4QMLA

Mst3 in complex with amp-pnp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
280
Chain Sequence
ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 280
sequence length 281
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmlA01
1BYGA 3BELA 4FTJA 2C6DA 3PFQA 1TVOA 4NM7A 1V0BA 3LXLA 2PZYA 3U9NA 3PY0A 4C4IA 2OXXA 4O7TA 4B7TA 2IW8A 2WMTA 3D9VA 5AADA 1T45A 4IZ7A 3DV3A 2YWVA 2BTRA 3CIKA 2WEIA 4D1SA 5LMAA 4AZFA 2XZSA 4FVRA 3ZMMA 1OL1A 1WBWA 2CCHA 2UZDA 4BDHA 4I24A 4BBFA 5IH4A 5EG3A 2ZYBA 4FKIA 4YZNA 5AM6A 4RJ3A 5F9EA 4E73A 4FEXA 1H1QA 1UU9A 4Q9ZA 4ITIA 4MVFA 2W99B 1Q8YA 4ZTSA 4JBVA 4AT3A 2UW6A 2A19B 5CF4A 4FE2A 4CSVA 4PDYA 1OKZA 4QQJA 5GJDA 4AE6A 4BIBA 4ZTHA 3BX5A 4C4GA 2GNFA 5EDRA 4EOJA 2KULA 3R8ZA 4DEAA 4PMPA 3IONA 3MWUA 2PVJA 3ERKA 3Q5IA 4O0SA 4OTRA 3BLRA 4CG9A 5EQEA 4OW8A 4Y8DA 1H4LA 4USFA 4K6ZA 2P55A 2UV2A 3LZBA 3OEFX 4C62A 4KIKB 5HHWA 5H2UA 2PTKA 4CFNA 4E26A 1OIQA 4WO5A 2JIUA 3PXZA 4ZY6A 4QOXA 3MJ2A 3TIYA 3I5NA 5TR6A 1Q5KA 3AC5A 3FZSA 2E9NA 2OICA 1JSTA 1PXOA 3HGKA 4IADA 3U4UA 1M14A 3OWPA 4EHEA 3G9NA 5AUTA 4O7RA 1IASA 4IB0A 4WKQA 3QHWA 5GJGA 3FDNA 2C6TA 5HVKA 1OL6A 1CKPA 2F2UA 4IWPA 1ERKA 2WTJA 5EI2A 4GKIA 5GIPE 4C4EA 1FPUA 4UMUA 3GP0A 3QCYA 3FUPA 4WNMA 4C35A 3Q52A 2BAKA 2AC3A 4GUEA 3TKHA 3BHHA 4D0WA 5K9IA 2IZRA 3O7LD 4FSNA 4WG4A 2W0JA 1MP8A 4WSYA 5J7HA 4FG7A 1SZMA 1PRYA 2QOCA 3ZH8A 4DC2A 4NM5A 4YLJA 4ANOA 2XRUA 2P3GX 1L8TA 2EWAA 3QD4A 3R28A 2OZAB 4AW0A 1XH9A 5JSMA 2BAQA 3EQHA 3MY0A 3TUDA 2OBJA 3RAKA 3W32A 3QQLA 4Y73A 5HD4A 4P7EA 3ZFYA 4F9AA 4AUAA 3R71A 5J87A 4XG3A 4AOJA 3R02A 4UWYA 3AC2A 4FKPA 2XCKA 2CN5A 2OZOA 4ASXA 3FXZA 2QKWB 4KRCA 3ZZEA 3EJ1A 3TUCA 3P7CA 2C47A 2GTMA 3R7GA 3RJCA 5CSWA 4I6QA 4FV5A 4YHFA 3R7VA 2O8YA 2OH4A 3RVGA 4RZVA 3I1AA 4CMUA 4CGAA 3POOA 3F2AA 2HCKA 4XP0A 4XS2A 4B6LA 2UW3A 4ZXTA 2GS6A 2W1IA 4ZMFA 4QMXA 4CFWA 3FMKA 2E9VA 2HZ0A 5DFPA 3I79A 3DFAA 5LMKC 3ZC6A 2GHGA 2WMQA 3ZDUA 5D9HA 1BI7A 3ZOSA 4GUBA 3FMJA 4I41A 2RF9A 5M57A 2QVSE 2WIPA 3QX2A 1JKKA 1Y8GA 4NTTA 5D12A 4BYIA 4CZTA 4QP1A 3EWHA 2QLUA 3PVGA 4FZ7A 1TQIA 2GTNA 2W9ZB 3BI6A 3O8UA 4S31A 2VTTA 1P5EA 2IWIA 2PE0A 3BV3A 3E88A 4UMTA 4V01A 5HNIX 4CRLA 5DEWA 4IIRA 2C6IA 1GZKA 2PE1A 1Q97A 3AGMA 3V5QA 4EOMA 3VUDA 3HUCA 3Q60A 3HV7A 3ZLWA 4R7IA 3PPKA 3DK6A 2GHMA 3D5WA 1FVRA 2XKCA 4ALWA 5LVOA 3EQBA 4RJ6A 5CENA 4A4XA 4ACDA 5TT7A 3DDPA 4F1OA 2Z02A 3EL7A 4C61A 4APCA 2YIYA 1FOTA 3D4QA 4DGLC 3JS2A 3M2WA 4ZSLA 2QU6A 4I93A 4LMNA 4IXPA 2QONA 2GU8A 1WAKA 3TXOA 3IOKA 2BKKA 3LFAA 3GOKA 4LL5A 4RLLA 2V55A 3QXOA 1SYKA 2R3GA 3IGGA 4G3DA 4QP3A 4ENXA 3CPCA 1TKIA 4C37A 2C1AA 4OTIA 4BKJA 3L9LA 4RZWA 3DTWA 4WNKA 5E9EA 3O8PA 4YJOA 4BI0A 1H1SA 3N4UA 4OTQA 3RTPA 2I0EA 5H8EA 1PW2A 3VJNA 5BX0A 3F3ZA 3TG1A 4O1OA 2ITTA 2CCIA 1X8BA 3OEZA 4IB3A 4MKCA 4KIKA 3RCJA 3RKBA 5LXMA 5FM2A 3ZTXA 5CALA 4ANLA 2R3KA 3U4WA 3ZLYA 4NKSA 4TNDA 3VS5A 4NW6A 4NKAA 3FKLA 4KBAA 1PXKA 1TQMA 4PNIA 2Z2WA 5GZAA 4BDIA 5JEBA 2A27A 2W4KA 2ZDUA 3DQWA 3VS4A 4FKSA 4M13A 3W8LA 3WILA 2A1AB 3LVPA 4JG7A 3SKCA 2QD9A 1B39A 2XMYA 4WNPA 2VWUA 4R5SA 3GC0A 5E8UA 4RC3A 2GHLA 3HZTA 3FLQA 1NY3A 5FBOA 4E4LA 5H3QA 2WXVA 3UNZA 4EH2A 4QP2A 3T9IA 2YIQA 2NNWB 2CKEA 2YA9A 4ASEA 5JK3A 1KV1A 4DLJA 2XBJA 2GDOA 1MQ4A 2REIA 5I5ZA 4H05A 4XLIA 3QLFA 3EMGA 4TNBA 2QO7A 2X2KA 2ITNA 2J5FA 2OZAA 3CD3A 3FLZA 4Q2AA 5BYLA 4FT7A 3D2KA 3PRFA 2QOOA 4ZK5A 4ZSAA 3FMEA 2OF2A 2RL5A 1MUOA 3R8VA 1Q8TA 4J8NA 3D83A 4GMYA 5HI2A 2R3LA 2VTIA 2C6OA 1SNUA 2UZLA 3KMWA 4XBUA 5CU3A 2QHMA 1FVVA 3GXLA 4UWCA 4ZLOA 3Q6WA 3ACJA 5CF8A 2WOUA 3SG9A 3QALE 2UW8A 3F9NA 4BDKA 3PY3A 1PY5A 4YJPA 4JLCA 1H25A 1CSNA 2OIDA 2Z7SA 2JDVA 5HNBA 3LCOA 4I94A 3E3PA 4M66A 2WMBA 5HCYA 3PA3A 3D5XA 4M0YA 5L4QA 4G3CA 2JEDA 4UV0A 5FP6A 3FL5A 3W8QA 3KXNA 2PU8A 3DCVA 4OAVB 2XCHA 4GG5A 3RNIA 2YITA 3MTFA 4EC8A 3CSVA 4EOPA 4TN6A 3Q9YA 1KV2A 2CPKE 2XK3A 2ZM3A 4YZMA 3V51A 3QA8A 3D94A 2C5YA 5EI6A 3G9LX 5CT0A 3ZSGA 3HAVA 4PTCA 2YM3A 3R8LA 3R9NA 4H1MA 3I7BA 2XNGA 4E6QA 2HW6A 2GMXA 1XH8A 3LXPA 5J9LA 3FZRA 5FWKK 4UN0C 4NUSA 5AMNA 4BIEA 4G5JA 2PMIA 4JRVA 5IH6A 3MA6A 5EQYA 3KFAA 4DGOA 3R1NA 3GQLA 4U79A 3NUYA 5KZ0A 3AD6A 3F3TA 4AAAA 5HX6A 2PUIA 4ORKA 4JDHA 4F9BA 5L6WL 4PF4A 3Q9ZA 3BEGA 1LPUA 5AA9A 3BHVA 4IBMA 5EOBA 3UC3A 1KUTA 4GRBA 3DAEA 3M42A 3R21A 3TCPA 3UPXA 4FV6A 3HYHA 2OO8X 4IC8A 5HO7A 3PY1A 2PZIA 2W05A 3IKAA 3W1FA 3NVMB 2XP2A 4GSBA 5CI7A 3GC9A 5D7VA 2W5HA 4FNYA 4D1ZA 4AACA 1UU8A 3L9NA 4G17A 1ZYCA 2ESMA 4U43A 2DWBA 3DTCA 3WZKA 3W2RA 3NCZA 2HWPA 3GU8A 3F3VA 1RQQA 4FX3A 2H34A 4EYJA 5IF1A 2VNYA 4HZRA 4G3FA 4FTUA 4ZZNA 3L8SA 4DFYA 4GT4A 4RX8A 3I60A 2XIYA 4IAYA 4BCNA 4U42A 5DT3A 1OPLA 4QMTA 2X9EA 4XYFA 4PMSA 4FZDB 4RA4A 4O82A 1OECA 5IQEA 3GNIB 4QQ5A 4AW5A 3KF4A 2X6DA 5CANA 3BWJA 3OUNB 4C2WA 1F0QA 4BWXA 3OP5A 3C4CA 4D2SA 3GCPA 2BROA 2R64A 5AV1A 3OWLA 2J5EA 5E91A 2EUFB 4U81A 4JL9A 4A9RA 4LL0A 3RHKA 3RPRA 2PMOX 2HXQA 3HMIA 3PZEA 2IO6A 5CI6A 2J7TA 4CRSA 3QXPA 2NP8A 3ZSHA 4PNKA 2F57A 1H01A 3RI1A 5L8LA 2I0YA 3JYAA 3ID6C 2PSQA 3GI3A 5C8KA 4BICA 5HLWA 4L7FA 4FTKA 3RALA 3COHA 3CLYA 