5HO7A

Discovery of novel 7-azaindoles as pdk1 inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
289
structure length
280
Chain Sequence
b'PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of novel 7-azaindoles as PDK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 280
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ho7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ho7A01
4KBKA 3P08A 5BVWA 2PE2A 2XK8A 5EHLA 1W84A 4RSSA 2QO2A 3IPHA 3IO7A 5K4IA 4XOZA 4FTLA 4EORA 2UW3A 4FIGA 5LVLA 2I0YA 3GC7A 5CSVA 3ZO1A 3DU8A 5EQYA 3ZONA 4FSTA 3TWJA 2V5QA 3KXZA 2B1PA 5HTCA 3KRXA 3FZPA 1WVYA 3QRKA 2H34A 3QX2A 2JLDA 4PTEA 4ANLA 3NYNA 4AGWA 3G2FA 2Z7SA 4RVMA 1WFCA 4CGAA 5L6PA 4BDBA 3L9MA 1PRYA 2RFNA 2OI4X 2R9SA 4HGEA 3IK3A 3FSKA 3HV3A 4G5JA 4J98A 5DHJA 5HNIX 2BZJA 2BHHA 3PFQA 1GZOA 3ZYAA 4LI5A 4QMNA 4QMSA 4EZ7A 3OCBA 5GINE 1JPAA 3QKKA 3A7JA 4XRLA 2G2HA 3VUIA 5LVPA 3IQ7A 3R9OA 2C1AA 2V7AA 3Q60A 3NNVA 4ITJA 4HZRA 3MV5A 4RA5A 3I7CA 4XUFA 5AUWA 2IVVA 4Y8DA 4S34A 4AW2A 3DAEA 3C4EA 4UXLA 4W4WA 4YLKA 3UNJA 1YXTA 2P2IA 5HVJA 2XEZA 3ZSIA 1ND4A 4XG2A 4FTJA 3TZ8A 4ZSGA 3QL8A 3QZIA 2VWYA 1B6CB 1F5QA 3W55A 5KMOA 5C4KA 4CTCA 4BKJA 2YACA 4DYMA 5CEOA 5K0XA 3UMWA 2R5TA 4FT9A 4L3LA 5HESA 4PP7A 3FI8A 4RX5A 3QWKA 4KB8A 5IQAA 3F5UA 1HCKA 5IU2A 2ERKA 2XNPA 5LMKA 2XEYA 3NGAA 4IQ6A 2RG6A 5HU9A 2VTIA 4CRLA 4ZMFA 4YNOA 2C1BA 4L00A 4RJ7A 4W9WA 5EYKA 3I1AA 4U44A 4V0GB 3CSVA 2VGPA 4H39A 1WAKA 3NCGA 1LR4A 4FTMA 4WO5A 2GS6A 2OSCA 4XG3A 3VJOA 5KMLA 2VTHA 1NW1A 3TV6A 2OIQA 4IZAA 4O7VA 3I81A 3PJ3A 4EZ3A 4R7HA 5A4LA 3NSZA 4IX3A 3PXZA 4MD8E 2PZPA 3TXOA 3GU8A 4DGNA 3A7GA 3A4PA 3T9TA 4E26A 4EUTA 1OIUA 4HJOA 3P7BA 3QBNA 4EOPA 2EXCX 5LVNA 3PLAE 4O2PA 4I4EA 4X2FA 2FUMA 2BUJA 1OZ1A 5B0XA 2QKRA 5JZJA 3VO3A 2QLQA 5C8NA 4FVQA 3UMXA 3HMNA 4IC7A 3KL8A 3VUHA 4U3YA 4G5PA 4EEVA 3F3TA 5AV1A 5GIOE 4G6NA 2C3JA 3E3BX 4FKLA 3BCEA 1O6LA 3OOGA 2XNGA 4ANBA 5E1EA 4RJ4A 4B9DA 3AMBA 2WHBA 4RQVA 5AUUA 4EOJA 2ZJWA 3NAXA 2WQBA 3VUKA 4QP8A 2CPKE 3U51A 2XRWA 4DG0E 3FC2A 5CEPA 3W18A 3EKKA 4FEQA 1XWSA 4BTJA 3DQWA 1O6YA 2P0CA 4J1RA 3RZFA 4DFBA 5IQEA 3FQEA 3ZO4A 4CT2A 3CTQA 1KV1A 1PY5A 4FYOA 4GG7A 3SW4A 4DGOA 3ZO2A 4QTBA 4O0TA 2E2BA 4CMTA 3SW7A 4C4JA 3MTLA 4FL3A 2GMXA 3GC0A 4M14A 3MVLA 3I0OA 2CNQA 2YLFA 1JLUE 3ZSGA 4IB1A 4BBEA 3ZZWA 4RVKA 4IAIA 4YPDA 2AC3A 3LMIA 3PY3A 2QR8A 2R3NA 4FTIA 1NVSA 4FV4A 4TYHB 2X9EA 4CRSA 2YHVA 4I41A 4EONA 1FVVA 5KZIA 2XF0A 4Z55A 3E8CA 3G0EA 4MXZA 3MH2A 5CF6A 1MUOA 4G6LA 2CKEA 4J99A 2P33A 2W1EA 4OTFA 5A4QA 3LW0A 4F9WA 2F7ZE 3MIAA 4D9UA 3ODZX 5CI6A 5AV0A 4EYJA 2JKQA 4D2RA 2YM3A 3VW6A 2J4ZA 2W9ZB 1Y57A 1SM2A 4KIQA 5J5SA 1UU7A 4DA5A 1YXUA 3QYZA 1SVHA 4GUBA 4X6QC 5AV3A 4XG9A 4FYNA 4X2NA 3NRMA 4YZDA 4DGGA 3H30A 4XYFA 5IMEA 4GH2A 1IEPA 2VTJA 5JFSA 3DV3A 1MP8A 4RC4A 3G9NA 3AD5A 5F4NA 5M4FA 3ZC5A 3HMPA 2QO9A 4TYJA 4BTMA 4F0FA 2XK9A 3OC1A 4Y83A 3WZKA 2JKKA 3LPBA 4BKZA 2OICA 2WXVA 4JI9A 4CFUA 2X7FA 3BX5A 3HECA 1UNHA 3RINA 4C62A 1U54B 4OT5A 3TTJA 4I1ZA 1OBDA 5J95A 2A27A 4XG8A 3ZM4A 4I24A 3FLQA 4B6LA 2SRCA 2VTSA 3Q4UA 4XV2A 4MAOA 4BL1A 3FMMA 2EU9A 2CGVA 1YWVA 1FPUA 1XKKA 2HZ4A 2QOHA 4OTGA 3A7IA 5IEVA 3V5LA 3NEWA 5KMMA 3AC4A 2JD5A 3BV3A 3EHAA 2RL5A 3GU7A 4MF0A 4O0SA 4QMPA 3AC8A 2UZVA 3AG9A 3KMUA 3Q2JA 5EI6A 2C5VA 5FLFA 2W06A 1DS5A 3W2SA 3FEGA 4PRJA 3GQLA 4I5CA 1IASA 2PE0A 3CY2A 5F95A 3RMFA 3N4TA 3WE4A 4HVHA 3FXZA 4D55A 4M12A 5AX3A 5IUIA 3D7TB 4G34A 5BVFA 1U46A 3FLSA 5A4EA 1ZMUA 3FKOA 4QYYA 4IMYA 3E93A 3NUYA 4BY9E 1YWNA 1H25A 3R7IA 2ITPA 2RFSA 3O23A 4MK0A 4HGSA 5IH5A 5AR4A 3GOKA 5CX9A 1Q8TA 2WIPA 4M69B 5BPYA 5IZFA 1ZZ2A 4I6QA 1G8SA 4FSYA 2OJGA 4XG7A 3FLYA 4CXAA 2HIWA 4OUCA 4BDJA 4P2KA 4IJ9A 3WBLA 4BI1A 3PZHA 3MS9A 4TNBA 3V3VA 1RJBA 4RWJA 2C5YA 1H00A 5CNNA 5E8UA 2ZV7A 2ONLA 2UZUE 3A4OX 2ZOQA 4OTQA 3H9OA 4J8NA 4EOIA 2JIUA 2UZLA 3ZXTA 3UO6A 1REJA 1YI4A 5F9EA 4I94A 4AZEA 4WNKA 3TV4A 3MYGA 4EH7A 1SYKA 2UW4A 3RPVA 4ZS0A 3MFTA 3QC9A 3JS2A 2JDRA 4YC6A 4TWPA 4RIYB 1H1SA 1BMKA 2WAJA 3QKMA 2WQEA 1I44A 2YCRA 3HNGA 3M11A 4HCVA 3G6GA 5AAFA 4NTSA 3UGCA 2YN8A 3EIDA 2I0EA 2QLUA 3ERKA 2EXMA 2VTRA 4L43A 3QGWA 4EOOA 2PZ5A 3WF8A 4H36A 4PMTA 4G16A 3FY0A 3ZEPA 2OXYA 2QR7A 3LJ0A 1B38A 3DXPA 4K0YA 2UW5A 5M09A 2YDKA 3ZDUA 5AA8A 4AWIA 5KCVA 5HLNA 5JK3A 3GFWA 3FKLA 4QTDA 4DF3A 3ATSA 4FSWA 1JAMA 3NNWA 5JGAA 4O0VA 3EYHA 3D4QA 4ZIMA 4RIOA 4OAVB 2VWWA 3C5UA 2G2IA 1OB3A 4DTAA 1M17A 3KF4A 3OW4A 4QP6A 4RT7A 5HG8A 5CSXA 5AUZA 3MA3A 1ZARA 2R0UA 3EQIA 2BKKA 3PDTA 1RE8A 