4QMLA

Mst3 in complex with amp-pnp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
280
Chain Sequence
ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 280
sequence length 281
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmlA01
3LFFA 3N4VA 1PW2A 4IB3A 2PVFA 5CVGA 3ZDUA 4F0FA 2EXCX 3PG1A 3UG1A 1Q5KA 3V5PA 3PZEA 2P33A 1JSUA 3TJCA 5L2SA 3SW7A 4O7SA 4WHZA 1OL1A 2X2LA 4MBJA 2BDJA 1VJYA 3Q9YA 3KC3A 5DEYA 3N4UA 4IM0A 5LVLA 4FZFB 2X7OA 4RFMA 2ERZE 3EH9A 3L8XA 4RA5A 3FMMA 4O22A 2Z7RA 4R8QA 4IWPA 4YC6A 2G2FA 3N9XA 4WO5A 3ZTXA 4FKIA 4GH2A 2F7XE 4Y83A 2DUVA 3FJQE 4BIEA 4D2TA 5LJJA 4JG8A 3AMAA 4YHFA 4XJ0A 1M17A 3O7LB 4ARKA 3SHEA 4FKLA 3C4CA 4ZAUA 4PNIA 4BF2A 3OZ6A 5AP2A 3DAKA 3ELJA 5L6PA 1PYXA 3OVVA 3Q5ZA 3QKMA 4PUZA 4FI1A 2FO0A 3HP2A 3G5DA 4TRLA 4YJVA 3UQGA 2IVTA 4AU8A 4ONAA 2WIHA 1H0VA 2QOCA 4BDEA 3ZO1A 3DTCA 4ANBA 2BIYA 4ORKA 2RIOA 5HI2A 4BL1A 5BUEA 4PWNA 5AADA 5HG7A 3Q96A 3OEZA 4XNEA 3D2IA 4RRVA 5EDQA 3VS0A 4ZLOA 3HECA 4DE4A 2JKQA 3Q32A 3VS3A 5ITAA 3NIZA 5M07A 5I0BA 4LUDA 2WFYA 3TTIA 5KNJA 1PMVA 4BFMA 3RZFA 5HU3A 3NAXA 4QMVA 2XEZA 2J50A 4F7SA 3ORXA 5D7VA 2BCJA 2JFLA 2PTKA 3Q52A 5TR6A 4D1ZA 4PTEA 4D5HA 5CAVA 3MJ1A 3ZXTA 3M11A 4IANA 3TKUA 3LVPA 3BE9A 4EK5A 2W1GA 1H27A 3ORMA 2A2AA 2YITA 3ZO4A 1SVEA 5HTBA 4FTRA 4KRCA 2QLUA 3EQIA 3QRJA 2ZMCA 1DI8A 3KXGA 4FT5A 5E9EA 1U54A 5B2KA 4O38A 4AW1A 3QZGA 4BCGA 2C3KA 4QTAA 4YZNA 3R7YA 1P4OA 3OOGA 5GZ9A 3GP0A 4HPUE 2P3GX 2B9HA 2CSNA 2QOHA 4LGDA 4BDCA 3LJ2A 1PY5A 4JDHA 3R0TA 1BLXA 2I0VA 5JGAA 4U80A 3UOHA 3DLSA 3E87A 4IZYA 3HL7A 3QRIA 2E2BA 5FRIA 2R3RA 4TWPA 4O7ZA 4XG7A 3UYTA 3LCOA 1PMNA 2WTKB 1UNLA 3Q9WA 4BI2A 2IW8A 5BMMA 4P90A 3CP9A 2X9EA 3F88A 4FV1A 3O23A 4AACA 3NS9A 3OWLA 2WKMA 3ENMA 3PJ2A 4UMUA 4XG9A 4XUFA 3EFKA 1UWJA 3DQXA 1Y57A 2WQEA 2Z2WA 4X2FA 2VTOA 1GZNA 3ORNA 4ACHA 4JX7A 2PYWA 4FV8A 3TL8A 5FTGA 2XZSA 5HE3A 1U46A 3MW1A 3VUMA 4XH6A 3VBWA 3VQUA 4CQEA 3UPZA 4IQ6A 1M7QA 5CVHA 2IG7A 3AC2A 3L9PA 4EYMA 2UZVA 4EHGA 4BDDA 5FXRA 2ZB0A 2WU6A 2OWBA 3ZRMA 3FLWA 4LL5A 5CY3A 3H0ZA 4X2NA 4EWQA 4O0XA 4EC8A 2EXEA 4C62A 3E7VA 1PMUA 4EK8A 2G01A 3KMUA 3N4TA 4M3QA 4FYNA 3W2SA 3QKKA 2WTVA 4BWXA 1T46A 4ZSGA 3PZHA 2GTMA 3HMOA 4L7SA 4I94A 4M0YA 2BRNA 5CZHA 4YR8A 5CXZA 4IAKA 4TKSA 4M13A 1Q41A 4PMSA 4NZWB 2VX0A 4U0IA 2CLQA 5HNIX 2X81A 4DH8A 3SX9A 1OKVA 4FL1A 4IM2A 3VUGA 5CEKA 3R9HA 3WF9A 2H6DA 4UMPA 4AE6A 2Y7JA 2A27A 4QYYA 2V62A 4TWOA 2OU7A 2OXYA 3SLSA 3RJCA 3UDBA 4BY9E 4DEIA 3V6RA 4W8EA 5HLNA 4U45A 5I4NA 2H9VA 4XS2A 2J0IA 3BGPA 3VS1A 4X6RA 5AJQA 1UU8A 4JI9A 3UC3A 3MN3A 5DHJA 1E1XA 3DTWA 2PVJA 3TV7A 3DK7A 2R3KA 3H0YA 3LQ8A 4PMMA 3CTJA 4I93A 1YDSE 3FPQA 5AMNA 5L6OA 1R0EA 2VX3A 3DFAA 3IOPA 4JQ7A 3VULA 4BZOA 1GIHA 4N0SA 3QTIA 3HZTA 3PIXA 5JRSA 3WI6A 4JAIA 3C7QA 3FLSA 4IDVA 4TXCA 5B0XA 2UW8A 3VWAA 2WQOA 1WBPA 5KBQA 3RHXA 4HZRA 3G33A 3IDCA 3AGLA 3PP0A 2W4KA 4DG0E 1WBTA 2IWIA 4BGGA 4DG2E 2B7AA 1I09A 4E6CA 2P4IA 3KVXA 4PPBA 3MTLA 4AX8A 4RPVA 1ATPE 3SGCA 1YDTE 2X1NA 4FK3A 3DKOA 3A4PA 5EDPA 2HZ4A 4Y5QA 4LRKA 2VWXA 3FC1X 2XMYA 2YAAA 3BU6A 5IA4A 4KUJA 4NM0A 4C57A 5ANIA 4DFYA 2YM7A 4XBRA 5AFVA 3WE8A 2OIDA 2BRHA 2OJGA 2IN6A 3ZBFA 2DQ7X 5BYZA 4YTFA 3L8PA 1YHSA 4EH6A 5F94A 2HOGA 3G6GA 3R1QA 4I0SA 3II5A 4FC0A 4MD9E 3VJOA 3RBWA 3VUKA 3IW8A 4GKHA 2ITXA 3PA5A 5IPJA 4CFMA 4I6FA 4XRJA 3PPZA 3WF7A 3QCYA 2WAJA 2ZM1A 2ITYA 4USDA 5C27A 1E1VA 2Z7LA 2CN5A 4J1RA 4FOCA 2VO3A 4F99A 5KMLA 2QOFA 4L45A 2HWOA 2R3FA 2PSQA 3NVMB 2WQBA 3SG9A 2YM8A 4S2ZA 3WZDA 3TUBA 4H36A 4M66A 1WBWA 4GG7A 3GFWA 3LFEA 1IG1A 1U5QA 3GC8A 4XV9A 2OIBA 2IZSA 1HOWA 3P7AA 4ID7A 4X3FA 4O2ZA 3WZEA 4PMPA 1UNGA 4GK2A 2X2KA 3CE3A 4FTCA 1R3CA 4BI1A 3DJ6A 2A19B 3OFMA 2J0MB 3KULA 3CKWA 4ZTNA 1XJDA 4ANLA 5L3AA 5EW8A 3KREA 5E91A 3BV2A 3UC4A 3WYYA 4DTBA 2C6KA 3DPKA 1CKJA 4U3YA 4OTPA 3TKIA 3ANQA 3PP1A 4O7YA 4EL9A 1H1PA 4YPSA 5AUTA 3R1NA 4MQ1A 4CKIA 3MA3A 4WSYA 2ONLA 3VN9A 2PL0A 3R9DA 3E88A 4FSZA 2PE0A 3IGOA 3EHAA 3MFSA 3WZJA 4QOXA 5CEOA 2ZYBA 1KOAA 5GNKA 4EBWA 2JKMA 4G1WA 4EK6A 1YXSA 5CYIA 4F7LA 3MH0A 5BVWA 4HZSA 2XEYA 3L1SA 2I7QA 4FZ6A 3ZDIA 3FZRA 1BI7A 1PXPA 1OECA 4M12A 2VWIA 3LXKA 3V5LA 4O7WA 3C5IA 5ETIA 4I6QA 3RPOA 5LWNA 1OPKA 1ZYLA 3I5ZA 4TYIA 4D4RA 4YC3A 1RDQE 2VN9A 4KBAA 2Y0AA 4EHEA 4OT6A 3TXOA 5CF4A 4MWHA 4EH8A 2XJ0A 4FTQA 3ZUUA 3UIMA 3VHKA 4JQ8A 5HBJA 4EQMA 1FINA 3PXZA 2W1FA 4ZSEA 3U4UA 3H3CA 4GVAA 4NU1A 5EW3A 3G90X 4BDKA 2GNJA 4X2JA 1OBGA 4WNKA 2YHVA 4X21A 4ASDA 3QL8A 4KKEA 3CCNA 5C1QB 4DT8A 2JDRA 3FMNA 4UMTA 1OI9A 1X8BA 5JEBA 5KHWA 3R22A 4EEVA 3C4WA 3F9NA 3OBGA 1JKLA 1H28A 3WF8A 4A9UA 3QF9A 4E26A 4F6WA 3C4EA 4ZIMA 4QP7A 2Y8OA 4EZ3A 4KSQA 4DN5A 3IS5A 3TUDA 4DYMA 2YLFA 5LVNA 5EDRA 4NW6A 3P7CA 3OHTA 2WIPA 2OJFE 3PIYA 4DBXA 4WG4A 5JT2A 4QMSA 3W33A 1GOLA 2IVVA 5AP3A 4XCUA 3TIYA 2VD5A 4FUXA 4G2FA 3HKOA 2ZM3A 4RJ8A 1H01A 4PDOA 2XB7A 3DOGA 4QP6A 3DB8A 2XK7A 1O6KA 3MY0A 3QQHA 4FSUA 4FTAA 3DNDA 4GK4A 2XF0A 3D7TB 1JPAA 2GNGA 1FMOE 4EH7A 1MUOA 3R7EA 5LVOA 5HNGA 5IG1A 4I4FA 3EWHA 3OROA 4BRXA 2C5OA 4ZZMA 3QTXA 5JZJA 3DKGA 3S0OA 4U97A 5A6OA 5IKWA 