5HO7A

Discovery of novel 7-azaindoles as pdk1 inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
289
structure length
280
Chain Sequence
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of novel 7-azaindoles as PDK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 280
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ho7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ho7A01
2FB8A 2YABA 4IM2A 1UA2A 2BAJA 2GNHA 4GEOA 4D28A 4F70A 4I92A 2W0JA 1Y8GA 3CKXA 1XBAA 5BMSA 3DZQA 2WTCA 2YIRA 4LQMA 3MY1A 4DTKA 2XJ1A 4NW6A 4BTMA 3O0GA 5I9XA 3LM0A 4AZEA 1J91A 2OZAA 4F0FA 3TIZA 2ITOA 3UDBA 5FXQA 1HCLA 5AM7A 5C01A 4RPVA 4F64A 2OLCA 3R1YA 2WGJA 4FT3A 4II5A 5B2MA 1PXPA 3O7LB 3ZONA 3PTGA 4QYHA 3TZ7A 4FKSA 3VJNA 5BUJA 5GZAA 2WTJA 2VO0A 3R1SA 3V8SA 2ZV7A 2ZM3A 4GVJA 3UVQA 4E5AX 5F1ZA 2VAGA 4F9AA 3MGYA 5GIPE 2F7ZE 1Y8YA 1LPUA 3OWKA 4XS2A 4HNFA 2C1AA 1Q99A 2O63A 3K3JA 5I0BA 5JFWA 4FG9A 3ZDUA 4BICA 3LLAA 4AN3A 2VWIA 3B8QA 2VWWA 4X2FA 2WMUA 3RAIA 3F5PA 5CI6A 2WEVA 4FVQA 3SQQA 1OB3A 2G2IA 2OF4A 2WMRA 4MK0A 3E3BX 4I0SA 4TN6A 5DBXA 4BCMA 4C38A 3ZFXA 5JT2A 1ZOEA 4JI9A 3TUBA 2O8YA 4L6QA 3DY7A 5EYCA 5FUTA 4L67A 3NUNA 2XK3A 4PY1A 2ERKA 4GUEA 4UMRA 4AW5A 5B2KA 2Y8OA 5L6PA 3Q60A 4Z7HA 1FQ1B 3CQWA 4TYHA 5AFVA 5BYLA 4C2VA 4EBVA 3JXWA 2JD5A 2W96B 2B9IA 3EN7A 5E8XA 4ZZMA 3R7OA 5DIAA 4E7WA 5LVMA 1STCE 2YN8A 1U5RA 1WBPA 3NUUA 5E8UA 5JGBA 1O6YA 4YTHA 4L7FA 5E8TA 4FEUA 3ZUTA 3FQEA 3QD3A 1QMZA 3E7VA 3UVPA 3NYOA 3BX5A 3II5A 3EHAA 4CNHA 4IZYA 2QO7A 3QXOA 2VWYA 1W82A 5LMKA 5CANA 4NIFB 1MRVA 3G51A 4PX6A 2FUMA 4EYJA 3RPSA 2FSOX 2IW8A 2EB3A 3HGKA 4IB0A 4CTCA 4QMNA 3FLNC 3DDPA 3ROCA 4HYIA 4YZDA 2XVDA 4FKUA 4BDGA 1H27A 3FPQA 3NNUA 2Z02A 1QPEA 4WBOA 5ANEA 2QI8A 3CGOA 1M14A 3GQIA 4IWQA 1T46A 5EYKA 4QMVA 3SKCA 4A9RA 2V5QA 4D2VA 3DCVA 4HVIA 4P5ZA 4H1MA 1JQHA 3ORPA 4I24A 1IA9A 3NVMB 2Y7JA 4J1RA 5D10A 5DI1A 4L01A 2Y4PA 1XH7A 4UMQA 3CXWA 4QNAA 4DG2E 3A7IA 3KULB 2FO0A 3I0OA 1S9IA 4H58A 4RJ5A 2WD1A 3FZPA 4RRVA 4NWMA 4C4FA 4YHTA 2CJMA 2R9SA 2OFUA 4AA4A 3N4VA 4CV9A 3QZIA 3OW4A 4I1ZA 4G3GA 4IDVA 4DCEA 4IJ9A 1T45A 5AAFA 4CSVA 4F63A 5JKGA 4PWNA 4RIYB 4W4VA 4TKSA 1BI7A 1Q41A 2QG5A 1OZ1A 3PJ1A 2F4JA 2WTKC 2ZMDA 3CE3A 4JX7A 2YHVA 2OG8A 3LMGA 2F2CB 3HMMA 4TWCA 3RPOA 3BIZA 3ELJA 3IW5A 2XH5A 2YIWA 2C3KA 2R3GA 4E5BA 1CKPA 1H24A 2ERZE 3GNIB 5DHJA 5CTPA 4AW2A 3TV7A 4KIKA 4EQUA 4IVDA 4ACCA 5EW8A 5LMBA 1ZARA 2HZ4A 3LQ8A 2RKUA 4ENXA 1GOLA 4OUCA 1MP8A 3FZTA 5B2LA 3VUDA 4IAZA 3QA8A 4DINA 4RQVA 4U5JA 3SDJA 4P90A 2OJJA 5HG9A 3ZFYA 4FG8A 2C0OA 2Y6MA 4Y73A 4CD0A 3R8VA 3RK9A 5DR2A 3KGAA 1KE8A 3R73A 4IIRA 5HG8A 4RX5A 4ZJIA 2XMYA 3OCSA 3GFWA 3EYGA 3BU6A 2UW0A 1SM2A 2AUHA 4IM3A 5B7VA 3HMIA 2W4KA 3EOCA 4FTRA 3WZDA 3U9CA 1CKJA 3KA0A 3PWYA 1W84A 2WMQA 2PMIA 3R71A 1H0VA 3UPXA 2VRXA 3ENMA 5JEBA 1KE6A 1YXVA 3AC2A 3I7CA 4QPAA 2YCQA 4L7SA 5DOSA 3WF5A 4AT4A 3KQ7A 4NJ3A 4TTHB 2BDWA 4D2WA 3EQBA 5K4IA 5CU3A 3ZM4A 3SXFA 3LJ0A 2BIKB 5L2WA 4DGGA 2QNJA 4AN2A 3DTCA 4M3QA 4QP4A 2PMLX 1O6LA 2Y4IC 3U87A 3WARA 4FKOA 4EOSA 3GU6A 4EBWA 5L2IA 2VTMA 3OMVA 2J0KA 2ZDUA 2DUVA 5AM6A 2YDKA 4RWIA 3MH2A 4V0GA 5A14A 2IW6A 3A8XA 3FE3A 2IZRA 4AA0A 4UWYA 1OKVA 4C0TA 1H1RA 3PPJA 3TUDA 3V3VA 1PHKA 1MQ4A 4BBFA 3GC8A 4A07A 2PL0A 5EQPA 4S32A 4BWPA 3FQSA 4O7ZA 2V7AA 4FGBA 5JQ8A 2P33A 2YEXA 3LZBA 3WZEA 3CR0A 2B54A 4JBVA 4BY9E 2C6DA 3BLHA 1YQJA 3DB6A 4NU1A 3CJGA 3QGWA 5HO7A 4CVAA 3BPRA 3HA8A 4WSYA 4JG6A 3R9OA 3OWLA 3BKBA 4O0VA 1FVRA 2VX1A 2I0HA 1UU7A 5BMMA 3IOPA 4JT3A 4YNOA 3F7ZA 3W2PA 4RWLA 5IUGA 3PA5A 4AZVA 4GFGA 2YZLA 3NUYA 3VUKA 4EQCA 4LOPA 1REJA 3DAEA 3G5DA 1Q8YA 3QQLA 1JKSA 2QHMA 2R4BA 5DNRA 3VS0A 3WI6A 4AOTA 4OAVB 3ORIA 1SMHA 4AA5A 1H00A 5K0KA 3FHIA 3UP7A 1ZYCA 2PE2A 3GUBA 3LCOA 3P78A 4WSQA 1NY3A 4YJQA 4YSJA 4FGRA 4E73A 4BDHA 1AD5A 4DC2A 4CEGA 2OJ9A 2WMWA 2RFSA 1TQMA 5CYIA 2C3JA 3RWQA 4LL0A 4BF2A 5I4NA 3VC4A 3FJQE 1KSWA 1L8TA 2GNLA 5CEIA 5BUIA 4E6CA 1L3RE 3KXZA 5JZNA 2X2MA 3F6XA 4I5CA 3ORLA 3OVVA 3Q53A 2RFEA 3PXKA 4NUSA 1H26A 2HZ0A 4G31A 2X81A 4YJPA 1QCFA 1YHVA 2BHEA 4TPTA 3BGQA 5CEMA 4FV0A 1J7IA 2VTSA 4W8DA 3D5XA 4U3ZA 4J99A 4XLVA 4R5YA 4H05A 4FYOA 4D4RA 3UVRA 4D1SA 2XNBA 4DH8A 4YC6A 1JSUA 1PXNA 4S2ZA 1OGUA 3IKAA 3V5JA 4B9DA 2ZM4A 4RVMA 2VTOA 3L8VA 4S33A 4L44A 1Q8TA 3WYYA 5CALA 5CU6A 5LXMA 2UW7A 4YZNA 4RJ3A 4NW5A 5HE1A 4WG5A 4AG8A 4Q5EA 2B0QA 2ZYBA 2XM8A 5K3YA 3FHRA 5HVKA 4L53A 3QQKA 4KIOA 4UALA 4L3LA 3CTJA 4DH5A 1ND4A 4K11A 4YHFA 3C51A 3VS3A 2WFYA 5E92A 4AZSA 5I9VA 1PKGA 5K9IA 3Q6UA 2XNGA 4FSYA 5EI8A 3OZ6A 4LMNA 4D4SA 3PIXA 2PPQA 5CF5A 3P0MA 3OTUA 3F69A 2PULA 3C4XA 3HAVA 4GG7A 1Q24A 4QYGA 3KXGA 2WMAA 3DBEA 3ORXA 3OBGA 4RIWA 4UEUA 4WNPA 3UP2A 4A7CA 1QPCA 4AU8A 2WXVA 3KL8A 5F20A 5DWRA 4OBOA 2R3NA 3P1AA 5T68A 2QOKA 3NRMA 4FIHA 5JSMA 4LRJA 2OIDA 4FIIA 3VS1A 3RI1A 4IVAA 4FZFB 3DNDA 3FMLA 3E64A 4EWHA 3ID6C 4CG8A 3LCDA 3P7CA 2X2LA 4RX7A 5DA3A 4QP9A 4C34A 3V5LA 4XG9A 2QC6A 3EN4A 5ETCA 3R00A 2Z7LA 1R39A 3LFQA 2YAKA 2XKFA 2ZV8A 3PXFA 5GIOE 2GHLA 3KXHA 3IW7A 3VUMA 3E8DA 5HU9A 2BFXA 3C0GA 1JVPP 3HA6A 1CKIA 4XG2A 4KRDA 