4X0MA 4J8MA 3K3JA 2JITA 3COKA 2FGIA 3R9RA 3R00A 4NCTC 1YDTE 4DEDA 4U7ZA 3MPMA 2XKDA 3GXLA 5D11A 2IZTA 4FV9A 2F57A 4QTCA 4D28A 2XS0A 3CGOA 4GKHA 4CZUA 5AP2A 4RJ6A 3FMJA 3UOLA 2JFMA 1ZOGA 2YM6A 4KBAA 4DH5A 1H08A 4C57A 1XBAA 1TKIA 4IAZA 5CU6A 3TIZA 4IEBA 2OLCA 2HZNA 4G1WA 4PL4A 4E5BA 2JDOA 4F6SA 3DBEA 3OP5A 1REKA 5J1VA 4LM5A 2IJMA 5DE2A 2Y6MA 4Z3VA 4W8DA 4O82A 3QF9A 3QQGA 3UIXA 4JNWA 2BR1A 2GU8A 1ATPE 3Q9WA 2YM7A 3E7VA 2YIXA 2QD9A 5ICPA 3W2RA 3D2IA 4DT9A 3KREA 5AR7A 3ZTXA 4XS2A 1ZLTA 3CE3A 1H0WA 5EDQA 3OHTA 4WBOA 3K54A 4HOKA 5E8SA 2BRGA 4BCQA 2V55A 4L9IA 3W2CA 3OEFX 1BYGA 2C30A 3Q6WA 4ZTLA 2KTYA 3RP9A 3O51A 5IDNA 3DJ5A 4JX3A 5AIRA 1R0EA 5TR6A 5C8MA 4C3RA 3BU3A 4MBJA 3UO5A 2X8IA 3P1AA 3CXWA 2J0JA 1IR3A 3DA6A 4LMNA 4FEWA 1YHWA 2XNEA 3P23A 4G2FA 5M08A 3D7TA 5E8WA 5CEMA 1UKHA 3F7WA 5ACBC 3P9JA 5LMBA 3OCGA 2XNMA 1T45A 2Y9QA 3MSSA 4L44A 3UBDA 4O83A 3GCVA 4GVAA 3VS7A 4K33A 1R78A 4CYIA 4FZDB 3RK5A 3CQWA 5DNRA 4O84A 3PY1A 4M69A 4O96A 2W99B 4WRGA 5D7AA 1CSNA 2WFYA 4AE6A 5IA1A 2FVDA 4FG9A 4AQCA 5BX0A 3ULIA 3G15A 2GNGA 3V5TA 1NVQA 2VNWA 2QVSE 3F82A 1Q8ZA 1H1PA 3PWDA 5G1XA 4HCUA 3WZEA 4LGDA 4ACCA 5IA3A 1H01A 3FI3A 5ANIA 2OWBA 3FWQA 4EQCA 2DUVA 3ORTA 3QD0A 3THBA 3RCJA 4EH2A 3OWPA 1WCCA 1OPKA 2R3IA 5CF4A 2WEIA 4I6FA 3K3IA 3R8PA 4RLKA 4CFVA 1M7QA 2BFXA 3Q3BA 5HCZA 5K3YA 2W1DA 5E8XA 4RIYA 2BDFA 2XNBA 2PVRA 2W0JA 4F9YA 2VO6A 4NYEA 3OEZA 2IW6A 1H28A 1Z9XA 5CVHA 2XYUA 4DG3E 5DI1A 4UMQA 3KCFA 3VS0A 4M67A 3PPKA 2BRHA 3P4KA 4NUSA 4P90A 3VBWA 2PVNA 2W9FB 5KMKA 3SA0A 1PKDA 2W17A 2B53A 2A1AB 5CLPA 2GNFA 4D4SA 3PXQA 3VIDA 3EZRA 3FXWA 3F61A 1XR1A 4MQ1A 3HV4A 4J95A 4O0YA 4FV6A 4E4NA 4FT0A 4JG6A 3COMA 4L53A 4AN2A 3E3PA 2YIYA 4HVDA 3EFKA 5A4TA 1CKIA 3GGFA 5BVNA 4H05A 5A6OA 4KD1A 1FVRA 3DDQA 4G3DA 5KBRA 1W7HA 2XA4A 3BPRA 5AM7A 4I4FA 4ENYA 2WMUA 4KRCA 4EK5A 5IQCA 1WBOA 2PULA 1ZXEA 2C3KA 4QYHA 1GZ8A 1E1VA 3EB0A 3MA6A 3ZH8A 4YR8A 2WEVA 2PK9A 2OF2A 3HMIA 3QRJA 3V6SA 2ETKA 4K77A 5K5XA 2WOUA 3E92A 2Q83A 2QODA 3QCSA 3FL4A 5FGKA 4UBAA 4OBOA 3UQFA 5IQHA 1BI8A 1S9JA 5E91A 2HYYA 3UNZA 2GDOA 3H4JA 3PVUA 4DEAA 5L8LA 2XIRA 3FZTA 1P4OA 3PJ2A 3JVRA 1OL1A 3KFAA 4RIXA 3P5KA 4IWQA 4U8ZA 3ULZA 3EQBA 4WNMA 4FTUA 4RWLA 4R77A 3F9NA 4HYHA 4N6YA 4PP9A 5EW9A 3IW7A 2QURA 4N57A 4YLJA 4XBRA 3AGLA 2B9JA 5BQ0A 3OBJA 4FTRA 2BAKA 2JIVA 5BUJA 3COHA 3HUCA 3JY0A 4JR7A 3NW6A 4FNWA 3TJCA 5L2QA 3MFSA 5LARA 4C58A 3MJ1A 3KRLA 2WZJA 3U6HA 3KEXA 3HRCA 4ASEA 3BYUA 4R5YA 3UJGA 5ANGA 3OUNB 4YURA 3E8NA 4CLJA 4KKGA 3ZLYA 3TACA 4FKWA 1L8TA 4HPUE 2XRUA 3W2OA 3RK7A 1CMKE 3A61A 3OWKA 3ZRLA 3GNIB 5AV4A 3KCKA 5M57A 3UQCA 4N70A 2HCKA 2J7TA 4M7IA 3W8QA 4U9AA 3QUPA 3C13A 3TIYA 5LXMA 3FHIA 4XX9A 1IRKA 3A60A 3WYXA 4B8MA 1WBTA 3U6IA 4GEOA 2OZAA 4XHKB 3OOMA 4BTFA 4FKTA 4CFXA 5HO6A 5CEKA 4BWXA 5JN2A 3KC3A 3PJ1A 3ID6C 5AA9A 3EYGA 3MW1A 4UY9A 5ACKA 4ZLYA 5A54A 3KXHA 3LKMA 4FKSA 3WF9A 3GU6A 4PF4A 4O7NA 2WNTA 3FZ1A 1A9UA 1DAYA 2QCSA 3H9RA 4JRVA 2HWOA 3GEQA 4QNYA 5FBNC 3RAKA 3FI2A 3R1SA 4AOTA 2Z02A 1OGUA 4D5HA 2VWUA 3TEIA 3GBZA 5JQ5A 2W5BA 2PSQA 5FTOA 4MQ2A 4CFWA 1R1WA 3ORXA 4DTBA 4MXYA 2OJFE 4K1BA 5BVEA 4PDYA 3ACJA 4TT7A 1E1XA 4AGCA 1M52A 4XCUA 5AV2A 4BCJA 5L6OA 3QXOA 4IZ5A 3QQFA 2ZDUA 4JX7A 4NFMA 3OXTA 4ACDA 3DNDA 3C0HA 4R3RA 2C5OA 5HNGA 4UZDA 4ANMA 2HK5A 5DFPA 5ANKA 3UIBA 1GIHA 3QAME 4CKJA 2H9VA 3EL8A 4DTKA 4BTKA 5EM8A 3LXKA 4CG9A 3W1FA 3H0ZA 2FYSA 5AP7A 4E73A 3OF0A 2HELA 2J9MA 4L46A 4C38A 3JR1A 2IWIA 4GS6A 4CMOA 2VRXA 2Z2WA 5FXRA 4EBVA 4IAYA 2JKOA 3F6XA 5LCJA 1JKTA 3LCDA 4NH1A 4W4YA 2CLQA 1T46A 3GCUA 3CPBA 4CD0A 2HY0A 2YCFA 4WNOA 4BGQA 5CXZA 3F5PA 4XG4A 2E9OA 4ZEGA 1WVWA 4BYIA 5A4CA 1OKYA 2F7EE 3BE9A 3B8RA 3LFCA 3HYHA 3ORLA 3OY3A 4FIIA 4ALWA 5EFQA 5FP5A 3QKLA 3PSCA 4OTDA 4QTAA 4O6LA 1P5EA 1UNGA 3MI9A 3C5IA 5KMNA 2C69A 3NYOA 2PY3A 3H9FA 5DH3A 3HDMA 5DYJA 3D14A 4IC8A 4IX4A 2ZAZA 4I6HA 4YBKA 2A2AA 3RPYA 2GQRA 4E1ZA 4F4PA 4FEVA 4YZCA 4EI4A 4K9YA 2UUEA 4UMPA 1BX6A 3LHJA 3CTJA 4K2RA 3RKBA 1ZYJA 3HKOA 5CYIA 4LGGA 4MX9A 5EM5A 4ACMA 4AOIA 5HQ0A 4NW5A 3RAIA 1YI3A 2XKFA 3R8MA 3VF8A 4DLIA 3NVMB 3RHKA 3BKBA 3LMHA 3S4QA 5HLWA 2XZSA 4ZTRA 4F9BA 5CEIA 4TWCA 4JBQA 4QNAA 3V5QA 3QQLA 3E64A 3O17A 4GIIA 5EYDA 3TUBA 2ZYBA 1KOAA 2F2UA 1JKLA 2GNLA 4PPCA 5DEWA 3C4FA 3FQSA 5J79A 1OBGA 4JDKA 4QP7A 5CTPA 1GOLA 4ARKA 4DFYA 1K2PA 3PZEA 4Q9ZA 1SNUA 3VWAA 3FLNC 4GK2A 3QQJA 1QL6A 4UXQA 3R8LA 2PPQA 3DT1A 1SVGA 4JBOA 2GFSA 2WQOA 2BKZA 2UW6A 4IAAA 4E93A 4QOXA 1FBNA 3ORNA 2E9NA 3IDCA 5J7HA 5I9WA 4Z7HA 2VN9A 5AJQA 