3MBLA 3FMDA 4JT3A 2CPKE 4TYGA 3DKFA 3E7OA 4FSMA 4FG9A 4WRGA 5D41A 4ACCA 3MH2A 4NTTA 4XMOA 3E62A 4ASEA 5JKGA 3QGWA 3L9LA 1VEBA 3HA6A 4YLJA 3S3IA 4I20A 2RFSA 4F64A 2EXMA 2UZLA 4KS7A 4ZXTA 1DAYA 3BYVA 3VUHA 4CNHA 2EWAA 3MB6A 4JLCA 5AR4A 1BYGA 2YN8A 2GSFA 2CCIA 3HV6A 1A9UA 4HYUA 4I1ZA 4YPDA 4GS6A 4I41A 1TQPA 2Y4PA 4XG2A 3AMYA 2BVAA 2YISA 4ZTQA 1YXXA 2WTWA 2X8IA 4QD6A 4RQVA 2ITTA 1ZLTA 2B0QA 3LKMA 1ZWSA 3DU8A 3R71A 1KOBA 1W82A 3FBVA 4DCEA 4PQNA 1LEZA 1YI3A 2O5KA 1XBBA 4BCJA 2R0UA 5CI7A 3DBFA 3NW5A 4G6LA 3GU7A 4JDJA 4TNBA 5EM5A 5FQDC 3G15A 2HW6A 4IH8A 2QHMA 2W06A 4M0ZA 4FVQA 5IQIA 2UW9A 5L8JA 1OMWA 3Q3BA 2WMSA 3UYSA 3PVUA 4AXAA 5IDNA 3NIEA 3SRVA 3QD0A 2R3HA 4DGLC 3JUHA 5E90A 1OIYA 4PP7A 5HBEA 1OKZA 4L46A 4J98A 3Q4UA 4YLLA 3ZH8A 2HY81 4I3ZA 4D1XA 4ZTLA 2I1MA 2GS7A 5I3OA 2VWWA 4TZRA 4D2RA 4DLIA 4AGDA 2C30A 4O7NA 3KCFA 2Z7SA 4FTNA 4M69B 2C6TA 2OXXA 4IWQA 3I7BA 3ET7A 4ZY6A 1UKIA 5AA8A 2H96A 3V5JA 2DS1A 4WIHA 2BHHA 2ESMA 4FTLA 3OCSA 3NCGA 4AE9A 4IC8A 4QTEA 3UZTA 2WEIA 1M2PA 2X7GA 4CZTA 1ZXEA 3KXXA 3JXWA 3QWKA 2QOLA 2J4ZA 4LGGA 3BU5A 4XLIA 4EOSA 2QCSA 1XH7A 3OUNB 5D11A 2PE1A 3EQDA 2CKEA 3MGYA 4NM7A 4B4LA 5BPYA 1V0BA 3DY7A 3GU8A 3HX4A 3LJ1A 5CAUA 4WNPA 3HDMA 1NA7A 4HVSA 3NUNA 3PY0A 5HIBA 4D0XA 4Q2AA 4GFOA 2W9ZB 4EH5A 1TQMA 4XV3A 4AGWA 4D2PA 3JY0A 5DVRA 4DAWA 4EWHA 4EOLA 3GOPA 3R2BA 4NK9A 5M09A 3NVKI 2P0CA 5C8KA 2C5YA 4AN9A 2PK9A 2QODA 2E9OA 2QLQA 3ZRLA 4BYJA 4ERKA 3JVSA 4FV4A 3L8SA 4L43A 1OITA 3W2RA 3SW4A 3ZUVA 4DH5A 4NJDA 2O0UA 3FXWA 1YHWA 4F65A 3CJFA 4M14A 4BWPA 2GQRA 3H9OA 2GFSA 3MFRA 3EIDA 3KY2A 4WG5A 4YBKA 1PXIA 2X6DA 3EYHA 3R1YA 3VBQA 4LMUA 3VAPA 5E4HA 3NW6A 2Y6OA 2O64A 3F6XA 2CGWA 2O63A 2RGPA 3GCQA 5FDXA 3BGZA 1WVXA 1Q8WA 3A62A 4GUBA 4WD5A 5CSXA 5L2QA 3V04A 4GT3A 2HELA 4OTRA 2JAMA 5HLPA 2BMCA 5DT3A 3QYZA 4YHTA 4DINA 4DH3A 1H1SA 5DNRA 5M55A 4L67A 4YJOA 4Z9LA 4EUTA 5KKRC 2C0IA 3F7WA 3LZBA 4FTTA 4IAYA 5FEQA 3RWQA 3O50A 1WBVA 3ZSGA 4G9RA 4HNFA 4TPTA 1URCA 2WELA 3MI9A 4JDIA 3POOA 5L8KA 4BCKA 3ZMMA 5A6NA 4BWKA 5DYJA 4I6BA 1STCE 2GFCA 1FQ1B 3CY3A 4EI4A 5BVNA 4I92A 3DQWA 4OR5A 4FV9A 1OL5A 4AZEA 4MEDA 5A4TA 4DFZE 2C6EA 4JBOA 4BC6A 2Z02A 2O2UA 4AT4A 4XHKB 3U8WA 4BBFA 3I4BA 3VBTA 1PXMA 3D0EA 3F2AA 4OAVB 3ODYX 5DBXA 4ZSJA 5HG8A 4DFNA 1OL6A 4QP9A 3R8VA 3UP7A 1WZYA 4FNXA 3CIKA 4RIXA 4CLIA 5JQ8A 5KMIA 3LFCA 2BDFA 3AC3A 4FT9A 4HGEA 3SV0A 5HVYA 5F9EA 2IVUA 5HCZA 3B2TA 3AC4A 2I6LA 3R21A 4LRMA 4CZUA 4DEBA 5L2IA 4YZDA 4JJRA 4YMJA 3BLRA 3COHA 4F1TA 3LM5A 2WMVA 2QOOA 1OL7A 4K6ZA 3UOLA 2C5XA 4YNEA 3VF8A 1T45A 3SXRA 4QMWA 3K2LA 4IJPA 3PSBA 3QXPA 4MNEB 2WZJA 4IVDA 3M42A 4ZP5A 3UMXA 2ACXA 4ZMFA 3TTJA 3EFWA 4BBMA 3KFAA 5I9ZA 3DCVA 4I5HA 1ND4A 1ZARA 5C26A 4KBCA 2AUHA 2XH5A 4G34A 5BYLA 2JFMA 4IVAA 2C6DA 4F9AA 1IEPA 3CBLA 4RVKA 5M56A 3BYOA 5HX8A 3VRZA 2VGPA 2VNYA 3DDPA 4A9RA 3GCUA 4AT3A 4U3ZA 1GIJA 4IACA 4RFYA 5CU4A 3NAYA 3EL8A 4J95A 5C01A 1H1RA 4ANMA 3OTVA 3TIZA 5IH6A 5KMNA 4QMYA 5HESA 4YJQA 4DTKA 5HG9A 4ZSAA 2JDSA 4QMTA 1P14A 4TL0A 3QTZA 3W1FA 2XYUA 2OZOA 4BCNA 3GU5A 4AAAA 1UU3A 4OTWA 3Q9XA 4B7TA 3QQKA 5CEQA 4EH4A 3TN8A 1BL7A 2PMIA 5CI6A 3BCEA 2JBOA 4PV0A 4BTKA 2F7ZE 4CYJA 4KIQA 2IW9A 3Q6WA 4C33A 2UW7A 1XR1A 3HRBA 3TDVA 4FIFA 3AC1A 5KMKA 4I4EA 3ROYA 4FODA 5HCXA 4IW0A 1Q99A 3EQFA 3HVCA 3GT8A 4JIKA 4WA9A 3AMBA 4AOTA 4AFEA 4P4CA 4ENXA 3RCDA 4RLKA 4AA4A 1J7UA 5M08A 2O65A 3CGFA 4DA5A 3EQGA 3FE3A 3NDMA 4L3PA 5DLSA 5EHYA 4F63A 3MVLA 4BDHA 4CEGA 4MD8E 2WXVA 4UWBA 3ATSA 4WKQA 5JGDA 3NZ0A 4FSQA 3DNEA 1YOMA 5DI1A 5M53A 1Q97A 1YW2A 2UVYA 5CVFA 3F66A 3W18A 3Q53A 4D58A 3Q6UA 3QX4A 1UKHA 2PVYA 2GQSA 5EYMA 1BKXA 3T3UA 1U5RA 2YAKA 5HE2A 3AG9A 2UUEA 3HRCA 1QPJA 3SQQA 3JY9A 3CD3A 3I60A 3VNTA 4DTAA 5KHXA 4W9WA 2OG8A 2VX1A 1H08A 1PJKA 2V22A 4MBLA 3LAUA 5I9UA 5DR2A 4C36A 4EZ5A 4M97A 4CQGA 4C4FA 5DR9A 3UOKA 1FGIA 2QC6A 3FSFA 4GIIA 3D5WA 4FEUA 4PDYA 1B38A 2CKOA 3OMVA 2ZVAA 3TEIA 4N57A 4PNKA 2HIWA 3GBZA 2J5EA 1JQHA 4LM5A 1XQZA 5HD7A 5AWMA 3PRFA 3VW8A 1O6LA 4LOQA 4CTCA 3PG3A 3L9NA 4YTIA 2W5HA 3R63A 4FKGA 4MWIA 3ZS5A 3FI8A 3IONA 3E93A 3VQHA 4AW2A 5CNNA 3V01A 1ZMVA 5HVJA 5J95A 5JFWA 5J7HA 4BCPA 3UO4A 5E8ZA 4QMLA 3WOWA 4FKTA 3WF5A 5AAFA 3FMJA 4KNBA 4ZSLA 1Y8YA 3QTRA 4FVRA 3VBYA 2UV2A 4F7JA 5DA3A 3ZBXA 1IRKA 4GJ3A 4MNEA 4U41A 5DOSA 3R8LA 3DBEA 3H30A 3W32A 4D5KA 3QRKA 2HW7A 3WZUA 1Q62A 4KD1A 3N51A 5AP4A 2JC6A 4D2VA 3NEWA 1TVOA 3JVRA 4WSQA 2QOKA 1WCCA 4Y85A 4MNFA 2VTIA 4IFCA 3PYYA 3E8NA 3IW5A 3AD5A 2JAVA 4QP3A 4KIKB 4OTHA 3QALE 3OT3A 1ZYJA 4NCTA 2FUMA 2ONLC 1OM1A 4RVLA 2I0YA 4YJUA 4YJNA 1FBNA 2F57A 2WMUA 5HTIA 3OW3A 3D5XA 4RIYB 4RFZA 4ENYA 3PVGA 4AZVA 1DS5A 4E5WA 1IAHA 4RVMA 3EQBA 3QRUA 3D15A 4Z3VA 5IDPA 5M57A 2E9NA 2OZAB 3OOMA 3KU2A 3TG1A 2PUUA 2PVLA 4IAIA 3O8PA 4JRVA 4BB4A 4E3CA 5LMKA 2X2MA 3R1SA 4TYHA 4CG9A 4FOBA 3OWKA 4FYOA 4RX9A 5E8SA 2P2HA 2YFXA 3I6UA 3OUKA 4DEDA 4AZWA 4G3FA 3TNQB 5FBOA 2J90A 4FV3A 5IA2A 1UU7A 4FKRA 2JIUA 3DAEA 3EN4A 4XV1A 3I6WA 3V6SA 1Q8YA 3ZU7A 4G17A 3ZCLA 4BKYA 5A54A 1Q4LA 2C6IA 2J5FA 1H00A 3GOKA 4WUNA 3TM0A 3RAIA 3VS7A 4B8LA 