5TO8A 2IVTA 2J9MA 4QOXA 4Q2AA 3NNVA 4R6VA 3T9TA 3VBVA 3SXRA 3IW6A 3ALNA 2OH0E 4KSQA 3DQXA 4JJRA 4BRXA 4M69A 3LFDA 3NUXA 3SC1A 2CNUA 4QPSA 3EQHA 5E1EA 2YLFA 2RFDA 4YC8A 3R9NA 1Q61A 3RHKA 3NEWA 3R7YA 2QOFA 4I22A 4KD1A 4Z9LA 2YCFA 3UZTA 1YVJA 3I6WA 4CFNA 4EUUA 2AC5A 4IACA 2YJRA 5DT4A 2VTTA 3TZ8A 5BVOA 1UNLA 1B6CB 5BYYA 2QOHA 3QTXA 3FMHA 4FTAA 4NT4A 1H1WA 4HYHA 1ZOGA 1GIIA 3QUEA 3NAYA 5L2QA 4GU9A 4QP6A 4YZMA 4O83A 2XA4A 3GU7A 3MH1A 3MS9A 2VUWA 4KS8A 3QYWA 3RAKA 2QOQA 5FBOA 5FXSA 4ZTSA 3V5WA 5KNJA 5EQYA 2CKPA 4TNDA 3QL8A 2PSQA 5DE2A 3Q52A 4HOKA 4NCTA 3RZFA 5FM3A 4DHFA 3DXPA 4GKHA 3C4WA 2WMXA 4RWKA 4MX9A 2XCHA 3BCEA 4FV8A 5AEPA 3ZU7A 4BI2A 3TNWA 2XNMA 3W55A 3CEKA 4X0MA 4GK4A 4RMZA 4YLLA 1XKKA 2B7AA 4RGJA 2BDJA 4O21A 3R7IA 1SVEA 3OXIA 3WF8A 5LVPA 2XCKA 1BYGA 4BHNA 1HCKA 4PPCA 5ANKA 3KN5A 2VTAA 4FUYA 4XEYA 5H8GA 2XNNA 4RLLA 3R0TA 4HCVA 4F0GA 2C0IA 2R3JA 4FV2A 4K33A 4I23A 3EH9A 4MNEA 1OKWA 3NW5A 4R3CA 5AJQA 4FTMA 5FLFA 3UE4A 3VIDA 5HBHA 4MBIA 1TQPA 2IVSA 5I9UA 2G9XA 2YACA 4U9AA 4U45A 4JDHA 1M7QA 1XH4A 2HELA 1J1CA 2C47A 1SVHA 4JDIA 4DN5A 5CI7A 3FBVA 1PMUA 2CDZA 4YHJA 1XQZA 4WRGA 4UZHA 3CCNA 2DQ7X 4AT5A 3CP9A 3RZBA 4IAIA 4EK4A 5AP0A 3LMHA 3BQRA 2GTNA 2QQ7A 3KY2A 3Q3BA 2I1MA 3IPHA 3ZO1A 5FD2A 3PYYA 4IZ7A 4KKGA 2HAKA 4G2FA 3UNKA 4I5MA 4QYEA 2GMXA 3VWAA 3I6UA 3HMNA 5HIDA 2Z2WA 4B0GA 4M14A 3GC0A 5BVNA 5HE0A 5AMNA 4K8AA 2G01A 2R0UA 3QRTA 4CV8A 5A46A 4RFYA 4CKJA 4JRNA 5AR3A 2PVRA 2XNPA 1CMKE 2C5OA 2VTJA 5C4KA 3TUCA 4FUXA 5E8YA 4PL3A 3FEGA 3DJ5A 1OIUA 4TZRA 4W8EA 5DLSA 2WQNA 2OK1A 2VTQA 3DB8A 3IW4A 5DEYA 5EKNA 1G8SA 3Q4TA 2XYUA 5IQAA 2ZV2A 4YJSA 3R7GA 3RNIA 3IOKA 3E63A 3R7UA 3ERKA 4CZYB 4E3CA 5IZFA 4YJUA 2WKMA 4XX9A 3WF7A 4J8MA 3VQUA 4CT2A 1URWA 2O0UA 3A7JA 3CC6A 3QHRA 4A9UA 4D2RA 4CG9A 4O91A 3VO3A 4L46A 3ZO3A 3LXNA 1GIJA 4QQJA 5L3AA 3RAWA 2C69A 4FTIA 3FXZA 4BZNA 4EJ7A 3EYHA 3TDWA 1EH4A 3QRIA 3GI3A 2X9FA 1XH5A 3OCTA 3QD4A 3A60A 4NJDA 3BYSA 4HVHA 4CGAA 2VD5A 5TT7A 4IMYA 3KREA 4EI4A 4TRLA 3FSFA 4PTCA 3R28A 4I21A 1R3CA 1ATPE 4GW8A 1PXLA 3FMJA 1O9UA 1XH6A 4IX3A 3ZLWA 3F2RA 5EHYA 2PVYA 5TF9A 2YWVA 3O96A 4XV2A 1H0WA 3C0IA 4O0UA 3F3VA 4PNKA 1PXOA 4IAKA 5AUYA 5AV3A 2PVJA 4C4JA 4FVRA 1PXKA 4C57A 3RAHA 4QD6A 5JRSA 3FSKA 3AD6A 4BVUA 4C2WA 4ONAA 5BVDA 3PSCA 2BCJA 2WTWA 3NWWA 4IM0A 4QQ5A 4RC4A 5FXRA 2I40A 2AC3A 3CY3A 4EQMA 3EMGA 4O7LA 3VW6A 2XZSA 2JAVA 5CASA 5L6OA 3JPVA 1IAHA 4F6SA 3G33A 2ESMA 2ZDTA 3WZKA 5ETAA 4CMUA 3ALOA 4BL1A 3QU0A 1XHAA 5JMSA 3Q5IA 2I6LA 3Q9YA 4E4XA 5J79A 2SRCA 2B9FA 4DEBA 5JFVA 5GZ9A 5JRQA 5I9ZA 3GEQA 4MF0A 3EFLA 4BWXA 4FEVA 4FT9A 2YERA 5F4NA 1ZXEA 2QKRA 4ZTHA 3I81A 3ZLYA 4AW1A 1Y6BA 4R3PA 2BROA 1VR2A 1NA7A 3SLSA 2J0JA 3COHA 3FZ1A 4IDTA 3DXQA 3A2CA 2PZIA 4YSMA 5DH3A 1XR1A 4PPBA 2XIKA 3QALE 5HTBA 2RG6A 5HI2A 4OR5A 1DI9A 2UZWE 5J87A 3VBQA 3KF7A 5AV1A 5KHXA 3LPBA 3HRFA 3KRWA 4H3PA 3A61A 1KV1A 1PW2A 2UZOA 4J96A 4JLCA 4XG3A 2HOGA 3D5VA 4ASXA 4QQTA 5CVFA 3OY3A 1GNGA 2Y0AA 3DDQA 2PVNA 3VNTA 4EYMA 2NRYA 2UW4A 2XK9A 3L9LA 1YHWA 5DT3A 5ANOA 5B0XA 4AF3A 4D4YA 4R78A 3CD3A 2F9GA 2IZUA 3RBWA 4FTNA 3HAMA 4YTIA 2YLEA 3BGPA 1M2QA 5LVOA 3PIYA 3FLQA 1V0PA 4C62A 4FIFA 2YISA 3AQVA 3UIXA 4WNOA 3CQEA 2EUFB 3QD0A 3FLYA 4BBMA 3W16A 3OOMA 3U9NA 4BGQA 3RKBA 3SAYA 3LLTA 4DFUA 4UMUA 4F6WA 5DMZA 5HGIA 1E1VA 3VW8A 3FMEA 4EOPA 5KUPA 4O81A 3QGYA 2X4FA 3BU3A 2W1IA 3F3WA 4TW9A 3C5IA 1AQ1A 3FLSA 5HE3A 4HPUE 1OL1A 3VS7A 2OZOA 1U54A 4S30A 1OIRA 4A9SA 1YDSE 4NEUA 3ZBFA 4EOLA 3IGOA 4XLIA 1SVGA 5AUVA 5HBEA 5IMEA 3DPKA 3AXWA 1H4LA 4DTBA 3ITZA 4FSUA 4CFUA 5M09A 2JDOA 2P3GX 3BRBA 1TQIA 3DU8A 4C4HA 1RQQA 3ZEWA 4ZS4A 3C13A 1P2AA 1PKDA 2ZVAA 3EZVA 3OHTA 4FF8A 4KB8A 5FP6A 1W98A 4EOOA 5HTIA 2X6EA 3POOA 4TWNA 4BTKA 2V62A 4DGMA 4E6AA 3LCTA 3MESA 3QWJA 4C4GA 3I0QA 4CTBA 4FL1A 3ZSHA 3P86A 3BWFA 3RTPA 3KXMA 2VGPA 2PMOX 5HNBA 2WTVA 3NX8A 5HHWA 1OPKA 3AMYA 4FV6A 3TV4A 5J1WA 2CPKE 2NNWB 4HVDA 4Y5HA 2ZJWA 4RVTA 4M97A 2WQBA 3TDVA 4N6YA 2XK7A 5DEWA 3PVBA 2ZV9A 1J3HA 4ITIA 4F0IA 5ANDA 5A4EA 3D7TB 4YURA 5GZ8A 5A4CA 2ITWA 4JR7A 3OF0A 3KRJA 3E3PA 4U40A 3D83A 4UWCA 3LQ3A 1DI8A 1WVYA 1ZMUA 2WNTA 3ZHPC 4ZEGA 4WG4A 4TWOA 4EZ7A 2ETMA 2VTPA 3I79A 3A62A 5I3RA 4YO6A 3C50A 4G17A 3LCKA 3NPCA 1IAJA 1YI6A 1JKLA 4WO5A 4J71A 3I60A 2VN9A 4YJTA 3NZ0A 2XIXA 3C9WA 4FKPA 5TKDA 3LXPA 5IA2A 2XB7A 4G5PA 1JKTA 3C5UA 2W7XA 3EJ1A 4MF1A 3ZUVA 4YLJA 4ANNA 3ATTA 5IMXA 3GBZA 4B8MA 1G5SA 2X7GA 5HORA 5EHOA 4LL5A 2EXCX 5BVKA 3T3VA 2H6DA 3R7EA 5D41A 1UWJA 1WMKA 2XK8A 2X0GA 2WTKB 3PG3A 3JY9A 1GZOA 3F3ZA 3WE4A 3COIA 3ZMMA 3DAKA 1PJKA 4G9RA 5EI2A 5CNNA 3U51A 2WOTA 5HD4A 4ANQA 3WBLA 3LXKA 4DT8A 4JG7A 3QFVA 3OROA 1ZYDA 3JVRA 4M12A 4QMXA 5CAQA 3AC3A 2Z7SA 3QF9A 2BAKA 5ETIA 4LGDA 2E9VA 4XOYA 4JDJA 4X7QA 2EB2A 4CFMA 2YCRA 2CGWA 2JAMA 4ALUA 4AOIA 5DRBA 2XIZA 3LFAA 2WHBA 3TG1A 1GIHA 2WTDA 2RL5A 1IG1A 3Q9WA 3ACJA 5CSXA 3OFMA 4DFLA 4EC9A 2XEYA 1R0PA 3E88A 4TXCA 5AP7A 3ZS5A 3I5ZA 4CYJA 1Q4LA 2O64A 2BRMA 2WU6A 3DNEA 4EOMA 4ZSJA 3UOHA 3UYSA 3DJ6A 2BTRA 2PMNX 2IO6A 3QTWA 3DK7A 1FVTA 4MAOA 2IW9A 4BKYA 5K5NA 4JQEA 5AX3A 3PDTA 2C30A 