3CP9A 4LYNA 3U55A 3PG1A 4ZSJA 1M2QA 3KMMA 3Q2MA 4YLLA 2GQSA 2G15A 5TOZA 5IDPA 2YWVA 3NW7A 4N0SA 4NZWB 4LUEA 5KZ0A 4BDFA 2R3HA 3UYSA 5EKNA 4E8AA 4RVTA 3FPMA 2YCSA 3WILA 1GJOA 4OR5A 3RJCA 3BHTA 4GMYA 4IADA 5CAQA 3LVPA 3O8TA 4X6RA 3P86A 3NYVA 3UZPA 2PVHA 4ZTHA 5C27A 3NVKI 3R63A 2V7OA 3NIEA 3VS4A 1OKWA 3O7LB 3R2BA 3BU6A 4QP1A 5HE2A 3K5UA 2UZEA 4OBPA 3F7ZA 5EI8A 4BCIA 3LFDA 4YJUA 2Z60A 4DE4A 3ZLXA 4C36A 3QXPA 4ASXA 2VTPA 3M42A 4DBXA 3TNPC 4X2KA 5FEEA 3U9CA 3PY0A 3M1SA 3MH3A 4D5KA 4XP0A 1ZWSA 4MNFA 4C33A 4OW8A 3BQCA 5LJJA 3ANRA 5TF9A 4NW6A 2B55A 5JKGA 4A4XA 1H24A 3RGFA 3MPTA 3CC6A 2VO0A 2FH9A 3H0YA 3KVWA 4YBJA 3WF6A 5AWMA 2E9UA 4QMUA 4WSQA 5DBXA 1X8BA 3DLSA 3HLLA 3QTZA 1V1KA 3F88A 4D4RA 1CM8A 5EOBA 3S1HA 3DJ7A 4RC3A 1M2RA 3VF9A 3VBTA 2J2IB 4EKLA 4L67A 3HRFA 4FV3A 2E9VA 4G9RA 3QUDA 2PL0A 4GW8A 4KABA 4FVPA 3TNIA 2QU6A 3C4CA 1BL6A 4GUEA 2W96B 2Y0AA 3HDNA 4X7QA 4ZLOA 3JVSA 2ITOA 5L2SA 3AXWA 3W8LA 5EM6A 5HO8A 4DEGA 3L8VA 3Q5IA 3MGYA 4C0TA 2OK1A 3TUDA 3B2WA 4I0SA 4TWOA 5DT3A 2W05A 2X2MA 3MTFA 4EZ5A 2FB8A 3I5ZA 3U8WA 3F2NA 1Y8YA 2W1CA 1IAHA 2X1NA 2WQMA 2QOQA 4FSUA 3R7UA 1XO2B 3ZUVA 4DEEA 3OG7A 3S0OA 4D9TA 4TKSA 5HTIA 4MXAA 4FGRA 5IQIA 1RW8A 3VN9A 3BI6A 5CT7A 3E88A 4IXPA 4BR3A 4MTAA 2JGZA 3T8OA 3L9NA 3ENHA 3KK9A 5ETCA 3D94A 5JMSA 1J7LA 2QI8A 3KU2A 4XV9A 3R01A 4LRKA 5C1QB 3PIYA 4JOAA 2R3FA 4FSNA 2AYPA 4YJRA 4A4LA 1NA7A 4M97A 1ZOHA 4GFMA 4DCEA 2UZWE 3EL7A 4BDAA 1AGWA 5BUIA 3OCSA 2YLEA 1JKKA 3WF5A 3MY5A 4EWQA 4F6UA 3ZSHA 1JBPE 5FEQA 3UPXA 4ANQA 2J51A 2VX3A 1YOLA 4YUQA 3DKOA 5JQ8A 1W82A 4NEUA 5E1SA 4C4HA 3GCQA 5CASA 3FV8A 3CY3A 3GVUA 2XBJA 3SGCA 3AGMA 3HP5A 2UW8A 1W0XC 3LCKA 3VUMA 4ZZNA 4IANA 1MRYA 2R3LA 2XP2A 3BU5A 3QUEA 3D2KA 4UB7A 4D2PA 5CZHA 4XP3A 4C4GA 5IEXA 4C3PA 2OJ9A 4O1OA 3WZJA 5I9UA 3II5A 4RFYA 4AZFA 4ZTMA 5AP0A 1ZZLA 5CQWA 2XM9A 2VWVA 3RAWA 2C6EA 4YZNA 1H1WA 2ITUA 2WO6A 1Y6AA 2JKMA 2XJ2A 5BVOA 1KOBA 3DTCA 4RPVA 3PJCA 5L8KA 5CI7A 2UZNA 2OG8A 4IJPA 3O0GA 3ZBFA 3BGZA 5B2MA 4FTCA 3QRUA 3ZS5A 4MNEB 4Y85A 3DJ6A 4BN1A 1Q99A 4DH8A 4H3QA 4BFMA 3I4BA 2YWPA 2X4ZA 4L52A 4M3QA 3FKNA 4DN5A 5K5NA 2GNIA 3FXXA 5IH4A 1OL7A 4D1ZA 2WTIA 4U40A 4YHTA 5EH0A 2PUNA 5HBHA 4YZBA 5ETAA 2WU7A 5FQDC 4AGDA 4YJNA 3ZFMA 4G17A 3CJGA 3QA8A 4FTKA 4FK3A 3CLYA 4RIWB 3DKGA 4ZZOA 3FZRA 2BAQA 3O2MA 3ZDIA 4BCKA 3D7ZA 3EWHA 2ZV9A 3OWJA 3PA3A 4E7WA 5IPJA 4Y5QA 2HAKA 3VAPA 3P0MA 4FV2A 5BVKA 3SG8A 4YSMA 5CU4A 1YQJA 3Q4CA 3NMUF 4A9UA 3HAVA 5KHWA 4UN0C 4FTTA 3FI4A 4MVFA 3L9PA 3R04A 4GJ2A 4NM7A 4GKIA 4OBQA 3EZVA 4IX6A 4WKQA 4ANOA 4PPAA 2XJ1A 3TG1A 4C2WA 1IAJA 3R1QA 5DT4A 1SMHA 4DEHA 2C68A 4NWMA 4Q2AA 3CKXA 2JBPA 2YEXA 3BE2A 3KRJA 3OMVA 4X2GA 4FA2A 5IF1A 3NR9A 2F7XE 5AAEA 3WI6A 5AUVA 4DFLA 1BLXA 4EJNA 4E5AX 5M55A 3BYOA 3QQHA 3QTUA 4JG7A 4FUXA 2WMBA 3HVCA 2QOLA 4L3JA 3ZLWA 4S31A 4DLJA 2HW6A 4PDOA 4BBFA 4EYMA 4V0GA 5FTQA 1FVTA 4IDTA 4UWCA 1F3MC 4IVAA 3T3UA 5J9LA 3R1YA 5AR8A 4HVIA 5IISA 4O7YA 1OL6A 3R7EA 3UOJA 2G01A 4WSYA 1SZMA 1XH9A 2ZV8A 3BHVA 4CTBA 2JC6A 2OIDA 2A0CX 3P7AA 4NM0A 2V62A 3WZUA 4PMPA 2OH0E 5DRDA 3TJDA 5L3AA 3DKFA 4R7BA 2X2LA 5ANJA 3ROYA 4C37A 4F1TA 4XEYA 4DBNA 2GNJA 3FL5A 4GT3A 1YKRA 4IVDA 4O21A 4S2ZA 3TDVA 3SQQA 1PXMA 2YAAA 4O22A 4GSBA 4ZSLA 3OS3A 4JXFA 1MQ4A 3MDYA 3CBLA 4BI0A 2ZDTA 4FT7A 5C01A 2EXEA 3I7BA 4HYSA 4WOVA 1H27A 3MVMA 2XK7A 2C47A 4ZJJA 3UVRA 4DG2E 5HORA 2WMVA 2HENA 2PWLA 2X7GA 4ITIA 3Q32A 4FZAB 4J52A 2GHMA 3H3CA 3QZGA 4L7SA 2WKMA 4W4XA 5JGDA 4U3ZA 4QMZA 3BRBA 4NM3A 4ZSEA 3E62A 5M06A 1CKPA 4XG6A 3NNXA 5DGZA 1UV5A 2R3MA 4NIFB 4AFJA 5HX6A 4HYUA 4YJTA 2E9PA 4MYGA 2NNWB 5KUPA 3FBVA 3N4UA 5HD7A 5J9YA 5M44A 1HOWA 4FGBA 4HPTE 2OJIA 4I0TA 4QQCA 4XLIA 5AMNA 3L9LA 3BIZA 5JFXA 4GYIA 4RX9A 1GAGA 5AP6A 1YXXA 4QO9A 2GQGA 2R7BA 5EG3A 3BHYA 5HNBA 4F6WA 2CKPA 4HYIA 5EDRA 4R7IA 5HIEA 2ITXA 4LOPA 4TYHA 2P55A 5TKDA 5AUTA 3O71A 1OUKA 1GZKA 2VUWA 5GJGA 1K3AA 2BTRA 1BL7A 3V8WA 1O9UA 2VU3A 4YZ9A 5C26A 1OKVA 3KXXA 3OBGA 3OW3A 4G3FA 3ACKA 3UPZA 4AP7A 2ITZA 3RM6A 1YW2A 3OT3A 1UVRA 2NP8A 4RWKA 2H96A 1TQPA 1R0PA 2VTNA 4MNEA 3T3VA 3MFUA 4O0WA 5LMAA 3G90X 4GU9A 4M68A 4AT5A 1CTPE 3OFMA 4B7TA 5M4IA 5IA0A 2J0LA 1Y6BA 5HU3A 1VZOA 3ALOA 2R2PA 3ODYX 4K6ZA 3DAKA 5FDPA 4JDHA 4TYIA 2W5AA 4I5PA 4IM0A 2ZV2A 4M0ZA 3ATTA 3EQHA 4CKIA 5GJFA 5CU0A 4RIWA 3Q9XA 3DB8A 2C6OA 5BYLA 3P7CA 4FKIA 4PMMA 2YISA 4BCNA 5CU2A 5AX9A 3C4ZA 3PXYA 4YU2A 1U54A 5FRIA 4XRJA 3ORMA 4FG7A 4BIBA 5DR6A 1JSTA 3UP7A 4O7WA 2X6DA 1FMKA 3FZSA 3PXKA 3KRWA 4FNYA 4S33A 5E8TA 4GT4A 4NJ3A 3RAHA 