5FTOA 2XIKA 4C7TA 1IAJA 2YM6A 3KEXA 3C50A 4JBQA 3GUBA 2WEVA 4EKKA 5C03A 3IO7A 3QLGA 1AD5A 3BE2A 3FY0A 3OWPA 4IADA 4DGMA 5HTCA 1JAMA 2UZEA 3DXNA 2G1TA 5CASA 4DCAA 4CFNA 1H25A 5I3RA 2J9MA 3QUPA 3O8UA 3BKBA 4J7BA 2W96B 4ANOA 5K5NA 3KK9A 3F5XA 5T68A 3FY2A 5I9YA 5CANA 1JKSA 2CKQA 3LXLA 3BX5A 3DLZA 5FM2A 3SD0A 3O8TA 3A99A 3Q2MA 1REKA 3LIJA 2PZPA 5IMXA 4K9YA 3NYOA 2E9UA 4CT1A 2EB2A 3QCQA 5CT7A 4AOIA 1O9UA 3O51A 4FUYA 4TW9A 3JYAA 1LR4A 3HMMA 2HXLA 5H8EA 1OKWA 4N6YA 4Q9ZA 4UYAA 4DFXE 3FLYA 3P4KA 3ZLWA 1OL2A 3QZIA 4AGCA 4RJ6A 4I0TA 2EU9A 3PA4A 4UWCA 3ZXZA 4C4EA 4O0VA 3F3VA 2YCQA 2WMQA 3SKCA 1NT2A 2XIXA 3IECA 3IW6A 4JG7A 4U5JA 2CNUA 3LFBA 4FSWA 4CFXA 5D10A 3E3BX 2PUNA 5DR6A 3D7ZA 3QWJA 4NYEA 3HLLA 5IQEA 2J51A 4FG7A 2BZIB 2OFVA 3BV3A 1AGWA 1QPCA 4PP9A 4IZ7A 4K33A 4E7WA 1J1CA 3HV7A 3WIGA 3DBDA 3R7IA 2V5QA 4HVDA 4MH7A 5BVFA 5IA3A 5EK7A 5EW9A 2QO7A 4O1OA 2GNIA 3KL8A 4GRBA 5HHWA 4RZVA 4ASZA 5IEVA 2XIRA 2HCKA 4G16A 4RGJA 4NFMA 2ZV9A 4U43A 5JGBA 5IQDA 3FZ1A 1UV5A 4FVPA 4F6SA 3ZM4A 5AUVA 2WTDA 2CGUA 3O2MA 3TJDA 4QMUA 2QURA 5DPVA 1PHKA 4QMQA 5I9XA 3P7BA 2YERA 4XLVA 4ERWA 4U7ZA 3P79A 4D4SA 3R9RA 3ZZEA 2HZIA 4ZK5A 4OUCA 3ZSHA 4EOOA 2JKKA 3C13A 3NGAA 4W8DA 3VIDA 5CAQA 2OLCA 4HW7A 2C6MA 5KMMA 4MF0A 4G9CA 3PWDA 4V0GB 3R7UA 5L2TA 3WARA 1MRYA 4DBNA 3O17A 4MXCA 4O84A 4MVFA 2VGOA 3FLZA 1XH8A 3S95A 3DXPA 3LLAA 2QI8A 2HAKA 5E7RA 3LFNA 3W8LA 4D4VA 1OPJA 4WG3A 2B52A 3NUXA 2OO8X 2YM4A 1YOJA 5GIPE 2OI4X 2WQMA 3G9NA 4R1YA 4A4XA 1URWA 4M67A 1MRUA 2WTIA 3DT1A 3Q9ZA 4L01A 4WT6A 1G3NA 3QTQA 5CU0A 3Q60A 2VTQA 3QD3A 5HVKA 1UU9A 2GPHA 2F49A 5KBRA 3DDQA 1J3HA 3I0OA 2XNMA 2OBJA 3NMUF 4A4LA 3DJ7A 2UZUE 3HNGA 3PXFA 1ZYSA 3RPRA 4C02A 2E9PA 3OC1A 4EOMA 5IA0A 4GVJA 2NP8A 2XNEA 3P78A 4IB0A 4JDKA 4DFBA 3V5QA 1DI9A 3EN6A 4L00A 1G8SA 1Q61A 4FIHA 1IA8A 4KSPA 1YKRA 5BVEA 3UIBA 3RPSA 2CDZA 4DEHA 2KULA 5K4IA 3RVGA 5D9HA 2QO9A 1H4LA 5L6WL 3OXIA 4XOZA 5AV1A 4D2SA 2C3IB 1PXJA 4FTUA 4GMYA 2R3JA 3FAAA 4IWDA 4MBIA 4E8AA 1PXOA 4FKSA 5BVDA 1XHAA 4S31A 1JKTA 1SNXA 2W17A 4RIOA 2IPXA 5F95A 5M06A 2DYLA 2OSCA 2XUUA 2YJRA 4ZS0A 5HO7A 2XJ1A 1QL6A 4RG0A 4C3FA 4WUAA 5E92A 3OTUA 4AA5A 2YDJA 3LXNA 4YJRA 4I21A 3TV6A 3W16A 2RF9A 4F1OA 3D5UA 1OIUA 1JNKA 2PMNX 2VWZA 4GU6A 3VHEA 4Q5HA 5FP6A 4GK3A 3RMFA 4S30A 4BVUA 3RWPA 1SVHA 1GAGA 3U51A 2XK8A 2XK3A 3GC0A 4E4XA 5DMZA 5DRDA 5IISA 3VW6A 3R8UA 2JITA 3HA8A 3NRMA 4R7BA 4IAAA 4DGNA 5BUIA 1ZYDA 4L42A 3EMGA 5LVPA 3NYVA 1IR3A 5L4QA 3IQ7A 3FQEA 4NM3A 4Y46A 5GJFA 4N4SA 4HGSA 5GJGA 2GNHA 2UZNA 4XRLA 4BICA 5BUJA 3BBWA 4U6RA 1LUFA 2FSMX 2CNVA 3A60A 4P2KA 4QO9A 3ZRKA 5M4CA 3P86A 5AV2A 3TT0A 3VUIA 3FMEA 3D5VA 5KCVA 3F3UA 2XIZA 1CMKE 1XH6A 1HCKA 5EFQA 1GZOA 3IDBA 3HRFA 3AD4A 3EN9A 1RJBA 2Q0NA 3CR0A 1FVTA 4KINA 3CLYA 5FLFA 5CEIA 4R3CA 5H2UA 4E5BA 1PXKA 4BIDA 1XH5A 2C47A 3GQLA 4Q5EA 3HV3A 2XVDA 4GYGA 1ZMUA 4HYHA 4EH9A 3BPRA 3ORPA 4GJ2A 1FMKA 5CNOA 4RBLA 2I40A 5JFVA 2AYPA 4F09A 4U40A 1ERKA 3PDTA 2VUWA 4QTCA 4X3JA 4UN0C 2VRXA 3E92A 2BDWA 1JSTA 3A7JA 4G3EA 3OT8A 2O8YA 4ITJA 3LMGA 5CS6A 3FKNA 4RX8A 4D1SA 1YWNA 3DZOA 2ITOA 4ZJVA 5BVKA 4LG4A 5AUXA 4GT4A 1S9JA 3QHRA 5HOAA 4ACMA 3S1HA 5IU2A 4DLJA 5EYDA 3PWYA 3CQEA 3TI1A 3NWWA 5HBHA 3PXKA 4HYIA 5LXMA 3A61A 4B6LA 4W4WA 4ANNA 3TACA 4EC9A 4C61A 4O82A 1ZAOA 4QP4A 3QYWA 4MX9A 3UIUA 1XH4A 1JOWB 2FGIA 4KIOA 2PVNA 3HAVA 3LPBA 4D55A 4NW5A 1YDRE 4O7RA 3IKAA 3MVMA 2UZOA 3A8XA 2ITNA 2R0IA 3V8TA 3KRLA 4YSMA 2ITPA 5EM7A 2B9FA 4FF8A 5AR2A 3OY1A 4E1ZA 5HQ0A 2P55A 4BGQA 4FT7A 5EM8A 1U59A 2OH4A 2WMAA 3LE6A 3C4ZA 4QTDA 4DFLA 1YVJA 4IIRA 3S2PA 5L8LA 5C9CA 2HK5A 3LXPA 5EI8A 1JVPP 3FQSA 3QQFA 3SOCA 3HMPA 3ZO3A 4B0GA 4D9TA 2ITQA 3TNPC 2UZDA 4R3PA 4DGOA 1QPDA 3U55A 5E1SA 1VYZA 4MTAA 3PJ8A 4QQJA 5HLWA 2GDOA 4O0YA 4F1MA 4YZ9A 3K3JA 5J5TA 5IEYA 3CKXA 3MYGA 4J71A 4FEVA 2PVKA 2DWBA 2ZM4A 3RCJA 2V7AA 2RSVA 1M2QA 4PL5A 5A4QA 4II5A 3ALOA 2FYSA 4ALVA 2C4GA 2XCKA 2W1CA 3ROCA 1PXNA 1P2AA 1W7HA 2AC3A 2UVZA 2WTCA 4HOKA 5K0KA 1E9HA 4RWLA 4NJ3A 4F0GA 4AZSA 4JG6A 4GIHA 2IW6A 4MD7E 3FYKX 4G3GA 4R7IA 3FZOA 2PUPA 4BZDA 4UYNA 3O96A 4CKRA 2UW3A 4KS8A 5DN3A 4FV7A 3EOCA 3AD6A 4DHFA 3W55A 5JZNA 5ANGA 5A3XA 4BTJA 4GFMA 4JXFA 4EZ7A 3B8QA 3UNKA 2YIQA 3EKNA 3ZEPA 2VWBA 5TT7A 2R64A 3Q4CA 1QCFA 4YSJA 5E8YA 4F4PA 4ZLYA 1O6YA 1Q24A 2WMWA 4A9TA 2PUIA 5TOZA 1K9AA 3HUBA 5K5XA 3DBQA 2A4LA 3I1AA 3C1XA 4O6EA 1YI4A 3NUUA 3T8OA 2OK1A 4C58A 1CKIA 1H0WA 2QQ7A 4GU9A 4CRSA 3A7GA 4LGHA 5HNBA 4BCMA 2X8DA 3MVHA 3GC9A 4EBVA 2QG5A 4L9IA 4EUUA 3I79A 5GHVA 5TF9A 4BDIA 5JN2A 2C3LA 3FV8A 3K3IA 2BILB 4ALUA 4PF4A 5CXHA 1XWSA 4CYIA 4M8TA 5IQFA 2UZWE 2YIYA 1H1QA 1XBCA 1Y91A 4OTFA 4AG8A 5HG5A 3QCSA 4E20A 4MF1A 4QP1A 4G3DA 2YABA 2WNTA 3BLHA 4FZDB 4JR7A 4RC3A 4RIWB 4O0SA 4IJ9A 5IA1A 3B8RA 3CQWA 5AAEA 3VRYA 4ZLZA 2YJSA 1V0OA 1ZOGA 2HXQA 3CEKA 3EFLA 4NT4A 4O2PA 3KXNA 3V8SA 3TZ8A 3VC4A 4HGTA 5AUZA 3MESA 4I5PA 2JEDA 2BAJA 2QD9A 5D1JA 5DG5A 4FEXA 4HNIA 2VTAA 2XA4A 4H3BA 4C2VA 4ZY4A 3TZ9A 1GY3A 2R7IA 2IZTA 3OP5A 5ETCA 3RPYA 2ETRA 3KGAA 5K3YA 5EKOA 4JQEA 3D4QA 4QT1A 3MB7A 4MKCA 4EHVA 