3EHAA 3TNQB 3BU6A 3F3UA 4H39A 3UVRA 1H0VA 3PSBA 4IX6A 1ZRZA 3BYSA 4I5HA 4JBPA 1ZYSA 2ONLA 2JKMA 4S30A 4APPA 1JKTA 3KN5A 3EFWA 3RZBA 4BTFA 2OJJA 5CNNA 2PZ5A 1NXKA 4O81A 4XOYA 2J6MA 4CTBA 5K4IA 2VTJA 4BCQA 1P2AA 3ZEPA 5CVHA 2YHVA 1SVHA 3VUHA 5A46A 3UZPA 4EK4A 4XJ0A 3MTLA 1U46A 2XK9A 4FT3A 4I21A 4O6LA 2HK5A 4QYHA 5TOZA 1IAHA 2BHHA 3UE4A 2IVSA 4A9SA 2WMWA 3R30A 2JBOA 4RIXB 3FY0A 2R3JA 4ZOGA 5B2KA 3FI8A 2Z7QA 3IS5A 4BDDA 1J91A 4CKJA 1ZXEA 4R1VA 5EKOA 1FBNA 4MBIA 4CCBA 1OBDA 2WMXA 3FHIA 2VO0A 4HVDA 3U51A 3OOGA 5KKRB 3H3CA 2XF0A 4LGDA 4RG0A 1Q8ZA 2VO3A 4B4LA 5CAPA 3UPZA 3DKGA 2J0MB 3TM0A 4FKVA 2WTVA 5CSVA 2QG7A 3BLHA 4X7QA 2GS2A 3TNHA 4WG5A 4EQCA 3ORZA 4NYEA 3K5UA 3NEWA 2HZIA 4F9YA 1GNGA 2IG7A 5IA4A 4GFGA 1IG1A 3QKKA 4HGEA 4W8EA 1PF8A 2XEZA 4V0GA 3KGAA 2EB3A 3BGPA 3A2CA 2Y0AA 4AX8A 4DG0E 2E9OA 2JDTA 3VUIA 3F69A 1APME 1DAWA 4J52A 4PY1A 5FEDA 3WZDA 4PTGA 2X4FA 4ACCA 2UVXA 4O2ZA 4YC8A 4F1MA 4C4HA 4MK0A 2QURA 5DHJA 4JR7A 5FTOA 3HDNA 3HMPA 4O7LA 4ZJIA 3KK8A 5ANIA 2YCSA 4TYHA 3BYMA 2BRGA 3D5VA 3S95A 4GFMA 4CFXA 3CTJA 2YAKA 3OHTA 1FMOE 1YXVA 4IWOA 3DK7A 2JFMA 4I6HA 5HORA 2J2IB 2HELA 5IMXA 3HL7A 4F7LA 2WMUA 2ZJWA 2C5VA 2JLDA 1PMUA 5M44A 4AP7A 4IFGA 5K3YA 3A99A 1R78A 5CXZA 3QX4A 3F7WA 5AP5A 5CX9A 3E93A 5BVWA 3ROYA 4FOCA 2ZV9A 4UYNA 3DOGA 4I6BA 3MPAA 4AN3A 1S9IA 3B2TA 5IEYA 4O7WA 3OS3A 3N9XA 1OL2A 1H07A 3VW8A 4GU6A 3KU2A 2W1DA 4ZJVA 3F2NA 4IANA 3VC4A 2BRNA 4FSYA 2FSLX 1U5QA 4O0TA 5HG9A 1YKRA 4YZBA 3VULA 4DGMA 3OC1A 4OT5A 4JDIA 3VS0A 4EEVA 4A4LA 1XKKA 3FMMA 4WRSA 5ICPA 3Q4ZA 4ZTQA 2ETRA 5ETAA 3R8PA 3ZHPC 5IUHA 4ALUA 3F2RA 1ZZLA 1WVYA 4C58A 4PWNA 4J97A 4HNFA 4MQ2A 4WBBB 4KBKA 3C4EA 4EI4A 4XV9A 3EQRA 3BE9A 4HZSA 3WE8A 3GC8A 3VRYA 3NSZA 2PVRA 3ZBFA 4TYJA 3FLSA 2WKMA 3UG2A 2JDOA 4BTKA 4AZTA 4XG2A 5C4LA 1UV5A 3FWQA 3KB7A 4L52A 4HCVA 4WNOA 5IA5A 1JPAA 4KKHA 5DR9A 5AR3A 4BCJA 1XH6A 4ZIMA 4RX7A 3U55A 3HV4A 4KSQA 4OTPA 3JR1A 4GL9A 4EYMA 4HYHA 5IG1A 3IPHA 4MQ1A 4CLIA 4I4FA 3B8RA 4MXXA 4AZEA 4FVPA 3ZYAA 1BMKA 4CMOA 1JWHA 1GOLA 5KBQA 3ORTA 4M68A 4RIXA 3PJ2A 2V5QA 1BKXA 1Z57A 1ZWSA 3GU4A 3R8MA 3EZVA 4IE9A 4BDGA 1NVSA 4P2KA 3A8XA 1WVWA 1A9UA 3PXKA 3QZFA 1ZMVA 3P4KA 4QNYA 5HLNA 3AG9A 3FC2A 1OKVA 4RT7A 2LAVA 2VGOA 2F9GA 5TE0A 1M7NA 3QQHA 4J1RA 3RNYA 3TNIA 4LOPA 3WF5A 2JITA 3TV4A 2GS7A 3VBVA 3K3JA 4O0VA 2WB8A 4M14A 4O7SA 4AU8A 2Z8CA 4W9WA 3BGQA 5DGZA 4MHAA 4FL1A 4CFVA 3NUXA 5C01A 3ZM9A 3PSDA 4GFOA 4DEDA 3IW5A 1KWPA 2O0UA 4LUEA 4ZP5A 4E8AA 4FKUA 5F4NA 4BCFA 1HOWA 1I09A 2C5OA 4JIAA 4X2JA 5CEIA 4G2FA 1JSVA 4GW8A 3ALOA 4S32A 4AOIA 3KF7A 4YTFA 1YXSA 3LJ0A 1OUYA 2CGUA 3NUUA 5C8MA 4DT9A 3IDCA 3HA8A 1V1KA 1JSUA 3FLNC 4YC6A 4D55A 2UZEA 3OXTA 3VNTA 3C0GA 3LFCA 3QCXA 2XJ0A 2JBPA 3FYKX 2YCFA 4PDSA 5DPVA 5L2QA 4CKIA 5A4CA 5B2MA 3V04A 4BHNA 3LM0A 4DH8A 3COKA 3F5UA 3ZSIA 5A54A 2QR8A 3A61A 3LKMA 1UKHA 2XBAA 4GYIA 4TYIA 5CEKA 4R7HA 5CVGA 3SW4A 3A7IA 5HBJA 5CEQA 2WTKC 1CKIA 3IW4A 1NA7A 4K0YA 5LVMA 3WZJA 3UIMA 1A48A 2R3RA 5CVFA 3VUKA 3OT8A 1Y6BA 4RVTA 1OVEA 5IISA 4R7BA 3U8WA 2BUJA 2XIZA 4IAIA 4I6FA 4EH5A 2F7ZE 3EIDA 1H27A 2HENA 4EUTA 4ZLZA 4O84A 3UODA 1M2QA 4DYMA 2V22A 2OJIA 2QHNA 3Q96A 3A60A 3LPBA 3W2SA 4ERKA 2XNPA 3EFLA 3WI6A 4O27B 4X21A 3C1XA 4K8AA 4GT5A 4DFNA 1VEBA 4NH1A 2F49A 1OL5A 2O3PA 2XJ2A 2FSMX 1PKGA 3DU8A 1DI9A 3F6XA 4PP9A 4XBRA 5KMNA 5EW3A 4AW2A 4MBJA 3OBJA 2BZJA 4LOQA 3Q3BA 4YP8A 4I5CA 4FKTA 5D41A 2VWWA 4KABA 3TJDA 2C5NA 3OCSA 3HA6A 2XYUA 4KIOA 1B6CB 3ORIA 1ZZ2A 3LFFA 2XH5A 4UMPA 5D7AA 5CAVA 3IDBA 4PL3A 4L01A 4D58A 2OH0E 5HBEA 3S2PA 3SQQA 2BZHB 2OSCA 3BHYA 3NNXA 1GY3A 3GB2A 4NT4A 2C4GA 2RFEA 3VRZA 1IAJA 3GQIA 3NAXA 3RPSA 1WCCA 4FKQA 2B52A 1H1PA 2W1EA 4YJVA 5I9WA 4M7IA 4XCUA 2G15A 3NZ0A 4OT6A 4I0RA 3WF9A 4Y5QA 4BN1A 5D11A 4X6QC 2YM8A 3CY3A 2H9VA 4EH8A 5ITAA 5BVKA 3EN5A 3ZCLA 1G3NA 1J7IA 3L8XA 2XKEA 4O22A 1O9UA 4D4YA 4ZLYA 3AC8A 3R0TA 5AM7A 4RC2A 5EH0A 1JQHA 2YABA 4E1ZA 3GEQA 2QLQA 4NSTA 2C5XA 2J0IA 3MFRA 3R8UA 4E4XA 1KSWA 1XH4A 4FR4A 4DN5A 1UU3A 3EQIA 4DA5A 3QCQA 2ITYA 4DFUA 3NIEA 4JX7A 3FE3A 2I40A 3COMA 3BPRA 3RINA 2X2MA 5CAUA 3Q4TA 4QP9A 1Y6AA 4QYGA 1OBGA 3C4ZA 3A7JA 3H10A 3GGFA 5IA0A 2JIVA 4C3FA 1WBOA 3OY3A 2Z60A 1OIYA 2W17A 2C1BA 3DNEA 1YQJA 5HCXA 4C7TA 2UZWE 2QOKA 1RW8A 3QQUA 4M69A 5LJJA 3V8WA 4ZAUA 3BBTB 3V5LA 3QUEA 5FEQA 4UMQA 2VX3A 2YERA 3DQXA 4FYNA 2CNUA 2I0VA 2WQNA 4XHKB 3ZU7A 2RG5A 4DBNA 4L43A 1KOAA 1M7QA 2C0IA 2F2CB 3CTQA 3ORNA 3Q04A 4NM0A 4NTSA 2ONLC 5F94A 5HG7A 3CPBA 3OW3A 5AV3A 2FA2A 5BVEA 3S1HA 4BF2A 3CBLA 3VUTA 2B55A 1AGWA 5AIRA 1T46A 5KMLA 1YWNA 3FV8A 3IK3A 5HTCA 5FXRA 4FI1A 1E9HA 2VTNA 3JVSA 4EWQA 2OK1A 4IEBA 4M84A 4YJTA 4EOLA 5IZFA 3MESA 3H9OA 2OJ9A 3KULA 3D5UA 2G2FA 4BWKA 5EW9A 5E1EA 3DZOA 5GZ9A 2QODA 4RX9A 1S9JA 4C57A 1W7HA 4IB1A 1P4FA 3FJQE 1K9AA 2WZJA 3LW0A 1YDRE 4H3QA 2PVKA 3DJ7A 4BCGA 2VO6A 5EFQA 5KBRA 3BIZA 4ZTMA 3VIDA 3JUHA 4J95A 3SVVA 1QMZA 2HAKA 3FMLA 5M51A 3P23A 2SRCA 3DJ5A 3KMUA 4QPAA 3W55A 4AA0A 1XO2B 2PUNA 2X1NA 1DI8A 4FKWA 4P5ZA 2CGXA 4Y72A 2XYNA 5A6OA 1ZY5A 5EKNA 4U0IA 3OFMA 1R0PA 3KA0A 4RQVA 