3PY0A 2YITA 4PV0A 3DKOA 2OIQA 3U4UA 2ITYA 4DGNA 2J0IA 4U80A 2R7BA 3TM0A 5KMNA 4D2TA 2JBPA 3OXTA 1OITA 4TY1A 4EOKA 4KIPA 2A27A 4QYFA 4GJ2A 4LOQA 5C27A 4X2GA 2Y4IB 4DE4A 2OF2A 3HUCA 5BNJA 1JLUE 2QVSE 3UNZA 4BKZA 1H1SA 5IDPA 5FM2A 5KZ0A 3R8MA 5DFPA 5EDQA 5IQIA 2CN8A 5FG8A 2V7OA 1M7NA 3HV4A 4L42A 4FSTA 2WMVA 3QRUA 4KBCA 5BPYA 5H3QA 1K3AA 3AT2A 4CLJA 5M4FA 1JNKA 3NDMA 4EKLA 3MIAA 4O0WA 3OY1A 3IG7A 4FIGA 4PDSA 3R22A 4HGTA 3UQGA 3VN9A 4GYGA 5CQWA 2OZAB 1YI4A 2CHLA 2ITVA 4LV5A 4BDJA 3QD2B 2LAVA 3U6IA 2CCIA 3WYXA 3MFUA 3M11A 1JWHA 3O7LD 3EWHA 4PNIA 2OJGA 4YPDA 2FGIA 4QP1A 3VBYA 3HUBA 1SNXA 5CEQA 5DVRA 5FDPA 3BHVA 4OTPA 2W4JA 3OWJA 4LI5A 3ZO2A 2CLQA 4ACMA 4DH3A 2IWIA 2RGPA 2R3IA 4H36A 3F82A 3D0EA 3EN5A 4NM7A 5FWKK 4F9CA 1VEBA 1AGWA 3GCPA 2CN5A 5M57A 3TIYA 3L9PA 2J50A 4QMZA 4WRSA 5CWZA 2C3LA 3BBWA 4AGUA 4DGOA 2J90A 3S1HA 2GNFA 2BKZA 3WZJA 1WBOA 4FNWA 4XP2A 4O1PA 2VO7A 4LOOA 4PUZA 5FRIA 4FTOA 4USEA 2UZUE 3G90X 4XV1A 3R9DA 5A4TA 3U8WA 2WIPA 5ITAA 2JKKA 2O5KA 1RJBA 3P08A 4FTKA 2XS0A 5L2TA 5IA0A 2XJ2A 3ZRMA 3LJ1A 4LRMA 2IZTA 4FZ6A 4TYHB 3C4FA 2Z7QA 1Q3WA 3H9FA 2CNQA 4RJ4A 3KRRA 5CLPA 3DFCB 3O50A 4TT7A 3D94A 3QTQA 3IS5A 3VS5A 4O0SA 4WUNA 1KUTA 2YJSA 2UZVA 3FLZA 4O38A 3NIZA 5GJGA 4L52A 4ZAUA 5HNGA 4C58A 4FYNA 3R8LA 3CKWA 5EW9A 5AR8A 4FL2A 4N70A 5KZIA 4PDYA 3BV2A 2W9ZB 3DBQA 4S34A 5C26A 3R2YA 4M68A 3DTWA 4IXPA 4FSQA 4O2ZA 1MRUA 3W2OA 2X7FA 4D5HA 4CZTA 3BU5A 3R30A 3KCKA 2PY3A 4L3PA 2JIVA 2C6MA 4W4XA 4CFVA 3EFKA 3LFCA 1UVRA 4A4XA 1ZYSA 5DGZA 3HDNA 3QTSA 3VJOA 2J5FA 3BEGA 3DLSA 5KE0A 3PJ3A 3RPYA 4UN0C 4OTDA 2PUPA 1KE9A 1K9AA 3EL8A 4UMTA 5E8VA 4AGWA 3UO5A 4XG4A 4MHAA 2EWAA 4PTGA 4PMMA 3QLGA 4KBAA 1PRYA 4JX3A 5FGKA 3VRYA 4F9WA 4LG4A 4B6LA 3N4TA 1KE5A 3NYNA 4QMMA 5CVHA 4BCJA 2ITNA 3Q04A 4QMQA 3ULZA 1YWRA 3WILA 4O7SA 1OIQA 3QAME 4G3FA 3SG9A 1RDQE 4R5SA 4I93A 4L8MA 5F9EA 3IONA 5D7AA 1OKYA 4YR8A 1ZRZA 4DEAA 4O6LA 4AW0A 4ASEA 3F88A 3W8QA 4C37A 3K2LA 4IFGA 4KSPA 3PZHA 4PQNA 4GT4A 3Q4CA 4APCA 1BL6A 1MQBA 2YM6A 3UOKA 3DBDA 2ONLA 4G3CA 4HYSA 4IAAA 3UG1A 4GYIA 4JQ8A 2PE0A 1PXIA 1UU8A 3QC9A 2JKOA 4KBKA 5EK7A 5AAEA 4XP3A 2UVYA 4J97A 3DZOA 5CS6A 3ZM9A 4Y85A 3HEGA 3I5NA 4ACHA 4IJPA 3DGKA 3GP0A 4UWBA 3ZLSA 5FEDA 2BAQA 4XBRA 2OW3A 2W1ZA 2WTIA 3MJ1A 5CZIA 4F99A 5E8SA 3OUKA 4S31A 4UY9A 2J5EA 2UUEA 2QLUA 1OBDA 2E9NA 3QKMA 2O65A 4PPAA 2J0MB 4XP0A 4BDAA 1NVSA 4DTAA 3OT3A 4EL9A 1QPDA 3PA3A 4QTBA 3RGFA 3MY0A 4WNKA 5HCXA 1BMKA 2P55A 2VO6A 4V04A 4ERWA 4PP7A 1FBNA 2FA2A 4AAAA 3UZRA 2FH9A 3QCYA 5E91A 5LARA 3F5GA 3MPTA 2HK5A 4X3FA 3KRXA 4GT3A 3Q4UA 4JS8A 3ZO4A 5E90A 5ACKA 5TE0A 4F6UA 2X9EA 5C8NA 4IWPA 2ETKA 2FVDA 2QHNA 4GIHA 1WAKA 4IQ6A 2HW6A 5AP6A 4D9UA 4M66A 4FIEA 3H9RA 3QUDA 1ZZLA 3NUSA 5HU3A 1YDTE 1FMOE 2GTMA 2WMTA 4W4YA 1BX6A 2QOCA 2C5VA 3W8LA 3E7OA 1APME 1ZYLA 1U4DA 2UW8A 3QUPA 4FBXA 3R7VA 2E9PA 5CNOA 4ZTLA 2J51A 3LCSA 4DFYA 1YXXA 4C61A 4NL0A 3ZXZA 5AIRA 2QOBA 4I3ZA 4V0GB 5M07A 2FSLX 4O2PA 4YLKA 1H08A 3KU2A 4GV1A 5LMKC 2WPAA 3O8UA 1PF8A 5EYDA 3R01A 4ZLOA 4Q9ZA 4I41A 3HV6A 3PRIA 4QYYA 3ORTA 3SRVA 2BMCA 2WAJA 4E6DA 5LOHA 4ITJA 4O7TA 2C6TA 2R3PA 2BVAA 5J8IA 4ACDA 2CGVA 3GU8A 3MY5A 2XKEA 5AR2A 3MTLA 3GC7A 2ITUA 3TACA 3V8TA 4IHPA 4PMPA 5FQDC 4O0XA 5J9ZA 4IC8A 3DV3A 1F3MC 3FYJX 4IB3A 4Y83A 4I6QA 2UZEA 2W06A 3FI4A 5BVEA 4M0YA 2ACXA 1I09A 3P7AA 4OLIA 3OBJA 5IQEA 2ZB1A 3U6JA 2W5AA 4PF4A 4FT0A 5EG3A 3SV0A 5L4QA 3R8PA 3D2KA 4KWPA 3UNJA 2X8IA 2VNYA 2ZMCA 3H10A 5K5XA 2VTRA 4AFEA 2CMWA 1WBNA 4RT7A 5AR5A 4EOIA 2QOOA 4IANA 1XO2B 3BYOA 3OWPA 4G3EA 4GH2A 3ZSIA 2UVXA 1WVXA 4FG7A 3R1QA 2GFCA 2QU5A 5J7HA 3U4WA 2BZIB 2VX0A 3RCJA 2VX3A 4FOBA 3HP5A 5AP3A 1OUYA 2CGXA 3NYVA 4QMSA 3Q5ZA 4DFZE 4ERKA 4ACGA 3CY2A 4G16A 4CFWA 5AR7A 5KX8A 4R3RA 4FKWA 3LIJA 3S3IA 3PIZA 4DCAA 3L9NA 4YUQA 1W0XC 2PU8A 3FI3A 5KMOA 5T6KA 3BEAA 4BYJA 3IO7A 5CAVA 5IQBA 3NS9A 3BV3A 1UNHA 4ZMFA 4GFMA 5CSPA 2GS2A 2JIUA 1PXMA 2BALA 4U97A 4FODA 4EZ3A 3L8PA 3GENA 4EK6A 4WBBB 3NNWA 3P9JA 5M4IA 4J95A 2PWLA 3QBNA 3MH3A 3KCFA 1B38A 4ZY5A 5J1VA 3THBA 3S4QA 3SA0A 2UZTA 4ZSAA 3TEIA 2G2FA 2XKCA 4RIWB 4EH2A 5CEKA 4GG5A 4UMPA 4FNYA 4FEQA 4UB7A 4LYNA 3A99A 3FYKX 4MXYA 1YWVA 3BI6A 4I6FA 3BYVA 3PXYA 2BDFA 3MFSA 4YPSA 3MN3A 3FUPA 3WF6A 1J7UA 1UWHA 3L1SA 1M52A 2WEIA 4FE2A 2Z8CA 3EQDA 5BVFA 4AUAA 3MVJA 4YP8A 2JIIA 2PUIA 1MRYA 4IWDA 1V0OA 4UZDA 5AA8A 5M4UA 2J0LA 3NW6A 5EFQA 5C03A 4ANOA 3RK7A 4ZTRA 4LFIA 5E4HA 3MIYA 2Q0BA 1H1QA 3RK5A 1UU9A 3QQHA 4PDPA 3EKKA 3KFAA 4L3JA 4EHGA 5JZJA 4RA4A 5CSHA 3TNIA 2JC6A 4M69B 4QQCA 5HE2A 5LWMA 2R3MA 1P4FA 4C59A 3B8RA 1CDKA 3O8PA 4FIJA 4FTLA 3LMIA 5KMKA 1ERKA 3W2CA 2FYSA 3GOKA 3ORMA 3EQRA 4B8LA 5IH5A 3AOXA 3E92A 5AV0A 4PL4A 2RIOA 3R6XA 2PVLA 3UODA 3HRCA 3TKUA 1UKIA 4UV0A 2PVFA 3R04A 3UPZA 3R63A 5JFSA 2QOIA 3KXXA 4RC3A 2C4GA 3C0HA 4U43A 1OL7A 4X2NA 2VNWA 2ZB0A 2OJIA 5FP5A 4QRCA 4ZSEA 2RG5A 3B2WA 3ANQA 3MJ2A 3VULA 4XOZA 3KB7A 4WUAA 3V8WA 3MFRA 4FTQA 3KMMA 2W1EA 2BZHB 3FMMA 1YOJA 3NYXA 3OTVA 4FTCA 4MEDA 3V5QA 1LEZA 4BDCA 4EH6A 3TKIA 2Q0NA 1S9JA 2XK4A 4IB1A 4IVBA 4RIXA 1A06A 5AV2A 2CLXA 3FMKA 2CKQA 