4ITIA 3DJ5A 2FH9A 2BFYA 3QZHA 5D12A 5ETFA 2PE2A 3NW7A 4C3RA 4C34A 1J91A 3UNZA 5FEEA 4MXAA 4PTCA 4ACDA 4CMUA 3PJ1A 4C37A 3KRWA 3AC5A 2YM5A 2XNPA 1OUYA 4XYFA 5J9ZA 1P5EA 3DAJA 2H8HA 4G3CA 3TNHA 3FSKA 3QA0A 1FPUA 3QQLA 3F2NA 5AIRA 5J79A 2YIXA 2XRUA 2OJ9A 3LCTA 4K1BA 4CTBA 4DH7A 3QTWA 1WFCA 5AX3A 1F3MC 4NL0A 4ANQA 5EHOA 2HZNA 2QG7A 4PRJA 2ERKA 2VNWA 3QKLA 4RQKA 4F70A 4YO4A 4O7VA 2GU8A 5LMKC 3LFSA 3MFTA 5C8MA 3KN5A 4RX5A 4RJ3A 1Q3DA 1VR2A 4R7HA 4YUQA 3OY3A 4L8MA 5G6VA 1ZYCA 4EH2A 4EK3A 3LMIA 5HU9A 5A9UA 3ODZX 4QNYA 4BCOA 3D7TA 2FVDA 4FT0A 3FHIA 3U6IA 4IAZA 4OT5A 3AC8A 4DGGA 1KE6A 2IVSA 4FG8A 4OBQA 5HORA 4YBJA 4RWIA 4GSBA 1R1WA 4NIFB 5HE1A 3FXZA 3WBLA 2IZUA 2PVHA 4IMYA 2UW0A 1XH9A 3A4OX 5M4FA 3DXQA 4E6QA 4IVCA 2BAQA 4FTIA 5BQ0A 4D0WA 3T3VA 2XM8A 3CD8A 4OTGA 4AZTA 2R3LA 4KB8A 2R4BA 4H05A 3OF0A 4FSYA 4Y8DA 3A7IA 5LCJA 5FWKK 3M2WA 1AQ1A 5HICA 3I7CA 5AP6A 1CTPE 4F9YA 4LL0A 4PDSA 4ZJIA 4S34A 2C6OA 4O1PA 4FGRA 4ZMEA 2Y6MA 2JLDA 4CV9A 1KE7A 5K4JA 4DEGA 3FL5A 2W4OA 3BU3A 1I44A 3RNYA 4BTMA 5EOBA 2XNGA 3Q4ZA 3TKHA 3VVHA 2VTLA 1M14A 5J8IA 4U79A 4O0TA 1H07A 4KKHA 4TT7A 1M2RA 4JR3A 2O3PA 3R28A 3BEGA 2J0KA 3NX8A 5F4NA 3PXRA 4R6VA 5EKNA 3BHTA 1FGKA 4OTIA 2R3IA 5KE0A 5T3QA 3WILA 2LAVA 3W2OA 5J9LA 4TYJA 5GJDA 4S32A 5DE2A 2QHNA 2BR1A 3GU4A 3BELA 4ZJJA 3ZSIA 3QHWA 2EVAA 2GHLA 4J8NA 1NXKA 4RC4A 4XG6A 1WVWA 5IUHA 3SOAA 1IA9A 4FZAB 2FSTX 2J6MA 4U9AA 5HIEA 4FE2A 4M15A 4M69A 4L44A 4FK6A 3BHVA 3R9NA 2PPQA 4KWPA 4W4VA 3DK6A 4TWNA 5AR8A 3ZO2A 4AZFA 2R5TA 2JDTA 3QFVA 4QMPA 4QYEA 3PVWA 2QKRA 4CZYB 4EOPA 3QZFA 5B2MA 4PPAA 2NRUA 4M7IA 2G9XA 2F2CB 2W0JA 3G0FA 2ZJWA 5FXQA 3NPCA 2OH0E 1OKYA 4IB1A 3KMWA 3WIKA 3UO6A 4A07A 3COKA 4CFVA 2A1AB 4MXYA 1CKPA 2R3QA 4W9XA 2QU6A 2HWPA 2YDKA 3EL7A 3QTUA 3MPTA 5CSWA 3ITZA 3V3VA 4QQTA 4O86A 3QCXA 4IE9A 3BRBA 5FD2A 3EZRA 3NUYA 4E4LA 2R3NA 4HJOA 1GIIA 4BGHA 2CN8A 3P1AA 2W1HA 3HDNA 3GB2A 4B8MA 3MFUA 2ETMA 3GQIA 1J1BA 4EORA 3RAKA 2WU7A 3U6HA 1PXLA 4DEEA 4BYIA 4P5ZA 5CF8A 3FKLA 1NW1A 5IQAA 2BKKA 4LYNA 4X2KA 4Y73A 5KKRB 5C4KA 2X7FA 3MJ2A 5H9BA 3IGGA 2BZJA 2NPQA 3BYMA 5HEZA 4KAOA 3C4XA 5KZIA 2CCHA 2VU3A 3FXXA 4LMNA 3UG2A 4AN2A 1U54B 2QONA 2RFEA 4EYJA 4CLJA 3SA0A 4AWIA 3PA3A 5GZAA 3FUPA 2IO6A 2UW4A 2B54A 2PZ5A 3C0HA 2ZB1A 2AC5A 5KMJA 2QU5A 1KE8A 1OIQA 2BKZA 5LVMA 1ZZLA 4UY9A 5IMEA 1Z9XA 4CSVA 2Z60A 4FEQA 2GQGA 2R2PA 4H3PA 3UE4A 4BCFA 4E93A 5GZ8A 3OW4A 5M4IA 2PVMA 4NUSA 1WVYA 2C1BA 2VTSA 4GFGA 4FICA 4BIBA 3LHJA 4V04A 5M51A 1YXTA 2WOUA 3OD6X 2KTYA 4FNWA 4WOVA 4FIIA 4OBPA 5CU3A 4IXPA 4XV2A 4IX6A 1KWPA 5HGIA 5TO8A 4TY1A 4O7TA 5IQBA 3QXOA 2X8EA 5ACBC 4LOOA 4K18A 4XBUA 5I9VA 2CHLA 4APCA 2ZDUA 3EN7A 1GZKA 4QPMA 3KN6A 5H3QA 3RAHA 3KF7A 4E5AX 3BQCA 5IH4A 1PKGA 3R7OA 2PZYA 2W5AA 5DIAA 4OW8A 4BDBA 3B2WA 4L68A 2WTJA 3SDJA 1KV2A 2G2HA 4J97A 2WTKC 5J87A 4KRDA 2J0JA 4O0RA 4C4HA 3H9FA 3QQUA 4FSTA 3E63A 4YJPA 3BHYA 3FI2A 2YDIA 1NVSA 1PKDA 2RG6A 2WOTA 3QX2A 4JRNA 4USEA 5EQYA 3F2RA 4QQCA 4RZWA 2BTRA 3PPJA 3UNJA 4R77A 4YZMA 3F82A 2ITVA 5JSMA 4P5QA 3NR9A 5EG3A 3S4QA 4EK4A 4Z7GA 1YWRA 4QMZA 3I5NA 3LW0A 3U4WA 4AOJA 5BYYA 1PMEA 4UZHA 4X3FC 3PXQA 4A06A 3OWJA 2P2IA 1KE5A 3G0EA 4QP8A 3KXHA 2FB8A 3VS6A 2FSOX 4HVIA 5IH5A 4LFIA 4AFJA 3RM6A 4ZZNA 3LLTA 4CMTA 4RWKA 4BDGA 2XP2A 3E8DA 4UB7A 3BHHA 4BKZA 3NYNA 3ETAA 3HYHA 2C5NA 2YCSA 5DFPA 3GNIB 3HAMA 3PLAE 2ZAZA 5J9YA 4FKJA 4CV8A 5I9WA 5I5ZA 4L52A 5C8NA 4U42A 1Y8GA 4F0IA 2VWUA 4GV1A 3BEAA 3BWJA 3EN5A 3VUDA 4GKIA 3VF9A 5K0XA 3MH1A 3C5UA 4F6UA 4FSNA 4QMNA 2WMBA 2W1DA 1BMKA 1JSVA 4IAFA 5D7AA 3U9CA 1A06A 4GL9A 3ZEWA 4E4MA 1U4DA 2W99B 2XIYA 4K0YA 1W84A 4JBPA 3LFDA 4C35A 4EJNA 3FC2A 3EB0A 3MTFA 2H34A 3KCKA 3O0GA 4RWJA 5E8VA 4A7CA 1B39A 3ID6C 3UZRA 2R3MA 1SMHA 3D83A 2R9SA 4CFWA 4CKJA 4UXQA 5EYCA 1XO2B 4H1MA 4KABA 3E64A 3RKBA 3ZM9A 4MQ2A 1NY3A 3FMKA 3F5PA 1OGUA 4TYEA 4O7LA 2B9IA 3Q5IA 3GGFA 4MAOA 3UTOA 3MA6A 4NTSA 3AGMA 5FM3A 4HGLA 4EOQA 4XP2A 4QQ5A 4D2WA 3KB7A 4J52A 2C6LA 1CM8A 2W1IA 2YLEA 4HCUA 4HVHA 3JR1A 4PTGA 1NVRA 1KE9A 4LOPA 2W05A 5IQHA 2WMXA 3W2PA 4FKOA 3D9VA 3ZFYA 4CXAA 3UBDA 1F0QA 2W5BA 2JIVA 2Y9QA 3COMA 4IBMA 4L3JA 2YWVA 1UA2A 1A48A 4Y95A 2J0LA 4RJ4A 3ENHA 3EQCA 3TUCA 3PSDA 4ZTSA 5KO1A 3ORKA 2OJIA 2UZTA 3C4FA 5DRBA 3MY5A 2VTTA 4FMQA 5CEPA 2W1ZA 2QR7A 3F61A 4V01A 3BQRA 3QU0A 1EH4A 3V5TA 2WQNA 3FYJX 4FV6A 2C1AA 5EI2A 5CSVA 4AW0A 5L2WA 3QD2B 3ZLSA 1Q8ZA 4BDAA 2X9FA 3RK7A 4NKSA 3MSSA 3KRRA 3GI3A 3VBVA 2R3OA 4DG3E 3LCKA 1V1KA 4OTQA 1G5SA 4Z16A 3NUAA 4Q9SA 4BR3A 1SYKA 4BDJA 2RKUA 3OXTA 5GINE 5EQPA 1UVRA 4BTFA 3AQVA 4XP3A 4YJSA 2OFUA 3EQHA 1ZOHA 2XYNA 1ZZ2A 1ZY5A 3FMHA 3HEGA 3PPKA 3Q04A 5E8TA 5EH0A 3PSCA 3RZBA 2HZ0A 4IZ5A 4QYFA 4X3FB 3RK5A 1OPLA 5A4CA 4USFA 3I81A 2YWPA 3QC9A 4GUEA 5K9IA 3OXZA 2ETKA 2XS0A 2QKWB 3R7VA 2BRGA 5JMSA 4IFGA 3KULB 3MIYA 1OBDA 4YURA 4LUEA 4FNYA 5B7VA 2VWYA 4IVBA 2I0HA 2R3GA 3O71A 5LMBA 3CY2A 3DS6A 3FLNC 4C3PA 4KBKA 3S00A 1SZMA 2B53A 4FSRA 1LP4A 3F3WA 3CTHA 2HENA 3VBXA 5A46A 2PMOX 4M84A 4FEWA 4JL9A 5DGZA 1VYWA 2BROA 5AUYA 1Q8TA 1FOTA 3E8CA 3C0IA 5M4UA 2BZHB 3F3ZA 2ZV8A 