4AGWA 2HOGA 5AR7A 2IVVA 5IEVA 4YZ9A 3SV0A 4FZAB 1DM2A 2ITVA 4NM3A 3QWJA 1YI6A 2KTYA 3DFCB 1XHAA 3VJOA 2B9IA 4MXYA 1YI4A 4I3ZA 1ZLTA 3PIZA 3OOMA 4AGCA 2X8DA 3A62A 2WU7A 3O50A 5JMSA 4R77A 3WOWA 1FGIA 3RPOA 2BFYA 3PLSA 4EL9A 3VN9A 3DZQA 3RPVA 2XIKA 5E8WA 3VAPA 3ACKA 1URWA 4XP2A 2BRBA 2O63A 1GAGA 3E8CA 3Q53A 3M11A 4GIHA 4Q9SA 4S34A 3DXQA 4FL2A 3I6UA 3QTZA 1WBNA 3NAYA 4UYAA 4C4FA 3E8DA 3NX8A 4UZDA 2ITPA 2J9MA 3I7CA 4JBQA 3TUBA 3E8EA 3FPMA 3DBEA 2PZPA 4EJ7A 4IJ9A 3F82A 3LE6A 4AGDA 2ZM4A 3PDTA 2JDSA 5ANKA 4A06A 2P33A 4IAKA 4ACHA 3ZONA 2FUMA 3E8NA 2WTKB 5AUYA 3FSFA 4XP3A 3V01A 3CY2A 3DJ6A 3PPZA 5E92A 3ROCA 5IQDA 4X2GA 3E3BX 2P0CA 4XX9A 3ZRLA 2XEYA 3VHEA 4TXCA 4DGNA 4CCUA 2ETKA 2P4IA 2ZB1A 3ETAA 3LFBA 4N4SA 3ZEWA 3L8VA 3QUDA 3CS9A 3TWJA 1DS5A 4HCUA 4MEDA 4KS8A 4O7YA 3K2LA 4WSQA 5KO1A 2VV9A 3D7TB 5CY3A 4QYYA 3EN4A 2OJGA 1WFCA 3PXRA 4JT3A 5AX3A 2J4ZA 4UY9A 3VHKA 3TN8A 2QQ7A 3QTRA 3IOPA 4YNOA 4AT4A 4MNEB 1REJA 5FDPA 1AQ1A 3MW1A 5M55A 4GIIA 1ZAOA 1JLUE 5IUIA 5JRSA 3VBTA 1J7UA 5AP2A 2JC6A 1Z5MA 4HYIA 2PVYA 4NCTA 5CAQA 4D9UA 1W98A 3KRLA 4KB8A 4X3FA 4UZHA 5I9UA 4YTCA 3SLSA 4DEGA 5A3XA 1Q4LA 3KRRA 1JBPE 3KK9A 3ZO2A 2BZIB 4XMOA 5HG8A 4AZVA 4ID7A 4FGRA 2W1ZA 5M4FA 2JDRA 4HYSA 1PYXA 3ENHA 4TRLA 4QTCA 5M4IA 2OF4A 4USEA 3CD8A 3DGKA 4M0ZA 4DG2E 3OMVA 4GCJA 3DXNA 3W10A 2FSTX 5J1WA 4N6YA 4BZOA 3E92A 2W06A 2ZV2A 4XRJA 1Y57A 3GCUA 4PMTA 3U9CA 4B0GA 2F7XE 4B8LA 4ZZOA 4NIFA 3OT3A 5I0BA 2UW7A 2GNGA 4JIKA 5E1SA 4JX3A 3QTXA 4A7CA 2Z7RA 4KD1A 2OIQA 4QMLA 4QMSA 3NYXA 4L9IA 4TYGA 5KKRC 1ZARA 2PVHA 3CCNA 4IZAA 2WQOA 3BBWA 5DH3A 5GNKA 5BYYA 3GOPA 3ZFXA 4DINA 2R3IA 2DQ7X 2FGIA 4HPUE 4L3LA 3PWYA 1CKJA 2WHBA 4N0SA 3PVBA 5CTPA 1WZYA 3H0YA 1AD5A 5DRBA 1ZMUA 2UZUE 4RQKA 3RPYA 5EM6A 4O0WA 2Y4IC 5HBHA 5AP1A 4EQUA 5I9VA 1OI9A 2XM8A 4FNXA 3OXZA 1IEPA 2BDFA 3NGAA 5JT2A 5F20A 2WPAA 3LCKA 5DWRA 2Y4PA 3HAMA 2WD1A 4HGTA 3VF9A 1VJYA 3BU5A 2O65A 2P2IA 1UWHA 4WUAA 3RAIA 3S3IA 1G8SA 5IQCA 1OB3A 4Q5EA 4ASZA 3PLAE 4OBOA 4RJ4A 3F7ZA 4QQTA 4Y85A 3QYZA 4EOQA 2UW4A 5HO6A 5I9YA 4BDAA 4DH5A 1IA8A 3MY1A 4H3BA 4XNEA 4QP7A 5DA3A 3VS1A 3Q2JA 3WZEA 4IVDA 5AAEA 4FT0A 3CTHA 4EOKA 3KCKA 4F0GA 2UVYA 1O6KA 3POZA 3R7IA 4BCMA 4E5BA 1WBTA 4ALVA 4EZ5A 4YURA 4FIIA 5HU9A 3QBNA 4CTCA 3KVWA 2ETMA 3ET7A 4PV0A 1OKWA 1JAMA 2XS0A 4FKOA 4QP8A 4RMZA 1PYEA 3RHXA 3LMGA 4QD6A 2AUHA 4PMMA 1M2RA 5JFWA 1J1CA 4BZNA 4L6QA 4LGGA 3FMDA 2ZAZA 2QU5A 3HMOA 4EQMA 5FUTA 1UVRA 3WF8A 3FSKA 3OF0A 5CU2A 3VS6A 2BIKB 4RWIA 2JGZA 5AUUA 2WQMA 2EU9A 2R2PA 3DT1A 3EFKA 1M2PA 4LYNA 4PQNA 3V5PA 4A07A 2J50A 3CE3A 1L3RE 2JIIA 2IZUA 4DT8A 3CQEA 4YJSA 5L8KA 1URCA 4YNEA 1SVGA 2VWIA 4TL0A 5M07A 4OBQA 4FV7A 3D7TA 4YGAA 4DFXE 3IECA 4V0GB 5JFVA 1G5SA 3QTIA 4FNZA 4DEBA 2GQRA 3R22A 2EXCX 2XK4A 3NYNA 3FZPA 3CR0A 3C13A 3T3UA 3QRTA 4MNEA 3AQVA 3BCEA 3G51A 4AN2A 4RIOA 4ERWA 3HX4A 4ITHA 3UBDA 1QCFA 2J51A 4DCEA 5LARA 3QTQA 3UP2A 2HY0A 3MVMA 5HTBA 1WBSA 1YDTE 2B53A 3I0QA 4Q5HA 4U97A 4U80A 5H8GA 3ZFMA 4Z7HA 2FB8A 4E5AX 4EJNA 4AN9A 4MNFA 4TYHB 4AA4A 4EZ7A 2ITZA 4F08A 4CT1A 3EQCA 3ZO1A 4O7VA 1W0XC 5BPYA 4WRGA 4O7NA 3TV6A 1H26A 3RP9A 4ZSJA 4M97A 5FLFA 3I5ZA 4O6EA 4C8BA 2YDKA 1PMVA 4X0MA 5EHLA 3OG7A 2O5KA 4F70A 3SDJA 2BALA 4IM2A 4M8TA 5DT0A 3C5IA 2XKFA 4CKRA 4J71A 3LJ1A 4RFYA 2PWLA 3AC4A 1R3CA 3C51A 3R7UA 2YM7A 2RFNA 4WOVA 4AT5A 2W96B 4F65A 3WIGA 1JKSA 3UIBA 5FM3A 4L45A 3GC7A 5C27A 3QRJA 3QC9A 3QQGA 1Q3DA 3L1SA 3KY2A 4FKLA 4FTIA 1WBPA 5GJFA 3VS7A 4ANNA 2GNHA 4G5PA 4CV8A 1NW1A 3GU5A 3SX9A 5HD7A 1VR2A 4D0XA 2PVNA 1Q41A 2NO3A 1PJKA 5CSPA 3GVUA 3QL8A 4ZSEA 1KE9A 4FSZA 4UB7A 2WU6A 5ETCA 4MTAA 3QZIA 3SC1A 4W4YA 4DH1A 1W83A 1SNXA 5HVJA 5JZJA 4ZMEA 5EDPA 3LMHA 2C69A 5C9CA 3FKOA 5M06A 1R0EA 4ZY5A 4OBPA 3CGOA 3MGYA 2GSFA 4GJ3A 3TKUA 4C0TA 2ITXA 4E7WA 4RA5A 3V5JA 5IMEA 3K5VA 2ERKA 3P9JA 3ZDIA 3QD0A 4O0XA 2B54A 4YZCA 5H8BA 2R3MA 5EYDA 5TF9A 4OTFA 2FO0A 4X2FA 4EHZA 3UOJA 3AT3A 2CKOA 4DE4A 2WOTA 1H0WA 4MH7A 4EH3A 5ANGA 4CXAA 3ATSA 3ZXZA 3QGYA 4UALA 4U45A 2OKRA 4BCHA 2J90A 3DBDA 4RSSA 1FVTA 1MRVA 4U3YA 4N6ZA 5DN3A 3BYUA 4BR3A 2CLQA 2JKQA 2W1HA 2BRMA 3LQ8A 3RGFA 4J8MA 4KIPA 4EZ3A 4FK6A 3C4FA 3Q6UA 5I9ZA 4FTMA 2XB7A 2IW6A 5FG8A 3MBLA 4XG4A 3UMXA 1BI8A 2UW9A 4F9WA 2B7AA 3TKIA 1H8FA 5C8NA 3HMMA 3HMNA 5DOSA 4BGQA 2X6EA 5I9XA 1NVQA 1MRYA 4PL5A 5AAFA 5DMZA 3EN6A 2CLXA 5JQ8A 1H1WA 3LM5A 5BUIA 5ANEA 3QKMA 4IH8A 3QU0A 3IO7A 4R3PA 3HVCA 5E8ZA 3ENMA 1YOMA 2Q0BA 3FI4A 3FY2A 4I92A 2RSVA 2YAAA 4FVQA 4LRJA 2Y4IB 3FI2A 4RVMA 5CQWA 3WZUA 4EK5A 5LCJA 4HOKA 4FV3A 2X4ZA 3TZ7A 2YCRA 4FTCA 4AG8A 3VBQA 3R04A 1OM1A 4C02A 3Q9XA 1VYZA 4OR5A 2NPQA 3RCDA 3O7LB 2B4SB 1OIUA 2X8IA 3FMNA 4DEEA 1OUKA 3EB0A 4GK3A 3LCDA 3ZXTA 1B38A 4P4CA 3EH9A 4EOSA 2EB2A 5GZ8A 2HIWA 5EOLA 3Q5ZA 2W5BA 5EYKA 5J7BA 3PA5A 5BQ0A 3DDQA 4I5MA 4I1ZA 4Z9LA 2VTHA 5CU6A 1YW2A 5C03A 2ZMCA 3K3IA 3LOKA 3MH1A 1F3MC 2UW0A 4HCTA 3RK9A 4E3CA 5J5SA 3G0EA 2YEXA 3EQGA 1Y8YA 4BFMA 3C4WA 3BYVA 4FT5A 5E7RA 3JY9A 2C0OA 5F1ZA 4D2TA 2Y8OA 4KWPA 4F6SA 3FQHA 2C3IB 4XRLA 4FTLA 3FZTA 2VO7A 3R01A 2VTMA 1KE5A 4JG8A 5L8JA 