1WZYA 2X8EA 4JIAA 4WG5A 4X3FC 4AN9A 4O0RA 3DDPA 4CFFA 3TV7A 4I21A 1OECA 4A06A 4TWNA 3QD2B 5M51A 3GQIA 4NU1A 4FICA 4NFNA 3FUPA 1YHVA 4DEBA 3P79A 1PMVA 3HRBA 3NUSA 3NS9A 4NCTA 5IQDA 2JFLA 4A4OA 5CT0A 1XBCA 2C6KA 3QCQA 4JT3A 2DQ7X 2Z7LA 4ENXA 2YIWA 1FMOE 1KWPA 4E6CA 4BWPA 4P7EA 3WYYA 3VHKA 3B2TA 3R71A 3TNHA 1JQHA 3BEAA 4IBMA 4NSTA 1U5RA 2VV9A 1YOMA 4PDSA 3ORKA 3CTHA 4IM2A 3G33A 5K0KA 2OGVA 4ZJVA 4YC3A 4ORKA 2GS2A 3G0FA 4L42A 3ZRKA 3LFFA 5E7RA 5DA3A 3CQUA 4MH7A 5AADA 2XIXA 5AM6A 1YVJA 2PZRA 4QD6A 1P14A 2CNUA 3RALA 2XK3A 2W4KA 4HGTA 2BZKB 5GNKA 3PJ8A 1A06A 2X9FA 4FZ7A 2VWBA 2O65A 2OH4A 2YA9A 4P4CA 4USEA 5KE0A 3WARA 4MKCA 3RPOA 3PRIA 4J97A 3V6RA 3SLSA 3CR0A 3PYYA 5HG5A 4W9XA 3LFEA 4TTHB 1E9HA 1LPUA 4ONAA 1KE8A 5GIPE 3HV7A 3FZOA 5TT7A 3SDJA 3N9XA 4C02A 1UNLA 4KNBA 4PPBA 4JRNA 2EB3A 4ZY6A 4BDHA 5CALA 4WUAA 2F4JA 2XCKA 2UV2A 2PUIA 3VS6A 3UZRA 4FI1A 1H0VA 2PVKA 2A4LA 1U4DA 2YIQA 3D5XA 5AP5A 4X21A 3HZTA 4LV5A 4CQEA 4IZYA 4E4XA 1H8FA 2VAGA 4C7TA 4LL0A 2JDSA 5A9UA 2ZVAA 1GZNA 1JWHA 4E5WA 4O7LA 3C51A 4QTEA 3TZ9A 5J7BA 4F99A 2X81A 4HNFA 4LL5A 5HE3A 3REPA 1XHAA 2BDJA 2B4SB 4IWDA 4EOQA 3AC3A 3A8XA 3IONA 3KXGA 1ZY5A 4EWHA 4GK3A 3RBWA 3E8DA 5CAVA 3R7GA 3ZO3A 3ET7A 1ZYLA 2RKUA 2VWZA 3TNWA 4N6ZA 4PQNA 4BB4A 1XJDA 2B0QA 4O86A 4AG8A 4DEIA 4PL5A 5HCXA 3D5WA 4C34A 1DM2A 4P5QA 3NX8A 2C6TA 4B99A 1QPEA 4ZTQA 3VS3A 3R9HA 3PVGA 1MRUA 5BMSA 3BLQA 3L1SA 3EFWA 4M84A 5FD2A 5JSMA 3E8EA 2JDVA 5HG9A 1K9AA 4HGLA 3RTPA 4HVGA 4QMOA 2O64A 2BZHB 3NUXA 4Y5HA 4GFGA 4AACA 3L8PA 3SRVB 4C4IA 4DH7A 4AA0A 3D9VA 4AW5A 4UMRA 4AW0A 5ANDA 4DCAA 4BBMA 2I0VA 2P2HA 2XMYA 4Y95A 3LXNA 3KN5A 4QP3A 4ZK5A 3SHEA 4AN3A 2JEDA 3R1NA 5GJDA 4UWYA 2LGCA 2R3JA 2WTVA 4RA4A 2WTKC 1OKZA 4D0XA 5FXSA 4JQEA 4BICA 5EK7A 4E4LA 2IVTA 4QMQA 3R2YA 5HLPA 4E6AA 3F5GA 4HVSA 2Y4IC 1FOTA 5FM3A 5EI2A 3GI3A 2WQNA 5A6NA 3BBWA 4UYAA 3R02A 4EC9A 5CVGA 1JKSA 4ZMEA 4EBWA 4WRSA 2CJMA 3CQEA 4C35A 3P78A 4O27B 1CDKA 4QYGA 1YI6A 5D12A 1VEBA 2WIHA 1H4LA 4KIKB 4FV5A 5DR2A 4WG4A 4DT8A 5HD4A 2BPMA 1Q97A 2J0MB 4DFZE 3LJ2A 4BI2A 2V22A 4NKAA 2OFUA 4G3EA 4GJ3A 1KE5A 4QMVA 4BDDA 3SG9A 3GCSA 1U5QA 1AQ1A 3QLFA 3EMGA 3DZOA 4YGAA 3NUNA 3ITZA 2LAVA 2VTQA 4M0YA 1HCLA 3PP0A 3SOAA 4AXAA 1MQBA 4KBCA 1PJKA 4FEUA 1JSVA 5HX8A 4UZHA 4CG8A 4NJDA 2P4IA 3VUGA 1M14A 2DS1A 2ITNA 2RF9A 2QG7A 4WBBB 4UYNA 2OU7A 3LFSA 2X39A 3OTUA 2EWAA 2XKEA 4AZTA 3ZCLA 5M53A 4IZ7A 5F20A 2QQ7A 3LAUA 4O6EA 3EQFA 3JUHA 5DN3A 5T6KA 5C03A 4YPSA 4DINA 1PXOA 4IAFA 2XK4A 5D1JA 4KIPA 2PMIA 4UX9A 3COIA 4GRBA 5BYZA 2C0IA 2QOCA 3VBXA 2WMRA 2WMSA 1M7NA 4FKPA 1VJYA 3I6UA 4FIJA 3AD4A 5DRBA 3CEKA 5LWNA 4KSQA 3VBQA 4O7SA 4FX3A 4BDKA 1STCE 2J0KA 2IW8A 2W1IA 5GZ9A 4D0WA 4U81A 3MBLA 5EKOA 1PHKA 4EH9A 3QTSA 4LMUA 1EH4A 4QP4A 3ZU7A 3GC9A 3LCTA 5CY3A 2C3IB 4F1OA 4YJOA 3QA0A 4EH4A 4BRXA 2QHNA 3UP2A 2OF4A 3MWUA 4FK6A 2QOOA 2BCJA 2VGOA 4FZFB 3L8SA 4U0IA 4QMLA 4Z16A 4F9CA 3KA0A 3BGPA 4FBXA 1PYXA 3IW4A 4WD5A 4USDA 5HHWA 2QHMA 4FTQA 4G3CA 4W4VA 2BAJA 4FNZA 5L8JA 2ETRA 5L2IA 2BROA 4CZTA 5KBQA 3UC3A 3QTXA 4FV1A 3N51A 4Q9SA 1J7IA 3V8SA 3CD8A 3EFLA 5DT0A 5IH6A 2HXLA 1PXNA 3VHEA 3UDBA 1ZYSA 2UZOA 3BYMA 3LOKA 5J1WA 3R9DA 2CNVA 3F2RA 4FL1A 4FUYA 3PWYA 4ZLZA 2AC5A 5HI2A 5C9CA 2FSMX 1YHSA 4EH5A 5JH6A 4PX6A 2R3QA 1UA2A 2VX1A 1J91A 5IA5A 2RFEA 3FAAA 1YRPA 2CLXA 3DQXA 3OY1A 2QO7A 3DB6A 2UVXA 5F94A 4RVLA 3MPAA 1XH6A 3CPCA 1OM1A 2YCQA 4JAJA 5ETIA 3VJNA 4O7RA 2XCHA 2YM5A 3ZLSA 4CQGA 2C6IA 4C8BA 4BCHA 2HWPA 4L3PA 4QRCA 4FSZA 4AZWA 3LXPA 1QCFA 3UO4A 5AUXA 5H3QA 1VR2A 2O3PA 4RGJA 4O1PA 5AP4A 5EHYA 2YABA 4FKOA 4H1JA 5HG7A 4CVAA 5CS6A 3R8UA 4QMXA 5D7VA 4I5MA 4DC2A 3RPRA 5CEQA 4CKRA 3E5AA 3W32A 5LCKA 4AFEA 1GY3A 2AUHA 4FV7A 5C4LA 3AOXA 4L01A 2C0OA 3IW6A 4QPAA 3QFVA 4ACHA 2RIOA 3ANQA 3DBDA 3AC1A 4JJRA 1PMUA 5HO7A 4V04A 5D41A 5EM7A 3QD4A 4WHZA 3EN6A 2R3OA 4TW9A 3RM7A 4AZVA 4CCBA 4DFUA 5M07A 2WGJA 3FMDA 2C4GA 4JAIA 4R6VA 3PIZA 2ITWA 5FM2A 2XKCA 5L2WA 2XH5A 2O2UA 2UZTA 4Y73A 4HW7A 2PUUA 4V01A 1KE6A 4KA3A 2YITA 5FUTA 1NT2A 1PYEA 2J6MA 4CMUA 4QP9A 4E4MA 4F09A 4D1XA 3WIKA 5LVOA 4ZSAA 4O2ZA 3DGKA 1LUFA 4D2TA 3GU5A 1PMEA 2NO3A 2UVYA 3Q04A 4FKQA 4UALA 5AR3A 4WA9A 1DAWA 2QOIA 4RFZA 4BCPA 2ERZE 4NT4A 3F2AA 2Q0NA 1WBVA 1KSWA 3TZ7A 3QZHA 3DBFA 5HTBA 5LMKC 4TPTA 3KRRA 2PTKA 3UOKA 4R3PA 3MJ2A 4RX8A 3NDMA 4GIHA 4PY1A 4EQMA 5LVMA 2Y7JA 5LQFA 3T9IA 3FLZA 4LG4A 2VD5A 2QOKA 2QOFA 4XLVA 2PVMA 4PTGA 2IPXA 1BUHA 4WG3A 3O8PA 3QWJA 5FDXA 5B2KA 2JIIA 3EQCA 2PVLA 2XIYA 4PV0A 3VBVA 4MXXA 4CT1A 4Q5HA 