4TNDA 3G2FA 2QR8A 3KK8A 4ITHA 4KIKA 5ETAA 4XOYA 2NNWB 2ITWA 2XNBA 2BTSA 2F2UA 4IM3A 1YI6A 5DT0A 4RIYA 3UVPA 3MV5A 2YACA 4RA4A 3A7HA 5J7BA 3QUDA 4DT9A 2I0EA 2OZAA 2XJ2A 3CXWA 3FMLA 4L6QA 4R3RA 4WBOA 2CGVA 2CLXA 3GU6A 5AV3A 3UVRA 1ZMWA 3V8WA 4B9DA 3DB6A 3ZHPC 2Z8CA 2XKEA 5ANDA 4F9WA 1KV1A 4BI0A 4CG8A 4FTMA 1BI8A 4G6NA 2W1EA 4YLKA 3JPVA 4O6LA 2XM9A 2YM3A 4MK0A 2BFXA 3SAYA 1DAWA 2WMRA 4EHZA 3PJ3A 3FZTA 2GCDA 1TKIA 1FVVA 3FHRA 4FBXA 1MP8A 3RTPA 3UODA 4EH3A 2NO3A 4P7EA 3LQ3A 3LFQA 4QMOA 2YCRA 4CCUA 4ALWA 4DITA 4OAUC 1L8TA 3HMNA 4F9CA 4DH1A 1Y6AA 4FKUA 5BVOA 5JRQA 5AA9A 4J99A 2F7EE 2C3JA 5KUPA 3K5VA 1MRVA 4IEBA 5H8BA 3PJCA 5A14A 3BIZA 2VTNA 4NFNA 4K2RA 3U87A 2OW3A 4H39A 1R0PA 3ACKA 4CFFA 5J1WA 4O0UA 4J96A 2QVSE 4ZOGA 3DFCB 3DZQA 3GEQA 4S33A 4J8MA 3BHUA 5CEMA 4X7QA 4PY1A 2EUFB 4I6HA 4C38A 3LOKA 5E8UA 2VZ6A 4AS0A 2SRCA 3MIAA 3OCGA 4L53A 5CSPA 5B2LA 5ACKA 2XNOA 3PTGA 3VS2A 1APME 5HKMA 3W2CA 3SC1A 3Q2JA 4RVTA 3PE2A 4JNWA 5CENA 2XRWA 4MXOA 2X4ZA 4MCVA 3FWQA 5EYKA 3DA6A 4XX9A 4QRCA 2PMLX 1P4FA 5BNJA 3P5KA 5FTQA 5FG8A 3JS2A 1WBOA 3EKKA 5EI6A 5IEXA 2XKFA 5CLPA 2YEXA 3NNUA 1GNGA 2JD5A 2ZDTA 4G31A 4O27B 4MYGA 1OUKA 2UZBA 1J7IA 2YA9A 1H26A 3IW4A 4Y5HA 2QOQA 3F69A 4JIAA 2VAGA 3ZC5A 4EOJA 5BX0A 4JX3A 2JGZA 2BRBA 2ZMDA 1HCLA 3R6XA 4I24A 4ZEGA 3POZA 3NUSA 4Y72A 1W8CA 1W98A 1MQ4A 2PZRA 3KRXA 3MY1A 3BGQA 1UNHA 2CJMA 3BLQA 3DKCA 4EQCA 5KMOA 5AR5A 5KX8A 3FPMA 3WYXA 3QLFA 1W0XC 3P08A 3UMWA 4AN3A 4IZAA 1GZ8A 3DGKA 4EONA 2XNNA 2C68A 3U54A 1SM2A 1PF8A 2BZKB 2X0GA 3PLSA 3EQPA 5CAOA 5AP1A 1REJA 1WMKA 2XKCA 3FZPA 5CF5A 3QBNA 4D9UA 4L7FA 3IDPA 4U8ZA 5H8GA 4RLLA 4C4IA 4F9BA 5DT4A 3NNVA 4BKJA 4Z7HA 2OICA 2WB8A 3F5UA 4RC2A 5F1ZA 1VZOA 2JIIA 3SRVB 1Q3WA 4PPCA 3LMHA 4V0GA 2CGXA 1M7NA 2GS2A 2RG5A 2XKDA 4UBAA 2F9GA 4YTHA 2OF2A 3BYSA 3AXWA 3RGFA 5AM6A 5FGKA 2JKOA 1RW8A 3HP5A 4D28A 3ZYAA 4PX6A 3V5WA 3ZUTA 3ZFMA 4NSTA 5G1XA 2C0TA 4BHNA 3IK3A 4G5JA 2ITUA 4NH1A 4I5CA 4V05A 4BN1A 5AIKA 3CTQA 1G8AA 5C4LA 5DH3A 3VO3A 2BUJA 4GT5A 5CSHA 2EB3A 3QD4A 4ZS4A 4HCVA 3FLQA 4XG3A 2YZLA 3NNWA 2B55A 4E4NA 2B4SB 1LPUA 4R1VA 3CQUA 3GC7A 3COIA 3KKVA 3OCTA 2FSLX 3P0MA 2VTJA 4BBEA 4N6ZA 3GCSA 3BZ3A 5HO6A 3R9OA 4AQCA 4ZTMA 1WBSA 2XBAA 3E8EA 4X6QC 2PVRA 4O83A 3ORTA 3GENA 1JKKA 4DFUA 4QP2A 4O81A 4H1JA 5CU2A 3EJ1A 4WNOA 2VWVA 3OG7A 3BBTB 5E1EA 5LWMA 4HCTA 4ZTRA 2PHKA 3C51A 3R00A 3RNIA 4FV5A 1ZRZA 4OTDA 3KA0A 2BPMA 2YIWA 4JAJA 3QQGA 3UPXA 4F7NA 5EHLA 5BMSA 2XCHA 3LFAA 4UMQA 4FIJA 4R5YA 4YHJA 4NKAA 4FIGA 2WD1A 3AT3A 4C0TA 2PU8A 2OKRA 2IJMA 1BX6A 1ZY4A 3OBJA 4I5MA 3OEFX 1YXUA 3UJGA 3RINA 3LQ5A 4PL3A 5TE0A 4X0MA 4KIPA 1YWVA 5LCKA 5FBNC 4E73A 2XK4A 3SG8A 3UO5A 3L9MA 3ANRA 2RFDA 4MXXA 4N70A 4AA0A 3EFJA 3L8VA 4LRJA 5CALA 1W83A 2XK6A 5LMAA 2GMXA 3TV4A 5IQGA 4FKVA 3R83A 2BIKB 3F5GA 3G51A 3LJ0A 3U9NA 1Y6BA 2C0OA 4F08A 3R04A 3QA8A 1MQBA 4IWOA 4QNAA 3SXFA 3FEGA 2C69A 2B9JA 1Q8UA 4JBVA 3ZZWA 3ZFXA 2OJJA 3K54A 3P9JA 3RPVA 3U6JA 3MVJA 5DEWA 4EOIA 3UOJA 1CDKA 2Y4IC 4FR4A 4XG4A 3CPBA 5ANOA 3ALNA 3ERKA 4GEOA 4D4YA 3H9RA 4I23A 3CGOA 1BL6A 2CNQA 1RE8A 4UV0A 4RSSA 2VTRA 1KUTA 4RIXB 1KSWA 5AV4A 1H24A 4TWCA 3NCZA 4AW5A 3UQFA 3HGKA 3QTSA 1WBNA 2WPAA 4O21A 2QNJA 5IA5A 4HVGA 4CGAA 4UXLA 2QO2A 2V55A 4C59A 1YHVA 3IPHA 3VJNA 4YJTA 2WGJA 4BDFA 3AT2A 1QMZA 4EKLA 1ZOEA 5IZFA 2QOIA 5IUIA 1CSNA 4NWMA 4EOKA 3NLBA 3TZMA 1B6CB 1BUHA 3RALA 1LEWA 4WRSA 4MXZA 4CMOA 3FI4A 3ZLYA 2R7BA 4CD0A 4E6AA 2QOBA 4YZBA 3K5UA 4GW8A 4PDPA 1QPEA 3UP2A 2CMWA 3CPCA 4R5SA 3FL4A 4UMRA 3D94A 4QTBA 4UALA 3KVWA 2BAKA 4DEAA 4FA2A 5CX9A 4GYIA 2BHEA 1XBAA 3G6HA 2G2IA 3TZ7A 4IC7A 5JFSA 4O0WA 3O7LD 1SNUA 5HE0A 1NVQA 4G5PA 2VTMA 3HV5A 3KRJA 3UZPA 2BRMA 3FDNA 3R02A 4KA3A 4XP0A 4CT2A 5FXSA 4FGBA 4ANSA 5ANEA 3GXLA 4RMZA 4WNMA 3BWFA 4ACGA 2WO6A 3RK9A 5T6KA 3IW7A 4HYSA 5FEDA 1IASA 3SXSA 1OZ1A 1V0PA 4M68A 5E8XA 3QUEA 4NCTC 4E6DA 4QMXA 1R78A 2GNLA 5HO8A 4QMMA 3PIZA 5JFXA 1H1WA 3LCSA 3PE1A 2RFNA 2GNFA 3R7GA 1SVGA 4O96A 4UWYA 4X2GA 2UW5A 4JS8A 5IQCA 5ICPA 2J7TA 2ZOQA 4K77A 3MDYA 3MPMA 3I0QA 3ZONA 2V0DA 3QRTA 5J5SA 3R01A 4FL3A 2PY3A 3T9TA 5A4LA 5FP5A 3ZLXA 3TNWA 4FL2A 3CSVA 2ITZA 5CWZA 3W10A 5CU6A 3M1SA 3ORZA 3PFQA 3GVUA 3T9IA 5HIDA 4YU2A 4CRLA 4W4XA 4C4GA 4KKGA 3DV3A 2PZIA 4C4JA 5JK3A 4RJ7A 1JWHA 1J7LA 4AGUA 3A2CA 2VO0A 3R2YA 2X4FA 3HUCA 4C8BA 2JDOA 4K8AA 2V7OA 4WBBB 2ZV7A 5AX9A 4U44A 1TQIA 5LQFA 3ACJA 3EQRA 3SVVA 1PRYA 3D14A 4OLIA 3ZOSA 3W8QA 4BHZA 3ULZA 4L3LA 5AP0A 1Z5MA 3AT4A 1YRPA 3P23A 5EOLA 5AEPA 3HMIA 2J2IB 5JH6A 3KMMA 3WF6A 3ORLA 4LV8A 3F3TA 2Y4IB 1K3AA 3CJGA 4H58A 2B1PA 5CTPA 1L3RE 2OXDA 1PYEA 4LI5A 3RHKA 3TNIA 4TN6A 4QYGA 3UIXA 1GJOA 3MH3A 4I0RA 4UZDA 4PL4A 3THBA 3KXMA 4YTCA 4XG8A 2VV9A 2CKPA 2E9VA 3BI6A 3H4JA 5CZIA 5CQWA 4JOAA 4AUAA 5AR7A 3PRIA 4UEUA 2NRYA 1JLUE 4YC8A 4CVAA 3FKOA 5IF1A 4A4OA 3NNXA 2OIQA 3MPAA 2UVXA 3EYGA 4QYHA 4IB5A 5KZ0A 4FX3A 3IOKA 3VS5A 5CAPA 3V51A 3NUPA 4RIWA 4A9SA 3F7ZA 4YP8A 3RP9A 2X39A 3VUTA 5AR3A 3CC6A 1M52A 5J1VA 5EQEA 1DM2A 3C9WA 2GTNA 4H3QA 3ORIA 4FTOA 3QGYA 3GCPA 4I22A 4YNOA 3UGCA 4W4YA 5CQUA 