3COIA 2XJ1A 4DBXA 2YM5A 3PA4A 4YR8A 1PHKA 4A4OA 2ZM1A 5ANJA 2A4LA 2W9FB 3G5DA 4OLIA 1I44A 4I0SA 5IEXA 4K11A 1Q3WA 3GBZA 4FOBA 3LFNA 4BTMA 1BLXA 2H6DA 2Y9QA 4GJ2A 3BWFA 4FV8A 3CGFA 4G6OA 3QD2B 4DG3E 4N57A 2XA4A 4FIGA 5AR5A 5HNGA 3PIYA 4IFCA 3KRJA 1LEWA 4EOOA 2P2HA 1U54A 3ORXA 1QPJA 4O1PA 5M53A 4FTQA 4O0YA 3QHRA 3QWKA 5AWMA 2R7BA 4BBEA 3BHTA 2R3HA 4XG7A 2C68A 4BC6A 4F0FA 3R1YA 4MF1A 4RWKA 5EYCA 5CSHA 4F7SA 3A7GA 4BKYA 5DIAA 2BDWA 1JNKA 4ZS0A 4UWBA 4BDEA 2WELA 2QC6A 4C34A 1PXMA 3KMMA 2OIBA 4NCTC 5CQUA 3TTIA 3WBLA 4X3FC 3D0EA 4YJRA 4DTAA 4QTBA 2QO2A 2V7AA 4FNWA 5DRDA 1M52A 1OPKA 3VBYA 4HVIA 3LCTA 4JDKA 3A7FA 3PZHA 5FRIA 3HECA 5JH6A 3PRIA 4GYGA 5CZHA 5HESA 4EK8A 5HIBA 1YHVA 4L00A 3PXYA 3D14A 5FEEA 1HCKA 1QPEA 1V0PA 1XH7A 2BZKB 2WTCA 4L7SA 3F3WA 5KE0A 3R7EA 4D2PA 5LWNA 1SM2A 2PE2A 4MXZA 5BYZA 4CFFA 3UJGA 2VU3A 2WMRA 4ZSGA 4JOAA 4FSTA 4O7ZA 2QKRA 4IWQA 5AR2A 3WYYA 2XRWA 5I3RA 4E6AA 1XBAA 3GFEA 5LVNA 3ALNA 4KKGA 2YJSA 4MAOA 4W9XA 2R5TA 4DITA 3TT0A 4FV4A 4ZZMA 2PL0A 3UQGA 4RIYA 5T68A 4C38A 3CEKA 4AWIA 3BZ3A 4KRDA 3PE2A 1OPJA 4YU2A 2IW9A 1PMNA 5AJQA 4DH7A 3DBQA 4IM0A 2QO9A 4E93A 1E1XA 5J8IA 2OU7A 4JAJA 1YOJA 2QOLA 4RJ5A 3SA0A 2HYYA 3MN3A 4GT3A 4BKZA 5KX8A 1J7LA 3HV6A 2CKQA 4X3JA 3HV5A 4M69B 1OL7A 5JFSA 5LVLA 4B99A 4RWLA 4DLIA 3OCTA 3G6GA 3V6RA 5C1QB 2WMVA 4V05A 5HCZA 4EONA 4ZS4A 4CYJA 3QTUA 3UMWA 5CASA 2CHLA 3BE2A 3PJ3A 2FVDA 1YRPA 2OXYA 3TZ8A 5BUEA 3I6WA 4KS7A 4IWDA 5BVFA 2X9FA 4G31A 5AUZA 4HNIA 4ZY4A 2QR7A 3FQEA 3OD6X 3TDVA 1UA2A 3MJ1A 4FICA 2CN8A 4W4WA 3VF8A 4EHGA 4HPTE 3ZBXA 2PHKA 2YLEA 4CQGA 2JKKA 3G0FA 3OCGA 4IHPA 4QMUA 4BDJA 5IPJA 1QL6A 2VWXA 2C6MA 3E87A 3KC3A 3MFUA 2ACXA 2I6LA 3JPVA 3OWJA 3KXXA 4XLVA 1YVJA 4MBLA 4IVAA 3EFJA 5DI1A 3KULB 3A4PA 3JXWA 3MFSA 4RWJA 4Y5HA 3UNJA 4ARKA 1U4DA 2VTRA 2WQBA 1LEZA 3DAKA 2VWYA 4OAUC 2GCDA 3ORKA 4L46A 2OGVA 1RDQE 1ZYJA 4IDTA 4JG6A 5AUVA 5CF6A 3WARA 4YTHA 3O23A 2CKPA 3U6IA 3AC3A 3FEGA 2VRXA 1IA9A 1F5QA 2AC5A 4AW1A 1PXPA 1CMKE 5HOAA 5IQGA 4AZWA 4ITJA 2WTDA 3PXQA 4Y83A 2X7GA 1Y91A 4G6LA 2QOFA 3P79A 3MVJA 3QCSA 1JKLA 4LQMA 3DBFA 3GT8A 5BUJA 1IR3A 3KKVA 1H24A 3KRWA 3OUKA 3L9PA 4CEGA 4FV0A 5HLPA 2IN6A 4CFUA 4UX9A 2ITWA 3UVQA 4DAWA 3R9OA 3ZLXA 4UXLA 5IA1A 2YZLA 1UU7A 3I0OA 2R0IA 4LUDA 4U41A 4FTTA 3DNDA 3TNPC 4F09A 4FODA 4MX9A 3L8PA 2JKOA 4M3QA 4PPCA 4EORA 3GU6A 3ZO3A 4QMQA 5BNJA 4D1XA 4FUYA 4CYIA 4WT6A 2VWBA 4QP4A 4XOZA 4BDBA 3NUAA 3FHRA 3P1AA 3E64A 4MF0A 2PUUA 3RM6A 3MV5A 3LXNA 4BCPA 4EUUA 1TQPA 3DLZA 4IAAA 4J96A 2J0JA 5HX8A 5FXSA 3O51A 3SRVB 3REPA 2W4OA 2GQGA 3KVXA 3KXMA 4XG6A 4FKGA 5A14A 3GCSA 2C3LA 3CKXA 3TEIA 3EQDA 3SXSA 2XNOA 4L44A 4FSWA 2XNEA 3FC1X 3LXKA 5DR6A 3QKLA 3HRBA 1JVPP 2H96A 4H1JA 3GCVA 3Q32A 3AD4A 4BB4A 5LOHA 1YWRA 4DEHA 5IQBA 2FH9A 5AP3A 3A7HA 5AFVA 2BFXA 2C3JA 4F63A 2HXLA 4R3CA 3R00A 4QMNA 4PPBA 4CD0A 3KREA 3QQJA 5CWZA 5DT4A 2I0HA 4IX3A 2ZVAA 4WIHA 3EYHA 3QA0A 5E8VA 1YHWA 4CMTA 1QPCA 3ELJA 4FKJA 3H9RA 4K18A 2C3KA 2PULA 2R3NA 4CFMA 2Y6OA 4E6CA 4MYGA 3DKOA 4DFZE 5BVNA 1Q99A 3BKBA 4FEQA 2PMNX 4ACGA 4AE9A 1XH5A 4RPVA 3TJCA 3ULIA 3Q2MA 4A9TA 3NR9A 4E4MA 2C30A 4W4XA 3MIAA 4NWMA 3V5WA 4YSJA 3QF9A 4DCAA 3OXIA 3DB6A 3FAAA 4BCKA 3UZRA 3DY7A 3PVWA 3CKWA 3MVHA 4QMYA 3JVRA 3P7AA 4DTBA 4CNHA 2VNWA 4FV1A 4G3GA 2QOQA 3VQHA 4CT2A 3HP5A 5AIKA 1YDSE 3JY0A 3NNWA 3OBGA 4X3FB 4YSMA 2CDZA 2XUUA 4BRXA 5IA3A 5K0XA 3UYSA 3FLYA 4FIEA 2W1CA 3O96A 3TV7A 2QNJA 4FA2A 5EQPA 1BL7A 3NYVA 3BQCA 1LUFA 5KHWA 4D2WA 3QZHA 4ZJJA 2OFUA 2EXMA 2B9FA 3QYWA 4FMQA 3VQUA 2R0UA 5M4UA 4F7JA 5J5TA 4LMUA 4OTDA 4NIFB 4HVHA 4TTHB 3ANRA 1Q61A 1UWJA 5AUXA 2G01A 2RFDA 3NUPA 4FL3A 4FTAA 4PL4A 5ETFA 3NDMA 3P0MA 4W4VA 3BRBA 4ENYA 3EOCA 3UOHA 4BYJA 4EBVA 3BQRA 3SOAA 5IQIA 2VX0A 3UGCA 2XIRA 3R1SA 2G2HA 3HKOA 4KUJA 4MD9E 3PVUA 5G6VA 3V3VA 4C59A 3LQ3A 3S0OA 5B0XA 4EKKA 2OJFE 3OY1A 4GVAA 1WMKA 2BTSA 4N70A 4LV8A 1GJOA 3UG1A 3UOKA 4QTAA 2YLFA 2A2AA 5CEPA 1XBBA 3LFEA 4U8ZA 5KZIA 2R3OA 2AYPA 3R73A 4DHFA 5IKWA 5AR4A 4TWCA 4ANSA 3OVVA 4IAFA 3P86A 4JJRA 5DBXA 3ANQA 2YZAA 3V6SA 4EK3A 4I22A 1BX6A 2C6KA 5K4JA 2WFYA 3FL4A 4TKSA 3MDYA 3HV3A 3ODYX 4AFJA 2V0DA 2OLCA 1MRUA 2CSNA 2GFSA 2UZNA 3R1QA 4FBXA 3PJ8A 2XK8A 4YJUA 5E8XA 4D4VA 2WNTA 3G15A 3QRUA 4J98A 4BGHA 3CJFA 4FEUA 3E62A 4MD8E 4R1YA 2X0GA 2XK6A 2WGJA 3MH0A 4IB5A 5HGIA 3SRVA 2UUEA 3UOLA 4F99A 4R6VA 2RIOA 4FEVA 4G6NA 1RJBA 3FXXA 2YN8A 3PSCA 3EN7A 4O0RA 4USDA 3MPTA 5HE0A 3TTJA 3W2CA 4NJDA 3QRIA 2VD5A 2HZ4A 2CNQA 5GINE 5HQ0A 2RGPA 4PX6A 1SVEA 3PJCA 4YC3A 5AP0A 4EKLA 1H28A 3B8QA 3TNWA 3H4JA 4QQCA 3ORLA 5L2IA 2B9JA 2E9PA 3Q9WA 3F5XA 4QMVA 4Z7GA 3W2QA 5HIEA 5ANDA 3MPMA 4YUQA 5JRQA 5KUPA 4C4JA 5IU2A 2QCSA 2W4JA 1ATPE 4QNAA 4KNBA 5A6NA 3PPJA 2GNIA 3KCFA 4F6UA 3P08A 2OXDA 3O17A 3QQKA 4XV1A 4II5A 4AQCA 3NMUF 4RJ7A 3SOCA 4M12A 1GZOA 1YI3A 4FIHA 5K0KA 3AT4A 5AP6A 5GIOE 5BMMA 3LJ2A 1Q62A 4C33A 3OCBA 2BILB 4FV9A 4LRKA 4YLLA 5L3AA 3H0ZA 3PTGA 2BAJA 5AUWA 4IM3A 5JGAA 5E8YA 1SMHA 2VAGA 4CVAA 3ZLSA 3AGLA 5IDNA 2X2LA 5B7VA 3KL8A 3EQPA 4EH6A 3NW7A 3FZ1A 4WG3A 4O38A 4PDOA 5AV0A 5FP5A 4F9CA 