5HO7A

Discovery of novel 7-azaindoles as pdk1 inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
289
structure length
280
Chain Sequence
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of novel 7-azaindoles as PDK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 280
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ho7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ho7A01
1UKHA 4QTEA 3C4WA 2WU6A 4HPUE 3RGFA 3F9NA 4L67A 5IH4A 4O6EA 4GJ2A 4GEOA 5J8IA 1G8SA 1XHAA 4FOCA 3C0GA 3I60A 4MXZA 1OL5A 2GMXA 4DEBA 1ZZLA 2W9ZB 4BZOA 2BILB 3VIDA 2QO2A 4F0FA 3MIYA 5TOZA 2CGWA 2WMQA 3PVWA 5CSPA 4FV0A 2JEDA 2X4FA 3FE3A 2PVRA 3FLSA 1F5QA 3UVQA 2YDKA 4H05A 3QRUA 5C4LA 4O91A 2ZJWA 4L3LA 3F66A 4FVPA 4L00A 4JG6A 3VJOA 3BKBA 1OECA 3H0YA 3DFCB 3OT3A 1FGIA 4IM2A 1WBSA 3E8EA 3AXWA 5IQIA 2YCSA 1YOLA 2IVSA 2P33A 3R00A 4RX8A 4D2TA 4DFYA 4BCQA 2H9VA 4X2FA 1Z5MA 4O0UA 4OBPA 5IZFA 3AMBA 2XEZA 4FGRA 4YJQA 5EQPA 5IDPA 5JFWA 2PVJA 5HD7A 4D5KA 2HY0A 3AC8A 4IIRA 2RF9A 3GCPA 4MF1A 4RWKA 3BHYA 4X3FB 4FKSA 4IEBA 2EXCX 4H1JA 5T3QA 3R9HA 4CFWA 5CEMA 3O8PA 4IX4A 3QHRA 3FZSA 2UZBA 4F1MA 2XEYA 2X2KA 3L8XA 3RCDA 4MYGA 4BIEA 2W1EA 5IA4A 4HGEA 3ZLXA 3HKOA 4WIHA 4NWMA 2Z60A 3O7LD 4F9CA 1FOTA 2PMLX 3R22A 4GG5A 3LLAA 3GP0A 4O82A 2QVSE 3A7FA 4YZ9A 4AN2A 4BCJA 3VVHA 2BR1A 3LIJA 4FG9A 3LFAA 3LXLA 4DINA 1H1RA 3W33A 4EH8A 4QP8A 3VC4A 1E9HA 3MPMA 4UYNA 5E8ZA 3TKHA 3KRLA 4I41A 1BMKA 2X7FA 4CFMA 4YNEA 4PNIA 5EYMA 3HA6A 3C4ZA 5CZHA 3NNVA 2OWBA 4OT6A 2AC3A 4LQMA 3OCSA 4FSZA 4FZ7A 3R2YA 3R7IA 3TI1A 3FL5A 3D5UA 3EIDA 2WFYA 5HLWA 5LVNA 3UE4A 4FNYA 1YHWA 1S9IA 4AQCA 4EZ7A 1REJA 5FLFA 3ZEWA 5JN2A 3FC2A 1H27A 2WMWA 3L9MA 4ALWA 5HBHA 2IN6A 4NW6A 2J0MB 2OXDA 3CJFA 5CZIA 2VN9A 3DLSA 4L43A 4MNFA 3FMMA 4QMVA 4AN9A 3E8CA 4YP8A 3QALE 4BN1A 1H1PA 2XIRA 1SNUA 4RVMA 4ZLOA 1BX6A 3Q5IA 3GENA 4IZYA 4KKGA 5IKWA 4I22A 3R73A 4AP7A 1H07A 4AWIA 4C34A 4DFLA 4G3CA 2VWYA 4GYGA 3VUHA 1YOJA 2CHLA 5DOSA 4HYHA 3DXQA 4KABA 2VUWA 3DDQA 4WKQA 4JDKA 4JQ7A 4X7QA 3DJ7A 3AT4A 4B9DA 4DG2E 3UP2A 3EQFA 4EL9A 4FV3A 4FTJA 4ERWA 3VJNA 4EH4A 4N70A 5LMKC 2RG6A 4X3FC 4CGAA 2UW0A 2KULA 2R3OA 4MWIA 5M56A 3JY9A 4JJRA 3EQRA 3KVWA 4L6QA 4ZSLA 4LM5A 3MVHA 5KX8A 1A06A 4X0MA 4C7TA 4RGJA 4O7YA 4FICA 2HXLA 4F99A 2P2IA 1W98A 2IVTA 3FC1X 3GQLA 2A2AA 3MH3A 3RK7A 3UNZA 1J7IA 3COMA 3F5UA 5DNRA 2C6OA 4RWJA 4YHTA 4ITIA 5A14A 4FZFB 2DS1A 3KXHA 3D7TB 1HCLA 3GB2A 1W8CA 3IO7A 4A9SA 1YW2A 5EW9A 4ZK5A 4E73A 3BU5A 1SVHA 4N0SA 3HYHA 4F9WA 3EQBA 4YNOA 3QYWA 4C37A 1ZYCA 3C0HA 4FODA 5HU3A 3DTCA 2GNFA 1FVRA 4TNBA 3RNYA 3FHIA 3TV6A 1JKSA 2QOLA 3QUDA 3IW6A 4XCUA 3DAJA 4CFUA 1M7QA 2ZV7A 2JLDA 3L8SA 2XYUA 1Q97A 2XK4A 3C0IA 3PY1A 1CTPE 3MW1A 2WEVA 1QCFA 3EN7A 4GT3A 4OTDA 3N51A 2QONA 2OZOA 3FMJA 3GCUA 4YJUA 4Z55A 2W5BA 4K6ZA 3OG7A 4V0GA 2BALA 3FY2A 4AT3A 4I5CA 2X2MA 3BHHA 1MRVA 4DEHA 3O7LB 1YQJA 4MXAA 1GIIA 5JT2A 4G17A 4YTIA 4L01A 2BHHA 2PVHA 3OWPA 5BVWA 4IVAA 3RM6A 4A4OA 1KE7A 4F70A 4S31A 3RPSA 2BIYA 3ORZA 4HW7A 1YRPA 1OKYA 4WSYA 3RPRA 3WE4A 3N4TA 2OGVA 1OKWA 3RZFA 4CVAA 5L2QA 4R3RA 5M08A 2FO0A 4BDAA 4YUQA 4EZ3A 1KWPA 4FL2A 2XK9A 5KZ0A 3NX8A 3F69A 3R1YA 5HTIA 2FGIA 4FGBA 5JQ5A 2CKPA 1G3NA 4IXPA 5BVNA 1YXXA 5HLPA 2JAMA 3DV3A 4APPA 5C8KA 1Y8YA 3GC0A 5DT4A 3SVVA 1UVRA 4BTJA 3WZKA 4MD9E 4A07A 2LGCA 4AUAA 2CLQA 4YSMA 4EK3A 4MCVA 3DXPA 4ACMA 2YJSA 4ITJA 1V0BA 4I24A 3PSCA 1KE5A 4R1VA 4O7RA 5EK7A 2OU7A 1RQQA 5TR6A 3VS7A 2ZB1A 4YO6A 3QLGA 1OIQA 3O8TA 2WQOA 3PE2A 2CNUA 3OP5A 2P3GX 2PTKA 4OAVB 3U54A 1XH8A 3DNEA 4FIHA 4XNEA 3UO6A 3NIEA 2G15A 2JKOA 2KTYA 4CV9A 1P5EA 2E9VA 4QTCA 1LPUA 4BGGA 2UW5A 5EDRA 4BYJA 3OY3A 4FV4A 4ENXA 1R3CA 2VWXA 2YABA 3QRJA 4W4WA 4CQGA 5M53A 5JFSA 3ATTA 5FEQA 3EN9A 4EH2A 4M8TA 3EFWA 3F3TA 3AGMA 2XKFA 3LLTA 3G5DA 3OBJA 5C27A 1ZMVA 2WIHA 2WKMA 2WTVA 3CKWA 4MNEB 3LMIA 4DE4A 4GFGA 4ZSEA 2BRHA 3OOGA 4QTDA 1FBNA 2YWVA 3JS2A 3GU5A 2XUUA 3GI3A 2GQGA 3IS5A 3QQGA 5AP5A 2VTPA 2P4IA 1FVTA 2OF2A 3KRRA 4Y83A 4UB7A 2UVYA 2RFEA 4BF2A 2ITNA 4EJNA 5AA9A 3IGGA 4JS8A 1URCA 4XP0A 3NVMB 5D7AA 1OL7A 5DGZA 3F2AA 2WQEA 4G6LA 4GU9A 4C4HA 4MBIA 3P5KA 5D12A 4EOQA 1YDSE 3GNIB 4QQTA 3ODYX 4DFUA 5HNBA 4TY1A 4BHZA 4BICA 4AFEA 2Y8OA 2V5QA 1M52A 1ZMWA 5L2SA 3DBQA 4FTUA 5AA8A 3UVPA 3PIZA 3CC6A 3BBWA 4IX5A 5AR2A 4AW2A 5IQBA 1RW8A 4OUCA 4JIKA 3GBZA 2GHGA 3RBWA 4XOZA 1WFCA 3UOKA 2XCKA 2BKZA 3AC2A 4FT0A 3PZHA 1KE8A 4XH6A 2WTKB 1JOWB 4ALUA 4BGQA 4XBUA 3ORLA 2V62A 5IMEA 1Q24A 3V5QA 3UZTA 1VJYA 4BCKA 3KXZA 4M12A 4RVKA 1ND4A 5M4UA 3MPTA 2YCFA 2NPQA 1REKA 1KV2A 5GZ9A 5KZIA 4TPTA 2GS2A 3Q4UA 2OBJA 2B9FA 2UZEA 2W1HA 2YERA 4W4YA 5AFVA 4EORA 5AUVA 3VUKA 5AUTA 3F5XA 3O2MA 4D4SA 4OTRA 3UYSA 2VO3A 3DK6A 4IACA 1A9UA 1XKKA 2QI8A 2UW9A 3GOPA 4FTOA 4UXQA 1IAHA 4FSQA 3SDJA 3CQUA 3F7ZA 3EFKA 2RSVA 2FH9A 2VO0A 3VW6A 3LCTA 1JKLA 4M84A 2G2FA 2VTQA 1FINA 5KMIA 1QPCA 3U55A 4D2RA 3FMDA 3GCSA 3A4PA 5HO7A 3HDNA 4XG7A 4AZWA 4U42A 4IDTA 1P4OA 2HW6A 4MBJA 1XH4A 3TWJA 4IX6A 5BVDA 2H34A 4BKZA 1J91A 1NXKA 5FM2A 3S4QA 5AP4A 1WZYA 2O65A 2JKMA 2VWVA 4TWCA 4OBQA 5AR8A 4K11A 2GPHA 2PZIA 