2FA2A 5AUUA 2Q83A 5FUTA 2JDVA 2A0CX 4IX5A 4C2WA 3PUPA 2GHMA 4Z55A 1OIRA 1FVRA 5CT0A 5A4EA 4OBOA 5HX6A 4XEYA 3GFEA 2OF4A 3R8PA 3G9LX 2XK9A 3DK3A 2HY0A 4YGAA 3PVBA 3DBCA 5FDPA 4JVGA 4RJ5A 3H10A 5AUWA 4EQUA 3PXYA 4FT3A 3HV4A 5DWRA 4GG5A 4NM5A 5M44A 1YOLA 3TWJA 4GCJA 4DF3A 3W2QA 5F20A 4ZY5A 2W4JA 3R8MA 2X6EA 5HD4A 2BALA 3NSZA 4LQMA 5AP7A 5E8WA 4CFUA 2VTPA 3R8ZA 1UWHA 2XBJA 1H8FA 3LM0A 4G6OA 4IHPA 5HZNA 3PY1A 2HYYA 2JBPA 4IX4A 4CCBA 2PULA 1F5QA 3C0GA 4RX7A 3REPA 1WAKA 3NYXA 2VTHA 3RAWA 4J53A 3FZSA 3UVQA 5AAGA 2F4JA 3BYUA 3PY3A 3R30A 3RM7A 4TYHB 1OB3A 4LV5A 4ASXA 4APPA 4FNZA 2YIRA 1K2PA 1OVEA 4TTHB 1S9IA 2C5VA 3TDWA 3VS4A 3WE4A 4R78A 4FZ7A 4AP7A 2W7XA 2YZAA 4ZZOA 4RT7A 4FIEA 5IUGA 4AT5A 4BCIA 3OCBA 3UQCA 2Q0BA 4ZTHA 5ANJA 3ATTA 3QAME 2RL5A 5LOHA 3E3PA 3E5AA 3MWUA 3D2KA 2OGVA 4YZCA 3R73A 4U81A 3A8WA 4AF3A 4FV0A 3OS3A 5JQ5A 2GS6A 4NIFA 1XKKA 2VO6A 1RQQA 3LCDA 5AP5A 4K11A 4FKWA 4QPSA 5ANKA 2PWLA 3EZVA 3CS9A 5HCYA 3ZC6A 2W9FB 4EJ7A 4UX9A 1JBPE 4FKPA 1Z57A 2LGCA 3GCVA 4FTKA 4O91A 3KQ7A 1R39A 4MHAA 5AM7A 2WMTA 3QC4A 5TKDA 4FKQA 4HPTE 5AV0A 2R3PA 2G15A 3MS9A 3A7FA 4FV2A 4IDTA 4DC2A 3AOXA 3FQHA 2REIA 5CF6A 2GHGA 2UW6A 3QQJA 4BCHA 1YQJA 3KXZA 3KF4A 2IZRA 3IG7A 4B99A 3Q4TA 4PMTA 5EM6A 3ULIA 3WZKA 1YXVA 4OGRA 4A9YA 4BCQA 4QPAA 2ZV2A 2YCFA 2VO7A 4BZNA 3RI1A 4FTJA 4IX3A 4NEUA 5GIOE 2WHBA 3FI3A 4YO6A 3TCPA 5LARA 2Z7QA
chains in the Genus database with same CATH superfamily
3LFFA 3AKJA 3N4VA 1PW2A 4IB3A 2PVFA 5CVGA 3ZDUA 4F0FA 2EXCX 3PG1A 3UG1A 1Q5KA 3V5PA 3PZEA 2P33A 1JSUA 3TJCA 5L2SA 3SW7A 4O7SA 4WHZA 1OL1A 2X2LA 4MBJA 2BDJA 1VJYA 3Q9YA 3KC3A 5DEYA 3N4UA 4IM0A 5LVLA 4FZFB 2X7OA 4RFMA 2ERZE 3EH9A 3L8XA 4RA5A 3FMMA 4O22A 2Z7RA 4R8QA 4IWPA 4YC6A 2G2FA 3N9XA 4WO5A 3ZTXA 4FKIA 4GH2A 2F7XE 4Y83A 2DUVA 3FJQE 4BIEA 4D2TA 5LJJA 4JG8A 3AMAA 4YHFA 4XJ0A 1M17A 3O7LB 4ARKA 3SHEA 4FKLA 3C4CA 4ZAUA 4PNIA 4BF2A 3OZ6A 5AP2A 3DAKA 3ELJA 5L6PA 1PYXA 3OVVA 3Q5ZA 3QKMA 4PUZA 4FI1A 2FO0A 3HP2A 3G5DA 4TRLA 4YJVA 3UQGA 2IVTA 4AU8A 4ONAA 2WIHA 1H0VA 2QOCA 4BDEA 3ZO1A 3DTCA 4ANBA 2BIYA 4ORKA 2RIOA 5HI2A 4BL1A 5BUEA 4PWNA 5AADA 5HG7A 3Q96A 3OEZA 4XNEA 3D2IA 4RRVA 5EDQA 3VS0A 4ZLOA 3HECA 4DE4A 2JKQA 3Q32A 3VS3A 5ITAA 3NIZA 5M07A 5I0BA 4LUDA 2WFYA 3TTIA 5KNJA 1PMVA 4BFMA 3RZFA 5HU3A 3NAXA 4QMVA 2XEZA 2J50A 4F7SA 3ORXA 5D7VA 2BCJA 2JFLA 2PTKA 3Q52A 5TR6A 4D1ZA 4PTEA 4D5HA 5CAVA 3MJ1A 3ZXTA 3M11A 4IANA 3TKUA 3LVPA 3BE9A 4EK5A 2W1GA 1H27A 3ORMA 2A2AA 2YITA 3ZO4A 1SVEA 5HTBA 4FTRA 4KRCA 2QLUA 3EQIA 3QRJA 2ZMCA 1DI8A 4DHZA 3KXGA 4FT5A 5E9EA 1U54A 5B2KA 4O38A 4AW1A 3QZGA 4BCGA 2C3KA 4QTAA 4YZNA 3R7YA 1P4OA 3OOGA 5GZ9A 3GP0A 4HPUE 2P3GX 2B9HA 2CSNA 2QOHA 4LGDA 4BDCA 3LJ2A 1PY5A 4JDHA 3R0TA 1BLXA 2I0VA 5JGAA 4U80A 3UOHA 3DLSA 3E87A 4IZYA 3HL7A 3QRIA 2E2BA 5FRIA 2R3RA 4TWPA 4O7ZA 4XG7A 3VONA 3UYTA 3LCOA 1PMNA 2WTKB 1UNLA 3Q9WA 4BI2A 2XAMA 2IW8A 5BMMA 4P90A 3CP9A 2X9EA 3F88A 4FV1A 3O23A 4AACA 3NS9A 3OWLA 2WKMA 3ENMA 3PJ2A 4UMUA 4XG9A 4XUFA 3EFKA 1UWJA 3DQXA 1Y57A 2WQEA 2Z2WA 4X2FA 2VTOA 1GZNA 3ORNA 4ACHA 4JX7A 2PYWA 4FV8A 3TL8A 5FTGA 2XZSA 5HE3A 1U46A 3MW1A 3VUMA 4XH6A 3VBWA 3VQUA 4CQEA 3UPZA 4IQ6A 1M7QA 5CVHA 2IG7A 3AC2A 3L9PA 4EYMA 2UZVA 4EHGA 4BDDA 5FXRA 2ZB0A 2WU6A 2OWBA 3ZRMA 3FLWA 4LL5A 5CY3A 3H0ZA 4X2NA 4EWQA 4O0XA 4EC8A 2EXEA 4C62A 3E7VA 1PMUA 4EK8A 2G01A 3KMUA 3N4TA 4M3QA 4FYNA 3W2SA 3QKKA 2WTVA 4BWXA 1T46A 4ZSGA 3PZHA 2GTMA 3HMOA 4L7SA 4I94A 4M0YA 2BRNA 5CZHA 4YR8A 5CXZA 4IAKA 4TKSA 4M13A 1Q41A 4PMSA 4NZWB 2VX0A 4U0IA 2CLQA 5HNIX 2X81A 4DH8A 3SX9A 1OKVA 4FL1A 4IM2A 3VUGA 5CEKA 3R9HA 3WF9A 2H6DA 4UMPA 4AE6A 2Y7JA 2A27A 4QYYA 2V62A 4TWOA 2OU7A 2OXYA 3SLSA 3RJCA 3UDBA 4BY9E 4DEIA 3V6RA 4W8EA 5HLNA 4U45A 5I4NA 2NYAA 2H9VA 4XS2A 2J0IA 3BGPA 3VS1A 4X6RA 5AJQA 1UU8A 4JI9A 3UC3A 3MN3A 5DHJA 1E1XA 3DTWA 2PVJA 3TV7A 3DK7A 2R3KA 3H0YA 3LQ8A 4PMMA 3CTJA 4I93A 1YDSE 3FPQA 5AMNA 5L6OA 1R0EA 2VX3A 3DFAA 3IOPA 4JQ7A 3VULA 4BZOA 1GIHA 4N0SA 3QTIA 3HZTA 3PIXA 1OGYA 2XANA 5JRSA 3WI6A 4JAIA 3C7QA 3FLSA 4IDVA 4TXCA 5B0XA 2UW8A 3VWAA 2WQOA 1WBPA 5KBQA 3RHXA 4HZRA 3G33A 3IDCA 3AGLA 3PP0A 2W4KA 4DG0E 1WBTA 2IWIA 4BGGA 4DG2E 2B7AA 1I09A 4E6CA 2P4IA 3KVXA 4PPBA 3MTLA 4AX8A 4RPVA 1ATPE 3SGCA 2ZFYA 1YDTE 2X1NA 4FK3A 3DKOA 3A4PA 5EDPA 2HZ4A 4Y5QA 4LRKA 2VWXA 3FC1X 2XMYA 2YAAA 3BU6A 5IA4A 4KUJA 4NM0A 4C57A 5ANIA 4DFYA 2YM7A 4XBRA 5AFVA 3WE8A 2OIDA 2BRHA 2OJGA 2IN6A 3ZBFA 2DQ7X 5BYZA 4YTFA 3L8PA 1YHSA 4DDGA 4EH6A 5F94A 2HOGA 3G6GA 3R1QA 4I0SA 3II5A 4FC0A 4MD9E 3VJOA 3RBWA 3NFGB 3VUKA 3IW8A 4GKHA 2ITXA 3PA5A 5IPJA 4CFMA 4I6FA 4XRJA 3PPZA 3WF7A 3QCYA 2WAJA 2ZM1A 2ITYA 4USDA 5C27A 1E1VA 2Z7LA 2CN5A 4J1RA 4FOCA 2VO3A 4F99A 5KMLA 2QOFA 3O5AA 4L45A 2HWOA 2R3FA 2PSQA 3NVMB 2WQBA 3SG9A 2YM8A 4S2ZA 3WZDA 3TUBA 4H36A 4M66A 1WBWA 4GG7A 3GFWA 3LFEA 1IG1A 1U5QA 3GC8A 4XV9A 2OIBA 2IZSA 1HOWA 3P7AA 4ID7A 4X3FA 4O2ZA 3WZEA 4PMPA 3BL9A 1UNGA 4GK2A 2X2KA 3CE3A 4FTCA 1R3CA 4BI1A 3DJ6A 2A19B 3OFMA 2J0MB 3KULA 3CKWA 4ZTNA 1XJDA 4ANLA 5L3AA 5EW8A 3KREA 5E91A 3BV2A 3UC4A 3WYYA 4DTBA 2C6KA 