2ITQA 2VTQA 3LFDA 4W8DA 5IQHA 4IZ5A 3FBVA 4GS6A 4D2VA 4RGJA 2X7FA 2Y7JA 4BWPA 4F6WA 2WMSA 4F0IA 3HEGA 2YISA 1BL6A 5L6OA 2IVUA 3SHEA 4IMYA 3CQUA 2W1GA 4GK2A 3C4XA 5CF5A 4L68A 3CQWA 4E20A 3EZRA 4XG8A 5KMJA 1J3HA 3NRMA 1GZNA 4L3PA 4I5PA 4BHZA 3RAWA 4AXAA 3D7ZA 4C3RA 5K5XA 1J1BA 3C9WA 3EKKA 4IX4A 4GVJA 5BVDA 5H9BA 3BLQA 1YHSA 4YMJA 4AZSA 4PTEA 2YDIA 3C7QA 5AP7A 5I3OA 4E6DA 1NT2A 3SD0A 2W5AA 4QYEA 1PXIA 3CJGA 2E9UA 4U44A 4H36A 4S33A 4PPAA 5FXQA 3EL8A 2IZTA 4LG4A 4LI5A 2HW7A 4XUFA 3GU7A 4AFEA 3SGCA 3DK3A 5EM7A 5LVPA 5A4QA 2XKDA 2DS1A 4KAOA 3NWWA 2B1PA 3HRCA 4BCIA 3ULZA 4M15A 3IW6A 3RK7A 5J79A 3NIZA 4J99A 2VN9A 5JFXA 5JQ5A 5A9UA 1O6YA 4DTKA 1RE8A 4IJPA 4WHZA 1YXTA 2PVMA 1LR4A 2X7OA 3TI1A 4G34A 4TY1A 5TO8A 2RKUA 2OI4X 4FC0A 4BBMA 5JN2A 4RVKA 1UNHA 4TYEA 3HLLA 1ZYDA 4F1TA 1VZOA 3P78A 3ZZWA 1IRKA 5DYJA 4O0UA 1NVRA 5ETIA 4ACMA 3QUPA 5E90A 4KINA 2VX1A 4BL1A 3UC4A 4D4SA 3VO3A 2R9SA 2VTPA 3UVPA 3I4BA 2XNBA 4JXFA 5FQDC 3V8SA 4I4EA 4GEOA 4R3RA 2CJMA 5EK7A 2GNLA 1OKYA 4L67A 1K2PA 2YFXA 3C0HA 3MVLA 4XH6A 4YO4A 1ND4A 4P90A 4F4PA 4S2ZA 3SG8A 3VWAA 4XG9A 4IVBA 2PUPA 5KHXA 1K3AA 4PUZA 3AMYA 4QRCA 3ZS5A 1GIIA 2OG8A 2Z7LA 4D5HA 2Y6MA 4CV9A 5CU4A 3FI3A 4Y46A 4HYUA 4X6RA 3WF6A 5IH5A 5CT7A 4G3EA 4FF8A 4IW0A 5AV4A 2BRHA 5EM5A 2LGCA 3QAME 4LRMA 4QTDA 2VGPA 2HZNA 5CLPA 1Q24A 4QO9A 3ZO4A 2OWBA 3H30A 1Q8UA 4G9CA 4I20A 3Q4CA 2UZOA 3UYTA 4DFBA 5B2LA 3MFTA 3DS6A 3G90X 5JGBA 4JNWA 1GIHA 3TZMA 3UIUA 5M4CA 3IDPA 4MCVA 4FG9A 4HGLA 3LAUA 5JZNA 3LHJA 3TACA 4H3PA 4QMPA 5HTIA 3HNGA 4IAZA 1UNGA 2YWPA 4UBAA 4X2KA 2X8EA 2G1TA 2PMLX 4EH4A 3ZUVA 3MSSA 3R83A 3NLBA 3ZRKA 3FPQA 3AOXA 4YLKA 2IZSA 4RLKA 2VWZA 3E63A 4IC7A 4MWHA 1VYWA 4FZFB 4ZEGA 1E1VA 4RBLA 2A0CX 5ACBC 5JKGA 4CLJA 3MA3A 4FSQA 4TWOA 3NS9A 3FMHA 1YXXA 5CAOA 3UO6A 5HZNA 3VUMA 4CG8A 3UO5A 2ZOQA 3EN9A 3W2PA 4GKHA 5A4EA 3AD5A 4MXOA 4KSPA 4Z16A 4V04A 4E4NA 3DB8A 3R9DA 3PXFA 2ITUA 2C6EA 3KXHA 2C6LA 4YBKA 5KMOA 2YACA 5EYMA 3UTOA 1U54B 3MIYA 4HVSA 3IGOA 4DEIA 5IUGA 3PP1A 3LLAA 1UKIA 3N4VA 3R2YA 1HCLA 4C2VA 4KIQA 3FZOA 4U6RA 3BHUA 3KXZA 2ZV8A 4G9RA 3TZ9A 2XM9A 3SXRA 2PK9A 5IDPA 2PPQA 4B8MA 2JFLA 1KE6A 3FLWA 2G9XA 3BGZA 2W1FA 1FMKA 4YJQA 3LIJA 5DE2A 2BDJA 3OROA 4Y95A 3NPCA 4AGUA 3W16A 4ASDA 4FYOA 2W7XA 1OZ1A 1PXLA 3F88A 5HO8A 3T3VA 3F5PA 3MY5A 3TL8A 3OWKA 5ACKA 4K2RA 4CQEA 3WIKA 4TWPA 4TPTA 4X2NA 2ZV7A 2O64A 4O2PA 3IQ7A 3VW6A 3MB7A 4JQ7A 3ORMA 4NJ3A 4ZTLA 3ZRMA 4ANMA 4K77A 5CEMA 5CEOA 1R39A 2R7IA 3OTVA 5HEZA 4XEYA 3LCSA 4J53A 3QFVA 3NUSA 3D2IA 4EH7A 1GZ8A 4KBCA 2UZTA 4JBOA 3W2OA 4TZRA 3II5A 5CXHA 1PXJA 1ZMWA 3AMAA 4OUCA 3QTSA 4HVGA 5J95A 4NW5A 4I23A 4BTJA 3SW7A 1U59A 3QLGA 4D2RA 3LQ5A 3RM7A 3P7BA 4G1WA 3ZC5A 4RIYB 3N51A 5CS6A 5GHVA 3BEAA 3G2FA 1Z9XA 3GFWA 4AF3A 4QT1A 1CDKA 5T3QA 3RAHA 2GNJA 2CNVA 5BVOA 4WA9A 3R7OA 3AXWA 2RFSA 1O6LA 5LWMA 4D5KA 3UNKA 1REKA 3S4QA 4HGSA 3V8TA 4ONAA 4R8QA 3Q4UA 4JRNA 2WMAA 2WAJA 2WQEA 5FBNC 4EH9A 1A06A 5EM8A 3H9FA 4XV2A 4F64A 3R9RA 4FIJA 2WO6A 5HE1A 3HP2A 3C50A 4NFNA 4FTOA 4EHVA 4YHJA 5L2SA 4I0TA 3DA6A 3GENA 4EC9A 1YXUA 4IQ6A 3DAJA 4NK9A 1XR1A 5D1JA 1XBCA 3EQFA 5DEYA 1FINA 2YIXA 5TKDA 1KE8A 2PVFA 5HE3A 3E5AA 5KMKA 3PYYA 1ZOEA 4RFZA 3ZUTA 3RWQA 2R3PA 2Q0NA 3AT2A 3DPKA 1KOBA 3AMBA 3VBXA 5L2TA 3C5UA 5EHYA 3TDWA 4O83A 5M09A 3L9MA 3QQFA 4LV5A 3A8WA 3VBWA 5HE2A 2IVTA 2JD5A 4AOTA 4QPMA 2FYSA 3DKCA 5KMMA 4R78A 5AEPA 2VZ6A 1KE7A 4JVGA 4KA3A 3PIXA 4FIFA 4JAIA 3RMFA 4MD7E 5JGDA 1STCE 3G6HA 5IQFA 1EH4A 3VUGA 3F61A 2EVAA 3WF7A 1JOWB 3NNVA 2YIWA 4FSUA 4HJOA 4WUNA 4BIDA 4L42A 3AC1A 4PRJA 1CTPE 3LLTA 5DNRA 4IVCA 3UQCA 1OIRA 5AV2A 3QC4A 3QRKA 4BI2A 3D15A 3FXWA 5CNOA 4FEWA 5L2WA 1P14A 3U6JA 3VVHA 3RZFA 1V0OA 3T8OA 5FTGA 3ZUUA 4ZTRA 3HUBA 1WVXA 3B2WA 2XNMA 3FYJX 5DR2A 5E8SA 2R3FA 2RG6A 3U87A 5DG5A 4K33A 3RBWA 4BY9E 1FQ1B 3BV2A 3DXPA 4ANBA 5C4KA 2R4BA 1OGUA 2H8HA 4L3JA 3C0IA 3ZM4A 3DLSA 5M08A 2BHEA 2XVDA 3E7VA 4U40A 2PZRA 2IPXA 2I1MA 4QP6A 5LMKA 1G8AA 4TW9A 5DVRA 4O86A 4MXCA 4A9YA 3MI9A 5ANOA 4RX5A 2F7EE 3UZTA 2WIHA 4QMMA 3MH2A 4MWIA 5L6PA 4AA5A 3CP9A 2BVAA 5AR8A 5LCKA 3TIZA 2VTOA 3O8TA 3ORPA 5T6KA 3OZ6A 4YJNA 4ZTNA 3VS2A 3ITZA 3NVKI 4GU9A 3THBA 3VS3A 2XK7A 4D28A 2ITOA 4RFMA 3KN6A 3UDBA 4JDJA 4O96A 4NEUA 5FTQA 2B0QA 2UZVA 4JR3A 2QOIA 4FKRA 2X81A 3R63A 4P5QA 5AA8A 5LMBA 4O91A 1ZOGA 1QPDA 5K5NA 5M56A 4C36A 3KXGA 4JQ8A 2UVZA 2VTSA 1W84A 3UP7A 2ERZE 2YJRA 2VTLA 4GV1A 5KCVA 3N4TA 4BDCA 1PMEA 5HIDA 4YZDA 4BCOA 3IG7A 3PG3A 3DBCA 4RIWB 2EXEA 5A4LA 4CZYB 4CZUA 2DYLA 3UIXA 5E4HA 3UQFA 2XIXA 4FTRA 2BKZA 5LQFA 2DUVA 2UZBA 1GIJA 4U7ZA 3NUNA 3F5GA 3RK5A 2PVLA 2X39A 3K54A 4FZ6A 2XNNA 4TT7A 5EW8A 3SXFA 4FSRA 2VWVA 3NCGA 4MXAA 1U5RA 2GPHA 3MB6A 4QPSA 5I4NA 2YM6A 4FUXA 3OTUA 2BMCA 4NL0A 3T9TA 4U9AA 4F7NA 2BR1A 4EK6A 4GK4A 4G16A 5IA2A 4GG7A 4YO6A 2PY3A 4IX5A 4BZDA 1ZOHA 4RRVA 2G2IA 2IJMA 4BGGA 4EWHA 2O2UA 2OW3A 3EKNA 3NW6A 5CZIA 1FGKA 5HVYA 1P4OA 3MYGA 5IQAA 3CC6A 3QGWA 4LFIA 2V62A 4YBJA 4BDFA 4Z3VA 5AP4A 4Z55A 2CMWA 2BIYA 5E8TA 3WE4A 4QMZA 4IDVA 4U3ZA 3EYGA 1Q8WA 1ZYLA 2ZDTA 2YM4A 4M67A 1PKDA 