3PJCA 4EBVA 3NIZA 3CGFA 2VTNA 3MSSA 4NFNA 5TO8A 2FVDA 3UZPA 3VS0A 4IFCA 5E8WA 2UZWE 2VTTA 3HRBA 4O0SA 4KKHA 3AOXA 4RJ6A 5JFXA 4O0TA 4PPAA 4RA5A 4XG6A 2J0KA 4O7WA 2WD1A 3K2LA 3LQ5A 3MB6A 3MH1A 3NW5A 3DNDA 4AOJA 1VYZA 5HX8A 2Y4PA 5EM6A 4USFA 3BHVA 4RX5A 1CKPA 4ZZNA 3MESA 3I5ZA 3ZLSA 3Q52A 3RPYA 4M69A 3QKMA 3D4QA 2QURA 3ROCA 5HX6A 4AA5A 4PL5A 4U44A 4XLIA 3R7OA 4O0YA 2X8EA 1FPUA 3NUYA 4XRLA 3GT8A 3F5GA 4IADA 5JRQA 1K9AA 2HXQA 2OLCA 4WO5A 2QD9A 2QR8A 2ZAZA 3NCZA 5HG8A 5EDQA 4FKTA 5CXZA 1GNGA 1WBPA 3HNGA 4W4XA 3FI8A 3OBGA 3NEWA 5TF9A 4KIKA 3EL7A 3QTSA 4FKUA 1LEWA 3RAKA 3EKKA 4GUBA 3B2WA 4C58A 3OVVA 1YWVA 3NR9A 1YXTA 4HCUA 5CSXA 4E4LA 4CKJA 2Z7QA 3NUSA 3Q53A 3WF7A 3F2RA 3BX5A 4K18A 3WI6A 3OWJA 3ZUTA 2PZPA 5BNJA 1UKIA 4PP9A 5BYLA 2ZOQA 4JBOA 5IUHA 3MBLA 2C6EA 5CQWA 4ZXTA 2GSFA 2R3MA 5GZ8A 4L3JA 3A99A 3W55A 2BKKA 2J4ZA 2PSQA 5CEIA 1GAGA 1J1CA 4V05A 2QOCA 5M51A 3Q2JA 4GVJA 5HD4A 5HIDA 2R4BA 4EQUA 1APME 4YJSA 3Q9YA 3AC3A 4JX7A 3BGZA 3TV7A 5BQ0A 4P90A 1BL6A 2XIKA 2XJ1A 3O50A 4BCHA 3VUTA 4C4GA 2Q0BA 4JRVA 2G2HA 1H25A 3GFWA 4X2JA 3LMHA 4NSTA 4RWIA 5FEEA 4MWHA 2YJRA 4RIYB 4UWCA 4W8EA 3QD3A 3OXTA 4DFNA 5J95A 3MN3A 4CTCA 5FTQA 2X81A 1GZNA 4FEWA 4MXOA 3KB7A 3LPBA 3G51A 2BRMA 1XWSA 4L45A 4K8AA 3HAMA 4PUZA 3NMUF 3ZC6A 3KRJA 4EONA 4P2KA 4EH3A 2F7XE 2XS0A 4OTPA 3FQSA 3VAPA 4MXXA 4Q5HA 3SXSA 4D5HA 2C5XA 3SXRA 3NRMA 1JKKA 4O0XA 5FXQA 4EEVA 4DH1A 3KREA 3Q9WA 5FP5A 4NK9A 5CQUA 5GIOE 2CGUA 2EB2A 4D1XA 5KO1A 4FUXA 4XLVA 5AM7A 2EB3A 4JAJA 3P78A 3VQUA 2CN5A 1YDRE 4NM5A 3DBCA 3QTRA 4CFFA 4R3CA 1W84A 2C6IA 3MY5A 5BPYA 3SV0A 5L3AA 4AZEA 2VGOA 4C4FA 2JFLA 1U54A 3M2WA 4BBFA 3OUKA 2UZUE 3MVJA 4LMUA 2PVYA 4CYIA 4F7JA 5CU0A 1PF8A 4M0ZA 4HVIA 3N4UA 1HCKA 4TT7A 3QGWA 4H36A 2YZLA 2JDTA 4EWQA 5I9VA 4F0IA 2GNIA 2OIDA 3E3PA 1JKTA 3R7VA 3BYUA 3IOKA 4DAWA 5C26A 1QPEA 4PDPA 1XJDA 3VHKA 2XJ2A 1OIUA 4YC3A 1PMNA 2ERZE 2WB8A 5JFVA 1PW2A 2PUUA 2OW3A 2B7AA 2BFYA 4E5AX 3PE1A 5AV4A 3T3VA 2PPQA 2V22A 4D4YA 4QMOA 5IUIA 5C03A 1WVYA 2PL0A 4RWLA 4QYEA 3PVUA 2Z8CA 3QD4A 1M14A 4PPCA 3LCOA 4GRBA 3DLZA 3FXZA 2IW8A 4MVFA 4QP4A 4LV8A 2BTRA 2F2CB 4QTBA 5FQDC 3BYOA 3ANQA 4PDYA 5KMLA 1ATPE 1ZLTA 3FXXA 4FF8A 3VQHA 4ZY4A 5IMXA 4J96A 1ZWSA 3V8TA 1CKJA 5H3QA 3UGCA 4DH8A 1BL7A 3V51A 4RIWA 5B2LA 2HK5A 3R7YA 5J87A 1YXUA 2VWBA 3MGYA 2EUFB 4USDA 2J2IB 2WELA 2JC6A 3GOKA 4G1WA 4RFMA 4W9WA 3JVRA 3ZO2A 2C4GA 4AT4A 3UPZA 4O22A 3WF8A 5JZJA 1Q4LA 1Q41A 2XM9A 4Q5EA 3L9NA 4A9UA 3ORIA 3A7GA 4PL4A 1K3AA 3L1SA 2V7AA 4GYIA 2JKQA 4E5WA 3NWWA 2W1IA 3F2NA 1WBNA 2C69A 3HV3A 2QHMA 4PDOA 5HHWA 2C30A 4ZMFA 4R77A 2V55A 4J1RA 4BBMA 5LJJA 5CT0A 3C5UA 2RKUA 4FSRA 2G2IA 5EYKA 2QHNA 4Y85A 2BZIB 4I5PA 4QOXA 2BZHB 3V6SA 4F1TA 5IEXA 4IX3A 4B0GA 5LQFA 2G9XA 4JQ8A 2QKWB 3LFFA 4M66A 4H3BA 3R01A 3C5IA 1XH5A 3DAEA 4NU1A 4M7IA 1PXMA 3OUNB 5DE2A 2Z7RA 4RRVA 1XBCA 3COIA 3LHJA 4CCUA 4DEAA 4FEQA 4J8NA 3HRCA 3GQIA 3JY0A 3MFSA 4AXAA 1R0PA 1STCE 4NKAA 4CKIA 3OXZA 2VWUA 2XK3A 1T46A 1ZARA 1SNXA 2VO7A 5IA1A 3II5A 5AR5A 2CN8A 3CKXA 4ANQA 4PRJA 1UNLA 4ZZMA 2QOIA 4KRDA 2VD5A 3VUDA 2AC5A 1R39A 3W2RA 2PUNA 4B6LA 4EYMA 4F65A 4GW8A 3S0OA 4FV5A 3UNJA 2XKEA 1WVXA 1JQHA 1NVSA 4GMYA 3V8WA 4Q9ZA 3LCKA 4L52A 3QQKA 3KK8A 3K3IA 5B7VA 3OTVA 4JIAA 3W1FA 3L8VA 3A60A 4OTQA 4ZMEA 1YOMA 1JBPE 2W4KA 3TZ9A 4KS8A 5IQFA 4WNOA 4WA9A 4IWQA 4QTAA 2UVXA 2YFXA 3G33A 4B99A 4RLLA 4XEYA 1UNGA 3FKOA 4OGRA 3Q2MA 4U8ZA 4C3RA 4UMRA 3GVUA 3ZOSA 5I9YA 2VU3A 4EOJA 3SG9A 3OWKA 3UOHA 5A3XA 1CM8A 3RINA 3VUMA 4BGHA 4DHFA 3MIAA 2CSNA 2XIZA 5HNGA 4I0RA 3UQGA 5KMKA 2JDSA 3O8UA 3PY0A 4CTBA 2ZYBA 3ZFYA 1H0WA 2GFSA 3WIGA 4RJ3A 3ZRKA 2Z7LA 4R7IA 3KXMA 1URWA 4W8DA 1SVEA 4FYNA 4DH5A 2BRBA 3KMUA 4RSSA 2OH4A 2XNBA 2RL5A 3RI1A 3U4UA 3PVGA 1E1VA 2B52A 3EKNA 4EH7A 5FTGA 3AD5A 3U87A 4GFMA 4ZTNA 5M57A 1OL1A 4L8MA 3DZOA 3M11A 1Q8UA 3VF8A 4EI4A 2XH5A 3KK9A 4JG8A 5HO6A 3P23A 1P14A 2IJMA 3C4XA 4TYIA 3I4BA 3TZMA 4I6FA 3UMXA 2WMSA 4TZRA 4GS6A 5HTCA 5L8KA 2XNGA 3PDTA 4ANNA 3F3ZA 4G16A 5J9LA 2ZMCA 4YTHA 4O21A 5CANA 4BZNA 3ZSIA 4FL3A 2I0EA 3G6HA 2UW4A 4RX7A 2YLEA 4JDIA 4F64A 4QQ5A 2OKRA 3NAXA 4RZWA 5F1ZA 3THBA 4CFXA 1OI9A 5D9HA 3PRFA 3UOJA 4BIBA 5A4LA 4FZAB 4O2PA 4TYHB 2ERKA 5L8LA 3RALA 1Q8ZA 4CD0A 5AEPA 5LOHA 4C33A 3OF0A 2GTMA 3S3IA 4PX6A 5FWKK 3UO4A 2ZMDA 2XNMA 4RJ4A 3R1QA 5CF8A 1EH4A 3ELJA 3FSFA 3SLSA 4JQEA 5HKMA 5FBNC 1BYGA 1PY5A 3CE3A 4H1MA 4M97A 4AA0A 5F9EA 5CU2A 4I1ZA 2WZJA 4DFBA 3EZRA 3FLNC 3S95A 3HVCA 4IW0A 4C4JA 2YIRA 4FEVA 4IM0A 4EJ7A 3LFEA 2R7IA 4E4MA 3JYAA 4FTRA 4NT4A 3SA0A 3A61A 5IH5A 3TM0A 4FKQA 4IB3A 4QNYA 4ASXA 4PMSA 3KN5A 5BVEA 5LVMA 3BELA 5LVPA 3BHUA 1M17A 3BE9A 3EL8A 4Z3VA 3A2CA 5M4IA 5HE3A 4CMTA 2XNPA 4XV1A 4IAIA 5JZNA 2HCKA 5ETCA 5J7HA 4XYFA 4ZS4A 5IA2A 1AGWA 5DT3A 2WOTA 2WAJA 4MH7A 3KRXA 3ZDUA 3TUDA 2W1ZA 3DXNA 4E6CA 3I81A 3WBLA 4LGGA 5HICA 1Q3WA 2UV2A 3CS9A 1JNKA 1UU9A 2BRGA 2HZ4A 1H24A 1OUKA 3RTPA 2W96B 3I0OA 1UWHA 3NUAA 3LE6A 4ASEA 4ZIMA 4CFVA 3SOCA 2QLUA 5IEVA 3E5AA 3L9LA 3CLYA 4F0GA 5EM7A 4H3QA 4IFGA 1RE8A 4I94A 5HE1A 1TQIA 4M0YA 1JSTA 4BWKA 4JL9A 4FTQA 4DG3E 2IG7A 4CYJA 