3DPKA 3PFYA 1CKJA 4U3YA 4OTPA 3TKIA 3ANQA 3PP1A 4O7YA 4EL9A 1H1PA 4YPSA 5AUTA 3R1NA 4MQ1A 4CKIA 3MA3A 4WSYA 2ONLA 3VN9A 2PL0A 3R9DA 3UDSA 3E88A 4FSZA 2PE0A 3IGOA 3EHAA 3MFSA 3WZJA 4QOXA 5CEOA 2ZYBA 1KOAA 5GNKA 4EBWA 2JKMA 4G1WA 4EK6A 1YXSA 5CYIA 4F7LA 3MH0A 5BVWA 1ST4A 4HZSA 1W2FA 2XEYA 3L1SA 2I7QA 4FZ6A 3ZDIA 3FZRA 1BI7A 1PXPA 1OECA 4M12A 2VWIA 3LXKA 3V5LA 4O7WA 3C5IA 5ETIA 4I6QA 3RPOA 5LWNA 1OPKA 1ZYLA 3I5ZA 4TYIA 4O4DA 4YC3A 1RDQE 2VN9A 4D4RA 4KBAA 2Y0AA 4EHEA 4OT6A 3TXOA 5CF4A 4MWHA 4EH8A 2XJ0A 4FTQA 3ZUUA 3UIMA 3VHKA 4JQ8A 5HBJA 4EQMA 1FINA 3PXZA 2W1FA 4ZSEA 3U4UA 3H3CA 4GVAA 4NU1A 5EW3A 3G90X 4BDKA 2GNJA 4X2JA 1OBGA 4WNKA 2YHVA 4X21A 4ASDA 3QL8A 4KKEA 3CCNA 5C1QB 4DT8A 2JDRA 3FMNA 4UMTA 1OI9A 1X8BA 5JEBA 5KHWA 4DDIA 3R22A 4EEVA 3C4WA 3F9NA 3OBGA 1JKLA 1H28A 3WF8A 4A9UA 3QF9A 4E26A 4F6WA 2A98A 3C4EA 4ZIMA 4QP7A 2Y8OA 4EZ3A 4KSQA 4DN5A 3IS5A 3TUDA 4DYMA 2YLFA 5LVNA 5EDRA 4NW6A 3P7CA 3OHTA 2WIPA 2OJFE 3PIYA 4DBXA 4WG4A 5JT2A 4QMSA 3W33A 1GOLA 2IVVA 5AP3A 4XCUA 3TIYA 2VD5A 4FUXA 3AKLA 4G2FA 3HKOA 2ZM3A 4RJ8A 1H01A 4PDOA 2XB7A 3DOGA 4QP6A 3DB8A 2XK7A 1O6KA 3MY0A 3QQHA 4FSUA 4FTAA 3DNDA 4GK4A 2XF0A 3D7TB 1JPAA 2GNGA 1FMOE 4EH7A 1MUOA 3R7EA 5LVOA 5HNGA 5IG1A 4I4FA 3EWHA 3OROA 4BRXA 2C5OA 4ZZMA 3QTXA 5JZJA 3DKGA 3S0OA 4U97A 5A6OA 5IKWA 3MBLA 3FMDA 4JT3A 2CPKE 4TYGA 3DKFA 3E7OA 4FSMA 4FG9A 4WRGA 5D41A 4ACCA 3MH2A 1G8JA 4NTTA 4XMOA 3E62A 4ASEA 5JKGA 3QGWA 3L9LA 1VEBA 3HA6A 4YLJA 3S3IA 4I20A 2RFSA 4F64A 2EXMA 2UZLA 4KS7A 4ZXTA 1DAYA 3BYVA 3VUHA 4CNHA 2EWAA 3MB6A 4JLCA 5AR4A 1BYGA 2YN8A 2GSFA 2CCIA 3HV6A 1A9UA 4HYUA 2AQXA 4I1ZA 4GS6A 4I41A 1TQPA 2Y4PA 4XG2A 3AMYA 4YPDA 2BVAA 2YISA 4ZTQA 1YXXA 2WTWA 2X8IA 4QD6A 4RQVA 2ITTA 1ZLTA 2B0QA 3LKMA 1ZWSA 3DU8A 3R71A 1KOBA 1W82A 3FBVA 4DCEA 4PQNA 1LEZA 1YI3A 2O5KA 1XBBA 4BCJA 2R0UA 5CI7A 3DBFA 3NW5A 4G6LA 3GU7A 4JDJA 4TNBA 5EM5A 5FQDC 3G15A 2HW6A 4IH8A 3W0QA 2QHMA 2W06A 4M0ZA 4FVQA 5IQIA 2UW9A 5L8JA 1OMWA 3Q3BA 2WMSA 3UYSA 3PVUA 4AXAA 5IDNA 3NIEA 3SRVA 3QD0A 2R3HA 4DGLC 3W0OA 3JUHA 5E90A 1OIYA 4PP7A 5HBEA 1OKZA 4L46A 4J98A 3Q4UA 4YLLA 3ZH8A 2HY81 4I3ZA 4D1XA 4ZTLA 2I1MA 2GS7A 5I3OA 2VWWA 4TZRA 4D2RA 4DLIA 4AGDA 2C30A 4O7NA 3KCFA 2Z7SA 4FTNA 4M69B 2C6TA 2OXXA 4IWQA 3I7BA 3ET7A 4ZY6A 1UKIA 5AA8A 2H96A 3V5JA 2DS1A 4WIHA 2BHHA 2ESMA 4FTLA 3OCSA 3NCGA 4AE9A 4IC8A 4QTEA 3UZTA 2WEIA 1M2PA 2X7GA 4CZTA 1ZXEA 3KXXA 3JXWA 3QWKA 2QOLA 2J4ZA 4LGGA 3BU5A 4XLIA 4EOSA 2QCSA 1XH7A 3OUNB 5D11A 2PE1A 3EQDA 2CKEA 3MGYA 4NM7A 4B4LA 5BPYA 1V0BA 3DY7A 3GU8A 3HX4A 3LJ1A 5CAUA 4WNPA 3HDMA 1NA7A 4HVSA 3NUNA 3PY0A 5HIBA 4D0XA 4Q2AA 4GFOA 2W9ZB 4EH5A 1TQMA 4XV3A 4AGWA 4D2PA 3JY0A 5DVRA 4DAWA 4EWHA 4EOLA 3GOPA 3R2BA 4NK9A 5M09A 3NVKI 2IEWA 2P0CA 5C8KA 2C5YA 4AN9A 2PK9A 2QODA 2E9OA 2QLQA 3ZRLA 4BYJA 4ERKA 3JVSA 4FV4A 3L8SA 4L43A 1OITA 3W2RA 3SW4A 3ZUVA 4DH5A 4FJVA 4NJDA 2O0UA 3FXWA 1YHWA 4F65A 3CJFA 4M14A 4BWPA 2GQRA 3H9OA 2GFSA 3MFRA 3EIDA 3KY2A 4WG5A 4YBKA 1PXIA 2X6DA 3EYHA 3R1YA 3VBQA 4LMUA 3VAPA 5E4HA 3NW6A 2Y6OA 2O64A 3F6XA 2CGWA 2O63A 2RGPA 3GCQA 5FDXA 3TMOA 3BGZA 1WVXA 1Q8WA 3A62A 4GUBA 4WD5A 5CSXA 5L2QA 4AXDA 3V04A 4GT3A 2HELA 4OTRA 2JAMA 5HLPA 2BMCA 5DT3A 3QYZA 4YHTA 4DINA 4DH3A 1H1SA 2IF8A 5DNRA 4L67A 5M55A 4YJOA 4Z9LA 4EUTA 5KKRC 2C0IA 3F7WA 3LZBA 4FTTA 4IAYA 5FEQA 3RWQA 3O50A 1WBVA 3ZSGA 4G9RA 4HNFA 4TPTA 1URCA 2WELA 3MI9A 4JDIA 3POOA 5L8KA 4BCKA 3ZMMA 5A6NA 4BWKA 5DYJA 4I6BA 1STCE 2GFCA 1FQ1B 3CY3A 4EI4A 5BVNA 4I92A 3DQWA 4OR5A 4FV9A 1OL5A 4AZEA 4MEDA 5A4TA 4DFZE 2C6EA 4JBOA 4BC6A 2Z02A 2O2UA 4AT4A 4XHKB 3U8WA 4BBFA 3I4BA 3VBTA 1PXMA 3D0EA 3F2AA 4OAVB 3ODYX 5DBXA 3TYKA 4ZSJA 5HG8A 4DFNA 1OL6A 4QP9A 3R8VA 3UP7A 1WZYA 4FNXA 3CIKA 4RIXA 4CLIA 5JQ8A 5KMIA 1XMLA 3LFCA 2BDFA 3BLAA 3AC3A 4FT9A 4HGEA 3SV0A 5HVYA 5F9EA 2IVUA 5HCZA 3B2TA 3AC4A 2I6LA 3R21A 4LRMA 4CZUA 4DEBA 5L2IA 4YZDA 4JJRA 4YMJA 3BLRA 3COHA 4F1TA 3LM5A 2WMVA 2QOOA 1OL7A 4K6ZA 3UOLA 2C5XA 4YNEA 3VF8A 1T45A 3SXRA 4QMWA 3K2LA 4IJPA 3PSBA 3QXPA 4MNEB 2WZJA 4IVDA 3M42A 4ZP5A 3UMXA 2ACXA 4ZMFA 3TTJA 3EFWA 4BBMA 3KFAA 5I9ZA 3DCVA 4I5HA 1ND4A 1ZARA 5C26A 4KBCA 2AUHA 2XH5A 4G34A 5BYLA 2JFMA 4IVAA 2C6DA 4F9AA 1IEPA 3CBLA 4RVKA 5M56A 3BYOA 5HX8A 3VRZA 2VGPA 2VNYA 3DDPA 4A9RA 3GCUA 4AT3A 4U3ZA 1GIJA 4IACA 4RFYA 5CU4A 3NAYA 3EL8A 4J95A 5C01A 1H1RA 4ANMA 3P5JC 3OTVA 3TIZA 5IH6A 5KMNA 4QMYA 5HESA 4YJQA 4DTKA 5HG9A 4ZSAA 2JDSA 4QMTA 1P14A 4TL0A 3W0NA 3QTZA 3W1FA 2XYUA 2OZOA 4BCNA 3GU5A 4AAAA 1UU3A 4OTWA 3Q9XA 4B7TA 3QQKA 5CEQA 4EH4A 3TN8A 1BL7A 2PMIA 5CI6A 3BCEA 2JBOA 4PV0A 4BTKA 2F7ZE 4CYJA 4KIQA 2IW9A 3Q6WA 4C33A 2UW7A 1XR1A 3HRBA 3TDVA 4FIFA 3AC1A 5KMKA 4I4EA 3ROYA 4FODA 5HCXA 4IW0A 1VLRA 1Q99A 3EQFA 3HVCA 3GT8A 4JIKA 4WA9A 3AMBA 4AOTA 4AFEA 4P4CA 4ENXA 3RCDA 4RLKA 4AA4A 1J7UA 5M08A 2O65A 3CGFA 4DA5A 3EQGA 3FE3A 3NDMA 4L3PA 5DLSA 5EHYA 4F63A 3MVLA 4BDHA 4CEGA 4MD8E 2WXVA 4UWBA 3ATSA 4WKQA 5JGDA 3NZ0A 4FSQA 3DNEA 1YOMA 5DI1A 5M53A 1Q97A 1YW2A 2UVYA 5CVFA 3F66A 3W18A 4QEBA 3Q53A 4D58A 3Q6UA 3QX4A 1UKHA 2PVYA 2GQSA 5EYMA 1BKXA 