5EI8A 4J7BA 5KMIA 1W82A 1WBVA 1YWVA 2V7OA 4LGHA 3W18A 5J9ZA 1ZY4A 3QTWA 4LOOA 1CM8A 3IW7A 4OTGA 5J1VA 1PXNA 3PWDA 1H08A 4R5YA 3GUBA 4UEUA 4FK3A 3PE1A 4QTEA 4H58A 3CXWA 1DAYA 4K1BA 4XV3A 3RWPA 1W8CA 4DFLA 3PUPA 3ODZX 3LMIA 4JI9A 1H00A 5CYIA 3R9HA 2BPMA 3R6XA 4FG8A 4U5JA 4L8MA 2PYWA 3GCQA 2HWOA 2OFVA 3NYOA 5D10A 1OITA 3MS9A 4NZWB 5AAGA 5BMSA 5AX9A 2YCQA 3R7YA 5EHOA 4RVLA 3WYXA 1MQBA 3LFQA 2BCJA 3BU3A 3E7OA 3LFSA 3R2BA 5G1XA 4EBWA 1M17A 3O71A 4PP7A 5CU0A 2QG5A 4PDPA 2NRUA 3FQSA 2GQSA 3F66A 3HDMA 3O0GA 2ZB0A 3QD3A 4ANQA 5HG5A 5J9YA 1LP4A 3QZGA 4D9TA 4NU1A 2QOBA 5F95A 4OTHA 4WD5A 3KQ7A 4LM5A 1BUHA 4KKEA 1H1RA 2CGVA 3SAYA 5FDXA 2F4JA 3S00A 1XJDA 4K9YA 5EDQA 5C26A 2Q83A 2J0LA 4YTIA 3ATTA 5FD2A 2WTIA 4DF3A 3W33A 1YOLA 4A9UA 2QOHA 2NRYA 2R3QA 3A4OX 3FKNA 2WEVA 3KRXA 3PP0A 4RC4A 4BVUA 2E2BA 4FT9A 4DGGA 1UNLA 3OW4A 3I81A 2ZMDA 4QMWA 4RJ8A 2HY81 4FSMA 3M1SA 2I7QA 2FSOX 4UMRA 4YPSA 4DH3A 4IZYA 4EOIA 4B9DA 3DKFA 2CGWA 4YHTA 2UW5A 5DLSA 2GFCA 4OTWA 4FV2A 1XQZA 2QI8A 4GH2A 4IACA 4E5WA 3U6HA 5A4TA 3PG1A 4JS8A 2JAVA 4OGRA 3KEXA 4FTNA 4TWNA 2C0TA 3P5KA 4FGBA 4QYFA 5CSXA 5FGKA 4AS0A 3NW5A 4RIWA 4C3PA 3HRFA 4L53A 5HICA 4JQEA 3U54A 4YPDA 4QMOA 5HU3A 3G33A 1OMWA 4O21A 5KNJA 5HKMA 1R1WA 4UXQA 2B9HA 3V5TA 3O2MA 4HW7A 2YIRA 2JAMA 3UO4A 2YDJA 2VTAA 1XWSA 3MH3A 2VUWA 4D4RA 3BYOA 4NFMA 2WTWA 2J0KA 4BI1A 3NNUA 3PJ1A 3IW8A 4WBOA
chains in the Genus database with same CATH superfamily
1BYGA 3BELA 4FTJA 2C6DA 3PFQA 1TVOA 4NM7A 1V0BA 3LXLA 2PZYA 3U9NA 3PY0A 4C4IA 2OXXA 4O7TA 4B7TA 2IW8A 2WMTA 3D9VA 5AADA 1T45A 4IZ7A 3DV3A 2YWVA 2BTRA 3CIKA 2WEIA 4D1SA 5LMAA 4AZFA 2XZSA 4FVRA 3ZMMA 1OL1A 1WBWA 2CCHA 2UZDA 4BDHA 4I24A 4BBFA 5IH4A 5EG3A 2ZYBA 4FKIA 4YZNA 5AM6A 4RJ3A 5F9EA 4E73A 4FEXA 1H1QA 1UU9A 4Q9ZA 4ITIA 4MVFA 2W99B 1Q8YA 4ZTSA 4JBVA 4AT3A 2UW6A 2A19B 5CF4A 4FE2A 4CSVA 4PDYA 1OKZA 4QQJA 5GJDA 4O4EA 4AE6A 4BIBA 4ZTHA 3BX5A 4C4GA 2GNFA 5EDRA 4EOJA 2KULA 3R8ZA 4DEAA 4PMPA 3IONA 3MWUA 2PVJA 3ERKA 3Q5IA 4O0SA 4OTRA 3BLRA 4CG9A 5EQEA 4OW8A 4Y8DA 1H4LA 4USFA 4K6ZA 2P55A 2UV2A 3LZBA 3OEFX 4C62A 4KIKB 5HHWA 5H2UA 2PTKA 4CFNA 4E26A 1OIQA 4WO5A 2JIUA 3PXZA 4ZY6A 4QOXA 3MJ2A 3TIYA 3I5NA 5TR6A 1Q5KA 3AC5A 3FZSA 2E9NA 3AKKA 2OICA 1JSTA 1PXOA 3HGKA 4IADA 3U4UA 1M14A 3OWPA 4EHEA 3G9NA 5AUTA 4O7RA 1IASA 4IB0A 4WKQA 3QHWA 5GJGA 3FDNA 2C6TA 5HVKA 1OL6A 1CKPA 2F2UA 4IWPA 1ERKA 2WTJA 5EI2A 4GKIA 5GIPE 4C4EA 1FPUA 4UMUA 3GP0A 3QCYA 4O4DA 3FUPA 4WNMA 4C35A 3Q52A 2BAKA 2AC3A 4GUEA 3TKHA 3BHHA 4D0WA 1TZDA 5K9IA 2IZRA 3O7LD 4FSNA 4WG4A 2W0JA 1MP8A 4WSYA 5J7HA 4FG7A 1SZMA 1PRYA 2QOCA 3ZH8A 4DC2A 4NM5A 4YLJA 4ANOA 2XRUA 2P3GX 1L8TA 2EWAA 3QD4A 3R28A 2OZAB 4AW0A 1XH9A 5JSMA 2BAQA 3EQHA 3MY0A 3TUDA 2OBJA 3RAKA 3W32A 3QQLA 4Y73A 5HD4A 4P7EA 3ZFYA 4F9AA 4AUAA 3R71A 5J87A 4XG3A 4AOJA 3R02A 4UWYA 3AC2A 4FKPA 2XCKA 2CN5A 2OZOA 4ASXA 3FXZA 2QKWB 4KRCA 3ZZEA 3EJ1A 3TUCA 3P7CA 2C47A 2GTMA 3R7GA 3RJCA 5CSWA 4I6QA 4FV5A 4YHFA 3R7VA 2O8YA 2OH4A 3RVGA 4RZVA 3I1AA 4CMUA 4CGAA 3POOA 3F2AA 2HCKA 4XP0A 4XS2A 4B6LA 2UW3A 4ZXTA 2GS6A 2W1IA 4ZMFA 4QMXA 4CFWA 3FMKA 2E9VA 2HZ0A 5DFPA 3I79A 3DFAA 5LMKC 3ZC6A 2GHGA 2WMQA 3ZDUA 5D9HA 1BI7A 3ZOSA 4GUBA 3FMJA 4I41A 2RF9A 5M57A 2QVSE 2WIPA 3QX2A 1JKKA 1Y8GA 4NTTA 5D12A 4BYIA 4CZTA 4QP1A 3EWHA 2QLUA 3PVGA 4FZ7A 1TQIA 2GTNA 2W9ZB 3BI6A 3O8UA 4S31A 2VTTA 1P5EA 2IWIA 2PE0A 3BV3A 3E88A 4UMTA 4V01A 5HNIX 4CRLA 5DEWA 4IIRA 2C6IA 1GZKA 2PE1A 1Q97A 3AGMA 3V5QA 4EOMA 3VUDA 3HUCA 3Q60A 3HV7A 3ZLWA 4R7IA 3PPKA 3DK6A 2GHMA 3D5WA 1FVRA 2XKCA 4ALWA 5LVOA 3EQBA 4RJ6A 5CENA 4A4XA 4ACDA 5TT7A 3DDPA 4F1OA 2Z02A 3EL7A 4C61A 4APCA 2YIYA 1FOTA 3D4QA 4DGLC 3JS2A 3M2WA 2A98A 4ZSLA 2QU6A 4I93A 4LMNA 4IXPA 2QONA 2GU8A 1WAKA 3TXOA 3IOKA 2BKKA 3LFAA 3GOKA 4LL5A 4RLLA 2V55A 3QXOA 1SYKA 2R3GA 3IGGA 4G3DA 4QP3A 4ENXA 3CPCA 1TKIA 4C37A 2C1AA 4OTIA 4BKJA 3L9LA 4RZWA 3DTWA 4WNKA 5E9EA 3O8PA 4YJOA 4BI0A 1H1SA 3N4UA 4OTQA 3RTPA 2I0EA 5H8EA 1PW2A 3VJNA 3UDZA 5BX0A 3F3ZA 3TG1A 4O1OA 2ITTA 2CCIA 1X8BA 3OEZA 4IB3A 4MKCA 4KIKA 3RCJA 3RKBA 5LXMA 3AKLA 5FM2A 3ZTXA 5CALA 4ANLA 2R3KA 3U4WA 3ZLYA 4NKSA 4TNDA 3VS5A 4NW6A 4NKAA 3FKLA 4KBAA 1PXKA 1TQMA 4PNIA 2Z2WA 5GZAA 4BDIA 5JEBA 2A27A 2W4KA 2ZDUA 3DQWA 3VS4A 4FKSA 4M13A 3W8LA 3WILA 2A1AB 3LVPA 4JG7A 3SKCA 2QD9A 1B39A 2XMYA 4WNPA 2VWUA 4R5SA 3GC0A 5E8UA 4RC3A 2GHLA 3HZTA 3FLQA 1NY3A 5FBOA 4E4LA 5H3QA 2WXVA 3UNZA 4EH2A 4QP2A 3T9IA 2YIQA 2NNWB 2CKEA 2YA9A 4ASEA 5JK3A 1KV1A 4DLJA 2XBJA 2GDOA 1MQ4A 2REIA 5I5ZA 4H05A 4XLIA 3QLFA 3EMGA 4TNBA 2QO7A 2X2KA 2ITNA 2J5FA 2OZAA 3CD3A 3FLZA 4Q2AA 1TFFA 5BYLA 4FT7A 3D2KA 3PRFA 2QOOA 4ZK5A 4ZSAA 3FMEA 2OF2A 2RL5A 1MUOA 3R8VA 1Q8TA 4J8NA 3D83A 4GMYA 5HI2A 2R3LA 2VTIA 2C6OA 1SNUA 2UZLA 3KMWA 4XBUA 5CU3A 2QHMA 1FVVA 3GXLA 4UWCA 4ZLOA 3Q6WA 3ACJA 5CF8A 2WOUA 3SG9A 3QALE 2UW8A 3F9NA 4BDKA 3PY3A 1PY5A 4YJPA 4JLCA 1H25A 1CSNA 2OIDA 2Z7SA 2JDVA 5HNBA 3LCOA 4I94A 3E3PA 4M66A 2WMBA 4AXCA 5HCYA 3PA3A 3D5XA 4M0YA 5L4QA 4G3CA 2JEDA 4UV0A 5FP6A 3FL5A 3W8QA 3KXNA 2PU8A 3DCVA 4OAVB 2XCHA 4GG5A 3RNIA 2YITA 