4O7VA 1UV5A 3IONA 4GJ3A 4BDCA 4CSVA 3SXFA 4E4XA 2VWZA 2GNJA 1G5SA 3G2FA 4BDIA 3D15A 3RVGA 3O51A 3G15A 3EMGA 4PQNA 3LFCA 5CNNA 4QMSA 5AR4A 5K0XA 5FM3A 1H26A 5AADA 2WTIA 4IM3A 4X2KA 2C68A 2FB8A 3F3WA 4AU8A 3OHTA 4F9BA 3P7AA 3R8MA 4NEUA 3AG9A 4TL0A 3C4EA 4QMLA 4KIPA 1ZYDA 2OF4A 2QG7A 4EHZA 5HVJA 3FMKA 4G3FA 1WCCA 3BYMA 2JITA 1J7UA 4FTTA 3FZRA 4QP6A 3UO5A 3ZC5A 2YITA 5L2WA 3EB0A 1Q62A 1PMVA 2O63A 3D2IA 3RWQA 1YWRA 2PVMA 4MD7E 1Q3DA 4OTHA 3U9NA 3V5PA 4ANLA 5KKRB 3LXKA 2WMVA 4V01A 2CDZA 4RJ7A 3TL8A 3ZRLA 3ODZX 4IDVA 4ZTQA 2X2LA 2YDIA 4J52A 5EI2A 3GXLA 3QGYA 5H8GA 4C4EA 4CXAA 5CF5A 2CLXA 3NW7A 4YR8A 5K5XA 3EQHA 3U6HA 4MK0A 3OW4A 3WILA 4C3FA 1J1BA 1KSWA 1PXNA 3DU8A 1PXLA 4NZWB 3FY0A 4FVQA 1OUYA 3HEGA 4IB0A 4MF0A 4WRGA 4BDGA 2R7BA 3IW7A 3KULA 3KQ7A 2CGVA 1GOLA 4FSUA 4AGCA 3R6XA 3ZLYA 3CBLA 4YSJA 4NIFB 2ONLC 3EQDA 2ITZA 4J95A 2XKDA 5IF1A 2JKKA 3PZEA 4XV2A 3OZ6A 5DR2A 5FUTA 3TKUA 5CNOA 3VF9A 2I1MA 3H0ZA 4AW0A 3KRWA 4RC3A 3UVRA 5FDPA 2B53A 5HORA 3M1SA 3M42A 5LARA 2QQ7A 5CS6A 3ZONA 2R3HA 3TUCA 5HU9A 1UU7A 3EN5A 4MQ2A 4Y5HA 3TIZA 2E9UA 3NZ0A 3HECA 5AUYA 3RK9A 4CZTA 1OKZA 4FV7A 3F82A 4CT1A 4LOQA 4ASZA 4YJNA 2WMXA 3TNIA 4WNKA 3CD8A 1ZY5A 3DQXA 1YI3A 2GS6A 3OS3A 3EQIA 4R7BA 4FTLA 4NYEA 3ET7A 4C8BA 1SM2A 1NVRA 3ERKA 2ITOA 3LFDA 2WXVA 4FNZA 5A6NA 5L2IA 4FIEA 3QQFA 1Y91A 5AV3A 4ACCA 3QTQA 3WYYA 3IECA 2W4JA 3CTQA 2PVLA 3EFLA 3UIUA 4O7TA 4IWDA 2VGPA 4YTCA 4YPDA 3C4FA 3A8XA 3F3VA 3NYXA 1IR3A 3BIZA 3FSKA 3HUCA 4KSPA 5AIRA 1AQ1A 3OEZA 1QPDA 3D0EA 5IG1A 2OJJA 4PMTA 4DLIA 5J7BA 3NLBA 1KOAA 2VWWA 2CKOA 4L7SA 5EM5A 5HCZA 1Z9XA 3KMWA 5HGIA 2PVNA 4EBWA 2YAAA 4XX9A 4EH9A 4F63A 5LXMA 5KBQA 4OW8A 2V7OA 5IDNA 3DA6A 3L8PA 5KKRC 3HMMA 3R2BA 4AGUA 3QC9A 4XG9A 4E6DA 5FXRA 2QG5A 2X39A 5GJFA 3AD4A 5HIEA 4QYHA 4I3ZA 4HNFA 5ANJA 1KOBA 3PG3A 4L3PA 3EN6A 3V5WA 3R9OA 3ORMA 2VTOA 2OO8X 5K9IA 3PIXA 4ZJIA 3WZJA 3OD6X 4LFIA 3IDCA 4NCTC 5DRBA 3QA8A 2W0JA 4I4FA 1WBTA 4KSQA 2X8DA 5F94A 5FRIA 3ZH8A 5IU2A 4DEGA 4KBAA 2YIWA 3OFMA 2PU8A 3F7WA 4GK3A 4RJ5A 4RQVA 2JBPA 5EFQA 5HBEA 3BLHA 1O9UA 2C6KA 2VX3A 3DKFA 3FL4A 4FTIA 3P08A 4GFOA 3V5LA 3LFSA 3LFQA 3AMYA 3PY3A 4XBRA 1V1KA 1Q61A 2WMTA 1M2RA 5L6PA 1OPKA 1OBDA 3A4OX 3NCGA 3SOAA 5E8YA 1AD5A 4JI9A 5AV1A 3KXXA 4F08A 3KXNA 4EKKA 2VWIA 2NRYA 5DEWA 4CG9A 2B0QA 4KBKA 3K54A 3UP7A 5J9ZA 3W2OA 1I44A 5KUPA 5EQEA 2YHVA 5CAPA 4QP7A 4W4VA 2ETKA 4YJOA 3ZBFA 3OMVA 5DI1A 4M3QA 4E8AA 3AC4A 5DPVA 2GNGA 2JDRA 1PRYA 3DOGA 5ETFA 2C3JA 3VS2A 5JK3A 3GC8A 4FTNA 4S33A 4EK6A 4IJPA 4G6OA 2GQRA 4HVHA 2C0OA 2XK6A 4FX3A 4QMPA 3FQEA 3UTOA 2OZAA 2QO9A 2C6DA 5GNKA 4DEIA 5DLSA 3AMAA 5HOAA 3ZHPC 3LQ3A 1H01A 1BI8A 3D5XA 2R3JA 5EDPA 2BDFA 4GK4A 3EQPA 4Z7HA 3QZFA 2EWAA 3ZO1A 1ZOGA 3Q4TA 3ZSGA 5L4QA 2CNQA 2NNWB 2W06A 5DR6A 1H28A 1TVOA 1YHSA 2BFXA 3OW3A 3NAYA 2BRNA 3E8NA 3Q6UA 2QCSA 3A7HA 4UXLA 2YM8A 3DJ5A 4GT4A 4B4LA 2JGZA 4E4NA 1MRYA 1PYXA 3PA4A 5EI8A 4ARKA 4JLCA 4TNDA 3VS4A 1FVVA 3FI3A 3JUHA 1W82A 2X0GA 3PIYA 4UZDA 1HOWA 3VNTA 5HG9A 4G5JA 3TACA 3ZRMA 4F7LA 3CQEA 3JPVA 4OR5A 5LMAA 1JSUA 1U59A 4DA5A 5JGAA 4FTAA 4CRLA 2B54A 3OWLA 3FZ1A 2XNEA 1B6CB 3MS9A 4FKWA 4BDDA 3PLSA 2X7OA 3H9OA 2PWLA 4GV1A 2PK9A 4IAFA 4PPBA 2OSCA 2WMRA 3NPCA 4EHVA 4BTKA 2XK8A 5CTPA 5CEPA 4Y73A 4O38A 4LI5A 3R9NA 3IW8A 2W5AA 3MJ1A 3WOWA 2ITQA 2X9EA 4DEDA 3R9RA 5BVFA 5D1JA 2XYNA 1P4FA 5AP7A 3QQJA 5CF6A 3EHAA 1XQZA 2YM4A 3ZCLA 5E8XA 4EQMA 4JBPA 5M06A 2WU7A 4G6NA 4GVAA 3H3CA 3KVXA 2UZVA 4QD6A 3PXQA 3RAHA 2CJMA 2R0IA 4B8MA 2QOKA 2BZKB 3QD2B 3LM5A 4QQJA 3C4CA 1FMOE 3AC1A 5IPJA 5L2TA 3QL8A 2A19B 5LCJA 1H1WA 3E62A 3QRKA 4ID7A 4Z7GA 5TT7A 4KBCA 2IVUA 3CY2A 4BCMA 4WBBB 3QQLA 2WMUA 3HMIA 3PYYA 3R7EA 4GT5A 3P0MA 5H9BA 3O23A 3MH0A 5BYYA 4I93A 4JAIA 2WNTA 4RIXA 3ZXTA 3Q4ZA 3QTXA 4ANBA 5KCVA 5AP1A 2IPXA 4FEUA 1W83A 2UUEA 2WTJA 3AD6A 3PPKA 2WGJA 3CQWA 2PULA 5T68A 3TCPA 1CMKE 2UZOA 4XRJA 3POOA 4ACHA 4EC8A 5I9ZA 2GHMA 4O27B 4TWPA 5M4CA 5AV0A 1LP4A 2WTKC 2REIA 2W7XA 2XJ0A 3EFJA 2CKQA 4I5HA 3A7IA 3HMNA 4K77A 4N6YA 2CPKE 2B9JA 4X6QC 1UU3A 3KF7A 1IASA 4DYMA 2Y6OA 2UW8A 1H08A 2QOBA 4WSQA 4L9IA 4FK6A 2CNVA 1IA8A 2BIKB 5HQ0A 3R21A 3IQ7A 4CCBA 3AQVA 2HW7A 4NTTA 3TNHA 3COKA 2ZV8A 4FKVA 2YACA 3BGPA 3OT8A 2QU5A 2WOUA 3ANRA 1QL6A 3MA3A 5EM8A 2ITUA 3BPRA 3LKMA 4ANMA 4U9AA 3Q3BA 5H2UA 4FKPA 5AP6A 4U7ZA 4CFNA 5IH6A 3IKAA 4APCA 1GY3A 4IWOA 5IA5A 3DJ6A 2PZRA 5AUUA 2J5EA 3D7ZA 4WT6A 1BI7A 3NNXA 5DIAA 3GC7A 2JAVA 4EOIA 3QX4A 4CLJA 2QOOA 2XRWA 5HESA 5C8NA 2GU8A 4FV2A 4JDHA 2DWBA 3KL8A 4K0YA 4FSMA 4LRKA 3PWYA 4ZTHA 4IB5A 3PXYA 3TZ8A 2WQNA 3FAAA 4KB8A 2QODA 3QWJA 4QPSA 4R5SA 3SQQA 4YZNA 4EZ5A 4DGOA 4NUSA 5I4NA 3F5PA 3W2CA 5LCKA 2YA9A 3UODA 3H4JA 4O84A 5GHVA 4A9RA 4Q2AA 2C5NA 4IWPA 3DBFA 3LVPA 4JNWA 3IDBA 3Q60A 1YWNA 3QYZA 2HZNA 4IH8A 3PUPA 5F95A 4TYHA 3IK3A 2O2UA 4Y46A 3ZO4A 3K5UA 3OROA 3ORTA 3DS6A 4IZAA 5I9UA 3FYKX 5HVKA 3G6GA 3F3UA 1KE6A 3MPAA 3HP5A 3UYTA 3FHRA 4FTMA 2HENA 3FKNA 2J51A 3RHXA 3MTLA 3EYGA 3ZS5A 3W18A 4FZDB 5K4IA 1YKRA 4U45A 4YZDA 4AZVA 1SYKA 1YVJA 4O2ZA 3WZUA 4HZSA 4N4SA 3VBWA 3TTIA 4RFYA 2OH0E 3H9RA 5CWZA 