3T3UA 1U5RA 2YAKA 5HE2A 3AG9A 2UUEA 3HRCA 1QPJA 3SQQA 3JY9A 3CD3A 3I60A 3VNTA 4DTAA 5KHXA 4W9WA 2OG8A 2VX1A 1H08A 1PJKA 2V22A 4MBLA 3LAUA 5I9UA 5DR2A 4C36A 4EZ5A 4M97A 4CQGA 4C4FA 5DR9A 3UOKA 1FGIA 2QC6A 3FSFA 4GIIA 3D5WA 4FEUA 4PDYA 1B38A 2CKOA 3OMVA 2ZVAA 3TEIA 4N57A 4PNKA 2HIWA 3GBZA 2J5EA 1JQHA 4LM5A 1XQZA 5HD7A 5AWMA 3PRFA 3VW8A 1O6LA 4LOQA 4CTCA 3PG3A 3L9NA 4YTIA 2W5HA 3R63A 4FKGA 4MWIA 3ZS5A 3FI8A 3NFFB 3IONA 3E93A 3VQHA 4AW2A 5CNNA 3V01A 1ZMVA 5HVJA 5J95A 5JFWA 5J7HA 4BCPA 3UO4A 5E8ZA 4QMLA 3WOWA 4FKTA 3WF5A 5AAFA 3FMJA 4KNBA 4ZSLA 1Y8YA 3QTRA 4FVRA 3VBYA 2UV2A 4F7JA 5DA3A 3ZBXA 1IRKA 4GJ3A 4MNEA 4U41A 5DOSA 3R8LA 3DBEA 3H30A 3W32A 4D5KA 3QRKA 2HW7A 3WZUA 1Q62A 4KD1A 3N51A 5AP4A 2JC6A 4D2VA 3NEWA 4QDEA 1TVOA 3JVRA 4WSQA 2QOKA 1WCCA 4Y85A 4MNFA 2VTIA 4IFCA 3PYYA 3E8NA 3IW5A 3AD5A 2JAVA 4QP3A 4KIKB 4OTHA 3QALE 3OT3A 1ZYJA 4NCTA 2FUMA 2ONLC 1OM1A 4RVLA 2I0YA 4YJUA 4YJNA 1FBNA 2F57A 2WMUA 5HTIA 3OW3A 3D5XA 4RIYB 4RFZA 4ENYA 3PVGA 4AZVA 1DS5A 4E5WA 1IAHA 4RVMA 3EQBA 3QRUA 3D15A 4Z3VA 5IDPA 5M57A 2E9NA 2OZAB 3OOMA 3KU2A 3TG1A 2PUUA 2PVLA 4IAIA 3O8PA 4JRVA 4BB4A 4E3CA 5LMKA 2X2MA 3R1SA 4TYHA 4CG9A 4FOBA 3OWKA 4FYOA 4RX9A 5E8SA 2P2HA 2YFXA 3I6UA 3OUKA 4DEDA 4AZWA 4G3FA 3TNQB 3AKKA 5FBOA 2J90A 4FV3A 5IA2A 1UU7A 4FKRA 2JIUA 3DAEA 3EN4A 4XV1A 3I6WA 3V6SA 1Q8YA 3ZU7A 4G17A 3ZCLA 4BKYA 5A54A 1Q4LA 2C6IA 2J5FA 1H00A 3GOKA 4WUNA 3TM0A 3RAIA 3VS7A 4B8LA 5FTOA 2XIKA 4C7TA 1IAJA 2YM6A 3KEXA 3C50A 4JBQA 3GUBA 2WEVA 4EKKA 5C03A 3IO7A 3QLGA 1AD5A 3BE2A 3FY0A 3OWPA 4IADA 4DGMA 5HTCA 1JAMA 2UZEA 3DXNA 2G1TA 5CASA 4DCAA 4CFNA 1H25A 5I3RA 2J9MA 3QUPA 3O8UA 3BKBA 4J7BA 2W96B 4ANOA 5K5NA 3KK9A 3F5XA 5T68A 3FY2A 5I9YA 5CANA 1JKSA 2CKQA 3LXLA 3BX5A 3DLZA 5FM2A 3SD0A 3O8TA 3A99A 3Q2MA 2X0QA 1REKA 3LIJA 2PZPA 5IMXA 4K9YA 3NYOA 2E9UA 4CT1A 2EB2A 3QCQA 5CT7A 4AOIA 1O9UA 3O51A 4FUYA 4TW9A 3JYAA 1LR4A 3HMMA 2HXLA 5H8EA 1OKWA 4N6YA 4Q9ZA 4UYAA 4DFXE 3FLYA 3P4KA 3ZLWA 1OL2A 3QZIA 4AGCA 4RJ6A 4I0TA 2EU9A 3PA4A 4UWCA 3ZXZA 4C4EA 4O0VA 3F3VA 2YCQA 2WMQA 3SKCA 1NT2A 2XIXA 3IECA 3IW6A 4JG7A 4U5JA 2XAOA 2CNUA 3LFBA 4FSWA 4CFXA 5D10A 3E3BX 2PUNA 5DR6A 3D7ZA 3QWJA 4NYEA 3HLLA 5IQEA 2J51A 4FG7A 2BZIB 2OFVA 3BV3A 1AGWA 1QPCA 4PP9A 4IZ7A 4K33A 4E7WA 1J1CA 3HV7A 3WIGA 3DBDA 3R7IA 2V5QA 4HVDA 4MH7A 5BVFA 5IA3A 5EK7A 5EW9A 2QO7A 4O1OA 2GNIA 3KL8A 4GRBA 5HHWA 4RZVA 4ASZA 5IEVA 2XIRA 2HCKA 4G16A 4RGJA 4NFMA 2ZV9A 4U43A 3ML1A 5JGBA 5IQDA 3FZ1A 1UV5A 4FVPA 4F6SA 3ZM4A 5AUVA 2WTDA 2CGUA 3O2MA 3TJDA 4QMUA 2QURA 5DPVA 1PHKA 4QMQA 5I9XA 3P7BA 2YERA 4XLVA 4ERWA 4U7ZA 3P79A 4D4SA 3R9RA 3ZZEA 2HZIA 4ZK5A 4OUCA 3ZSHA 4EOOA 2JKKA 3C13A 3NGAA 4W8DA 3VIDA 5CAQA 2OLCA 4HW7A 2C6MA 5KMMA 4MF0A 4G9CA 3PWDA 4V0GB 3R7UA 5L2TA 3WARA 1MRYA 4DBNA 3O17A 4MXCA 4O84A 4MVFA 2VGOA 3FLZA 1XH8A 3S95A 3DXPA 3LLAA 2QI8A 2HAKA 5E7RA 3LFNA 3W8LA 4D4VA 1OPJA 4WG3A 2B52A 3NUXA 2OO8X 2YM4A 1YOJA 5GIPE 2OI4X 2WQMA 3G9NA 4R1YA 4A4XA 1URWA 4M67A 1MRUA 2WTIA 3DT1A 3Q9ZA 4L01A 4O4BB 4WT6A 1G3NA 3QTQA 5CU0A 3Q60A 2VTQA 3QD3A 5HVKA 1UU9A 2GPHA 2F49A 5KBRA 3DDQA 1J3HA 3I0OA 2XNMA 2OBJA 3NMUF 4A4LA 3DJ7A 2UZUE 3HNGA 3PXFA 1ZYSA 3RPRA 4C02A 2E9PA 3OC1A 4EOMA 5IA0A 4GVJA 2NP8A 2XNEA 3P78A 4IB0A 4JDKA 4DFBA 3V5QA 1DI9A 3EN6A 4L00A 1G8SA 1Q61A 4FIHA 1IA8A 4KSPA 1YKRA 5BVEA 3UIBA 3RPSA 2CDZA 4DEHA 2KULA 5K4IA 3RVGA 5D9HA 2QO9A 1H4LA 5L6WL 3OXIA 4XOZA 5AV1A 4D2SA 2C3IB 1PXJA 4FTUA 4GMYA 2R3JA 3FAAA 4IWDA 4MBIA 4E8AA 1PXOA 4FKSA 5BVDA 1XHAA 4S31A 1JKTA 1SNXA 2W17A 4RIOA 2IPXA 5F95A 5M06A 2DYLA 2OSCA 2XUUA 2YJRA 4ZS0A 5HO7A 2XJ1A 1QL6A 4RG0A 4C3FA 4WUAA 5E92A 3OTUA 4AA5A 2YDJA 3LXNA 4YJRA 4I21A 4O4EA 3TV6A 2RF9A 3W16A 4F1OA 3D5UA 1OIUA 1JNKA 2PMNX 2VWZA 4GU6A 3VHEA 4Q5HA 5FP6A 4GK3A 3RMFA 4S30A 4BVUA 3RWPA 1SVHA 1GAGA 3U51A 2XK8A 2XK3A 3GC0A 4E4XA 5DMZA 5DRDA 5IISA 3VW6A 3R8UA 2JITA 3HA8A 3NRMA 4R7BA 4IAAA 4DGNA 5BUIA 1ZYDA 4L42A 3EMGA 5LVPA 3NYVA 1IR3A 5L4QA 3IQ7A 3FQEA 4NM3A 4Y46A 5GJFA 1XMMA 4N4SA 4HGSA 5GJGA 2GNHA 2UZNA 4XRLA 4BICA 5BUJA 3BBWA 4U6RA 1LUFA 2FSMX 2CNVA 3A60A 4P2KA 4QO9A 3ZRKA 5M4CA 3P86A 5AV2A 3TT0A 3VUIA 3FMEA 3D5VA 5KCVA 3F3UA 2XIZA 1CMKE 1XH6A 1HCKA 5EFQA 1GZOA 2XALA 3IDBA 3HRFA 3AD4A 3EN9A 1RJBA 2Q0NA 3CR0A 1FVTA 4KINA 3CLYA 5FLFA 5CEIA 4R3CA 5H2UA 4E5BA 1PXKA 4BIDA 1XH5A 2C47A 3GQLA 4Q5EA 3HV3A 2XVDA 4GYGA 1ZMUA 4HYHA 4EH9A 3BPRA 3ORPA 4GJ2A 1FMKA 5CNOA 4RBLA 2I40A 5JFVA 2AYPA 4F09A 4U40A 1ERKA 3PDTA 2VUWA 4QTCA 4X3JA 4UN0C 2VRXA 3E92A 2BDWA 1JSTA 3A7JA 4G3EA 3OT8A 2O8YA 4ITJA 3LMGA 5CS6A 3FKNA 4RX8A 4D1SA 1YWNA 3DZOA 2ITOA 4ZJVA 5BVKA 4LG4A 5AUXA 4GT4A 1S9JA 3QHRA 5HOAA 4ACMA 3S1HA 5IU2A 4DLJA 5EYDA 3PWYA 3CQEA 3TI1A 3NWWA 1G8KA 4LDTA 5HBHA 3PXKA 4HYIA 5LXMA 3A61A 4B6LA 4W4WA 4ANNA 3TACA 4EC9A 4C61A 4O82A 1ZAOA 4QP4A 3QYWA 4MX9A 3UIUA 1XH4A 1JOWB 2FGIA 4KIOA 2PVNA 3HAVA 3LPBA 4D55A 4NW5A 1YDRE 4O7RA 3IKAA 3MVMA 2UZOA 3A8XA 2ITNA 2R0IA 3V8TA 3KRLA 4YSMA 2ITPA 5EM7A 2B9FA 4FF8A 5AR2A 3OY1A 4E1ZA 5HQ0A 2P55A 4BGQA 4FT7A 5EM8A 1U59A 2OH4A 2WMAA 3LE6A 3C4ZA 4QTDA 4DFLA