1L3RE 1OVEA 2ZB1A 4ID7A 4ZZMA 4XNEA 4L8MA 3CJFA 4I92A 3DTWA 4IE9A 4OTRA 4Y72A 3UIUA 4AOJA 4NTTA 4AW1A 4TYEA 3SC1A 4FC0A 2WU6A 3DCVA 3S95A 2CCHA 2HY81 3DFCB 4NKSA 5IA2A 1M2PA 1URWA 1XH4A 1W98A 3A8WA 4MEDA 5AIKA 2WTJA 3LFNA 3PE1A 2Z7RA 1Q8YA 3HV6A 3KVXA 5B7VA 4I6BA 1V0OA 2YM4A 4IH8A 4F64A 1ZYDA 1W83A 4FTAA 2B52A 3G5DA 4HZSA 4MD9E 1IA9A 4M13A 5DWRA 1IG1A 4ITHA 3V51A 4EQUA 1PF8A 2Y4PA 1JOWB 1PMNA 2R3RA 2WMQA 2JAVA 5G6VA 4AZSA 1A48A 4EC8A 3B8QA 2V0DA 4U5JA 3W33A 2VZ6A 2W4OA 3DKCA 4S32A 3BHUA 3ZZEA 4LFIA 4TL0A 4AT3A 2B7AA 2CGUA 4BDCA 5IUGA 2VTAA 4Y46A 5DIAA 4F7SA 4RJ5A 4BIDA 2FSOX 4EK3A 5KKRC 2UVZA 3DOGA 3O50A 4O7ZA 4BCMA 1DI8A 1F0QA 4BIEA 2ACXA 3ZM9A 2BRMA 3JPVA 3OTVA 3DK3A 3ORZA 4P5ZA 3AT4A 3ENMA 3PSDA 4JLCA 3TM0A 4OT6A 2HZIA 2G9XA 1FQ1B 2WTDA 4EK4A 3NUPA 4JVGA 2GNHA 4RFMA 3R21A 5IQGA 3BWFA 1J7UA 2OW3A 3R6XA 2YFXA 3IW5A 4YJPA 4FTOA 2CN8A 3GB2A 4C4EA 3M2WA 4A7CA 5JEBA 3D83A 3DXNA 4FKRA 2VNYA 5CQUA 5HOAA 5HVKA 2XIKA 3HMMA 2IO6A 4BZDA 5B2LA 1NXKA 4IWOA 3A62A 3FMKA 3HUBA 3FY2A 1WVXA 3PXRA 4U6RA 3KULB 2IW9A 3TCPA 3DK6A 3HA8A 3ELJA 4XV3A 2IG7A 2C6LA 3QTRA 3VS1A 4EKKA 5C8KA 5J9ZA 2X0GA 3RWPA 4MWIA 4IIRA 4RG0A 1RDQE 5AR5A 3S00A 3LQ5A 5HIBA 5A3XA 5EOLA 2WMWA 3BEGA 4ZXTA 3L8XA 4ANNA 5HZNA 4EHVA 5E4HA 3FMLA 5T3QA 5CWZA 5HEZA 1QPJA 3BV2A 1Q3WA 5HE1A 3UTOA 2GTMA 3F69A 4QT1A 4AE9A 3QCXA 5IUHA 2X2KA 2NRYA 2PUPA 4F9AA 3UVQA 2I40A 1AD5A 3A2CA 4CYJA 5I9ZA 4GYGA 1APME 1OITA 3BYSA 4GV1A 3C1XA 4U41A 3KB7A 5CVFA 5AFVA 1WBNA 2PZIA 1GIJA 2PVJA 3IDPA 1Q8WA 4LOOA 1Q24A 4C2VA 5I5ZA 3F3ZA 2IN6A 5K4JA 3G6HA 3BYVA 4GFOA 3MIYA 4OTWA 3PLSA 4XBUA 5IQFA 4I23A 3KMWA 3RZBA 2X8DA 4D4VA 4X3JA 5EW3A 3RVGA 4DGLC 4YO4A 5M56A 3Q6UA 3Q96A 3QD3A 4BGGA 2VWXA 4AX8A 1Q4LA 4CCUA 4ERWA 1VYZA 3ZFYA 5CAOA 2BHEA 3VRZA 5LWMA 3POZA 3SXFA 3VRYA 4AT4A 4LQMA 4BGHA 5IG1A 3TI1A 3TT0A 4EOSA 2YZLA 3CD3A 3K5VA 3TUCA 2I6LA 4L68A 5D10A 3OXIA 4S30A 3GUBA 2OKRA 2B9FA 2HW7A 2EUFB 2PE1A 2R3KA 2VTMA 4X2JA 3VVHA 4FNXA 3Q4ZA 3FMNA 5HBEA 4IFGA 3BGQA 4BHNA 3ZHPC 4IX5A 1I09A 2FSTX 3ORPA 1FGIA 4GT5A 4WIHA 4J71A 4BZOA 4BHZA 1KV2A 3F3UA 3QALE 4DFXE 5I3OA 1Q3DA 3EOCA 1UKIA 2JBOA 3E63A 3QLGA 2FSLX 1U59A 3IS5A 3LFAA 4GVJA 4LV8A 3U87A 4TXCA 3UC4A 3VULA 5I0BA 3KQ7A 3U9NA 2YDIA 3IDBA 4D2VA 4U79A 3F66A 4A9SA 5M4CA 3RK9A 5I9XA 3R7YA 3HMOA 1Q61A 2GPHA 3F3WA 4FKVA 1W8CA 4FSQA 2O5KA 3OVVA 4XOYA 5FP6A 5H9BA 3ZUTA 3NUUA 1OPLA 3LQ8A 4J7BA 3K2LA 2OBJA 3GENA 3ZXZA 3UODA 2ONLC 3VUTA 4EK8A 2QOBA 3ZRMA 1BI7A 3BWJA 3GP0A 4RJ3A 4RQKA 3D0EA 1URCA 4EH8A 4APCA 2I1MA 3EKNA 3ZOSA 3EJ1A 1Q5KA 3KKVA 3R9NA 1MRVA 4II5A 3ZBXA 2R3GA 3DPKA 4BWKA 3UG2A 1UU8A 3LIJA 4O81A 4YNEA 2YIRA 2Y6OA 3IOKA 3Q5ZA 4FF8A 4R1YA 1OIQA 3WIGA 3LFQA 3BQRA 2QG5A 4FG8A 1JSUA 4IVBA 4R78A 3Q53A 2OIBA 1GNGA 2W1ZA 3EQGA 1ZY4A 3FLWA 1ZOEA 2PMLX 2PVYA 3IECA 3NPCA 1WMKA 3OT8A 1PW2A 4FZ6A 2ZM4A 5H8GA 2PMOX 3V5WA 3ZUUA 4ZAUA 3LM0A 4FIEA 3R83A 5AEPA 1G3NA 3O8UA 5CNOA 5BYYA 4M8TA 4ZOGA 3PPJA 4HCTA 4BCGA 4F7LA 5E9EA 2B54A 2BTSA 3I6WA 3LLAA 1YWRA 4U45A 2UW0A 4Z9LA 3QRIA 1XH7A 4Z7GA 3NYXA 4OTPA 4EH3A 3C0IA 4ALUA 3RHXA 5I9YA 3MH1A 2DYLA 3VS2A 4LUDA 4XV1A 3SX9A 3MB6A 3JYAA 3CCNA 3PRFA 4I5HA 1QMZA 4PL3A 2GCDA 3VQHA 3CKWA 4LRJA 3VUDA 4BDGA 4C59A 4APPA 2F2CB 2WELA 4UMUA 3EN9A 3JY9A 2FA2A 4QQTA 2WMTA 3FSFA 3KN6A 4XP2A 3FDNA 4YMJA 4ASDA 2W7XA 4X3FB 1PXIA 4GG5A 5KX8A 1JVPP 2W1HA 4YJSA 3KULA 4J53A 3O7LD 1OMWA 3HAMA 4EK6A 2ITTA 2WMAA 2C3LA 3QQUA 3QC4A 1BKXA 4K18A 4MXCA 4ZP5A 1B39A 2O8YA 5FG8A 3SV0A 1J1CA 5CENA 3W10A 1Q62A 2R7IA 5FTGA 3LMGA 3OUKA 4YO6A 4A9TA 5HBJA 4D2SA 3RWQA 3EN4A 4CZYB 1UWHA 5JRSA 2C6MA 4B4LA 2WB8A 2UZDA 4RLLA 3FPQA 1UU9A 3OD6X 5A14A 4V05A 4DITA 3AT2A 3DBQA 3PPZA 2GS7A 2IVUA 1PXPA 4R3CA 3A7HA 3VNTA 3FMEA 3E7OA 3O96A 3DFAA 2CMWA 2C6DA 1O6KA 4A9YA 4CV8A 3DS6A 2GFCA 3C9WA 2UZBA 4NM5A 3LCOA 3SXRA 5HCYA 1FGKA 3MY0A 4AU8A 4CNHA 4BYJA 3AMYA 2OJJA 3CGFA 3GCPA 3NWWA 2FO0A 2CGXA 4R8QA 2RGPA 4EL9A 4ZY4A 2QC6A 3Q4TA 3U4WA 4CFNA 5HVYA 1LEWA 2CKOA 1ZAOA 2PU8A 1DI9A 4YSJA 4F0GA 3JXWA 5ANEA 3U6JA 3C50A 3IG7A 3VS5A 3PA4A 2R4BA 3PTGA 3EQPA 4TN6A 1R39A 5L4QA 4I93A 2WPAA 1QPCA 4OTIA 5CZIA 1WBPA 3FQHA 5ITAA 3LJ1A 1TVOA 3RPSA 2WOTA 5H8BA 4AA4A 4QMTA 3Q9ZA 4LGHA 4YHFA 4ERKA 3QX4A 2IZRA 2BIKB 4MBLA 5CXHA 4ACGA 3F5XA 2CGWA 2VWIA 2WTCA 3IKAA 4RIXB 4D58A 3OROA 5DR9A 4YTCA 1PXJA 4IB0A 3OCTA 3LLTA 4UV0A 3UIMA 3VC4A 1KE9A 1WBSA 4BKYA 1RQQA 1YOJA 3UZTA 3DK7A 2Y8OA 3C4XA 2GSFA 4CLIA 3LCSA 2GTNA 4L6QA 2XB7A 5KNJA 3RNYA 4MHAA 5AR2A 1J3HA 3ZEWA 1Q41A 2X7OA 