1OBGA 1NVRA 5M55A 4TYIA 5CF4A 1UKHA 1YWNA 4BTFA 1U46A 4J53A 3F9NA 3QCQA 4FKLA 3UO6A 3CPCA 3AC5A 1ZAOA 2W1HA 3L8XA 3Q96A 1A48A 4N57A 2C3IB 5JGDA 4H1JA 4I4EA 4MNEB 3NSZA 3LQ5A 3R2BA 4NFMA 5EM6A 4ZJVA 5IDNA 4KS7A 3W2QA 3MV5A 5IU2A 5EM8A 4FSMA 4IW0A 5E1SA 5H8BA 3FPMA 1H01A 3DLZA 3D15A 4KKEA 4NK9A 4C3FA 4UBAA 2JFMA 5EKOA 5ANGA 4F09A 5HCZA 3U55A 4X2KA 3N9XA 4M7IA 4RLKA 5CZHA 2YCSA 3O2MA 4F7JA 3TV6A 5JK3A 3QLFA 3GCVA 4N0SA 4ENYA 5IUHA 2VZ6A 4HGSA 3WOWA 3PA4A 3CBLA 2R2PA 2C1BA 4MD9E 3SHEA 4JG8A 3GGFA 3ZCLA 5CT0A 5KMLA 3UYTA 5FTGA 3C4EA 4DITA 2OU7A 3UOLA 2VWUA 1H8FA 2F7XE 2ZAZA 4DYMA 1FMKA 2EVAA 3NCZA 3AC4A 2GQGA 4OBQA 4R8QA 2G15A 4U7ZA 2PUUA 3KMWA 1Z5MA 3EIDA 3PRFA 4FKGA 4YTCA 2QU6A 5CSWA 1LEWA 1K2PA 2C6EA 2HY81 2X8DA 2YM3A 2GHMA 3GT8A 3OEFX 5AUUA 2C0TA 3REPA 4GS6A 4DEIA 4ZMEA 2YM4A 4QP8A 3OOGA 2XRUA 4QTAA 3GCUA 4YJOA 5IQHA 3UIMA 4G9CA 4WKQA 5CY3A 3PSBA 4D4VA 4FVPA 4J7BA 3KC3A 4CT1A 4LGGA 4EEVA 4QMUA 3I4BA 2XJ0A 5H8EA 3MSSA 4I20A 1BKXA 3IGGA 4ARKA 1WBSA 3MVMA 4I5PA 3VF9A 3DKGA 2F57A 4JBQA 4DH1A 5HVYA 2WMSA 4KABA 1X8BA 4RX8A 2UZDA 3PXZA 1WZYA 4U0IA 2FSMX 5J9LA 5BX0A 3OUNB 4Z55A 3MA3A 2UZNA 1REKA 5D12A 3LVPA 4U42A 1JBPE 3MTFA 3EKNA 5CF6A 4NTTA 4BIDA 5EM5A 3KMUA 3ZEPA 4HCTA 1M2PA 5FEEA 5AUZA 3ZRLA 3F7WA 2I7QA 3FZRA 3QXPA 4FV3A 3D4QA 4EH4A 4XG7A 4MYGA 4N6ZA 4PTEA 3MVLA 4BCHA 2PTKA 3JUHA 3PY3A 1PXJA 3QTIA 4GJ3A 5HNIX 3DK6A 1WBVA 3SXSA 5DT0A 4IVCA 4GK2A 2EXMA 3TZMA 5IA5A 4HPTE 1YW2A 4M0ZA 1Q8WA 4F1MA 4RWJA 3LKMA 4NCTC 4MXZA 2JEDA 3Q9XA 3VHKA 4L9IA 4QTCA 3ZC6A 3Q2MA 3QCXA 1PYXA 3DBCA 3EN6A 3ZYAA 4O7VA 2GU8A 2BRGA 4OTIA 3UQFA 4GRBA 4K1BA 2JITA 2GFSA 2REIA 1NW1A 4CLIA 1LUFA 4DH7A 4L68A 4OTRA 3RMFA 3CLYA 3D5UA 5HZNA 2IG7A 5CXZA 4TNBA 4EHEA 2X4ZA 4F1OA 2DWBA 3NR9A 4O1OA 3ODYX 4OTFA 3KK9A 4C02A 3BHUA 1P5EA 3EFJA 4B7TA 4EOQA 3CD8A 3VBWA 3WIGA 4QPMA 3JY0A 5I3OA 4LGHA 3FMNA 3O51A 3HKOA 1YRPA 4FKRA 2B4SB 3NIEA 4MCVA 2G2HA 2HW7A 2JDRA 2XBJA 4IE9A 3V6SA 2BZJA 3PLSA 1U5QA 5JGAA 3TWJA 2BILB 2QG7A 2OGVA 1H07A 4FSWA 4BZOA 5CU0A 2VGOA 5F95A 4EH8A 4OTWA 5A54A 4BCOA 5HLWA 4I0TA 4D1ZA 3C1XA 4IX6A 3U6HA 2BRNA 2OWBA 3PFQA 2CCHA 3S95A 4ZTQA 2W4OA 5AP1A 5AUXA 5HX6A 5GINE 4XRLA 1XH9A 5JQ5A 2BRHA 1DAYA 2ITZA 3TZ9A 4ZTMA 2FSTX 3GCQA 3JVSA 2UZLA 3ROYA 2BZKB 4A06A 1V1KA 4EKKA 1OL2A 5HKMA 1NT2A 5HCYA 3BGZA 4JBOA 2XM9A 1MUOA 5EQEA 2GNGA 2VWBA 3EQFA 2H34A 3H9OA 4G1WA 5AX9A 3RINA 4DBNA 1VZOA 1A9UA 5L2SA 3NCGA 1OM1A 2RFNA 4MD7E 3K5VA 4MD8E 2X2KA 5M44A 5E8WA 1PY5A 4O0YA 5EH0A 4FICA 1SYKA 2BFYA 2VWZA 1KWPA 3UC4A 2V55A 3V5PA 1TKIA 3ZH8A 4X21A 3QQGA 2PVKA 1R78A 3FZSA 3MYGA 3P23A 1U54B 4BCPA 4RA5A 4RIOA 4D55A 2C5YA 4C4EA 2R3LA 4K6ZA 4QP3A 5CQUA 3HRBA 5H2UA 1RW8A 3FQHA 5EHLA 2CSNA 3P7BA 2F49A 4QP7A 2RSVA 5D9HA 4E8AA 5J5SA 2Z7RA 4HYUA 3IDBA 4IWOA 3QCSA 1UNGA 2CKEA 1ZZ2A 3OD6X 4NSTA 3ULIA 5ANIA 3CPBA 3Q2JA 4YBKA 5KBQA 3G6GA 2CGUA 4NIFA 1YI3A 3EL7A 2VWXA 1JPAA 2VWVA 5I9WA 4R7BA 3NMUF 1IRKA 1PYEA 4OTGA 3MA6A 2BHHA 4AE9A 5IA1A 3ANRA 4Q5HA 4DFXE 4FV7A 4DLIA 4OAUC 3G0FA 3VQHA 2VV9A 2BUJA 3EQPA 4MQ2A 2R7IA 4JNWA 3OEZA 4MQ1A 4RC2A 3NAXA 5AUTA 3TJCA 4P4CA 3UIBA 2YWPA 1F5QA 2LGCA 3O71A 3COMA 4FK3A 4IC7A 5IPJA 3DFAA 4BCNA 4E4NA 1P14A 5DN3A 4WG3A 5CVGA 3VUHA 3DAJA 2A0CX 4FMQA 3HP2A 5CF8A 5HX8A 4FKQA 2HXQA 3OP5A 5FTOA 2IJMA 2C5NA 2C6IA 2UW9A 2WB8A 3D2IA 3FZOA 2KTYA 5HLPA 3FC2A 2JKMA 3T9IA 5C9CA 4A4OA 1J7LA 3QX2A 3KULA 2JDSA 3NVKI 3E8EA 5EYMA 2R5TA 2C6LA 2X8EA 3W2RA 3AMBA 4OTQA 3GCSA 4H39A 4IZAA 4D2SA 3GOPA 5D11A 4YTFA 4XNEA 2GHGA 4FEXA 1XBCA 5M06A 4APPA 4JBPA 3ZBXA 5HTCA 5JN2A 3IDPA 3RHXA 3HV7A 3W32A 3PXQA 5HOAA 3P79A 3UQCA 3H0YA 4RIYA 3DS6A 4G3DA 1GZKA 4C3PA 4YMJA 4G6OA 4QMOA 2W1CA 4FV1A 4W9XA 4BKJA 4QT1A 3F2AA 2W99B 2PZ5A 4NM0A 4K0YA 3PVWA 4WNMA 4YGAA 4GFOA 3FMDA 4BIBA 5CEPA 4GSBA 3RPVA 4ZXTA 3P4KA 3CSVA 5KO1A 2HY0A 2YZAA 4DBXA 5L6WL 4BCIA 3M1SA 4ZJJA 3PE2A 2GCDA 2XNOA 4AOJA 1OPLA 4GIIA 4RZVA 5AP5A 5E7RA 3EFWA 4NM5A 4E26A 2QR7A 5DRDA 2OH4A 3PZEA 4TYEA 3FY2A 5A6NA 2X7OA 4U44A 3R21A 3NLBA 4DEGA 4DEEA 2OIBA 2Y6OA 3F5UA 4FI1A 4R77A 3H4JA 3GQLA 4ZY4A 4TL0A 3SOAA 4BGGA 1FPUA 3FI8A 4ORKA 2OXYA 1KOAA 2XBAA 4UYNA 5EOBA 4UYAA 4IADA 1Z57A 2B52A 2BIYA 2ETRA 3VBXA 4JL9A 5AV4A 2XIYA 5IKWA 4MTAA 4B99A 4FTJA 2QO2A 2E9UA 4FKJA 4AZWA 1YXUA 1Q97A 4M15A 1VJYA 4YBJA 4U41A 4CZUA 5FTQA 2VU3A 4IFCA 4K18A 3CGFA 2A4LA 3DBFA 3LAUA 5HESA 4IAFA 2H9VA 3NGAA 2B9JA 4M84A 4CCUA 4F9BA 3PXRA 2W05A 4RSSA 4O84A 2HZNA 3RPRA 5K0XA 2UW3A 3DK3A 1F0QA 4TYGA 1VYZA 1E1XA 5CAOA 3SG8A 2BR1A 3U54A 5KBRA 3T3UA 2GSFA 1Y57A 1JKKA 4NM3A 4YZBA 1DAWA 4LUDA 2R3OA 5D1JA 4BZDA 5LQFA 4O7RA 2BRBA 2R3QA 4ANBA 4XJ0A 3UJGA 3SW7A 3FL5A 3UBDA 3DA6A 4U8ZA 4RVKA 3HDMA 1HOWA 3ACKA 3EB0A 4CCBA 4OT6A 2R3KA 3TJDA 3RM7A 4BC6A 5C1QB 2J6MA 4EH7A 2V22A 4GUBA 4DG0E 5IF1A 4DLJA 2Q83A 3PP0A 4QTDA 3OCBA 4GU6A 3QTZA 5E8ZA 4FOCA 5DYJA 4O96A 2HIWA 3WE8A 2WIHA 1RE8A 3E93A 3R1NA 1Q3DA 4PP9A 4D58A 5M4CA 3UIUA 3S0OA 3ZZWA 3CIKA 4MVFA 2QCSA 3RNYA 4I6HA 5HD7A 1PMVA 1WBWA 2QURA 2WELA 4AWIA 4LV8A 2DS1A 5LJJA 2O3PA 3NW7A 4MXOA 2KULA 4DG3E 4IEBA 2X1NA 4RJ6A 3LE6A 