2J9MA 4C02A 2W1DA 3MTFA 2OI4X 1ZAOA 2BAQA 1PXPA 3ACKA 3QUPA 4J98A 4U79A 4XP3A 4ANSA 1YI6A 2BTSA 4CT2A 4HNIA 5EI6A 4NKSA 4AF3A 2YCQA 2VTLA 4G3EA 2C6MA 2VAGA 4EH5A 4LV5A 2CKEA 3FZOA 4G9RA 3V6RA 2VX1A 3E87A 3FV8A 4RJ8A 4D4VA 5J1VA 5C4KA 4MHAA 4M13A 5C8MA 5AIKA 2XBAA 5JSMA 1CSNA 3D94A 3E8DA 3UMWA 3HP2A 3R04A 4I92A 1MP8A 4BR3A 2O8YA 2WMBA 2E9OA 3FMEA 4DGMA 5LMKA 4IANA 4X3FA 3DFAA 3I6UA 3BEGA 5CEQA 2QKRA 3MYGA 1H8FA 1PKGA 3GFEA 3DCVA 3FBVA 3QCQA 3QXPA 3ULIA 4CQEA 3VUIA 2W17A 3BRBA 5DG5A 4BCNA 4HYSA 3D2KA 3WZEA 4DH3A 3BLQA 2O3PA 4IAZA 3E64A 2BCJA 2ETMA 3ZZEA 4AACA 4ACGA 3CJGA 1ZMUA 3F88A 5TE0A 1IG1A 4FNWA 4JT3A 4NM3A 1UWJA 3DAKA 2GTNA 3QCYA 4MBLA 1W0XC 4O1OA 5EOLA 4CMUA 4ZY5A 1XO2B 2R3QA 3L9PA 4RA4A 2ZM4A 4QRCA 5HCYA 3RP9A 4DFZE 5J9YA 2Q83A 5DYJA 4GSBA 4J71A 4HJOA 3W2SA 4DC2A 5LVOA 5CLPA 4II5A 4P5QA 4ZTLA 4KUJA 4I5MA 3W10A 2C1BA 4ZTRA 5ANGA 5KMMA 5HTBA 5D10A 1JAMA 5CSHA 4MD8E 4LL0A 1GZKA 2I40A 3RPVA 5E8TA 3W2PA 2C3IB 4F7SA 3D5VA 3LW0A 4ZZOA 4DF3A 2VZ6A 4DTKA 2YDJA 4X21A 2B1PA 3LXNA 4X3JA 3QCSA 4UY9A 5AM6A 4EHEA 1YHVA 3CP9A 5IQEA 3U4WA 4QMXA 2W1CA 4GU6A 5LMBA 4WBOA 3V01A 3AT2A 3RCJA 4AS0A 3FJQE 5I3RA 2Y9QA 4C38A 3LM0A 2VRXA 1U5RA 4FR4A 2JIVA 3HLLA 3R28A 3CTJA 4QQCA 1JLUE 2R3GA 4D0XA 3AGLA 3PVBA 2P55A 3VULA 4F09A 5CAUA 4O81A 4BY9E 4KS7A 5BMMA 4G34A 4LRMA 3QZHA 4DH7A 2E9NA 4FKRA 4J8MA 3UIXA 3QTIA 1ZYJA 4EOOA 4L42A 2ITTA 2QNJA 4KD1A 4O7ZA 4WNMA 5DBXA 3TZ7A 4D2PA 2C6TA 3BEAA 3R63A 4YLLA 1PXOA 2Y0AA 4ONAA 2OXXA 4FE2A 4XMOA 1OL2A 2HWPA 4A06A 5ITAA 1NW1A 4O7SA 3HGKA 4FT7A 5IQAA 5L6OA 2YZAA 1DAWA 3FLYA 2PZYA 3MFRA 3B2TA 4JRNA 4J97A 3DKCA 4FL1A 5L6WL 4BTMA 4FSYA 3N4VA 3E92A 2NP8A 4FTCA 5ACBC 3UPXA 4EOKA 3E3BX 1OMWA 1MRUA 3DY7A 4BDEA 4FIGA 4G9CA 4XV9A 3HX4A 2W5HA 2XIYA 1OL6A 4PNKA 4WG5A 4ZJVA 4W9XA 3TUBA 4AOTA 3MDYA 4O86A 3GEQA 2RGPA 3U6IA 4IAYA 1L3RE 3HUBA 3BYSA 5AUWA 3D7TA 4E6AA 2CGXA 4UN0C 1B39A 4Q9SA 4S30A 4YJPA 1VEBA 4D1ZA 1LEZA 2R2PA 4EH6A 1MQ4A 2QOQA 2UZDA 4JDJA 3BWJA 2DQ7X 3RM7A 3OCTA 4KIQA 4BC6A 5DMZA 4EOPA 3ZM9A 2NO3A 3W8QA 4U6RA 5M55A 3PWDA 5HG5A 4IQ6A 2GNHA 1O6LA 2FSTX 2OJGA 3GU4A 3SAYA 3SRVB 4DG0E 3BV3A 4FK3A 3OTUA 3VBYA 4EWHA 3MVMA 4QMYA 4BDHA 4CLIA 3I79A 2JFMA 5CAOA 4ASDA 4TW9A 3P86A 5KHWA 3DT1A 2HELA 3R83A 1OGUA 3PTGA 5IEYA 1F3MC 1U5QA 2A4LA 5D41A 3D9VA 3DBDA 2R5TA 1ZY4A 3KCFA 4O7LA 5A54A 1OM1A 2PMOX 3JXWA 4FUYA 2I6LA 5CU6A 4CZYB 4EOMA 1R0EA 2PUPA 5LVLA 1JPAA 4H3PA 4MEDA 4I21A 2Y4IB 3UZRA 4TXCA 4ZJJA 3BQCA 2BZJA 5ICPA 4OTWA 5JRSA 4Y8DA 2ETRA 2ZVAA 4DLJA 3TEIA 4FIFA 4C59A 4ENYA 1VZOA 5IQGA 2VV9A 4LOOA 4JG7A 3PXRA 5CU4A 5KNJA 4L68A 2NRUA 4BZDA 4KIOA 5EYCA 5HVYA 3RMFA 5FXSA 2W1FA 1ZRZA 4MXCA 4BDKA 3E93A 2PMIA 2YCRA 3OC1A 4F1OA 4K9YA 4EK4A 3KXGA 3P79A 5KMNA 2J90A 3BU6A 4ZP5A 5A4CA 3LCSA 5BVKA 2GDOA 2SRCA 3QTWA 3PXZA 2ZV9A 3FMLA 3ZMMA 5A4QA 3BE2A 3VWAA 3QTZA 4BCIA 4NH1A 4YLKA 3ZEPA 2WQBA 3QRIA 3T9TA 4NTSA 5J5SA 4DTBA 4JOAA 4E20A 3MVLA 3LMGA 1T45A 2VO6A 3U9CA 3FEGA 3G0FA 4HPTE 2BDJA 3I1AA 2R3IA 3FPQA 3QZGA 3R8ZA 4JXFA 4O1PA 2XVDA 2VTIA 3NUUA 5E91A 4FC0A 2IZTA 4AOIA 3VBTA 3HAVA 1OIYA 1Q99A 4CV8A 3QKLA 3QC4A 4IZ7A 4IBMA 4RT7A 4CG8A 4MNEA 3G9LX 3C51A 3IW4A 1ERKA 2XM8A 4Y5QA 3LFNA 3ORNA 1U54B 3NYOA 4LRJA 4AA4A 4OTGA 3QLFA 1F0QA 5G6VA 4PDSA 2HAKA 2J0JA 3KEXA 4NW5A 5DN3A 3FUPA 5EHLA 3UQCA 3TXOA 3GCQA 3DTWA 4LOPA 4BWPA 2WIPA 4BIDA 4FT5A 5AR7A 2YM5A 5K4JA 2VTAA 2RFSA 4PTGA 4PTEA 3FLQA 4QP3A 4YBJA 3V04A 4C0TA 5M4FA 4O96A 4GKIA 2PUIA 2GCDA 3B8QA 3C7QA 3ORXA 4LGHA 4WUAA 5I9WA 3TNQB 4M14A 4YC8A 4DCAA 4RVTA 2F2UA 4HGLA 2Y4IC 1OZ1A 3R7UA 2RFNA 3VN9A 3PLAE 5GJDA 4YHFA 3SGCA 2B9HA 3OXIA 2E2BA 4WG4A 5EH0A 4QYGA 1PMUA 1NT2A 2JIUA 3CTHA 5M07A 1UA2A 3S1HA 4YJRA 3LJ2A 3O96A 4R1YA 2VTSA 4FBXA 1MQBA 4DGGA 4HGTA 1PXIA 5AUXA 4RIWB 3GUBA 3IPHA 3KKVA 3LOKA 4J53A 4HCVA 5K3YA 1SZMA 5D7VA 4XJ0A 4R6VA 4I20A 2YIQA 5TKDA 4X6RA 2I7QA 4NJDA 4QP1A 4O83A 2XIXA 3PFQA 4IVCA 4XG3A 2UVZA 2WHBA 3GGFA 1Y57A 3BI6A 2DUVA 5A4EA 3Q9ZA 4QMTA 4ZTSA 4AN3A 2IWIA 5CSVA 4WRSA 2W99B 3UG2A 2FSMX 4BCGA 5EW3A 5KE0A 3QRTA 3PP0A 3A8WA 4MX9A 4ZS0A 5ACKA 4IMYA 4BRXA 3TTJA 1PHKA 4AX8A 4U0IA 4BDFA 1DS5A 5CVGA 4AE9A 3TNWA 5EQYA 3PA5A 4BB4A 2PE0A 3R71A 1OB3A 1Q8WA 1TQPA 4F6UA 1GJOA 3W8LA 4ERKA 2JDOA 3ALNA 4FIJA 2XRUA 3N9XA 4OTIA 4S34A 2XNOA 2BAJA 4BDBA 4TWNA 5IA0A 4BWXA 4HYUA 4LUDA 1TKIA 4DN5A 5AV2A 4Y72A 2G1TA 3P1AA 3C50A 3UC4A 4FIIA 3O71A 5B2KA 4F7NA 2X6DA 3RHKA 5AX3A 3W32A 1GIJA 4A9YA 3AC5A 2XKCA 3F61A 5AMNA 2YISA 3BGQA 3MFUA 4AT5A 4AGWA 3DKGA 4EKLA 5KMJA 5FDXA 3A62A 1XR1A 4QMQA 2J0LA 2ZDTA 3QTUA 5IUGA 3EOCA 4I6QA 5FTOA 5CT7A 3Q32A 4R5YA 5HG7A 4YMJA 4PV0A 2OJIA 3FMHA 4KINA 3P9JA 4WG3A 3QZIA 4MXYA 2W4OA 5LWMA 2W05A 4GCJA 5HO8A 4UWBA 5DHJA 3VS6A 4ZTMA 1BLXA 4NJ3A 5AWMA 3ZXZA 2AYPA 3PXFA 1WBVA 3KU2A 1O6YA 1VR2A 3BBTB 4PL3A 4BKJA 4CRSA 2VTHA 5E92A 3DQWA 3DDPA 3PJ1A 4EK5A 2O64A 4C3PA 4USEA 4G31A 2ZV2A 3MV5A 5A4TA 5IA3A 2R3NA 2ZDUA 4KAOA 4D2SA 2F7ZE 4DBNA 4U40A 4R78A 5HI2A 4U3YA 2W9FB 1UU8A 2FSLX 1U46A 4RX9A 4XG2A 5CI7A 4BFMA 3OCGA 3UC3A 4EC9A 4QPMA 3GU6A 4EUUA 4FEXA 1H4LA 1ZXEA 3QA0A 