3MTFA 4EC8A 3CSVA 4EOPA 2IEWA 4TN6A 3Q9YA 1KV2A 2CPKE 2XK3A 2ZM3A 4YZMA 3V51A 3QA8A 3D94A 2C5YA 5EI6A 3G9LX 5CT0A 3ZSGA 3HAVA 4PTCA 2YM3A 3R8LA 3R9NA 4H1MA 3I7BA 2XNGA 4E6QA 2HW6A 2GMXA 1XH8A 3LXPA 5J9LA 3FZRA 5FWKK 4UN0C 4NUSA 5AMNA 4BIEA 4G5JA 2PMIA 4JRVA 5IH6A 3MA6A 5EQYA 3KFAA 4DGOA 3R1NA 3GQLA 4U79A 3NUYA 5KZ0A 3AD6A 3F3TA 4AAAA 5HX6A 2PUIA 4ORKA 4JDHA 4F9BA 5L6WL 4PF4A 3Q9ZA 3BEGA 1LPUA 5AA9A 3BHVA 4IBMA 5EOBA 3UC3A 1KUTA 4GRBA 3DAEA 3M42A 3R21A 3W0PA 3TCPA 3UPXA 4FV6A 3HYHA 2OO8X 4IC8A 5HO7A 3PY1A 2PZIA 2W05A 3IKAA 3W1FA 3NVMB 2XP2A 4GSBA 5CI7A 3GC9A 5D7VA 2W5HA 4FNYA 4D1ZA 4AACA 1UU8A 3L9NA 4G17A 1ZYCA 2ESMA 4U43A 2DWBA 3DTCA 3WZKA 3W2RA 3NCZA 2HWPA 3GU8A 3F3VA 1RQQA 4FX3A 2H34A 4EYJA 5IF1A 2VNYA 4HZRA 4G3FA 3W0OA 4FTUA 4ZZNA 3L8SA 4DFYA 4GT4A 4RX8A 3I60A 2XIYA 4IAYA 4BCNA 4U42A 5DT3A 1OPLA 4QMTA 2X9EA 4XYFA 4PMSA 4FZDB 4RA4A 4O82A 1OECA 5IQEA 3GNIB 4QQ5A 4AW5A 3KF4A 2X6DA 5CANA 3BWJA 3OUNB 4C2WA 1F0QA 4BWXA 3OP5A 3C4CA 4D2SA 3GCPA 2BROA 2R64A 5AV1A 3OWLA 2J5EA 5E91A 2EUFB 4U81A 4JL9A 4A9RA 4LL0A 3RHKA 3RPRA 2PMOX 2HXQA 3HMIA 3PZEA 2IO6A 5CI6A 2J7TA 4CRSA 3QXPA 2NP8A 3ZSHA 4PNKA 2F57A 1H01A 3RI1A 5L8LA 2I0YA 3JYAA 3ID6C 2PSQA 3GI3A 5C8KA 4BICA 5HLWA 4L7FA 4FTKA 3RALA 3COHA 3CLYA 2X0OA 3EHAA 3TNQB 3BU6A 3F3UA 4H39A 3UVRA 1H0VA 3PSBA 4IX6A 1ZRZA 3BYSA 4I5HA 4JBPA 1ZYSA 2ONLA 2JKMA 4S30A 4APPA 1JKTA 3KN5A 3EFWA 3RZBA 4BTFA 2OJJA 5CNNA 2PZ5A 1NXKA 4O81A 4XOYA 3UDTA 2J6MA 4CTBA 5K4IA 2VTJA 4BCQA 1P2AA 3ZEPA 5CVHA 2YHVA 1SVHA 3VUHA 5A46A 3UZPA 4EK4A 4XJ0A 3MTLA 1U46A 2XK9A 4FT3A 4I21A 4O6LA 2HK5A 4QYHA 5TOZA 1IAHA 2BHHA 3UE4A 2IVSA 4A9SA 2WMWA 3R30A 2JBOA 4RIXB 3FY0A 2R3JA 4ZOGA 5B2KA 3FI8A 2Z7QA 3IS5A 4BDDA 1J91A 4CKJA 1ZXEA 4R1VA 5EKOA 1FBNA 4MBIA 4CCBA 1OBDA 2WMXA 3FHIA 2VO0A 4HVDA 3U51A 3OOGA 5KKRB 3H3CA 2XF0A 4LGDA 4RG0A 1Q8ZA 2VO3A 4B4LA 5CAPA 3UPZA 3DKGA 2J0MB 3TM0A 4FKVA 2WTVA 5CSVA 2QG7A 3BLHA 4X7QA 2GS2A 3TNHA 4WG5A 2XAMA 4EQCA 3ORZA 4NYEA 3K5UA 3NEWA 2HZIA 4F9YA 1GNGA 2IG7A 5IA4A 4GFGA 1IG1A 3QKKA 4HGEA 4W8EA 1PF8A 2XEZA 4V0GA 3KGAA 2EB3A 3BGPA 3A2CA 2Y0AA 4AX8A 4DG0E 2E9OA 2JDTA 3VUIA 3F69A 1APME 1DAWA 4J52A 4PY1A 5FEDA 3WZDA 4PTGA 2X4FA 4ACCA 2UVXA 4O2ZA 4YC8A 4F1MA 4C4HA 4MK0A 2QURA 5DHJA 4JR7A 5FTOA 3HDNA 3HMPA 4O7LA 4ZJIA 3KK8A 5ANIA 2YCSA 4TYHA 3BYMA 2BRGA 3D5VA 3S95A 4GFMA 4CFXA 3CTJA 2YAKA 3OHTA 1FMOE 1YXVA 4IWOA 3DK7A 2JFMA 4I6HA 5HORA 2J2IB 2HELA 3PFYA 5IMXA 3HL7A 4F7LA 2WMUA 2ZJWA 2C5VA 2JLDA 3W0RA 1PMUA 5M44A 4AP7A 4IFGA 5K3YA 3A99A 1R78A 5CXZA 3QX4A 3F7WA 5AP5A 5CX9A 3E93A 5BVWA 3ROYA 4FOCA 2ZV9A 4UYNA 3DOGA 4I6BA 3MPAA 4AN3A 1S9IA 3B2TA 5IEYA 4O7WA 3OS3A 3N9XA 1OL2A 1H07A 3VW8A 4GU6A 3KU2A 2W1DA 4ZJVA 3F2NA 4IANA 3VC4A 2BRNA 4FSYA 2FSLX 1U5QA 4O0TA 5HG9A 1YKRA 4YZBA 3VULA 4DGMA 3OC1A 4OT5A 4JDIA 3VS0A 4EEVA 4A4LA 1XKKA 3FMMA 4WRSA 5ICPA 3Q4ZA 4ZTQA 2ETRA 5ETAA 3R8PA 3ZHPC 5IUHA 4ALUA 3F2RA 1ZZLA 1WVYA 4C58A 4PWNA 4J97A 4HNFA 4MQ2A 4WBBB 4KBKA 3C4EA 4EI4A 4XV9A 3EQRA 3BE9A 4HZSA 3WE8A 3GC8A 3VRYA 3NSZA 2PVRA 3ZBFA 4TYJA 3FLSA 2WKMA 3UG2A 2JDOA 4BTKA 4AZTA 4XG2A 5C4LA 1UV5A 3FWQA 3KB7A 4L52A 4HCVA 4WNOA 5IA5A 1JPAA 4KKHA 5DR9A 5AR3A 4BCJA 1XH6A 4ZIMA 4RX7A 3U55A 3HV4A 4KSQA 4OTPA 3JR1A 4GL9A 4EYMA 4HYHA 5IG1A 3IPHA 4MQ1A 4CLIA 4I4FA 3B8RA 4MXXA 4AZEA 4FVPA 3ZYAA 1BMKA 4CMOA 1JWHA 1GOLA 5KBQA 3ORTA 4M68A 4RIXA 3PJ2A 2V5QA 1BKXA 1Z57A 1ZWSA 3GU4A 3R8MA 3EZVA 4IE9A 4BDGA 1NVSA 4P2KA 3A8XA 1WVWA 1A9UA 3PXKA 3QZFA 1ZMVA 3P4KA 4QNYA 5HLNA 3AG9A 3FC2A 1OKVA 4RT7A 2LAVA 2VGOA 2F9GA 5TE0A 1M7NA 3QQHA 4J1RA 3RNYA 3TNIA 4LOPA 3WF5A 2JITA 3TV4A 2GS7A 3VBVA 3K3JA 4O0VA 2WB8A 4LV7A 4M14A 4O7SA 4AU8A 2Z8CA 4W9WA 3BGQA 5DGZA 4MHAA 4FL1A 4CFVA 3NUXA 5C01A 3ZM9A 3PSDA 4GFOA 4DEDA 3IW5A 1KWPA 2O0UA 4LUEA 4ZP5A 4E8AA 4FKUA 5F4NA 4BCFA 1HOWA 1I09A 2C5OA 4JIAA 1G8KA 4X2JA 5CEIA 4G2FA 1JSVA 4GW8A 3ALOA 4S32A 4AOIA 3KF7A 4YTFA 1YXSA 3LJ0A 1OUYA 2CGUA 3NUUA 5C8MA 4DT9A 3IDCA 3HA8A 1V1KA 1JSUA 3FLNC 4YC6A 4D55A 2UZEA 3OXTA 3VNTA 3C0GA 3LFCA 3QCXA 2XJ0A 2JBPA 3FYKX 2YCFA 4PDSA 5DPVA 5L2QA 4CKIA 5A4CA 5B2MA 3V04A 4BHNA 3LM0A 4DH8A 3COKA 3F5UA 3ZSIA 5A54A 2QR8A 3A61A 3LKMA 1UKHA 2XBAA 4GYIA 4TYIA 5CEKA 4R7HA 5CVGA 3SW4A 3A7IA 5HBJA 5CEQA 2WTKC 1CKIA 3IW4A 1NA7A 4K0YA 5LVMA 3WZJA 3UIMA 1A48A 2R3RA 5CVFA 3VUKA 3OT8A 1Y6BA 4RVTA 1OVEA 5IISA 4R7BA 3U8WA 2BUJA 2XIZA 4IAIA 4I6FA 4EH5A 4O4BB 2F7ZE 3EIDA 1H27A 2HENA 4EUTA 4ZLZA 4O84A 3UODA 1M2QA 4DYMA 2V22A 2OJIA 2QHNA 3Q96A 3A60A 3LPBA 3W2SA 4ERKA 2XNPA 3EFLA 3TMOA 3WI6A 4O27B 4X21A 3C1XA 4K8AA 4GT5A 4DFNA 1VEBA 4NH1A 2F49A 1OL5A 2O3PA 2XJ2A 2FSMX 1PKGA 3DU8A 1DI9A 3F6XA 4PP9A 4XBRA 5KMNA 5EW3A 4AW2A 4MBJA 3OBJA 2BZJA 4LOQA 3Q3BA 4YP8A 4I5CA 4FKTA 5D41A 2VWWA 4KABA 3TJDA 2C5NA 3OCSA 3HA6A 2XYUA 4KIOA 1B6CB 3ORIA 1ZZ2A 3LFFA 2XH5A 4UMPA 5D7AA 5CAVA 3IDBA 4PL3A 3W0MA 4L01A 4D58A 2OH0E 5HBEA 3S2PA 3SQQA 2BZHB 2OSCA 3BHYA 3NNXA 1GY3A 3GB2A 4NT4A 2C4GA 2RFEA 3VRZA 1IAJA 3GQIA 3NAXA 3RPSA 1WCCA 4FKQA 2B52A 1H1PA 2W1EA 4YJVA 5I9WA 4M7IA 4XCUA 2G15A 3NZ0A 