2W17A 3ZDIA 2NRUA 4C35A 3BE9A 4WA9A 1GZ8A 5AAGA 3ATSA 5BQ0A 4WD5A 3HECA 4KINA 3TL8A 3T8OA 3VUGA 1ZMVA 5D7VA 4ANSA 3RWPA 3DJ7A 5AP2A 4MBJA 4USDA 4ALVA 5C8KA 4A9TA 3FV8A 3QC4A 4FSRA 5CU4A 1XWSA 3VS6A 2B55A 1YOLA 1ZLTA 4XV3A 3MPMA 4LUEA 3PG1A 4QMLA 3LOKA 3GB2A 4ID7A 4UX9A 2UZBA 4KAOA 4WIHA 3CTHA 4QMPA 3UG2A 3KK8A 5HG7A 2WU7A 3GFEA 3PPKA 1QPJA 2ITTA 4OTHA 2ITXA 3MFTA 3MDYA 2V0DA 5AP4A 1B39A 4KIKB 1NXKA 4YJRA 2IVUA 3KRLA 3POZA 2GQRA 3R9HA 2P2HA 3PVUA 3HVCA 4FT7A 4EK5A 2OSCA 3BLRA 4YZCA 3WIKA 2P0CA 1YXTA 4X3JA 4FEWA 1CSNA 3DOGA 4ZY6A 4ITHA 5IEVA 3LM5A 1FGKA 3MB7A 5C8MA 1R0EA 4MWHA 4MKCA 2BKKA 2PVHA 4GMYA 4IX5A 4BYIA 2GPHA 4AP7A 3MB6A 4BCGA 5KKRB 1H1PA 2OKRA 3A4PA 4FZDB 3TTIA 4ANLA 4EH3A 4ZLZA 4D1XA 2YIYA 3DKCA 4GVAA 3IW8A 1PMNA 3FLWA 3CQUA 3TCPA 2YM8A 3FY0A 5FEQA 4BIEA 1GZNA 2UV2A 3FKOA 2B9HA 4FV9A 4QNYA 2OI4X 5J5TA 4K77A 4HVGA 3TNHA 3QZHA 4IBMA 5I9YA 3E5AA 2XYNA 5ACBC 3DKFA 2YFXA 4FA2A 2WZJA 4FV5A 4HZRA 4G6NA 4ASDA 1XJDA 3VBTA 2R3HA 3HL7A 4F1TA 3AGMA 1UU3A 5AR4A 4FC0A 3NNXA 3BYMA 4XG8A 4BBEA 4F08A 2OO8X 1ZYJA 5IH4A 3G2FA 3PSDA 4F65A 2XIRA 2Z60A 3SW4A 2XEZA 4FNXA 4C7TA 1YXSA 2GNIA 4D5KA 3AG9A 2OJFE 4WT6A 1ZY5A 1SZMA 4O27B 3W1FA 3MBLA 4PRJA 5IA4A 2A19B 4E4MA 2WOUA 3PPZA 3NUAA 1WCCA 3K3IA 3ENHA 2HYYA 3M42A 1G3NA 1Y91A 2IVVA 3UO4A 3QWKA 3E8CA 4AZFA 4ALWA 3E87A 4XCUA 4R1YA 5G6VA 4R1VA 3KKVA 1QL6A 2PZPA 3K5UA 5CENA 4MXCA 3K54A 5CT7A 2IPXA 4U3YA 4EORA 4QMYA 4XH6A 2A1AB 2C6OA 4RFZA 5EM7A 4AQCA 4D0XA 3CTQA 3TXOA 5J7BA 4PMSA 3D5WA 2Y9QA 3Q9ZA 5IISA 4RVLA 4F9YA 1M17A 3AD5A 3OCGA 4FT5A 2F7EE 2H96A 2PE1A 2WQOA 3BELA 3LJ2A 4BGHA 4PL5A 1YDRE 4DAWA 4NKSA 3N4UA 1M2RA 4FK6A 3G0EA 3F2NA 4HGLA 4O22A 5HVJA 1NVQA 4C36A 4Z3VA 4DT9A 4CXAA 4XG6A 1ZY4A 4M8TA 5TOZA 3HV3A 4X3FB 5K4JA 4LRKA 4QO9A 3DXNA 3QRJA 3UOJA 4MH7A 5CXHA 3TI1A 4P5QA 4HGEA 4U6RA 3P5KA 3PY1A 2CNVA 4AGCA 2PVMA 3HMPA 5IQFA 3NUPA 1FVVA 1IEPA 3ZTXA 3D7ZA 2X39A 5LCKA 2YDJA 5LMAA 4EK8A 5JFXA 4JIAA 4JRVA 2R64A 4I4FA 1JOWB 3MH0A 4AXAA 3ZXTA 4BI1A 3V51A 4X6QC 5LCJA 4CFFA 4DF3A 2QR8A 4BWKA 4OW8A 3QQFA 4F7SA 5AADA 3QZFA 1VYWA 3FI2A 3Q4ZA 2BTSA 4ZSLA 3O17A 4F7LA 5E9EA 3M2WA 3IECA 4R7IA 4AZTA 1U59A 2YIQA 4I0RA 4E5WA 4ZSGA 2HCKA 1IA8A 4PDOA 4ZS0A 4EK3A 1I44A 1W83A 1OL6A 3PJ8A 1W7HA 4W9WA 5EOLA 5HIBA 4DGLC 1GAGA 1LR4A 2QD9A 3LXLA 1DM2A 4GKIA 5IQCA 4YZ9A 3L9MA 3AT3A 3L8SA 4MBLA 3SRVB 4EHVA 4OGRA 5A3XA 3IDCA 3BHTA 5KKRC 4J52A 5HQ0A 2DYLA 1CM8A 5KHWA 3QQUA 4AX8A 2F2UA 4DFBA 2E9OA 4JR3A 2NO3A 3OC1A 3R02A 4ZK5A 3FKLA 4MNFA 3UMXA 1LP4A 2W1DA 2PYWA 4CMOA 5M08A 5HG5A 5HO8A 3W2SA 2OXDA 4D2PA 3BQCA 3A4OX 2XK6A 4JVGA 4K9YA 4RBLA 3ZZEA 4QMTA 4FZ7A 4BCKA 2JKQA 3AMAA 3CS9A 4Y8DA 4D0WA 3JYAA 3JR1A 5FDXA 5BUEA 4P2KA 1IR3A 2QKWB 4FTTA 2WO6A 1Y6AA 4JAIA 4BDDA 5BVWA 1GY3A 1JAMA 3LFBA 2UW5A 3PVGA 5ICPA 4NKAA 4IB5A 4KKHA 4L00A 2HWOA 3F3UA 2G1TA 4AACA 3QKLA 4CYIA 1OL5A 4Q9SA 3GC9A 1FOTA 4O7NA 4RZWA 4O86A 2P2IA 4O7WA 2XKDA 2QO9A 3VHEA 4DEDA 1XBBA 1ZMWA 4YJNA 4BDFA 2ONLC 4NTSA 4EC8A 1Q5KA 5ETFA 1GJOA 4FKVA 2ITPA 1G8AA 3FL4A 3W10A 4YJVA 2ZM1A 2WMBA 3CJFA 3BHYA 4C3RA 5IA3A 1JSVA 4JIKA 3HNGA 4HW7A 4PMTA 4EOJA 4ASZA 3ET7A 3RALA 4UXLA 3SOCA 4HCUA 2JFLA 5H9BA 4K2RA 3RCDA 4C8BA 5I5ZA 3R9RA 3IK3A 3QTRA 1BI8A 2B53A 5M56A 4JAJA 5KCVA 3TKHA 1IASA 3QRKA 4RJ7A 3VVHA 3D9VA 3QHWA 4FV4A 3LHJA 4FL3A 4AGDA 3ZOSA 5AUWA 3C4CA 3GVUA 3GU5A 4AFJA 3FKNA 4R7HA 1KOBA 4ZZNA 3EQGA 3TNQB 3ZC5A 4DFNA 2GS6A 3A7HA 2R3RA 3PP1A 2J7TA 4X3FC 4Y95A 3RJCA 4IH8A 5DG5A 4NH1A 2YM5A 1YOMA 3PWDA 3QX4A 4XYFA 4XRJA 4RX9A 4E93A 3BYUA 4P7EA 4BDKA 5HO6A 4RQKA 5KMJA 2W1GA 1W8CA 1WBTA 1OIYA 1WVWA 4JOAA 3R83A 4USFA 4N4SA 1OECA 4V05A 2JGZA 5KMMA 3QKKA 1WFCA 4HJOA 3ZUUA 2I0VA 2JLDA 2VTHA 3QQJA 4BN1A 4D9TA 2YM7A 2B1PA 3F61A 2P4IA 1OKZA 1R1WA 4BHZA 4GT5A 4I94A 2PK9A 4HVSA 4EH5A 4UXQA 5L8LA 4LMUA 1E9HA 4TYJA 4V01A 3A7FA 3SGCA 1JSTA 2PZYA 4OT5A 5A9UA 4C33A 2HXLA 4CFXA 3EQIA 4CQEA 2PZRA 1FINA 1J1BA 4G5JA 3QTUA 2R0IA 1Q62A 2IN6A 4O6EA 4L45A 3UZPA 4M67A 5IEXA 5IEYA 3BLQA 3LFSA 4RJ8A 4W4WA 4DA5A 3ODZX 4WHZA 2QOLA 3HYHA 4AE6A 4JQ7A 2OFVA 3IQ7A 3OT8A 3F66A 4NFNA 4BCQA 4A9YA 4AS0A 2GS7A 4CQGA 4CKIA 4E4LA 5A4QA 1FGIA 1CTPE 5LVLA 1OVEA 4O0TA 3F5XA 4FKTA 2OICA 2VTNA 3QZGA 5DPVA 5A4LA 5EI6A 3I1AA 4ZP5A 3VAPA 4Z7GA 4YC3A 3VS2A 2ZOQA 5AIKA 2QONA 4ZIMA 3RP9A 3E8NA 2JDTA 5DR6A 4ANMA 3OW3A 4YO4A 3KN6A 3Q6WA 2HENA 4FNZA 3LFFA 4FTUA 4KNBA 1XH8A 5GJFA 2C6KA 3PJCA 5A6OA 5IG1A 3HMOA 2YIXA 4GL9A 3BHHA 3ORZA 4RG0A 5IUIA 2UVZA 3COKA 3SX9A 1URCA 1OI9A 3MVHA 5CAPA 5JH6A 2J4ZA 3EZRA 1O6KA 4YNEA 3UMWA 3D14A 4EUTA 2X6DA 3FXXA 3GU4A 4EZ5A 3BBTB 4ZOGA 4G34A 2E2BA 4HNIA 2OBJA 2A2AA 5KMIA 2PUNA 4QMWA 4FR4A 4E6QA 4EH9A 4ZLYA 4RIXB 2BPMA 2XP2A 3HV5A 5G1XA 1KV2A 1DS5A 2NP8A 2PHKA 2IZSA 3MI9A 4BR3A 3QYZA 1H25A 4J98A 2XUUA 3H0ZA 1OPJA 4AT3A 3JS2A 5DR9A 3A7GA 3MW1A 3MWUA 5CEOA 2HWPA 4BTJA 4E20A 4Y72A 4XMOA 4EWQA 2W1FA 4H3BA 3RM6A 4EONA 5GHVA 4NZWB 4U79A 3ZSGA 3ZLXA 3A8WA 5HBJA 4F4PA 5GJDA 4E1ZA 5HIEA 1SNUA 4KA3A 4BB4A 3D7TA 3ZFMA 4IZ5A 2UW6A 3N51A 2JBOA 5L8JA 5TR6A 5J9YA 3V01A 2CKOA 2EXEA 4Y5QA 2WQEA 