5E7RA 4BYIA 5CASA 4FNXA 4AE6A 1VYWA 1V0OA 4U97A 3LCDA 2C5YA 3FI4A 2BAKA 3DB6A 4MAOA 1ZYLA 2ACXA 4M67A 1OIRA 3LQ8A 4CEGA 4N57A 4ZLZA 2WPAA 5AJQA 2QU6A 4LG4A 4C36A 2DYLA 5AAEA 1ZOHA 2B9IA 3QKKA 4RVLA 5CYIA 3VS3A 4JVGA 2R64A 4D9UA 3R30A 4RIYA 5K0KA 1BKXA 4AGDA 3DB8A 3MWUA 3P4KA 4C62A 1XH9A 5T6KA 3ITZA 4NL0A 4D0WA 5KHXA 4LYNA 4I6BA 3REPA 1PXKA 4UALA 1MUOA 4OT5A 2VNWA 4UV0A 4Y95A 3IW5A 4HGSA 2IZRA 3FZTA 3V8SA 4QP9A 2EXEA 4RQKA 3VO3A 5CAVA 2EVAA 4BDJA 3QCXA 5DWRA 3SD0A 4PTCA 3QFVA 5CVFA 5D11A 4EOSA 2C5OA 2J6MA 4FV6A 4MKCA 1IA9A 5FG8A 3CPCA 3W16A 3I6WA 2R3LA 3FZPA 4XHKB 3CCNA 3IGOA 1GIHA 2H8HA 3PJ2A 2YAKA 3RAIA 3C9WA 2QO7A 3EZVA 3HV5A 4FSNA 4KNBA 3QXOA 3QX2A 2YEXA 1SVGA 4F6SA 4E5BA 2PMNX 2C0IA 3IG7A 4PP7A 4K33A 3TKIA 2PHKA 3E7VA 5CX9A 4FV1A 1I09A 1DAYA 4S2ZA 4GH2A 4AG8A 1DI8A 3KFAA 2FUMA 3QQHA 4LUEA 2PZ5A 4WD5A 3HV4A 4RLKA 4UX9A 4RC4A 4A4LA 1Y8GA 5ANKA 5E1SA 3VBVA 4LMNA 4C35A 3Q96A 5F4NA 2UZTA 2C1AA 3P7BA 4J99A 3D5WA 3OOMA 4G3DA 3U6JA 4ITHA 3E63A 4FSWA 3HMPA 3VS5A 3ZUVA 1Z57A 3DK3A 5CXHA 1CKIA 3NNWA 4YGAA 4E6QA 2BHEA 3SC1A 3MA6A 1YI4A 3ZDIA 2PE1A 2GS7A 2XNNA 4BL1A 4P4CA 3RKBA 5IISA 5BYZA 4D9TA 4RMZA 2J7TA 1KE9A 5F20A 2P0CA 1FMKA 5KBRA 5HCXA 3CPBA 3PP1A 4L53A 4YHJA 2C5VA 2C0TA 2QOHA 3QUEA 3SKCA 4P5ZA 4IJ9A 3RAWA 4IC7A 3V3VA 3G0EA 1IEPA 2XF0A 3FMNA 5DRDA 5E8VA 2HZ0A 3EN4A 4KWPA 3UOLA 3ZBXA 4UMPA 2RG5A 2ITWA 3WZDA 4D2VA 1WBWA 3CR0A 5ANEA 3SW4A 3SW7A 4F6WA 4FKJA 4GK2A 1WVWA 3PPZA 5EHOA 2WTCA 3T8OA 5ETAA 4YZMA 3KC3A 3LJ1A 5HIBA 1WAKA 2XCHA 4I6HA 4QO9A 4TYEA 4UMTA 4YO4A 3PJ3A 4D2WA 2AUHA 2H6DA 2VTJA 3KA0A 3CSVA 2HWOA 2J50A 4QPAA 2IW6A 3H30A 4RZVA 4YZBA 1R78A 4FMQA 3COHA 3WIKA 1GZOA 4X2GA 4U80A 3FWQA 1ZZ2A 3VBXA 3QAME 4PF4A 1XH6A 3KCKA 3V5TA 1NVQA 4RIOA 4FKOA 4UMQA 1OKVA 3ZO3A 3S00A 4E1ZA 2YN8A 3WF9A 3R02A 4TRLA 1IRKA 2JDVA 2F57A 4JR3A 4OLIA 4PY1A 3VHEA 1XBAA 5BUEA 4BKYA 3CY3A 4V04A 5H8EA 4AFJA 4BI1A 5CI6A 3C1XA 3BV2A 3PSDA 3K5VA 4FZ6A 5JQ8A 5GZAA 4XV3A 3TDVA 2BDWA 4OTFA 5DR9A 3HMOA 2UW3A 2OXYA 2CCHA 3LAUA 1PMEA 1R1WA 5GIPE 4B8LA 4DGNA 4JBQA 3ZU7A 4F9AA 3UIBA 4ACDA 4E7WA 3HL7A 1J3HA 3R1NA 5AUZA 1M7NA 4OAUC 4IHPA 3VS1A 1XBBA 5HZNA 4DFXE 5IQDA 3UQFA 3A7JA 2J5FA 4KA3A 4BCPA 2HIWA 5HNIX 4WHZA 5K5NA 5E9EA 4D28A 2FYSA 4DT9A 3ULZA 2YM7A 5J5TA 3Q5ZA 3OEFX 4S32A 3ZM4A 3KULB 4ZOGA 4IAAA 3I0QA 3HV7A 2X1NA 2GFCA 5HEZA 4QMNA 2UW6A 1TQMA 3WF6A 4C61A 5CEKA 4WNPA 1M2PA 3R9DA 5JMSA 2FSOX 4FV8A 3BZ3A 2BROA 4R8QA 5CENA 4ALVA 3G90X 3Q9XA 4NM0A 3OY1A 4R3PA 3SG8A 3W2QA 3ATSA 3ZSHA 3LXPA 2R3KA 2OIBA 2IZUA 4TWOA 3PJ8A 4BBEA 4C2VA 4AW5A 2OICA 4E3CA 1RDQE 5DFPA 2OIQA 4MTAA 4TN6A 4FA2A 4A7CA 5E1EA 3E88A 4ORKA 3U51A 4X2NA 5HBJA 5LWNA 3BHTA 3PXKA 4HCTA 3I7CA 3RJCA 3BYVA 5HLNA 5E4HA 2H96A 2J0IA 3GU8A 4ZAUA 4UZHA 4IB1A 4YJVA 2B55A 3ID6C 3EWHA 3QBNA 4EOLA 3TT0A 4EQCA 1P2AA 3UBDA 3KF4A 5B0XA 4FG7A 5CSWA 4EYJA 3FI2A 1DM2A 3FQHA 5AAFA 5DVRA 5BVOA 3POZA 4HZRA 3Q4CA 3SX9A 3LFBA 5JGDA 3ZUUA 4I0TA 5JH6A 3KN6A 4DTAA 3MJ2A 5C9CA 4GUEA 2PYWA 4OBOA 4PMMA 4V0GB 2R3RA 4GG7A 2XBJA 3FYJX 3HA8A 4U43A 1S9JA 1YXVA 2I0HA 2XK7A 3ACJA 3PG1A 4IAKA 4JX3A 3WF5A 3IOPA 4CMOA 1O6KA 1X8BA 5CAQA 3NYNA 4JBVA 5IQHA 3UG1A 3WE8A 1NA7A 2I0VA 4KRCA 2A27A 2GQSA 5A9UA 5BUIA 3KMMA 3NUPA 5M44A 4EK8A 3ZZWA 1Q5KA 4FYOA 2UW7A 5JGBA 1YXSA 2X7GA 2ITXA 3ENMA 5ANOA 2IO6A 4GIHA 4M15A 4HVDA 1Y6AA 4BTFA 2OG8A 2F4JA 3H9FA 2V0DA 3NUNA 1OITA 5CF4A 1WBOA 2VTRA 3B8RA 3HDMA 3MB7A 3VRZA 4L7FA 4BI0A 4DEEA 4QP2A 2F9GA 2RFDA 3OCBA 4M68A 2RIOA 1CDKA 3EQGA 2E9PA 4DCEA 4I4EA 3KGAA 5AP2A 1SMHA 2XMYA 3MFTA 4IVDA 4UEUA 4AW1A 5I9XA 5ETIA 5B2MA 4BCFA 3H10A 4D55A 2CCIA 1KUTA 3DZQA 2YLFA 2QLQA 4TTHB 3T9IA 5DH3A 3G9NA 3VBQA 1H1QA 3NVKI 1H00A 5EHYA 3NSZA 4FT9A 4P7EA 5JEBA 3R0TA 1OBGA 1PKDA 4NM7A 2YIYA 3QU0A 5FP6A 1JWHA 5CEOA 5E8UA 1NY3A 2WTDA 4YLJA 5CU3A 4A4XA 5DT0A 4XG4A 3CGOA 2BUJA 1E1XA 2C3KA 3MI9A 3RWPA 3U8WA 4I0SA 5BUJA 1J7LA 1Q8TA 3K3JA 2VX0A 2IZSA 4BI2A 4CZUA 3DBEA 1WMKA 1H0VA 2B4SB 4WUNA 3O17A 4FOBA 2O0UA 3C13A 4KKEA 4UYAA 5E8SA 1Y6BA 1BUHA 1XH7A 3NYVA 2WMAA 2X8IA 4YTFA 2JIIA 2ONLA 4GL9A 3I5NA 5J1WA 4IVBA 5EOBA 2QC6A 2OFUA 2Y6MA 4H58A 3TN8A 4E26A 3Q04A 4DGLC 4XUFA 1FGKA 1QPJA 1JVPP 3ZLWA 5KMOA 1OPLA 3DGKA 2OZAB 3ETAA 3HV6A 5AP3A 5FEDA 2IW9A 2PE2A 2LAVA 2I0YA 3VRYA 3AT3A 3EQCA 4ZSGA 2QR7A 1U4DA 3UNKA 3TG1A 3JR1A 4DBXA 5I3OA 3FXWA 4RPVA 5JKGA 3FPMA 3MY0A 3VW8A 3PA3A 4G3GA 2Z02A 3GC9A 4F9YA 5EYDA 2R3PA 3BU3A 2X6EA 4TYGA 5FGKA 3BLRA 5L8JA 2BVAA 3LJ0A 5C01A 2YWPA 4IZ5A 3E7OA 5ANIA 2HY81 2ITPA 2HOGA 4U81A 4C2WA 3FDNA 4L46A 4XP2A 4D58A 5J79A 4C4IA 4U3ZA 4RBLA 3QHWA 3ZFXA 3ZTXA 2O5KA 4MQ1A 2R0UA 5CVHA 2OJ9A 5FBOA 5I5ZA 1LR4A 4HYIA 3S2PA 3R8UA 3ORKA 4CNHA 4FKIA 4Z9LA 3FKLA 4UBAA 2WO6A 3O0GA 2ZB0A 3NS9A 2HZIA 2F7EE 1Q8YA 2VTMA 3D83A 2R3FA 3Q6WA 2F49A 3EH9A 3QD0A 4FV9A 2C47A 4O0RA 3R8LA 2A1AB 4YU2A 4QMMA 3TJDA 3UDBA 5EKNA 3V5JA 4PWNA 4XOYA 5AAGA 1GZ8A 1FQ1B 4FT3A 3ZFMA 5IQCA 2BPMA 4YURA 3ORPA 3PRIA 4ZSAA 2WTWA 1K2PA 2YIXA 4IC8A 4YZCA 4ZLYA 5CALA 3NGAA 2EXMA 3DKOA 4K1BA 4QMWA 3RNIA 3WYXA 4AZFA 3CEKA 4PMPA 5C1QB 3CIKA 4AZTA 