3QZFA 2JDTA 3HL7A 1PKGA 2ETMA 2X4FA 4O91A 2VTOA 2WD1A 3I60A 4D1SA 4JG8A 3QHWA 3HX4A 5JFVA 2XUUA 3DLZA 4BCOA 3BBTB 4FOBA 5L2TA 4XMOA 1OIYA 2YERA 2BFYA 2CHLA 2PVFA 1H26A 5HGIA 4BC6A 4ZY5A 4DGMA 2EB2A 4U42A 1UU3A 5I3RA 4I22A 4F65A 3PSBA 4WNPA 1H07A 3UE4A 1CKJA 3KGAA 3MB7A 2ZMDA 4AA5A 2H6DA 4JBVA 2CCIA 4FVRA 2OZOA 2ITQA 5CSWA 3WZDA 5AUYA 3G9LX 4YHJA 2OZAB 3V5PA 4F1MA 4F08A 1R3CA 2B9HA 2WTKB 4LRMA 4FV8A 4CV9A 4F63A 4OAUC 4QYFA 2Y4IB 4FT3A 4EHEA 4FKJA 5JZNA 4CSVA 1ZMVA 4RMZA 3EQRA 1YDRE 4PWNA 5K9IA 4TY1A 2YAKA 3OXZA 1YDSE 5M4UA 4MD7E 3SAYA 3QTIA 4O0XA 3FJQE 4PTCA 3S2PA 4I20A 3IGGA 3KY2A 4FIFA 5AAGA 5GZ8A 2X6EA 4QYEA 1TQIA 3NIZA 4EHGA 1OUYA 4G3GA 5GZAA 4NL0A 2ITVA 2BRBA 4ZS4A 1OIRA 4FKUA 3SXSA 4JDJA 3EFJA 3FC1X 2WTWA 5AP1A 1YXSA 4JBPA 2CDZA 3DAJA 4JIKA 5CANA 5T68A 4RJ8A 3MFRA 3Q52A 4JL9A 3ROCA 2CSNA 3EN5A 4KS7A 4QP2A 2P3GX 5E8VA 4X3FA 4ZTNA 3W2PA 2J5FA 5CAPA 4XH6A 4E6DA 4G6OA 4MF1A 2BDWA 3PP1A 4YC8A 1Z57A 3TDWA 4LOQA 3UQGA 3RI1A 3W16A 4ALVA 4EHZA 4NIFA 3WE8A 3ZFXA 3LXLA 4RRVA 1H1QA 2OO8X 5FBOA 4AAAA 2G1TA 1P4FA 4U43A 4YZMA 4E3CA 2DWBA 5BNJA 4F7JA 1PXLA 2HZ0A 2IZSA 3MVJA 2WMXA 4AGUA 4N4SA 4YJVA 4U80A 4BCFA 4HNIA 2CKQA 4OTHA 1S9IA 3KXNA 2BRNA 2I0HA 2HOGA 2Z7QA 5J5TA 3PVBA 2XM8A 4G31A 2VO7A 3CIKA 1Q8UA 3R7OA 2W4JA 2NRUA 1WBWA 4FV0A 3C4WA 5BVDA 4IFCA 3ETAA 5L6WL 3KF7A 2F9GA 4RZWA 3D5UA 3MN3A 5KO1A 3TZMA 3KXMA 3ZMMA 4KINA 5A46A 2QU5A 3H10A 5CSPA 5D9HA 5IKWA 5E90A 3GFEA 5EQEA 4L7FA 5IQBA 3F3VA 4KS8A 1V0BA 1XQZA 2BVAA 4KKHA 4F70A 2PYWA 2C0TA 4B8LA 4QQ5A 3LFBA 3C7QA 4KSPA 2BMCA 3HA6A 4IDVA 5KMJA 4QMMA 1VYWA 4FT5A 4IAKA 2UW9A 5E8YA 1J1BA 3Q9YA 4IW0A 2GHLA 2ZMCA 3R28A 3SKCA 5J87A 3PUPA 2OFVA 2XBAA 4A9RA 4H58A 4K11A 4R1VA 3CS9A 3DZQA 4KRDA 4QPMA 4L45A 3HV5A 3IOPA 3V8TA 4GCJA 1ERKA 4AUAA 4DAWA 4AF3A 3UNKA 4MCVA 2RG5A 5AP3A 2KULA 3LQ3A 3R0TA 1IA8A 4H3BA 4FR4A 4PUZA 4TRLA 3SD0A 2YDJA 4WT6A 3QHRA 4OLIA 5ANOA 2ZM3A 4IACA 3R8ZA 2OXXA 4C3FA 4QQJA 4KIOA 3R22A 4PMSA 4MWHA 1KUTA 4GU6A 3TKUA 3SOCA 4CEGA 1OI9A 4MXOA 4IWPA 1PXKA 3GT8A 3MY1A 1XBBA 2OXDA 2XVDA 3BELA 3DY7A 1SVEA 2EVAA 3KK8A 3NUAA 4PNIA 4ZTSA 2J5EA 5E8ZA 5TO8A 4DHFA 5JRQA 2ITYA 2UW7A 5DPVA 5FWKK 3AMAA 3TN8A 5FXQA 5KMIA 3NW5A 1SNXA 4YTHA 4DH1A 3AC5A 3C0GA 5I9VA 4ZJIA 4TZRA 4M66A 5HE0A 4I3ZA 3NZ0A 5CF8A 3OZ6A 3QGYA 2XK6A 3BLHA 3QRTA 2W1FA 4FKGA 4W8EA 1ZRZA 2ZB0A 3PG3A 5IA4A 3EH9A 2XIZA 4UMTA 2XJ0A 3D15A 3NNUA 4JS8A 4O0UA 5EYCA 4EOMA 3DXQA 2J90A 5IMXA 4IHPA 2QNJA 2YJRA 5BUEA 3MVHA 3DNEA 1P2AA 3DBCA 2IVSA 1H1RA 3ORIA 4RC2A 1GIIA 4B0GA 4M15A 2J50A 4MBIA 4PNKA 4USFA 2XNNA 4KAOA 3IGOA 5DOSA 1V0PA 4I0RA 4YP8A 3A7FA 2VTLA 4RBLA 5DLSA 3PVWA 1YXVA 1QPDA 2BILB 2BIYA 2H8HA 3I5NA 3VBYA 5HIDA 5J8IA 1Y8GA 2NPQA 2R64A 3VQUA 2VTTA 3QCYA 1UWJA 4Q5EA 4BDEA 1XH8A 3AT3A 4EOLA 5CAUA 5JT2A 5KHXA 3WF7A 3V5JA 2QONA 2YJSA 3QQKA 4C4FA 2JAMA 4TNDA 3NAYA 5CU3A 5DEYA 1G5SA 3EQDA 5TE0A 3TTIA 3R30A 4E20A 4D2WA 4IVCA 3UG1A 4KWPA 3UYTA 4FIHA 2RSVA 3LE6A 4F0IA 4OGRA 3FMHA 5IEYA 5JFWA 4BVUA 3V01A 2XYNA 5EW8A 5CF5A 4AS0A 4FE2A 5EQPA 2ZM1A 4J96A 4QMWA 5HKMA 3TNQB 4JR3A 5F1ZA 3IW8A 4TYGA 2IZUA 4JQ8A 4BZNA 5LOHA 3AQVA 3TKIA 4IB5A 2W5HA 4KUJA 4O7TA 3E87A 5DMZA 2Q0BA 3PA5A 5BMMA 4H3PA 3POOA 4WUNA 4EUUA 2G2FA 4IM3A 1G8AA 3N4VA 3QTQA 3GU4A 2REIA 3GC8A 4H1MA 5E92A 3AD6A 5HICA 4EJ7A 2R3PA 3V04A 5I4NA 2O63A 3SVVA 2RFDA 3LM5A 1OPJA 2A19B 4CFMA 1FINA 3EN7A 4UEUA 4GK4A 4QPSA 1ZMWA 5DVRA 3FE3A 1LEZA 5DG5A 2C5NA 3LZBA 3MH0A 2XNOA 4DH3A 4JDIA 2HXQA 1OL5A 3G51A 3I79A 3PIXA 3A99A 1OL2A 3NLBA 4FMQA 4F7NA 4JQ7A 2VX0A 3SRVA 4EH6A 3FHRA 2YZAA 4FODA 4QMYA 5FEDA 3ALNA 3TL8A 4FEXA 5EDPA 1Y91A 2PZYA 3OWLA 1JNKA 5H2UA 4FL2A 3BHHA 3U4UA 1Z5MA 4FTNA 3NCZA 3RCDA 1NY3A 2CN5A 3QU0A 4FOCA 4G9CA 5GHVA 3PE2A 2ESMA 4A07A 2B9IA 4EOKA 4O38A 3HGKA 4XJ0A 5JGBA 3BLRA 5KKRB 3R73A 1LP4A 2I7QA 3R8VA 4FSRA 3W2QA 3ZC6A 2Z8CA 3PXFA 3HEGA 2VO3A 2YM8A 3UOHA 2PMNX 4YTFA 3FYKX 2BALA 3GOPA 3QTWA 4FSMA 1KE7A 3WOWA 2O0UA 5EHOA 5EYMA 3QYWA 4DFNA 4NK9A 4BDIA 3U54A 3D5VA 2PHKA 3BZ3A 3RNIA 5ETFA 5H8EA 2R0IA 5CSHA 4D4YA 4C61A 4KIKA 4RX7A 2F49A 4R5SA 3AC2A 4YTIA 3TKHA 4K8AA 2BZIB 2W1GA 3I0QA 3S3IA 3HP2A 3R7VA 2C5XA 4IB3A 1NVRA 2GHGA 4ANSA 4U97A 4RZVA 4KKEA 4YJQA 1ZYCA 2J0IA 2QKWB 4RWIA 4PDPA 3UVPA 4ASZA 4E6QA 4GL9A 1XH5A 3VW8A 4BF2A 4UWBA 3MESA 1TQMA 3FYJX
chains in the Genus database with same CATH superfamily