4U81A 3OS3A 3VRZA 3VUTA 3ZRKA 5M51A 1H28A 3LW0A 4JDKA 1YKRA 3AC1A 1Q8ZA 4ZTNA 3S00A 2JDVA 5LWNA 4FKIA 5AWMA 3SD0A 3OG7A 3H30A 3V6RA 3S2PA 4NYEA 4BI0A 3AD4A 5BYZA 5C4LA 5ANJA 4C4IA 1OMWA 2XF0A 2GQSA 1V0BA 3EN9A 4H3QA 3OXZA 5HLNA 5GNKA 2AYPA 2WQMA 3ETAA 1UV5A 2XNEA 3VF8A 3LFEA 4O7YA 4EJNA 2GNJA 4QP2A 4L43A 4F7NA 4DEHA 4JXFA 4BCFA 5CX9A 5CSVA 4CMTA 1P4OA 3R8ZA 4CRSA 2XRWA 5HICA 2YAAA 2NPQA 2EU9A 3TN8A 3W33A 2O2UA 4J8NA 1ZWSA 4GK3A 3HZTA 5CU2A 5HEZA 4X6RA 5EW3A 5AA9A 3AT4A 4HZSA 3KVXA 4RFMA 3PJ2A 4KRCA 2C5XA 4X2JA 3TNPC 5IH6A 1Q8UA 4B4LA 3TT0A 1OUKA 3BE2A 5EDRA 3DT1A 3E62A 2W5BA 2ITQA 3FAAA 3FC1X 1BL7A 4BDEA 4QTEA 5LVNA 5M53A 1BLXA 3KEXA 4MWIA 3PLAE 3MPAA 1KE7A 3Q32A 3G6HA 3FWQA 3W18A 2QLQA 3G9LX 4FX3A 3WZUA 2I0EA 2VTLA 3AC8A 4G6LA 3EQCA 3I7BA 4I5HA 4FSZA 4IX4A 1TVOA 3WF9A 3KXNA 4BDIA 3PE1A 4O82A 3HLLA 3KVWA 4XV9A 5FBNC 3TTJA 4BFMA 3FXWA 3V04A 4EHZA 3ORKA 3FDNA 5EDPA 4A4LA 4FSNA 4Z16A 3QA0A 4XUFA 3BWJA 4Y46A 3H3CA 2OXXA 3LFNA 5T3QA 3F3TA 1Z9XA 3UGCA 3C4ZA 3BZ3A 4O0RA 3PUPA 2I0YA 2HZIA 2R3FA 2VTIA 4XHKB 4CKRA 2YA9A 4GCJA 5F94A 2H8HA 4KIQA 3VUIA 3G9NA 2QODA 3AGLA 4KUJA 4I6BA 2C68A 3R8UA 4YU2A 3ORNA 2GDOA 3GXLA 3VS4A 1BUHA 3RVGA 2YDIA 4ZZOA 4OBPA 3O23A 2W9FB 5IQGA 1YHSA 3B2TA 3HX4A 4FZAB 4TWPA 5CAUA 3KF4A 1ZOHA 3O8TA 4XBUA 4WOVA 3G15A 3DQWA 4IAYA 4CRLA 4M13A 3C7QA 4LM5A 5IQDA 5L8KA 1PMEA 4MXXA 4AN9A 3V5TA 2J2IB 2VO3A 4BDBA 3UC3A 5J95A 2W5HA 3UTOA 3SVVA 4MXAA 2RF9A
chains in the Genus database with same CATH superfamily
2FB8A 2YABA 4IM2A 1UA2A 2BAJA 2GNHA 4GEOA 4D28A 4F70A 4I92A 2W0JA 1Y8GA 3CKXA 1XBAA 5BMSA 3DZQA 2WTCA 2YIRA 4LQMA 3MY1A 4DTKA 2XJ1A 4NW6A 4BTMA 3O0GA 5I9XA 3LM0A 4AZEA 1J91A 2OZAA 4F0FA 3TIZA 2ITOA 3UDBA 5FXQA 1HCLA 5AM7A 5C01A 4RPVA 4F64A 2OLCA 3R1YA 2WGJA 4FT3A 4II5A 5B2MA 1PXPA 3O7LB 3ZONA 3PTGA 4QYHA 3TZ7A 4LDTA 4FKSA 3VJNA 5BUJA 5GZAA 2WTJA 2VO0A 3R1SA 3V8SA 2ZV7A 2ZM3A 4GVJA 3UVQA 4E5AX 5F1ZA 2VAGA 4F9AA 3MGYA 5GIPE 2F7ZE 1Y8YA 1LPUA 3OWKA 4XS2A 4HNFA 2C1AA 1Q99A 2O63A 3K3JA 5I0BA 5JFWA 4FG9A 3ZDUA 4BICA 3LLAA 4AN3A 2VWIA 3B8QA 4DHIB 2VWWA 4X2FA 2WMUA 3RAIA 3F5PA 5CI6A 2WEVA 4FVQA 3SQQA 1OB3A 2G2IA 2OF4A 2WMRA 4MK0A 3E3BX 4I0SA 4TN6A 5DBXA 4BCMA 4C38A 3ZFXA 5JT2A 1ZOEA 4JI9A 3TUBA 2O8YA 4L6QA 3DY7A 5EYCA 5FUTA 4L67A 3NUNA 2XK3A 4PY1A 2ERKA 4GUEA 4UMRA 4AW5A 5B2KA 2Y8OA 5L6PA 3Q60A 4Z7HA 1FQ1B 3CQWA 4TYHA 5AFVA 5BYLA 4C2VA 4EBVA 3JXWA 2JD5A 2W96B 2B9IA 3EN7A 5E8XA 4ZZMA 3R7OA 5DIAA 4E7WA 5LVMA 1STCE 2YN8A 1U5RA 1WBPA 3NUUA 5E8UA 5JGBA 1O6YA 4YTHA 4L7FA 2X0PA 5E8TA 2AQXA 3ZUTA 4FEUA 3FQEA 3QD3A 1QMZA 3E7VA 3UVPA 3NYOA 3BX5A 3II5A 3EHAA 4CNHA 4IZYA 2QO7A 3QXOA 2VWYA 1W82A 5LMKA 5CANA 1TZDA 4NIFB 1MRVA 3G51A 4PX6A 2FUMA 4EYJA 3RPSA 2FSOX 2IW8A 2EB3A 3HGKA 4IB0A 4CTCA 4QMNA 3FLNC 3DDPA 3ROCA 4HYIA 4YZDA 2XVDA 4FKUA 4BDGA 1H27A 3FPQA 3NNUA 2Z02A 1QPEA 4WBOA 5ANEA 2QI8A 3CGOA 1M14A 3GQIA 4IWQA 1T46A 5EYKA 4QMVA 3SKCA 4I6LA 4A9RA 2V5QA 4D2VA 3DCVA 4HVIA 4P5ZA 4H1MA 1JQHA 3ORPA 4I24A 1IA9A 3NVMB 2Y7JA 4J1RA 5D10A 5DI1A 4L01A 2Y4PA 1XH7A 4UMQA 3CXWA 4QNAA 4DG2E 3A7IA 3KULB 2FO0A 3I0OA 1S9IA 4H58A 4RJ5A 2WD1A 3FZPA 4RRVA 4NWMA 4C4FA 4YHTA 2CJMA 2R9SA 2OFUA 4AA4A 3N4VA 4CV9A 3QZIA 3OW4A 4I1ZA 4G3GA 4IDVA 4DCEA 4IJ9A 1T45A 5AAFA 4CSVA 4F63A 5JKGA 4PWNA 4RIYB 4W4VA 4TKSA 1BI7A 1Q41A 2QG5A 1OZ1A 3PJ1A 2F4JA 2WTKC 2ZMDA 3CE3A 4JX7A 2YHVA 2OG8A 3LMGA 2F2CB 3HMMA 4TWCA 3RPOA 3BIZA 3ELJA 3IW5A 2XH5A 2YIWA 2C3KA 2R3GA 4E5BA 1CKPA 1H24A 2ERZE 3GNIB 5DHJA 5CTPA 4AW2A 3TV7A 4KIKA 4EQUA 4IVDA 4ACCA 5EW8A 5LMBA 1ZARA 2HZ4A 3LQ8A 2RKUA 4ENXA 3KIOC 1GOLA 4OUCA 1MP8A 3FZTA 5B2LA 3VUDA 3UDSA 4IAZA 3QA8A 4DINA 4RQVA 4U5JA 3SDJA 4P90A 2OJJA 5HG9A 3ZFYA 4FG8A 2C0OA 2Y6MA 4Y73A 4CD0A 3R8VA 3RK9A 5DR2A 3KGAA 1KE8A 3R73A 4IIRA 5HG8A 4RX5A 4ZJIA 2XMYA 4O4BB 3OCSA 3GFWA 3EYGA 3BU6A 2UW0A 1SM2A 3VONA 2AUHA 4IM3A 5B7VA 3HMIA 2W4KA 3EOCA 4FTRA 3WZDA 3U9CA 4MUQA 1CKJA 3KA0A 3PWYA 1W84A 2WMQA 2PMIA 3R71A 1H0VA 3UPXA 2VRXA 3ENMA 5JEBA 1KE6A 1YXVA 3AC2A 3I7CA 4QPAA 2YCQA 4L7SA 5DOSA 3WF5A 4AT4A 3KQ7A 4NJ3A 4TTHB 2BDWA 4D2WA 3EQBA 5K4IA 5CU3A 3ZM4A 3SXFA 3LJ0A 2BIKB 5L2WA 3W0NA 4DGGA 2QNJA 4AN2A 3DTCA 4M3QA 4QP4A 2PMLX 1O6LA 2Y4IC 3U87A 3WARA 4FKOA 4EOSA 3GU6A 4EBWA 5L2IA 2VTMA 3OMVA 2J0KA 2ZDUA 2DUVA 5AM6A 2YDKA 4RWIA 3MH2A 4V0GA 5A14A 2IW6A 3A8XA 3FE3A 2IZRA 4AA0A 4UWYA 1OKVA 4C0TA 1H1RA 3PPJA 3TUDA 3V3VA 1PHKA 1MQ4A 4BBFA 3GC8A 4A07A 2PL0A 5EQPA 4S32A 4BWPA 3P5JC 3FQSA 4O7ZA 2V7AA 4FGBA 5JQ8A 2P33A 2YEXA 3LZBA 3WZEA 3CR0A 2B54A 4JBVA 4BY9E 2C6DA 3BLHA 1YQJA 3DB6A 4NU1A 3CJGA 3QGWA 5HO7A 3ML1A 4CVAA 3BPRA 3HA8A 4WSYA 4JG6A 3R9OA 3OWLA 3BKBA 4O0VA 1FVRA 2VX1A 2I0HA 1UU7A 5BMMA 3IOPA 4JT3A 4YNOA 3F7ZA 3W2PA 4RWLA 5IUGA 3PA5A 4AZVA 4GFGA 2YZLA 3NUYA 3VUKA 4EQCA 4LOPA 1REJA 3DAEA 3G5DA 1Q8YA 3QQLA 1JKSA 2QHMA 2R4BA 5DNRA 3VS0A 3WI6A 4AOTA 4OAVB 3ORIA 1SMHA 4AA5A 1H00A 5K0KA 3FHIA 3UP7A 1ZYCA 2PE2A 3GUBA 3LCOA 3P78A 4WSQA 1NY3A 4YJQA 4YSJA 4FGRA 4E73A 4BDHA 1AD5A 4DC2A 4CEGA 2OJ9A 2WMWA 2RFSA 1TQMA 5CYIA 2C3JA 3RWQA 4LL0A 4BF2A 5I4NA 3VC4A 3FJQE 