1YDTE 2XP2A 3QF9A 3CXWA 4HOKA 3R8PA 4BVUA 4O0WA 1ZYSA 3TDWA 1QMZA 3SRVA 4BHNA 3FLWA 2GNLA 4G2FA 5AX9A 4FI1A 4ANOA 4NCTA 3RK5A 3DPKA 3T3UA 1A48A 2OFVA 3WARA 5FD2A 1PJKA 2R9SA 3GCVA 1M2QA 1ZOEA 4J7BA 2UZNA 1PYEA 2OJFE 2G01A 3NW6A 2FA2A 4NIFA 4RFZA 2C3LA 5E90A 4AZSA 2ITYA 4BCOA 4HVSA 4QYFA 5DA3A 4ZSJA 2XA4A 3KY2A 2XZSA 4U41A 5HE2A 4QYYA 4L44A 4QT1A 5GJGA 4YC6A 3NNUA 5BMSA 4XG8A 2XB7A 2W1GA 5CY3A 2YM6A 1L8TA 3F6XA 3GU7A 5DEYA 4RIXB 2CMWA 2VNYA 1UNHA 3D14A 3PSBA 5GINE 4D4RA 3IDPA 5EW8A 1IAJA 3NUXA 3RPOA 4FKLA 4IE9A 4M69B 5EG3A 4GKHA 4NFMA 1RJBA 4QNAA 3HZTA 4Z16A 4RC2A 4EHGA 2ZM3A 4G5PA 3UJGA 3ZYAA 2JBOA 3EJ1A 2X9FA 2HYYA 1OVEA 2EU9A 3QWKA 3R7GA 4I23A 4KIKB 1B38A 3BQRA 4YBKA 4CKRA 5M09A 5AR3A 4XS2A 4D1SA 4TYJA 4QMZA 4R7HA 4K2RA 3P7CA 4N6ZA 4ZY6A 5EKOA 4YJTA 3TV4A 4O0VA 3SHEA 1LUFA 4FG8A 1V0PA 2ITVA 1G8AA 4H39A 4FSTA 2Q0NA 4E93A 4HVGA 4YPSA 2YM3A 5H8BA 4QMUA 3R8VA 3ROYA 4C57A 4EUTA 2PY3A 4FVRA 4GIIA 3QQUA 2ZM1A 2Z2WA 3VUGA 3ALOA 4FKGA 4RG0A 4AAAA 3NDMA 2GHLA 5A6OA 3TNPC 2QOFA 4FTKA 3LZBA 2A0CX 2JD5A 1H1SA 4A9TA 4F4PA 5BX0A 4O6LA 2Y7JA 3RZBA 4UMUA 1PXJA 2IVVA 3MH2A 4ZEGA 5A46A 5ANDA 3EYHA 4B7TA 4U5JA 2C6LA 3ENHA 3PPJA 3R1SA 1OPJA 3MY1A 2ESMA 5I0BA 2UZLA 4DT8A 2WEIA 1KV1A 3TJCA 2X4ZA 4LGDA 4TKSA 4WOVA 1DI9A 1JSVA 3BCEA 5G1XA 4O7NA 2Z7SA 3FLZA 3HRFA 5HE0A 4LL5A 3JVSA 4DITA 3I7BA 3BWFA 2OK1A 2BMCA 3DK7A 3UIMA 2WQMA 1W7HA 5AP0A 3CD3A 2PVKA 4JR7A 3TIYA 2P2HA 4UWYA 2PVFA
chains in the Genus database with same CATH superfamily
1UKHA 4QTEA 3C4WA 2WU6A 4HPUE 3RGFA 3F9NA 4L67A 5IH4A 4O6EA 4GJ2A 4GEOA 5J8IA 1G8SA 1XHAA 4FOCA 3C0GA 3I60A 4MXZA 1OL5A 2GMXA 4DEBA 1ZZLA 2W9ZB 4BZOA 2BILB 3VIDA 2QO2A 4F0FA 3MIYA 5TOZA 2CGWA 2WMQA 3PVWA 5CSPA 4FV0A 2JEDA 2X4FA 3FE3A 2PVRA 3FLSA 1F5QA 3UVQA 2YDKA 4H05A 3QRUA 5C4LA 4O91A 2ZJWA 4L3LA 3F66A 4FVPA 4L00A 4JG6A 3VJOA 3BKBA 1OECA 3H0YA 3DFCB 3OT3A 1FGIA 4IM2A 1WBSA 3E8EA 3AXWA 5IQIA 2YCSA 1YOLA 2IVSA 2P33A 3R00A 4RX8A 4D2TA 4DFYA 4BCQA 2H9VA 4X2FA 1Z5MA 4O0UA 4OBPA 5IZFA 3AMBA 2XEZA 4FGRA 4YJQA 5EQPA 5IDPA 5JFWA 2PVJA 5HD7A 4D5KA 2HY0A 3AC8A 4IIRA 2RF9A 3GCPA 4MF1A 4RWKA 3BHYA 4X3FB 4FKSA 4IEBA 2EXCX 4H1JA 5T3QA 3R9HA 4CFWA 5CEMA 3O8PA 4IX4A 3QHRA 3FZSA 2UZBA 4F1MA 2XEYA 2X2KA 3L8XA 3RCDA 4MYGA 4BIEA 2W1EA 5IA4A 4HGEA 3ZLXA 3HKOA 4WIHA 4NWMA 2Z60A 3O7LD 4F9CA 1FOTA 2PMLX 3R22A 4GG5A 3LLAA 3GP0A 4O82A 2QVSE 3A7FA 4YZ9A 4AN2A 4BCJA 3VVHA 2BR1A 3LIJA 4FG9A 3LFAA 3LXLA 4DINA 1H1RA 3W33A 4EH8A 4QP8A 3VC4A 5BV3A 1E9HA 3MPMA 4UYNA 5E8ZA 3TKHA 3KRLA 4I41A 1BMKA 2X7FA 4CFMA 4YNEA 4PNIA 5EYMA 3HA6A 3C4ZA 5CZHA 3NNVA 2OWBA 4OT6A 2AC3A 4LQMA 3OCSA 4FSZA 4FZ7A 3R2YA 3R7IA 3TI1A 3FL5A 3D5UA 3W0MA 3EIDA 2WFYA 5HLWA 5LVNA 3UE4A 4FNYA 1YHWA 1S9IA 4AQCA 4EZ7A 1REJA 5FLFA 3ZEWA 5JN2A 3FC2A 4DHZA 1H27A 4AQKA 2WMWA 3L9MA 4ALWA 5HBHA 2IN6A 2X0OA 2J0MB 2OXDA 3CJFA 4NW6A 5CZIA 2VN9A 3DLSA 4L43A 4MNFA 3FMMA 4QMVA 4AN9A 3E8CA 4YP8A 3QALE 4BN1A 4JMQA 1H1PA 2XIRA 1SNUA 4RVMA 4ZLOA 1BX6A 3Q5IA 3GENA 4IZYA 4KKGA 5IKWA 4I22A 3R73A 4AP7A 1H07A 4AWIA 4C34A 4DFLA 4G3CA 2VWYA 4GYGA 3VUHA 3AKJA 1YOJA 2CHLA 5DOSA 4HYHA 3DXQA 4KABA 2VUWA 3DDQA 4WKQA 4JDKA 4JQ7A 4X7QA 3DJ7A 3AT4A 4B9DA 4DG2E 3UP2A 3EQFA 4EL9A 4FV3A 4FTJA 4ERWA 3VJNA 4EH4A 4N70A 5LMKC 2RG6A 4X3FC 4CGAA 2UW0A 2KULA 2R3OA 4MWIA 5M56A 3JY9A 4JJRA 3EQRA 3KVWA 4L6QA 4ZSLA 4LM5A 3MVHA 5KX8A 1A06A 4X0MA 4C7TA 1OGYA 4RGJA 4O7YA 4FICA 2HXLA 4F99A 2P2IA 1W98A 2IVTA 3FC1X 3GQLA 2A2AA 3MH3A 3RK7A 3UNZA 1J7IA 3COMA 3F5UA 5DNRA 2C6OA 4RWJA 4YHTA 4ITIA 5A14A 4FZFB 2DS1A 3KXHA 3D7TB 1HCLA 3GB2A 1W8CA 3IO7A 4A9SA 4DHJA 1YW2A 5EW9A 4ZK5A 4E73A 3BU5A 1SVHA 4N0SA 3HYHA 4F9WA 3EQBA 4YNOA 3QYWA 4C37A 1ZYCA 3C0HA 4FODA 5HU3A 3DTCA 2GNFA 1FVRA 4TNBA 3RNYA 3FHIA 3TV6A 1JKSA 2QOLA 3QUDA 3IW6A 4XCUA 3DAJA 4CFUA 1M7QA 2ZV7A 2JLDA 3L8SA 2XYUA 1Q97A 2XK4A 3C0IA 3PY1A 1CTPE 3MW1A 2WEVA 1QCFA 3EN7A 4GT3A 4OTDA 2XAMA 3N51A 2QONA 2OZOA 3FMJA 3GCUA 4YJUA 4Z55A 2W5BA 4K6ZA 3OG7A 4V0GA 2BALA 3FY2A 4AT3A 4I5CA 2X2MA 3BHHA 1MRVA 4DEHA 3O7LB 1YQJA 4MXAA 1GIIA 5JT2A 4G17A 4YTIA 4L01A 2BHHA 2PVHA 3OWPA 5BVWA 4IVAA 3RM6A 4A4OA 1KE7A 4F70A 1ST4A 4S31A 3RPSA 2BIYA 3ORZA 4HW7A 1YRPA 1OKYA 4WSYA 3RPRA 3WE4A 3N4TA 2OGVA 1OKWA 3RZFA 4CVAA 5L2QA 4R3RA 5M08A 2FO0A 4BDAA 4YUQA 4EZ3A 1KWPA 4FL2A 2XK9A 5KZ0A 3NX8A 3F69A 3R1YA 5HTIA 2FGIA 4FGBA 5JQ5A 2CKPA 2XARA 1G3NA 4IXPA 5BVNA 1YXXA 5HLPA 2JAMA 3DV3A 4APPA 5C8KA 1Y8YA 3GC0A 5DT4A 3SVVA 1UVRA 4BTJA 3WZKA 4MD9E 4A07A 2LGCA 4AUAA 2CLQA 4YSMA 4EK3A 4MCVA 3DXPA 4ACMA 2YJSA 4ITJA 1V0BA 4I24A 3PSCA 1KE5A 4R1VA 4O7RA 5EK7A 2OU7A 1RQQA 5TR6A 3VS7A 2ZB1A 4YO6A 3QLGA 1OIQA 3O8TA 2WQOA 3PE2A 2CNUA 3OP5A 2P3GX 2PTKA 4OAVB 3U54A 1XH8A 3DNEA 4FIHA 4XNEA 3UO6A 3NIEA 2G15A 2JKOA 2KTYA 4CV9A 1P5EA 2E9VA 4QTCA 1LPUA 4BGGA 2UW5A 5EDRA 4BYJA 3OY3A 4FV4A 4ENXA 1R3CA 2VWXA 2YABA 3QRJA 4W4WA 4CQGA 5M53A 5JFSA 3ATTA 5FEQA 3EN9A 4EH2A 4M8TA 3EFWA 3F3TA 3AGMA 2XKFA 3LLTA 3G5DA 3OBJA 5C27A 1ZMVA 2WIHA 2WKMA 2WTVA 3CKWA 4MNEB 3LMIA 4DE4A 4GFGA 4ZSEA 2BRHA 3OOGA 4QTDA 1FBNA 2YWVA 3JS2A 3GU5A 2XUUA 