4OT6A 4I0RA 3WF9A 4Y5QA 4BN1A 5D11A 4X6QC 2YM8A 3CY3A 2H9VA 4EH8A 5ITAA 5BVKA 3EN5A 3ZCLA 1G3NA 1J7IA 3L8XA 2XKEA 4O22A 1O9UA 4D4YA 4ZLYA 3AC8A 3R0TA 5AM7A 4RC2A 5EH0A 1JQHA 2YABA 4E1ZA 3GEQA 2QLQA 4NSTA 2C5XA 2J0IA 3MFRA 3R8UA 4E4XA 4AXEA 1KSWA 1XH4A 4FR4A 4DN5A 1UU3A 3EQIA 4DA5A 3QCQA 2ITYA 4DFUA 3NIEA 4JX7A 3FE3A 2I40A 3COMA 3BPRA 3RINA 2X2MA 5CAUA 3Q4TA 4QP9A 1Y6AA 4QYGA 1OBGA 4FRFA 3C4ZA 3A7JA 3H10A 3GGFA 2X0PA 2JIVA 5IA0A 4C3FA 1WBOA 3OY3A 2Z60A 1OIYA 2W17A 2C1BA 3DNEA 1YQJA 5HCXA 4C7TA 2UZWE 2QOKA 1RW8A 3QQUA 4M69A 5LJJA 3V8WA 4ZAUA 3BBTB 3V5LA 3QUEA 5FEQA 4UMQA 2VX3A 2YERA 3DQXA 4FYNA 2CNUA 2I0VA 2WQNA 4XHKB 3ZU7A 2RG5A 4DBNA 4L43A 1KOAA 1M7QA 2C0IA 2F2CB 3CTQA 3ORNA 3Q04A 4NM0A 4NTSA 2ONLC 5F94A 5HG7A 3CPBA 3OW3A 5AV3A 2FA2A 5BVEA 3S1HA 4BF2A 3CBLA 3VUTA 2B55A 1AGWA 5AIRA 1T46A 5KMLA 1YWNA 3FV8A 3IK3A 5HTCA 5FXRA 4FI1A 1E9HA 2VTNA 3JVSA 4EWQA 2OK1A 4IEBA 4M84A 4YJTA 4EOLA 5IZFA 3MESA 3H9OA 2OJ9A 3KULA 3D5UA 2G2FA 4BWKA 5EW9A 5E1EA 3DZOA 5GZ9A 2QODA 4RX9A 1S9JA 4C57A 1W7HA 3PUFC 4IB1A 1P4FA 3FJQE 1K9AA 2WZJA 3LW0A 1YDRE 4H3QA 2PVKA 3DJ7A 4BCGA 2VO6A 5EFQA 5KBRA 3BIZA 4ZTMA 3VIDA 3JUHA 4J95A 3SVVA 1QMZA 2HAKA 3FMLA 5M51A 3P23A 2SRCA 3DJ5A 3KMUA 4QPAA 3W55A 4AA0A 1XO2B 2PUNA 2X1NA 1DI8A 4FKWA 4P5ZA 2CGXA 4Y72A 2XYNA 5A6OA 1ZY5A 5EKNA 3BL9A 4U0IA 3OFMA 1R0PA 3KA0A 4RQVA 4AGWA 2HOGA 5AR7A 2IVVA 5IEVA 4YZ9A 3SV0A 4FZAB 1DM2A 2ITVA 4NM3A 3QWJA 1YI6A 2KTYA 3DFCB 1XHAA 3VJOA 4AQKA 2B9IA 4MXYA 1YI4A 4I3ZA 1ZLTA 3PIZA 3OOMA 4AGCA 2X8DA 3A62A 2WU7A 3O50A 5JMSA 4R77A 3WOWA 4AXFA 1FGIA 3RPOA 2BFYA 3PLSA 4EL9A 3VN9A 3DZQA 3RPVA 2XIKA 5E8WA 3VAPA 3ACKA 1URWA 4XP2A 2BRBA 2O63A 1GAGA 3E8CA 3Q53A 3M11A 4GIHA 4O4CA 4Q9SA 4S34A 3DXQA 3UDSA 4FL2A 3I6UA 3QTZA 1WBNA 3NAYA 4UYAA 4C4FA 3E8DA 3NX8A 4UZDA 2ITPA 2J9MA 3I7CA 4JBQA 3TUBA 3E8EA 3FPMA 3DBEA 2PZPA 4EJ7A 4IJ9A 3F82A 3LE6A 4AGDA 2ZM4A 3PDTA 2JDSA 5ANKA 4A06A 2P33A 4IAKA 4ACHA 3ZONA 2FUMA 3E8NA 2WTKB 5AUYA 3FSFA 4XP3A 3V01A 3CY2A 3DJ6A 3PPZA 5E92A 3ROCA 5IQDA 4X2GA 3E3BX 2P0CA 4XX9A 3ZRLA 2XEYA 3VHEA 4TXCA 4DGNA 4CCUA 2ETKA 2P4IA 2ZB1A 3ETAA 3LFBA 4N4SA 3ZEWA 3L8VA 3QUDA 3CS9A 3TWJA 1DS5A 4HCUA 4MEDA 4KS8A 4O7YA 3K2LA 4WSQA 5KO1A 2VV9A 3D7TB 5CY3A 4QYYA 3EN4A 2OJGA 1WFCA 3PXRA 4JT3A 5AX3A 2J4ZA 4UY9A 3VHKA 3TN8A 2QQ7A 3QTRA 3IOPA 4YNOA 4AT4A 4MNEB 1REJA 5FDPA 1AQ1A 3MW1A 5M55A 4GIIA 1ZAOA 1JLUE 5IUIA 5JRSA 3VBTA 1J7UA 5AP2A 2JC6A 1Z5MA 4HYIA 2PVYA 4NCTA 5CAQA 4D9UA 1W98A 3KRLA 4KB8A 4X3FA 4UZHA 5I9UA 4YTCA 3SLSA 4DEGA 5A3XA 1Q4LA 3KRRA 1JBPE 3KK9A 3ZO2A 2BZIB 4XMOA 5HG8A 4AZVA 4ID7A 4FGRA 2W1ZA 5M4FA 2JDRA 4HYSA 1PYXA 3ENHA 4TRLA 4QTCA 5M4IA 2OF4A 4USEA 3CD8A 3DGKA 4M0ZA 4DG2E 3OMVA 4GCJA 3DXNA 3W10A 2FSTX 5J1WA 4N6YA 4BZOA 3E92A 2W06A 2ZV2A 4XRJA 2XAOA 1Y57A 3GCUA 4PMTA 3U9CA 4B0GA 2F7XE 4B8LA 4ZZOA 4NIFA 3OT3A 5I0BA 2UW7A 2GNGA 4JIKA 5E1SA 4JX3A 3QTXA 4A7CA 2Z7RA 4KD1A 2OIQA 4QMLA 4QMSA 3NYXA 4L9IA 4TYGA 5KKRC 1ZARA 2PVHA 3CCNA 4IZAA 2WQOA 3BBWA 5DH3A 5GNKA 5BYYA 3GOPA 3ZFXA 4DINA 2R3IA 2DQ7X 2FGIA 4HPUE 4L3LA 3PWYA 1CKJA 2WHBA 4N0SA 3PVBA 5CTPA 1WZYA 3H0YA 1AD5A 5DRBA 1ZMUA 2UZUE 4RQKA 3RPYA 4DHJA 5EM6A 4O0WA 2Y4IC 5HBHA 5AP1A 4EQUA 5I9VA 1OI9A 2XM8A 4FNXA 3OXZA 1IEPA 2BDFA 3NGAA 5JT2A 5F20A 2WPAA 3LCKA 5DWRA 2Y4PA 3HAMA 2WD1A 4HGTA 3VF9A 1VJYA 3BU5A 2O65A 2P2IA 1UWHA 4WUAA 3RAIA 3S3IA 1G8SA 5IQCA 1OB3A 4Q5EA 4ASZA 3PLAE 1OGYA 4OBOA 4RJ4A 3F7ZA 4QQTA 4Y85A 3QYZA 4EOQA 2UW4A 5HO6A 5I9YA 4BDAA 4DH5A 3P5JC 4JMQA 1IA8A 3MY1A 4H3BA 4XNEA 4QP7A 5DA3A 3VS1A 3Q2JA 3WZEA 4IVDA 5AAEA 4FT0A 3CTHA 4EOKA 3KCKA 4F0GA 1VLRA 2UVYA 1O6KA 3POZA 3R7IA 4BCMA 4E5BA 1WBTA 4ALVA 4EZ5A 4YURA 4FIIA 5HU9A 3QBNA 4BCHA 4CTCA 3KVWA 2ETMA 3ET7A 4PV0A 1OKWA 1JAMA 2XS0A 4FKOA 4QP8A 4RMZA 1PYEA 3RHXA 3LMGA 4QD6A 2AUHA 4PMMA 1M2RA 5JFWA 1J1CA 4BZNA 4L6QA 4LGGA 3FMDA 2ZAZA 2QU5A 3HMOA 4EQMA 5FUTA 1UVRA 3WF8A 3FSKA 3OF0A 5CU2A 3VS6A 2BIKB 4RWIA 2JGZA 5AUUA 2WQMA 2EU9A 2R2PA 3DT1A 3EFKA 1M2PA 4LYNA 4PQNA 3V5PA 4A07A 2J50A 3CE3A 1L3RE 2JIIA 2IZUA 4DT8A 3CQEA 4YJSA 5L8KA 1URCA 4YNEA 1SVGA 2VWIA 4TL0A 5M07A 4OBQA 4FV7A 3D7TA 4YGAA 4DFXE 3IECA 4V0GB 5JFVA 1G5SA 3QTIA 4FNZA 4DEBA 2GQRA 3R22A 2EXCX 2XK4A 3NYNA 3FZPA 3CR0A 3C13A 3T3UA 3QRTA 4MNEA 3AQVA 3BCEA 3G51A 4AN2A 4RIOA 4ERWA 3HX4A 4ITHA 3UBDA 1QCFA 2J51A 4DCEA 5LARA 3QTQA 3UP2A 2HY0A 3MVMA 5HTBA 1WBSA 1YDTE 2B53A 3I0QA 4Q5HA 4U97A 4U80A 5H8GA 3ZFMA 4Z7HA 2FB8A 4E5AX 4EJNA 4AN9A 4MNFA 4TYHB 4AA4A 4EZ7A 2ITZA 4F08A 4CT1A 3EQCA 3ZO1A 4O7VA 1W0XC 5BPYA 4WRGA 4O7NA 3TV6A 1H26A 3RP9A 4ZSJA 4M97A 5FLFA 3I5ZA 4O6EA 4C8BA 2YDKA 1PMVA 4X0MA 5EHLA 3OG7A 2O5KA 2AQXA 4F70A 3SDJA 2BALA 4IM2A 4M8TA 5DT0A 3C5IA 2XKFA 4CKRA 4J71A 3LJ1A 4RFYA 2PWLA 3AC4A 1R3CA 3C51A 3R7UA 2YM7A 2RFNA 4WOVA 4AT5A 2W96B 4F65A 3WIGA 1JKSA 3UIBA 5FM3A 4L45A 3GC7A 5C27A 3QRJA 3QC9A 3QQGA 1Q3DA 3L1SA 3KY2A 4FKLA 4FTIA 1WBPA 5GJFA 3VS7A 4ANNA 2GNHA 4G5PA 4CV8A 1NW1A 3GU5A 3SX9A 5HD7A 1VR2A 4D0XA 2PVNA 1Q41A 2NO3A 1PJKA 5CSPA 3GVUA 3QL8A 4ZSEA 1KE9A 4FSZA 4UB7A 2WU6A 5ETCA 4MTAA