1KSWA 1L8TA 2GNLA 5CEIA 5BUIA 4E6CA 1L3RE 3KXZA 5JZNA 2X2MA 3F6XA 4I5CA 3ORLA 4BJJA 3OVVA 3Q53A 2RFEA 3PXKA 4NUSA 1H26A 2HZ0A 4G31A 2X81A 4YJPA 1QCFA 1YHVA 2BHEA 4TPTA 3BGQA 5CEMA 4FV0A 1J7IA 2VTSA 4W8DA 3D5XA 4U3ZA 4J99A 4XLVA 4R5YA 4H05A 4FYOA 4D4RA 3UVRA 4D1SA 2XNBA 4DH8A 4YC6A 1JSUA 1PXNA 4S2ZA 1OGUA 3IKAA 3V5JA 4B9DA 2ZM4A 4RVMA 2VTOA 3L8VA 4S33A 4L44A 1Q8TA 3WYYA 5CALA 5CU6A 5LXMA 2UW7A 4YZNA 4RJ3A 4NW5A 5HE1A 4WG5A 4AG8A 4Q5EA 2B0QA 2ZYBA 2XM8A 5K3YA 3FHRA 5HVKA 4L53A 3QQKA 4KIOA 4UALA 4L3LA 3CTJA 4DH5A 1ND4A 4K11A 4YHFA 3C51A 3VS3A 2WFYA 5E92A 4AZSA 5I9VA 1PKGA 5K9IA 3Q6UA 2XNGA 4FSYA 5EI8A 3OZ6A 4LMNA 4D4SA 3PIXA 2PPQA 5CF5A 3P0MA 4AXDA 3OTUA 3F69A 2PULA 3C4XA 3HAVA 4GG7A 1Q24A 4QYGA 3KXGA 2WMAA 3DBEA 3ORXA 3OBGA 4RIWA 4UEUA 4WNPA 3UP2A 4A7CA 1QPCA 4AU8A 2WXVA 3KL8A 5F20A 5DWRA 4OBOA 2R3NA 3P1AA 5T68A 2QOKA 3NRMA 4FIHA 5JSMA 4LRJA 2OIDA 4FIIA 3VS1A 3RI1A 4IVAA 4FZFB 3DNDA 3FMLA 3E64A 4EWHA 1G8KA 3ID6C 4CG8A 3LCDA 3P7CA 2X2LA 4RX7A 5DA3A 4QP9A 4C34A 3V5LA 4XG9A 2QC6A 3EN4A 5ETCA 3R00A 2Z7LA 1R39A 3LFQA 2YAKA 2XKFA 2ZV8A 3PXFA 5GIOE 2GHLA 3KXHA 3IW7A 3VUMA 3E8DA 5HU9A 2BFXA 3C0GA 1JVPP 3HA6A 1CKIA 4XG2A 4KRDA 5TO8A 2IVTA 2J9MA 4QOXA 4Q2AA 3NNVA 4R6VA 3T9TA 3VBVA 3SXRA 3IW6A 3ALNA 2OH0E 4KSQA 3DQXA 4JJRA 4BRXA 4M69A 3LFDA 3NUXA 3SC1A 2CNUA 4QPSA 3EQHA 5E1EA 2YLFA 2RFDA 4YC8A 3R9NA 1Q61A 3RHKA 3NEWA 3R7YA 2QOFA 4I22A 4KD1A 4Z9LA 2YCFA 3UZTA 1YVJA 3I6WA 4CFNA 4EUUA 2AC5A 4IACA 2YJRA 5DT4A 2VTTA 3TZ8A 5BVOA 1UNLA 1B6CB 5BYYA 2QOHA 3QTXA 3FMHA 4FTAA 4O4FA 4NT4A 1H1WA 4HYHA 1ZOGA 1GIIA 3QUEA 3NAYA 5L2QA 4GU9A 4QP6A 4YZMA 4O83A 2XA4A 3GU7A 3MH1A 3MS9A 2VUWA 4KS8A 3AKLA 3QYWA 3RAKA 2QOQA 5FBOA 5FXSA 4ZTSA 3V5WA 3BLAA 5KNJA 5EQYA 2CKPA 4TNDA 3QL8A 2PSQA 5DE2A 3Q52A 4HOKA 4NCTA 3RZFA 5FM3A 4DHFA 3DXPA 4GKHA 3C4WA 2WMXA 4RWKA 4MX9A 2XCHA 3BCEA 4FV8A 5AEPA 3ZU7A 4BI2A 3TNWA 2XNMA 3W55A 3CEKA 4X0MA 4GK4A 4RMZA 4YLLA 1XKKA 2B7AA 4RGJA 2BDJA 4O21A 3R7IA 1SVEA 3OXIA 3WF8A 5LVPA 2XCKA 1BYGA 4BHNA 1HCKA 4PPCA 5ANKA 3KN5A 2VTAA 4FUYA 4XEYA 5H8GA 3O5AA 2XNNA 4RLLA 3R0TA 4HCVA 4F0GA 2C0IA 2R3JA 4FV2A 4K33A 4I23A 3EH9A 4MNEA 1OKWA 3NW5A 4R3CA 5AJQA 4FTMA 5FLFA 3UE4A 3VIDA 5HBHA 4MBIA 1TQPA 2IVSA 5I9UA 2G9XA 2YACA 4U9AA 4U45A 4JDHA 1M7QA 1XH4A 2HELA 1J1CA 2C47A 1SVHA 4JDIA 4DN5A 5CI7A 3FBVA 1PMUA 2CDZA 4YHJA 1XQZA 4WRGA 4UZHA 3CCNA 2DQ7X 4AT5A 3CP9A 3RZBA 4IAIA 4EK4A 5AP0A 3LMHA 3BQRA 2GTNA 2QQ7A 3KY2A 3Q3BA 2I1MA 3IPHA 3ZO1A 5FD2A 3PYYA 4IZ7A 4KKGA 2HAKA 4G2FA 3UNKA 4I5MA 4QYEA 2GMXA 3VWAA 3I6UA 3HMNA 5HIDA 2Z2WA 4B0GA 4M14A 3GC0A 5BVNA 5HE0A 5AMNA 4K8AA 2G01A 2R0UA 3QRTA 4CV8A 5A46A 4RFYA 4CKJA 4JRNA 5AR3A 2PVRA 2XNPA 1CMKE 2C5OA 2VTJA 5C4KA 3TUCA 4FUXA 5E8YA 4PL3A 3FEGA 3DJ5A 1OIUA 4TZRA 4W8EA 5DLSA 2WQNA 2OK1A 2VTQA 3DB8A 3IW4A 5DEYA 5EKNA 1G8SA 3Q4TA 2XYUA 5IQAA 2ZV2A 4YJSA 3R7GA 3RNIA 3IOKA 3E63A 3R7UA 3ERKA 4CZYB 4E3CA 5IZFA 4YJUA 2WKMA 4XX9A 3WF7A 4J8MA 3VQUA 4CT2A 1URWA 2O0UA 3A7JA 3CC6A 3QHRA 4A9UA 4D2RA 4CG9A 4O91A 3VO3A 4L46A 3ZO3A 3LXNA 1OGYA 1GIJA 4QQJA 5L3AA 3RAWA 2C69A 4FTIA 3FXZA 4BZNA 4JMQA 4EJ7A 3EYHA 3TDWA 1EH4A 3QRIA 3GI3A 2X9FA 1XH5A 3OCTA 3QD4A 3A60A 4NJDA 3BYSA 4HVHA 4CGAA 2VD5A 5TT7A 4IMYA 3KREA 4EI4A 4TRLA 3FSFA 4PTCA 3R28A 4I21A 1R3CA 1ATPE 4GW8A 1PXLA 3FMJA 1O9UA 1XH6A 4IX3A 3ZLWA 3F2RA 5EHYA 2PVYA 5TF9A 2YWVA 3O96A 4XV2A 1H0WA 3C0IA 4O0UA 3F3VA 4PNKA 1PXOA 4IAKA 5AUYA 5AV3A 2PVJA 4C4JA 4FVRA 1PXKA 4C57A 3RAHA 4QD6A 5JRSA 3FSKA 3AD6A 4BVUA 4C2WA 4ONAA 5BVDA 3PSCA 2BCJA 2WTWA 3NWWA 4IM0A 4QQ5A 4RC4A 5FXRA 2I40A 2AC3A 3CY3A 4EQMA 3EMGA 4O7LA 3VW6A 2XZSA 2JAVA 5CASA 5L6OA 3JPVA 1IAHA 4F6SA 3G33A 2ESMA 2ZDTA 3WZKA 5ETAA 4CMUA 3ALOA 4BL1A 3QU0A 1XHAA 5JMSA 3Q5IA 2I6LA 3Q9YA 4E4XA 5J79A 2SRCA 2B9FA 4DEBA 5JFVA 5GZ9A 5JRQA 5I9ZA 3GEQA 4MF0A 3EFLA 4BWXA 4FEVA 4FT9A 2YERA 5F4NA 1ZXEA 2QKRA 4ZTHA 3I81A 3ZLYA 4AW1A 1Y6BA 4R3PA 2BROA 1VR2A 1NA7A 3SLSA 2J0JA 3COHA 3FZ1A 4IDTA 3DXQA 3A2CA 2PZIA 4YSMA 5DH3A 1XR1A 4PPBA 2XIKA 3QALE 5HTBA 2RG6A 5HI2A 4OR5A 1DI9A 2UZWE 5J87A 3VBQA 3KF7A 5AV1A 5KHXA 3LPBA 3HRFA 3KRWA 4H3PA 3A61A 1KV1A 1PW2A 2UZOA 4J96A 4JLCA 4XG3A 2HOGA 3D5VA 4ASXA 4QQTA 5CVFA 3OY3A 1GNGA 2Y0AA 3DDQA 2PVNA 3VNTA 4EYMA 2NRYA 2UW4A 2XK9A 3L9LA 1YHWA 5DT3A 5ANOA 5B0XA 4AF3A 4D4YA 4R78A 3CD3A 2F9GA 2IZUA 3RBWA 4FTNA 3HAMA 4YTIA 2YLEA 3BGPA 1M2QA 5LVOA 3PIYA 3FLQA 1V0PA 4C62A 4FIFA 4AQKA 2YISA 3AQVA 3UIXA 4WNOA 3CQEA 2EUFB 3QD0A 3FLYA 4BBMA 3W16A 3OOMA 3U9NA 4BGQA 3RKBA 3SAYA 3LLTA 4DFUA 4UMUA 4F6WA 5DMZA 5HGIA 1E1VA 3VW8A 3FMEA 4EOPA 5KUPA 4O81A 3QGYA 2X4FA 3BU3A 2W1IA 3F3WA 4TW9A 3C5IA 1AQ1A 3FLSA 5HE3A 4HPUE 1OL1A 3VS7A 2OZOA 1U54A 4S30A 1OIRA 4A9SA 1YDSE 4NEUA 3ZBFA 4EOLA 3IGOA 4XLIA 1SVGA 5AUVA 5HBEA 5IMEA 3DPKA 3AXWA 1H4LA 4DTBA 3ITZA 4FSUA 4CFUA 5M09A 2JDOA 2P3GX 3BRBA 1TQIA 3DU8A 4C4HA 1RQQA 3ZEWA 4ZS4A 3C13A 1P2AA 1PKDA 2ZVAA 3EZVA 3OHTA 4FF8A 4KB8A 5FP6A 1W98A 4EOOA 5HTIA 2AEGA 2X6EA 3POOA 4TWNA 4BTKA 2V62A 4DGMA 4E6AA 3LCTA 3MESA 3QWJA 4C4GA 3I0QA 4CTBA 4FL1A 3ZSHA 3P86A 3BWFA 3RTPA 3KXMA 