NA 3Q60A 2WMVA 2QI8A 4HCTA 3Q4CA 3HA8A 3ZUTA 4F1MA 1XR1A 4HJOA 2YCRA 3W55A 3AKJA 2PY3A 4WOVA 5HG9A 4DE4A 5IUHA 3KULA 4AN2A 5C03A 3IOPA 4CZYB 3Q4ZA 3FC1X 4XG6A 2OZAA 2X2KA 3EN9A 5IQEA 3NYNA 2X81A 3N4TA 2PVKA 2QONA 4I6LA 2O0UA 3EOCA 5JRSA 4BKZA 4E5BA 4M13A 3NW5A 2VWWA 2WGJA 2W1DA 4OBOA 4S32A 2UZVA 5AX9A 4PP9A 2GQRA 4CG8A