3GI3A 2GQGA 3IS5A 3QQGA 5AP5A 2VTPA 2P4IA 1FVTA 2OF2A 3KRRA 4Y83A 4UB7A 2UVYA 2RFEA 4BF2A 2ITNA 4EJNA 5AA9A 3IGGA 4JS8A 1URCA 4XP0A 3NVMB 5D7AA 1OL7A 5DGZA 3F2AA 2WQEA 4G6LA 4GU9A 4C4HA 4MBIA 3P5KA 5D12A 4EOQA 1YDSE 3GNIB 4QQTA 3ODYX 4DFUA 5HNBA 4TY1A 4BHZA 2A98A 4BICA 4AFEA 2Y8OA 2V5QA 1M52A 1ZMWA 5L2SA 3DBQA 4FTUA 5AA8A 3UVPA 3PIZA 3CC6A 3BBWA 4IX5A 5AR2A 4AW2A 5IQBA 1RW8A 4OUCA 4JIKA 3GBZA 2GHGA 3RBWA 4XOZA 1WFCA 3UOKA 2XCKA 2BKZA 3AC2A 4FT0A 3PZHA 1KE8A 4XH6A 2WTKB 1JOWB 4ALUA 4BGQA 4XBUA 3ORLA 2V62A 5IMEA 1Q24A 3V5QA 3UZTA 1VJYA 4BCKA 3KXZA 4M12A 4RVKA 1ND4A 5M4UA 3MPTA 2YCFA 2NPQA 1REKA 1KV2A 5GZ9A 5KZIA 4TPTA 2GS2A 3Q4UA 2OBJA 2B9FA 2UZEA 2W1HA 2YERA 4W4YA 5AFVA 4EORA 5AUVA 3VUKA 5AUTA 3F5XA 3O2MA 4D4SA 4OTRA 3UYSA 2VO3A 3DK6A 4IACA 1A9UA 1XKKA 2QI8A 2UW9A 3GOPA 4FTOA 4UXQA 1IAHA 4FSQA 3SDJA 3CQUA 3F7ZA 3EFKA 2RSVA 2FH9A 2VO0A 3VW6A 3LCTA 1JKLA 4M84A 2G2FA 2VTQA 1FINA 5KMIA 1QPCA 3U55A 4D2RA 3FMDA 3GCSA 3A4PA 5HO7A 3HDNA 4XG7A 4AZWA 4U42A 4IDTA 1P4OA 2HW6A 4MBJA 1XH4A 3TWJA 4IX6A 5BVDA 2H34A 4BKZA 1J91A 1NXKA 5FM2A 3S4QA 5AP4A 1WZYA 2O65A 2JKMA 2VWVA 4TWCA 4OBQA 5AR8A 4K11A 2GPHA 2PZIA 3PJCA 4EBVA 3NIZA 3CGFA 2VTNA 3MSSA 4NFNA 5TO8A 2FVDA 3UZPA 3VS0A 4IFCA 5E8WA 2UZWE 2VTTA 3HRBA 4O0SA 4KKHA 3AOXA 4RJ6A 4LDTA 5JFXA 4O0TA 2IEWA 4PPAA 4RA5A 2J0KA 4XG6A 4O7WA 2WD1A 3K2LA 3LQ5A 3MB6A 3MH1A 3NW5A 3DNDA 4AOJA 1VYZA 5HX8A 2Y4PA 5EM6A 4USFA 3BHVA 4RX5A 1CKPA 4ZZNA 3MESA 3I5ZA 3ZLSA 3Q52A 3RPYA 4M69A 3QKMA 3D4QA 2QURA 3ROCA 5HX6A 4AA5A 4PL5A 4U44A 4XLIA 3R7OA 4O0YA 2X8EA 1FPUA 3NUYA 4XRLA 3GT8A 3F5GA 4IADA 5JRQA 1K9AA 2HXQA 2OLCA 3BLAA 4WO5A 2QD9A 2QR8A 2ZAZA 3NCZA 5HG8A 5EDQA 4FKTA 5CXZA 1GNGA 1WBPA 3HNGA 4W4XA 3FI8A 3OBGA 3NEWA 5TF9A 4KIKA 3EL7A 3QTSA 4FKUA 1LEWA 3RAKA 3EKKA 4GUBA 3B2WA 4C58A 3OVVA 1YWVA 3W0RA 3NR9A 1YXTA 4HCUA 5CSXA 4E4LA 4CKJA 2Z7QA 3NUSA 3Q53A 3WF7A 3F2RA 3BX5A 4K18A 3WI6A 3OWJA 3ZUTA 2PZPA 5BNJA 1UKIA 4PP9A 5BYLA 2ZOQA 4JBOA 5IUHA 3MBLA 2C6EA 5CQWA 4ZXTA 2GSFA 2R3MA 5GZ8A 4L3JA 3A99A 3W55A 2BKKA 2J4ZA 2PSQA 5CEIA 1GAGA 1J1CA 4V05A 2QOCA 5M51A 3Q2JA 4GVJA 5HD4A 5HIDA 2R4BA 4EQUA 1APME 4YJSA 3Q9YA 3AC3A 4JX7A 3BGZA 2XALA 3TV7A 5BQ0A 4P90A 1BL6A 2XIKA 2XJ1A 3O50A 4BCHA 3VUTA 4C4GA 2Q0BA 4JRVA 2G2HA 1H25A 3GFWA 4X2JA 3LMHA 4NSTA 4RWIA 5FEEA 4MWHA 2YJRA 4RIYB 4UWCA 4W8EA 3QD3A 3OXTA 4DFNA 5J95A 3MN3A 4CTCA 5FTQA 2X81A 1GZNA 4FEWA 4MXOA 3KB7A 3LPBA 3G51A 2BRMA 1XWSA 4L45A 4K8AA 3HAMA 4PUZA 3NMUF 3ZC6A 3KRJA 4EONA 4P2KA 4EH3A 2F7XE 2XS0A 4OTPA 3FQSA 3VAPA 4MXXA 4Q5HA 3SXSA 4D5HA 2C5XA 3SXRA 3NRMA 1JKKA 4O0XA 5FXQA 4EEVA 4DH1A 3KREA 3Q9WA 5FP5A 4NK9A 5CQUA 5GIOE 2CGUA 2EB2A 4D1XA 5KO1A 4FUXA 4XLVA 5AM7A 2EB3A 4JAJA 3P78A 3VQUA 2CN5A 1YDRE 4NM5A 3DBCA 3QTRA 4CFFA 4R3CA 1W84A 2C6IA 2ZFYA 3MY5A 5BPYA 3SV0A 5L3AA 4AZEA 2VGOA 4C4FA 2JFLA 1U54A 3M2WA 4BBFA 3OUKA 2UZUE 3MVJA 4LMUA 2PVYA 4CYIA 4F7JA 5CU0A 1PF8A 4M0ZA 4HVIA 3N4UA 1HCKA 4TT7A 3QGWA 4H36A 2YZLA 2JDTA 4EWQA 5I9VA 4F0IA 2GNIA 2OIDA 3E3PA 1JKTA 3R7VA 3BYUA 3IOKA 4DAWA 5C26A 1QPEA 4PDPA 1XJDA 3VHKA 2XJ2A 1OIUA 4YC3A 1PMNA 2ERZE 2WB8A 5JFVA 1PW2A 2PUUA 2OW3A 2B7AA 2BFYA 4E5AX 3PE1A 5AV4A 3T3VA 2PPQA 2V22A 4D4YA 4QMOA 5IUIA 5C03A 1WVYA 2PL0A 4RWLA 4QYEA 3PVUA 2Z8CA 3QD4A 1M14A 4PPCA 3LCOA 4GRBA 3DLZA 3FXZA 2IW8A 4MVFA 1TFFA 4QP4A 4LV8A 2BTRA 2F2CB 4QTBA 5FQDC 3BYOA 3ANQA 4PDYA 5KMLA 1ATPE 1ZLTA 3FXXA 4FF8A 3VQHA 4ZY4A 5IMXA 4J96A 1ZWSA 3V8TA 1CKJA 5H3QA 3UGCA 4DH8A 1BL7A 3V51A 4RIWA 5B2LA 2HK5A 3R7YA 5J87A 1YXUA 2VWBA 3MGYA 2EUFB 4USDA 2J2IB 2WELA 2JC6A 3GOKA 4G1WA 4RFMA 4W9WA 3JVRA 3ZO2A 2C4GA 4AT4A 3UPZA 4O22A 3WF8A 5JZJA 1Q4LA 1Q41A 2XM9A 4Q5EA 3L9NA 4A9UA 3ORIA 3A7GA 4PL4A 1K3AA 3L1SA 2V7AA 4GYIA 2JKQA 4E5WA 3NWWA 2W1IA 3F2NA 1WBNA 2C69A 3HV3A 2QHMA 4PDOA 5HHWA 2C30A 4ZMFA 4R77A 2V55A 4J1RA 4BBMA 5LJJA 5CT0A 3C5UA 2RKUA 4FSRA 2G2IA 5EYKA 2QHNA 4Y85A 2BZIB 4I5PA 4QOXA 2BZHB 3V6SA 4F1TA 5IEXA 4IX3A 4B0GA 5LQFA 2G9XA 3W0NA 4JQ8A 2QKWB 3LFFA 4M66A 4H3BA 3R01A 3C5IA 1XH5A 3DAEA 4NU1A 4M7IA 1PXMA 3OUNB 5DE2A 2Z7RA 4RRVA 1XBCA 3COIA 3LHJA 4CCUA 4DEAA 4FEQA 4J8NA 3HRCA 3GQIA 3JY0A 3MFSA 4O4EA 4AXAA 3UDZA 1R0PA 1STCE 4NKAA 4CKIA 3OXZA 2VWUA 2XK3A 1T46A 1ZARA 1SNXA 2VO7A 5IA1A 3II5A 5AR5A 2CN8A 3CKXA 4ANQA 4PRJA 1UNLA 4ZZMA 2QOIA 4KRDA 2VD5A 3VUDA 2AC5A 1R39A 3W2RA 2PUNA 4B6LA 4EYMA 4F65A 4GW8A 3S0OA 4FV5A 3UNJA 2XKEA 1WVXA 1JQHA 1NVSA 4GMYA 3V8WA 4Q9ZA 3LCKA 4L52A 3QQKA 3KK8A 3K3IA 5B7VA 3OTVA 4JIAA 3W1FA 3L8VA 3A60A 4OTQA 4ZMEA 1YOMA 1JBPE 2W4KA 3TZ9A 4KS8A 5IQFA 4WNOA 4WA9A 4IWQA 4QTAA 2UVXA 2YFXA 3G33A 4B99A 4RLLA 4XEYA 1UNGA 3FKOA 4OGRA 3Q2MA 4U8ZA 4C3RA 4UMRA 3GVUA 3ZOSA 5I9YA 2VU3A 4EOJA 3SG9A 3OWKA 3UOHA 5A3XA 1CM8A 3RINA 3VUMA 4BGHA 4DHFA 3MIAA 2CSNA 2XIZA 5HNGA 4I0RA 3UQGA 5KMKA 2JDSA 3O8UA 3PY0A 4CTBA 2ZYBA 3ZFYA 1H0WA 2GFSA 3WIGA 4RJ3A 3ZRKA 2Z7LA 4R7IA 3KXMA 1URWA 4W8DA 1SVEA 4FYNA 4DH5A 2BRBA 3KMUA 4RSSA 2OH4A 2XNBA 2RL5A 3RI1A 3U4UA 3PVGA 1E1VA 2B52A 3EKNA 4EH7A 5FTGA 3AD5A 3U87A 4GFMA 4ZTNA 5M57A 1OL1A 4L8MA 3DZOA 3M11A 1Q8UA 3VF8A 