2VGPA 2PMOX 5HNBA 3AKKA 2WTVA 3NX8A 5HHWA 3TYKA 1OPKA 3AMYA 4FV6A 3TV4A 5J1WA 2CPKE 2NNWB 4HVDA 4Y5HA 2ZJWA 4RVTA 4M97A 2WQBA 3TDVA 4N6YA 2XK7A 5DEWA 3PVBA 2ZV9A 1J3HA 4ITIA 4F0IA 5ANDA 5A4EA 3D7TB 4YURA 5GZ8A 3UDTA 5A4CA 2ITWA 4JR7A 3OF0A 3KRJA 3E3PA 4U40A 3D83A 4UWCA 3LQ3A 1DI8A 1WVYA 1ZMUA 2WNTA 3ZHPC 4ZEGA 4WG4A 2ZFYA 4TWOA 4EZ7A 2ETMA 2VTPA 3I79A 3A62A 5I3RA 4YO6A 3C50A 4G17A 3LCKA 3NPCA 1IAJA 1YI6A 1JKLA 4WO5A 4J71A 3I60A 2VN9A 4YJTA 3NZ0A 2XIXA 3C9WA 4FKPA 5TKDA 3LXPA 5IA2A 2XB7A 4G5PA 1JKTA 3C5UA 2W7XA 3EJ1A 4MF1A 3ZUVA 4YLJA 4ANNA 3ATTA 5IMXA 3GBZA 4B8MA 1G5SA 2X7GA 5HORA 5EHOA 4LL5A 2EXCX 5BVKA 3T3VA 2H6DA 3R7EA 5D41A 1UWJA 1WMKA 2XK8A 2X0GA 2WTKB 3PG3A 3JY9A 1GZOA 3F3ZA 3WE4A 3COIA 3ZMMA 3DAKA 1PJKA 4G9RA 5EI2A 5CNNA 3U51A 2WOTA 5HD4A 4ANQA 3WBLA 3LXKA 4DT8A 4JG7A 3QFVA 3OROA 1ZYDA 3JVRA 4M12A 4QMXA 5CAQA 3AC3A 2Z7SA 3QF9A 2BAKA 5ETIA 4LGDA 2E9VA 4XOYA 4JDJA 4X7QA 2EB2A 4CFMA 2YCRA 2CGWA 2JAMA 4ALUA 4AOIA 5DRBA 2XIZA 3LFAA 2WHBA 3TG1A 1GIHA 2WTDA 2RL5A 1IG1A 3Q9WA 3ACJA 5CSXA 3OFMA 4DFLA 4EC9A 2XEYA 1R0PA 3E88A 4TXCA 5AP7A 3ZS5A 3I5ZA 4CYJA 1Q4LA 2O64A 2BRMA 2WU6A 3DNEA 4EOMA 4ZSJA 3UOHA 3UYSA 3DJ6A 2BTRA 2PMNX 2IO6A 3QTWA 3DK7A 1FVTA 4MAOA 2IW9A 4BKYA 5K5NA 4JQEA 5AX3A 3PDTA 2C30A 3PY0A 2YITA 4PV0A 3DKOA 2OIQA 3U4UA 2ITYA 4DGNA 2J0IA 4U80A 2R7BA 3BL7A 3TM0A 5KMNA 4D2TA 2JBPA 3OXTA 1OITA 4TY1A 4EOKA 4KIPA 2A27A 4QYFA 4GJ2A 4LOQA 5C27A 4X2GA 2Y4IB 4DE4A 2OF2A 3HUCA 5BNJA 1JLUE 2QVSE 3UNZA 4BKZA 1H1SA 5IDPA 5FM2A 5KZ0A 3R8MA 5DFPA 5EDQA 5IQIA 2CN8A 5FG8A 2V7OA 1M7NA 3HV4A 4L42A 4FSTA 2WMVA 3QRUA 4KBCA 5BPYA 5H3QA 1K3AA 3AT2A 4CLJA 5M4FA 1JNKA 3NDMA 4EKLA 3MIAA 4O0WA 3OY1A 3IG7A 4FIGA 4PDSA 3R22A 4HGTA 3UQGA 3VN9A 4GYGA 5CQWA 2OZAB 1YI4A 2CHLA 2ITVA 4LV5A 4BDJA 3QD2B 2LAVA 3U6IA 2CCIA 3WYXA 3MFUA 3M11A 1JWHA 3O7LD 3EWHA 4PNIA 2OJGA 4YPDA 2FGIA 4QP1A 3VBYA 3HUBA 1SNXA 5CEQA 5DVRA 5FDPA 3BHVA 4OTPA 2W4JA 3OWJA 4LI5A 3ZO2A 2CLQA 4ACMA 4DH3A 2IWIA 2RGPA 2R3IA 4H36A 3F82A 3D0EA 3EN5A 4NM7A 5FWKK 4F9CA 1VEBA 1AGWA 3GCPA 2CN5A 5M57A 3TIYA 1VLRA 4QDEA 3L9PA 2J50A 4QMZA 4WRSA 5CWZA 2C3LA 3BBWA 4AGUA 4DGOA 2J90A 3S1HA 2GNFA 2BKZA 3WZJA 1WBOA 4FNWA 4XP2A 4O1PA 2VO7A 4LOOA 4PUZA 5FRIA 4FTOA 4USEA 2UZUE 3G90X 4XV1A 3R9DA 5A4TA 3U8WA 2WIPA 5ITAA 2JKKA 2O5KA 1RJBA 3P08A 4FTKA 2XS0A 5L2TA 5IA0A 2XJ2A 3ZRMA 3LJ1A 4LRMA 2IZTA 4FZ6A 4TYHB 3C4FA 2Z7QA 3W0OA 1Q3WA 3H9FA 2CNQA 4RJ4A 3KRRA 5CLPA 3DFCB 3O50A 4TT7A 3D94A 3QTQA 3IS5A 3VS5A 4O0SA 4WUNA 1KUTA 2YJSA 2UZVA 3FLZA 4O38A 3NIZA 5GJGA 4L52A 4ZAUA 5HNGA 4C58A 4FYNA 3R8LA 3CKWA 5EW9A 5AR8A 4FL2A 4N70A 5KZIA 4PDYA 3BV2A 2W9ZB 3DBQA 4S34A 5C26A 3R2YA 4M68A 3DTWA 4IXPA 4FSQA 4O2ZA 1MRUA 3W2OA 2X7FA 4D5HA 4CZTA 3BU5A 3R30A 4LV7A 3KCKA 2PY3A 4L3PA 2JIVA 2C6MA 4W4XA 4CFVA 3EFKA 3LFCA 1UVRA 4A4XA 1ZYSA 5DGZA 3HDNA 3QTSA 3VJOA 2J5FA 3BEGA 3DLSA 5KE0A 3PJ3A 3RPYA 4UN0C 4OTDA 2PUPA 1KE9A 1K9AA 3EL8A 4UMTA 5E8VA 4AGWA 3UO5A 4XG4A 4MHAA 2EWAA 4PTGA 5BV3A 4PMMA 3QLGA 4KBAA 1PRYA 4JX3A 5FGKA 3VRYA 4F9WA 4LG4A 4B6LA 3N4TA 1KE5A 3NYNA 4QMMA 5CVHA 4BCJA 2ITNA 3Q04A 4QMQA 3ULZA 1YWRA 3WILA 4O7SA 1OIQA 3QAME 4G3FA 3SG9A 1RDQE 4R5SA 4I93A 4L8MA 5F9EA 3IONA 5D7AA 1OKYA 4YR8A 1ZRZA 1TFFA 4DEAA 4DHZA 4O6LA 4AW0A 4ASEA 3F88A 3W8QA 4C37A 3K2LA 4IFGA 4KSPA 3PZHA 4PQNA 4GT4A 3Q4CA 4APCA 1BL6A 1MQBA 2YM6A 3UOKA 3DBDA 2ONLA 4G3CA 4HYSA 4IAAA 3UG1A 4GYIA 4JQ8A 2PE0A 1PXIA 1UU8A 3QC9A 2JKOA 4KBKA 5EK7A 5AAEA 4XP3A 2UVYA 4J97A 3DZOA 5CS6A 3ZM9A 4Y85A 3HEGA 3I5NA 4ACHA 4IJPA 3DGKA 3GP0A 4UWBA 3ZLSA 5FEDA 1W2CA 2BAQA 4XBRA 2OW3A 2W1ZA 2WTIA 3MJ1A 5CZIA 4F99A 5E8SA 3OUKA 4S31A 4UY9A 2J5EA 2UUEA 2QLUA 1OBDA 2E9NA 3QKMA 2O65A 4PPAA 2J0MB 4XP0A 4BDAA 1NVSA 4DTAA 3OT3A 4EL9A 1QPDA 3PA3A 4QTBA 3RGFA 3MY0A 4WNKA 5HCXA 1BMKA 2P55A 2VO6A 4V04A 4ERWA 4PP7A 1FBNA 2FA2A 4AAAA 3UZRA 2FH9A 3QCYA 5E91A 5LARA 3F5GA 3MPTA 2HK5A 4X3FA 3KRXA 4GT3A 3Q4UA 4JS8A 3ZO4A 5E90A 5ACKA 5TE0A 4F6UA 2X9EA 5C8NA 4IWPA 2ETKA 2FVDA 2QHNA 4GIHA 1WAKA 4IQ6A 2HW6A 5AP6A 4D9UA 4M66A 4FIEA 3H9RA 3QUDA 1ZZLA 3NUSA 5HU3A 1YDTE 1FMOE 2GTMA 2WMTA 4W4YA 1BX6A 2QOCA 2C5VA 3W8LA 3E7OA 1APME 1ZYLA 1U4DA 2UW8A 3QUPA 4FBXA 3R7VA 2X0QA 2E9PA 5CNOA 4ZTLA 2J51A 3LCSA 4DFYA 1YXXA 4C61A 4NL0A 3ZXZA 5AIRA 2QOBA 4I3ZA 4V0GB 5M07A 2FSLX 4O2PA 4YLKA 1H08A 3W0RA 3KU2A 4GV1A 5LMKC 2WPAA 3O8UA 1PF8A 5EYDA 3R01A 4ZLOA 4Q9ZA 4I41A 3HV6A 3PRIA 4QYYA 3ORTA 3SRVA 2BMCA 4DHJA 2WAJA 4E6DA 5LOHA 4ITJA 4O7TA 2C6TA 2R3PA 4O4EA 2BVAA 5J8IA 4ACDA 2CGVA 3GU8A 3MY5A 2XKEA 1G8JA 5AR2A 3MTLA 3GC7A 2ITUA 3TACA 3V8TA 4IHPA 4PMPA 5FQDC 4O0XA 5J9ZA 4IC8A 3DV3A 1F3MC 3FYJX 4IB3A 4Y83A 4I6QA 2UZEA 2W06A 3FI4A 5BVEA 4M0YA 2ACXA 1I09A 3P7AA 4OLIA 3OBJA 5IQEA 2ZB1A 3U6JA 3TMOA 2W5AA 4PF4A 4FT0A 5EG3A 3SV0A 5L4QA 3R8PA 3D2KA 4KWPA 3UNJA 2X8IA 2VNYA 2ZMCA 3H10A 5K5XA 2VTRA 4AFEA 2CMWA 1WBNA 4RT7A 5AR5A 4EOIA 2QOOA 4IANA 4BJJB 1XO2B 3BYOA 3OWPA 4G3EA 4GH2A 3ZSIA 2UVXA 1WVXA 4FG7A 3R1QA 2GFCA 2QU5A 5J7HA 3U4WA 2BZIB 2VX0A 3RCJA 2VX3A 4FOBA 3HP5A 5AP3A 1OUYA 2CGXA 3NYVA 4QMSA 3Q5ZA 4DFZE 4ERKA