4KBKA 3P08A 5BVWA 4AXDA 2PE2A 2XK8A 5EHLA 1W84A 4RSSA 2QO2A 3IPHA 3IO7A 5K4IA 4XOZA 4FTLA 4EORA 2UW3A 4FIGA 5LVLA 2I0YA 3GC7A 5CSVA 3ZO1A 3DU8A 5EQYA 3ZONA 4FSTA 3TWJA 2V5QA 3KXZA 2B1PA 5HTCA 3KRXA 3FZPA 1WVYA 3QRKA 2H34A 3QX2A 2JLDA 4PTEA 4ANLA 3NYNA 4AGWA 3G2FA 2Z7SA 4RVMA 1WFCA 4CGAA 5L6PA 4BDBA 3L9MA 1PRYA 2RFNA 2OI4X 2R9SA 4HGEA 3IK3A 3FSKA 3HV3A 4G5JA 4J98A 5DHJA 5HNIX 2BZJA 2BHHA 3PFQA 1GZOA 3ZYAA 4LI5A 4QMNA 4QMSA 4EZ7A 3OCBA 5GINE 1JPAA 3QKKA 3A7JA 4XRLA 2G2HA 3VUIA 5LVPA 3IQ7A 3R9OA 2C1AA 2V7AA 3Q60A 3NNVA 4ITJA 4HZRA 3MV5A 4RA5A 3I7CA 4XUFA 5AUWA 2IVVA 4Y8DA 4S34A 4AW2A 3DAEA 3C4EA 4UXLA 4W4WA 4YLKA 3UNJA 1YXTA 2P2IA 5HVJA 2XEZA 3ZSIA 1ND4A 4XG2A 4FTJA 3TZ8A 4ZSGA 3QL8A 3QZIA 2VWYA 1B6CB 1F5QA 3W55A 5KMOA 5C4KA 4CTCA 4BKJA 2YACA 4DYMA 5CEOA 5K0XA 3UMWA 2R5TA 4FT9A 4L3LA 5HESA 4PP7A 3FI8A 4RX5A 3QWKA 4KB8A 5IQAA 3F5UA 1HCKA 5IU2A 2ERKA 2XNPA 5LMKA 2XEYA 3NGAA 4IQ6A 3W0OA 2RG6A 5HU9A 2VTIA 4CRLA 4ZMFA 4YNOA 2C1BA 4L00A 4O4FA 4RJ7A 4W9WA 3I1AA 4U44A 4V0GB 5EYKA 2VGPA 3CSVA 4H39A 1WAKA 3NCGA 1LR4A 2AEGA 4FTMA 4WO5A 2GS6A 2OSCA 4XG3A 3VJOA 5KMLA 2VTHA 1NW1A 3TV6A 2OIQA 4IZAA 4O7VA 3I81A 3PJ3A 4EZ3A 4R7HA 5A4LA 3NSZA 4IX3A 3PXZA 4MD8E 2PZPA 3TXOA 3GU8A 4DGNA 3A7GA 3A4PA 3T9TA 4E26A 4EUTA 1OIUA 4HJOA 3P7BA 3QBNA 4EOPA 2EXCX 5LVNA 3PLAE 4O2PA 4I4EA 4X2FA 2FUMA 2BUJA 1OZ1A 5B0XA 2QKRA 5JZJA 3VO3A 2QLQA 5C8NA 4FVQA 3UMXA 3HMNA 4IC7A 3KL8A 3VUHA 4U3YA 4G5PA 4EEVA 3F3TA 5AV1A 5GIOE 4G6NA 2C3JA 3E3BX 4FKLA 3TMOA 3BCEA 1O6LA 3OOGA 2XNGA 4ANBA 2A98A 5E1EA 4RJ4A 4B9DA 3AMBA 2WHBA 4RQVA 5AUUA 4EOJA 2ZJWA 3NAXA 2WQBA 3VUKA 4QP8A 2CPKE 3U51A 2XRWA 4DG0E 3FC2A 5CEPA 3W18A 3EKKA 4FEQA 1XWSA 4BTJA 3DQWA 3O5AA 1O6YA 2P0CA 4QDEA 4J1RA 3RZFA 4DFBA 5IQEA 3FQEA 3ZO4A 4CT2A 3CTQA 1KV1A 1PY5A 4FYOA 4GG7A 3SW4A 4DGOA 3ZO2A 4QTBA 4O0TA 2E2BA 4CMTA 3SW7A 4C4JA 1TFFA 3MTLA 4FL3A 2GMXA 3GC0A 4M14A 3P5JC 3MVLA 3I0OA 2CNQA 2YLFA 1JLUE 3ZSGA 4IB1A 4BBEA 3ZZWA 4RVKA 4IAIA 4YPDA 2AC3A 3LMIA 3PY3A 2QR8A 2R3NA 4FTIA 1NVSA 4FV4A 4TYHB 2X9EA 4CRSA 2YHVA 4I41A 4EONA 1FVVA 5KZIA 2XF0A 4Z55A 3E8CA 3G0EA 4MXZA 3MH2A 5CF6A 1MUOA 4G6LA 2CKEA 4J99A 2P33A 2W1EA 4OTFA 5A4QA 3LW0A 4I6LA 4F9WA 2F7ZE 3MIAA 4D9UA 3ODZX 5CI6A 5AV0A 4EYJA 2JKQA 4D2RA 2YM3A 3VW6A 2J4ZA 2W9ZB 1Y57A 1SM2A 4KIQA 5J5SA 1UU7A 4DA5A 1YXUA 3QYZA 1SVHA 4GUBA 4X6QC 5AV3A 4XG9A 4FYNA 4X2NA 3NRMA 4YZDA 4DGGA 3H30A 4XYFA 5IMEA 4GH2A 1IEPA 2VTJA 5JFSA 3DV3A 1MP8A 4RC4A 3G9NA 3AD5A 5F4NA 5M4FA 3ZC5A 3HMPA 2QO9A 4TYJA 4BTMA 4F0FA 2XK9A 3OC1A 4Y83A 3WZKA 2JKKA 3LPBA 4BKZA 2OICA 2WXVA 4JI9A 4CFUA 2X7FA 3BX5A 3HECA 1UNHA 3RINA 4C62A 1U54B 4OT5A 3TTJA 4I1ZA 1OBDA 5J95A 2A27A 4XG8A 3ZM4A 4I24A 3FLQA 4B6LA 2SRCA 2VTSA 3Q4UA 4XV2A 4MAOA 4BL1A 3FMMA 2EU9A 2CGVA 1YWVA 1FPUA 1XKKA 2HZ4A 2QOHA 4OTGA 3A7IA 5IEVA 3V5LA 3NEWA 5KMMA 3AC4A 2JD5A 3BV3A 3EHAA 2RL5A 3GU7A 4MF0A 4O0SA 4QMPA 3AC8A 2UZVA 3AG9A 3KMUA 3Q2JA 5EI6A 2C5VA 5FLFA 2W06A 1DS5A 3W2SA 3FEGA 5BV3A 4PRJA 3GQLA 4I5CA 1IASA 2PE0A 3CY2A 5F95A 3RMFA 3N4TA 3WE4A 4HVHA 3FXZA 4D55A 4M12A 5AX3A 5IUIA 3D7TB 4G34A 5BVFA 1U46A 3FLSA 5A4EA 1ZMUA 3FKOA 4QYYA 4IMYA 3E93A 3NUYA 4BY9E 1YWNA 1H25A 3R7IA 2ITPA 2RFSA 3O23A 4MK0A 4HGSA 5IH5A 5AR4A 3GOKA 5CX9A 1Q8TA 2WIPA 4M69B 5BPYA 5IZFA 1ZZ2A 4I6QA 1G8SA 4FSYA 2OJGA 4XG7A 3FLYA 4CXAA 2HIWA 4OUCA 4BDJA 4P2KA 4IJ9A 3WBLA 4BI1A 3PZHA 3MS9A 4TNBA 3V3VA 1RJBA 4RWJA 2C5YA 1H00A 5CNNA 5E8UA 2ZV7A 2ONLA 2UZUE 3A4OX 2ZOQA 4OTQA 3H9OA 4J8NA 4EOIA 2JIUA 3PFYA 2UZLA 3ZXTA 3UO6A 1REJA 1YI4A 5F9EA 4I94A 4AZEA 3PUFC 4WNKA 3TV4A 3MYGA 4EH7A 1SYKA 2UW4A 3RPVA 4ZS0A 3MFTA 3QC9A 3JS2A 2JDRA 4YC6A 4TWPA 4RIYB 1H1SA 1BMKA 2WAJA 3QKMA 2WQEA 1I44A 2YCRA 3HNGA 3M11A 4HCVA 3G6GA 5AAFA 4NTSA 3UGCA 2YN8A 3EIDA 2I0EA 2QLUA 3ERKA 2EXMA 2VTRA 4L43A 3QGWA 4EOOA 2PZ5A 3WF8A 4H36A 2XARA 4PMTA 4G16A 3FY0A 3ZEPA 2OXYA 2QR7A 3LJ0A 1B38A 3DXPA 4K0YA 4JMQA 2UW5A 5M09A 2YDKA 3ZDUA 5AA8A 4AWIA 5KCVA 5HLNA 5JK3A 3GFWA 3FKLA 4QTDA 4DF3A 3ATSA 4FSWA 1JAMA 3NNWA 4O4DA 5JGAA 4O0VA 3EYHA 3D4QA 4ZIMA 4RIOA 4OAVB 2VWWA 3C5UA 2G2IA 1OB3A 4DTAA 1M17A 3KF4A 3OW4A 4QP6A 4RT7A 5HG8A 5CSXA 5AUZA 3MA3A 1ZARA 2R0UA 3EQIA 2BKKA 3PDTA 1RE8A 4X0MA 4J8MA 3K3JA 2JITA 3COKA 2FGIA 3R9RA 3R00A 4NCTC 1YDTE 4DEDA 4U7ZA 3MPMA 2XKDA 3GXLA 5D11A 2IZTA 4FV9A 2F57A 4QTCA 4D28A 2XS0A 3CGOA 4GKHA 4CZUA 5AP2A 4RJ6A 2XAMA 3FMJA 3UOLA 2JFMA 1ZOGA 4F78A 2YM6A 4KBAA 4DH5A 1H08A 4C57A 1XBAA 2AQXA 1TKIA 4IAZA 5CU6A 3TIZA 4IEBA 2OLCA 2HZNA 4G1WA 4PL4A 4E5BA 2JDOA 4F6SA 3DBEA 3OP5A 1REKA 5J1VA 4LM5A 2IJMA 5DE2A 2Y6MA 4Z3VA 4W8DA 4O82A 3QF9A 3QQGA 3UIXA 4JNWA 2BR1A 2GU8A 1G8JA 1ATPE 3Q9WA 2YM7A 