4EI4A 2XH5A 3KK9A 4JG8A 5HO6A 3P23A 1P14A 2IJMA 3C4XA 4TYIA 3I4BA 3TZMA 4I6FA 3UMXA 2WMSA 4TZRA 4GS6A 5HTCA 5L8KA 2XNGA 3PDTA 4ANNA 3F3ZA 4G16A 5J9LA 2ZMCA 4YTHA 4O21A 5CANA 4BZNA 3ZSIA 4FL3A 2I0EA 3G6HA 2UW4A 4RX7A 2YLEA 4JDIA 4F64A 4QQ5A 2OKRA 3NAXA 4RZWA 5F1ZA 3THBA 4CFXA 1OI9A 5D9HA 3PRFA 3UOJA 4BIBA 5A4LA 4FZAB 4O2PA 4TYHB 2ERKA 5L8LA 3RALA 1Q8ZA 4CD0A 5AEPA 5LOHA 4C33A 3OF0A 2GTMA 3S3IA 4PX6A 5FWKK 3UO4A 2ZMDA 2XNMA 4RJ4A 3R1QA 5CF8A 1EH4A 3ELJA 3FSFA 3SLSA 4JQEA 5HKMA 5FBNC 1BYGA 1PY5A 3CE3A 4H1MA 4M97A 4AA0A 5F9EA 5CU2A 4I1ZA 2WZJA 4DFBA 3EZRA 3FLNC 3S95A 3HVCA 4IW0A 4C4JA 2YIRA 4FEVA 4IM0A 2X0PA 4EJ7A 3LFEA 2R7IA 4E4MA 3JYAA 4FTRA 4NT4A 3SA0A 3A61A 5IH5A 3TM0A 4FKQA 4IB3A 4QNYA 4ASXA 4PMSA 3KN5A 5BVEA 5LVMA 3BELA 5LVPA 3BHUA 1M17A 3BE9A 3EL8A 4Z3VA 3VONA 3A2CA 5M4IA 5HE3A 4CMTA 2XNPA 4XV1A 4IAIA 5JZNA 2HCKA 5ETCA 5J7HA 4XYFA 4ZS4A 5IA2A 1AGWA 5DT3A 2WOTA 2WAJA 4MH7A 4BJJB 3KRXA 3ZDUA 3TUDA 2W1ZA 3DXNA 4E6CA 3I81A 3WBLA 4LGGA 5HICA 1Q3WA 2UV2A 3CS9A 1JNKA 1UU9A 2BRGA 2HZ4A 1H24A 1OUKA 3RTPA 2W96B 3I0OA 1UWHA 3NUAA 3LE6A 4ASEA 4ZIMA 4CFVA 3SOCA 2QLUA 5IEVA 3E5AA 3L9LA 3CLYA 4F0GA 5EM7A 4H3QA 4IFGA 1RE8A 4I94A 5HE1A 1TQIA 4M0YA 1JSTA 4BWKA 4JL9A 4FTQA 4DG3E 2IG7A 4CYJA 4O7VA 1UV5A 3IONA 4GJ3A 4BDCA 4CSVA 3SXFA 4E4XA 2VWZA 2GNJA 1G5SA 3G2FA 4BDIA 3D15A 3RVGA 3O51A 3AKKA 3G15A 3EMGA 4PQNA 3LFCA 5CNNA 4QMSA 5AR4A 5K0XA 5FM3A 3O5AA 1H26A 5AADA 2WTIA 4IM3A 4X2KA 2C68A 2FB8A 3F3WA 4AU8A 3OHTA 4F9BA 3P7AA 3R8MA 4NEUA 3AG9A 4TL0A 3C4EA 4QMLA 4KIPA 1ZYDA 2OF4A 2QG7A 4EHZA 5HVJA 3FMKA 4G3FA 1WCCA 3BYMA 2JITA 1J7UA 4FTTA 2XANA 3FZRA 4QP6A 3UO5A 3ZC5A 2YITA 5L2WA 3EB0A 1Q62A 1PMVA 2O63A 3D2IA 3RWQA 1YWRA 2PVMA 4MD7E 1Q3DA 4OTHA 3U9NA 3V5PA 4ANLA 5KKRB 4AXDA 3LXKA 2WMVA 4V01A 2CDZA 4RJ7A 3TL8A 3ZRLA 3ODZX 4IDVA 4ZTQA 2X2LA 2YDIA 4J52A 5EI2A 3GXLA 3QGYA 5H8GA 4C4EA 4CXAA 5CF5A 2CLXA 3NW7A 4YR8A 5K5XA 3EQHA 3U6HA 4MK0A 3OW4A 3WILA 4C3FA 1J1BA 1KSWA 1PXNA 3DU8A 1PXLA 4NZWB 3FY0A 4FVQA 1OUYA 3HEGA 4IB0A 4MF0A 4WRGA 4BDGA 2R7BA 3IW7A 3KULA 3KQ7A 2CGVA 1GOLA 4FSUA 4AGCA 3R6XA 3ZLYA 3CBLA 4YSJA 4NIFB 2ONLC 3EQDA 2ITZA 4J95A 2XKDA 5IF1A 2JKKA 3PZEA 4XV2A 3OZ6A 5DR2A 5FUTA 3TKUA 5CNOA 3VF9A 2I1MA 3H0ZA 4AW0A 3UDTA 3KRWA 4RC3A 3UVRA 5FDPA 2B53A 5HORA 3M1SA 3M42A 5LARA 2QQ7A 5CS6A 3ZONA 2R3HA 3TUCA 5HU9A 1UU7A 3EN5A 4MQ2A 4Y5HA 3TIZA 2E9UA 3NZ0A 3HECA 5AUYA 3RK9A 4CZTA 1OKZA 4FV7A 3F82A 4CT1A 4LOQA 4ASZA 4YJNA 2WMXA 3TNIA 4WNKA 3CD8A 1ZY5A 3DQXA 1YI3A 2GS6A 3OS3A 3EQIA 4R7BA 4FTLA 4NYEA 3ET7A 4C8BA 1SM2A 1NVRA 3ERKA 2ITOA 3LFDA 2WXVA 4FNZA 5A6NA 5L2IA 4FIEA 3QQFA 1Y91A 5AV3A 4ACCA 3QTQA 3WYYA 3IECA 2W4JA 3CTQA 2PVLA 3EFLA 3UIUA 4O7TA 4IWDA 2VGPA 4YTCA 4YPDA 3C4FA 3A8XA 3F3VA 3NYXA 1IR3A 3BIZA 3FSKA 3HUCA 4KSPA 5AIRA 1AQ1A 3OEZA 1QPDA 3D0EA 1G8KA 5IG1A 2OJJA 4PMTA 4DLIA 5J7BA 3NLBA 1KOAA 2VWWA 2CKOA 1XMMA 4L7SA 5EM5A 5HCZA 1Z9XA 3KMWA 5HGIA 2PVNA 4EBWA 2YAAA 4XX9A 4EH9A 4F63A 5LXMA 5KBQA 4OW8A 2V7OA 5IDNA 3DA6A 3L8PA 5KKRC 3HMMA 3R2BA 4AGUA 3QC9A 4XG9A 4E6DA 5FXRA 2QG5A 2X39A 5GJFA 3AD4A 5HIEA 4QYHA 4I3ZA 4HNFA 5ANJA 1KOBA 3PG3A 4L3PA 3EN6A 3V5WA 3R9OA 3ORMA 2VTOA 2OO8X 5K9IA 3PIXA 4ZJIA 3WZJA 3OD6X 4LFIA 3IDCA 4NCTC 5DRBA 3QA8A 2W0JA 4I4FA 1WBTA 4KSQA 2X8DA 5F94A 5FRIA 3ZH8A 5IU2A 4DEGA 4KBAA 2YIWA 3OFMA 2PU8A 3F7WA 4GK3A 4RJ5A 4RQVA 2JBPA 5EFQA 5HBEA 3BLHA 1O9UA 2C6KA 2VX3A 3DKFA 3FL4A 4FTIA 3P08A 4GFOA 3V5LA 3LFSA 3LFQA 3AMYA 3PY3A 4XBRA 1V1KA 1Q61A 2WMTA 1M2RA 5L6PA 1OPKA 1OBDA 3A4OX 3NCGA 3SOAA 5E8YA 1AD5A 4JI9A 5AV1A 3KXXA 4F08A 3KXNA 4EKKA 2VWIA 2NRYA 5DEWA 4CG9A 2B0QA 4KBKA 3K54A 3UP7A 5J9ZA 3W2OA 1I44A 5KUPA 5EQEA 2YHVA 5CAPA 4QP7A 4W4VA 2ETKA 4YJOA 3ZBFA 3OMVA 5DI1A 4M3QA 4E8AA 3AC4A 5DPVA 2GNGA 2JDRA 1PRYA 3DOGA 5ETFA 2C3JA 3VS2A 5JK3A 3GC8A 4FTNA 4S33A 4EK6A 4IJPA 4G6OA 2GQRA 4HVHA 2C0OA 2XK6A 4FX3A 4QMPA 3FQEA 3UTOA 2OZAA 2QO9A 2C6DA 5GNKA 4DEIA 5DLSA 3AMAA 5HOAA 3ZHPC 3LQ3A 1H01A 1BI8A 3D5XA 2R3JA 5EDPA 2BDFA 1VLRA 4GK4A 3EQPA 4Z7HA 3QZFA 2EWAA 3ZO1A 1ZOGA 3Q4TA 3ZSGA 5L4QA 2NYAA 2CNQA 2NNWB 2W06A 4O4FA 5DR6A 1H28A 1TVOA 1YHSA 2BFXA 3OW3A 3NAYA 2BRNA 3E8NA 3Q6UA 2QCSA 3A7HA 4UXLA 2YM8A 3DJ5A 4GT4A 4B4LA 2JGZA 4E4NA 1MRYA 1PYXA 3PA4A 5EI8A 4ARKA 4JLCA 4TNDA 3VS4A 1FVVA 3FI3A 3JUHA 1W82A 2X0GA 3PIYA 4UZDA 1HOWA 3VNTA 2XAOA 5HG9A 4G5JA 3TACA 3ZRMA 4F7LA 3CQEA 3JPVA 4OR5A 5LMAA 1JSUA 1U59A 4DA5A 5JGAA 4FTAA 4CRLA 2B54A 3OWLA 3FZ1A 2XNEA 1B6CB 3MS9A 4FKWA 4BDDA 3PLSA 2X7OA 3H9OA 2PWLA 4O4BB 4GV1A 2PK9A 4FJVA 4IAFA 4PPBA 2OSCA 2WMRA 3NPCA 4EHVA 4BTKA 2XK8A 5CTPA 3BL9A 5CEPA 4Y73A 4O38A 4LI5A 3R9NA 3IW8A 2W5AA 3MJ1A 3WOWA 2ITQA 2X9EA 4DEDA 3R9RA 5BVFA 5D1JA 2XYNA 1P4FA 5AP7A 3QQJA 5CF6A 3EHAA 1XQZA 2YM4A 3ZCLA 5E8XA 4EQMA 4JBPA 5M06A 2WU7A 4G6NA 4GVAA 3H3CA 3KVXA 2UZVA 4QD6A 3PXQA 3RAHA 2CJMA 2R0IA 4B8MA 2QOKA 2BZKB 3QD2B 3LM5A 4QQJA 3C4CA 1FMOE 3AC1A 5IPJA 5L2TA 3QL8A 2A19B 5LCJA 1H1WA 3E62A 3QRKA 4ID7A 4Z7GA 5TT7A 4KBCA 2IVUA 3CY2A 4BCMA 4WBBB 3QQLA 2WMUA 3HMIA 3PYYA 3R7EA 4GT5A 3P0MA 5H9BA 3O23A 3MH0A 5BYYA 4I93A 4JAIA