3E7VA 2YIXA 2QD9A 5ICPA 2X0PA 3W2RA 3D2IA 4DT9A 3KREA 5AR7A 3ZTXA 4XS2A 1ZLTA 3CE3A 1H0WA 5EDQA 3OHTA 4WBOA 3K54A 4HOKA 5E8SA 2BRGA 4BCQA 2V55A 3VONA 4L9IA 3W2CA 3OEFX 1BYGA 2C30A 3Q6WA 4ZTLA 2KTYA 3RP9A 3O51A 5IDNA 3DJ5A 4JX3A 5AIRA 4O4EA 1R0EA 5TR6A 5C8MA 4C3RA 3BU3A 4MBJA 3UO5A 2X8IA 3P1AA 3CXWA 2J0JA 1IR3A 3DA6A 4LMNA 1VLRA 4FEWA 1YHWA 2XNEA 3P23A 4G2FA 5M08A 3D7TA 5E8WA 5CEMA 1UKHA 3F7WA 5ACBC 3P9JA 5LMBA 3OCGA 2XNMA 1T45A 2Y9QA 3MSSA 4L44A 3UBDA 4O83A 3GCVA 4GVAA 3VS7A 4K33A 1R78A 4CYIA 4FZDB 3RK5A 3CQWA 5DNRA 4O84A 3PY1A 4M69A 4O96A 2W99B 4WRGA 5D7AA 1CSNA 2WFYA 4AE6A 5IA1A 2FVDA 4FG9A 4AQCA 5BX0A 3ULIA 3G15A 2GNGA 3V5TA 1NVQA 2VNWA 2QVSE 3F82A 1Q8ZA 1H1PA 3PWDA 5G1XA 4HCUA 3WZEA 4LGDA 4ACCA 5IA3A 1H01A 3FI3A 5ANIA 2OWBA 3FWQA 4EQCA 2DUVA 3ORTA 3QD0A 3THBA 3RCJA 4EH2A 3OWPA 1WCCA 1OPKA 2R3IA 5CF4A 2WEIA 4I6FA 3K3IA 3R8PA 4RLKA 4CFVA 1M7QA 2BFXA 3Q3BA 5HCZA 5K3YA 2W1DA 5E8XA 4RIYA 2BDFA 2XNBA 2PVRA 2W0JA 4F9YA 1ST4A 2VO6A 4NYEA 3OEZA 2IW6A 1H28A 1Z9XA 5CVHA 2XYUA 4DG3E 5DI1A 4UMQA 3KCFA 3VS0A 4M67A 3PPKA 2BRHA 3P4KA 4NUSA 4P90A 3VBWA 2PVNA 2W9FB 5KMKA 3SA0A 1PKDA 2W17A 2B53A 2A1AB 5CLPA 2GNFA 4D4SA 3PXQA 3VIDA 3EZRA 3FXWA 3F61A 1XR1A 4MQ1A 3HV4A 4J95A 4O0YA 4FV6A 4E4NA 4FT0A 4JG6A 3COMA 4L53A 4AN2A 3E3PA 2YIYA 4HVDA 3EFKA 5A4TA 1CKIA 3GGFA 5BVNA 4H05A 5A6OA 4KD1A 1FVRA 3DDQA 4G3DA 5KBRA 1W7HA 2XA4A 3BPRA 5AM7A 4I4FA 4ENYA 2WMUA 4KRCA 4EK5A 5IQCA 1WBOA 2PULA 1ZXEA 2C3KA 4QYHA 1GZ8A 1E1VA 3EB0A 3MA6A 3ZH8A 4YR8A 2XALA 2WEVA 2PK9A 2OF2A 3HMIA 3QRJA 3V6SA 2ETKA 4K77A 5K5XA 2WOUA 3E92A 2Q83A 2QODA 3QCSA 3FL4A 5FGKA 4UBAA 4OBOA 3UQFA 5IQHA 1BI8A 1S9JA 5E91A 2HYYA 3UNZA 2GDOA 3H4JA 3PVUA 4DEAA 5L8LA 2XIRA 3FZTA 1P4OA 3PJ2A 3JVRA 1OL1A 2IF8A 3KFAA 4RIXA 3P5KA 4IWQA 4U8ZA 3ULZA 3EQBA 4WNMA 4FTUA 4RWLA 4R77A 3F9NA 4HYHA 4N6YA 4PP9A 5EW9A 3IW7A 2QURA 4N57A 4YLJA 4XBRA 3AGLA 2B9JA 5BQ0A 3OBJA 4FTRA 2BAKA 2JIVA 5BUJA 3COHA 3HUCA 3JY0A 4JR7A 3NW6A 4FNWA 3TJCA 5L2QA 3MFSA 5LARA 4C58A 3MJ1A 3KRLA 2WZJA 3U6HA 3KEXA 3HRCA 4ASEA 3BYUA 4R5YA 3UJGA 5ANGA 3OUNB 4YURA 3E8NA 4CLJA 4KKGA 3ZLYA 3TACA 4FKWA 1L8TA 4HPUE 2XRUA 3W2OA 3RK7A 1CMKE 3A61A 3OWKA 3ZRLA 3GNIB 5AV4A 3KCKA 5M57A 3UQCA 4N70A 2HCKA 2J7TA 4M7IA 3W8QA 4U9AA 3QUPA 3C13A 3TIYA 5LXMA 3FHIA 4XX9A 1IRKA 3A60A 3WYXA 4B8MA 1WBTA 3U6IA 4GEOA 2OZAA 3BL9A 4XHKB 3OOMA 4BTFA 4FKTA 4CFXA 5HO6A 5CEKA 4O4BB 4BWXA 5JN2A 3KC3A 3PJ1A 3ID6C 5AA9A 3EYGA 3MW1A 4UY9A 5ACKA 4ZLYA 5A54A 3KXHA 3LKMA 4FKSA 3TYKA 3WF9A 3GU6A 4PF4A 4O7NA 2WNTA 3FZ1A 1A9UA 1DAYA 2QCSA 3H9RA 4JRVA 2HWOA 3GEQA 4QNYA 5FBNC 3RAKA 3FI2A 3R1SA 4AOTA 2Z02A 1OGUA 4D5HA 2VWUA 3TEIA 3GBZA 5JQ5A 2W5BA 2PSQA 5FTOA 4MQ2A 4CFWA 1R1WA 3ORXA 4DTBA 4MXYA 2OJFE 4K1BA 5BVEA 4PDYA 3ACJA 4TT7A 1E1XA 4AGCA 1M52A 4XCUA 5AV2A 4BCJA 5L6OA 3QXOA 4IZ5A 3QQFA 2ZDUA 4JX7A 4NFMA 3OXTA 4ACDA 3DNDA 3C0HA 4R3RA 2C5OA 5HNGA 4UZDA 4ANMA 2HK5A 5DFPA 5ANKA 3UIBA 1GIHA 3QAME 4CKJA 2H9VA 3EL8A 4DTKA 4BTKA 5EM8A 3LXKA 4CG9A 3W1FA 3H0ZA 2FYSA 5AP7A 4E73A 3OF0A 2HELA 2J9MA 4L46A 4C38A 3JR1A 2IWIA 4GS6A 4CMOA 2VRXA 2Z2WA 5FXRA 4EBVA 4IAYA 2JKOA 3F6XA 5LCJA 1JKTA 3LCDA 4NH1A 4W4YA 2CLQA 1T46A 3GCUA 3CPBA 4CD0A 2HY0A 2YCFA 4WNOA 4BGQA 5CXZA 3F5PA 4XG4A 2E9OA 4ZEGA 1WVWA 4BYIA 5A4CA 1OKYA 2F7EE 3BE9A 3B8RA 3LFCA 3HYHA 3ORLA 3OY3A 4FIIA 4ALWA 5EFQA 5FP5A 3QKLA 3PSCA 4OTDA 4QTAA 4O6LA 1P5EA 1UNGA 3MI9A 3C5IA 5KMNA 2C69A 3NYOA 2PY3A 3H9FA 5DH3A 3HDMA 5DYJA 3D14A 4IC8A 4IX4A 2ZAZA 4I6HA 4YBKA 2A2AA 3RPYA 2GQRA 4E1ZA 4F4PA 4FEVA 4YZCA 4DHZA 4EI4A 4K9YA 2UUEA 4UMPA 1BX6A 3LHJA 3CTJA 4K2RA 3RKBA 1ZYJA 3HKOA 5CYIA 4LGGA 4MX9A 5EM5A 4ACMA 4AOIA 5HQ0A 4NW5A 3RAIA 1YI3A 2XKFA 3R8MA 3VF8A 4DLIA 3NVMB 3RHKA 3BKBA 3LMHA 3S4QA 5HLWA 2XZSA 4ZTRA 4F9BA 5CEIA 4TWCA 4JBQA 4QNAA 3V5QA 3QQLA 3E64A 3O17A 4GIIA 5EYDA 3TUBA 2ZYBA 1KOAA 2F2UA 1JKLA 2GNLA 4PPCA 5DEWA 3C4FA 3FQSA 5J79A 1OBGA 4JDKA 4QP7A 5CTPA 1GOLA 4ARKA 4DFYA 1K2PA 3PZEA 4Q9ZA 1SNUA 3VWAA 3FLNC 4GK2A 3QQJA 1QL6A 4UXQA 3R8LA 2PPQA 3DT1A 1SVGA 4JBOA 2GFSA 2WQOA 2BKZA 2UW6A 4IAAA 4E93A 4QOXA 1FBNA 3ORNA 2E9NA 3IDCA 5J7HA 5I9WA 4Z7HA 2VN9A 5AJQA 3CP9A 4LYNA 3U55A 3PG1A 4ZSJA 1M2QA 3KMMA 3Q2MA 4YLLA 2GQSA 2G15A 5TOZA 5IDPA 2YWVA 3NW7A 4N0SA 4NZWB 4LUEA 5KZ0A 4BDFA 2R3HA 3UYSA 5EKNA 4E8AA 3NFGB 4RVTA 3ML1A 3FPMA 2YCSA 3WILA 1GJOA 4OR5A 3RJCA 3BHTA 4GMYA 4IADA 5CAQA 3LVPA 3O8TA 4X6RA 3P86A 3NYVA 3UZPA 2PVHA 4ZTHA 5C27A 3NVKI 3R63A 2V7OA 3NIEA 3VS4A 1OKWA 3O7LB 3R2BA 3BU6A 4QP1A 5HE2A 3K5UA 2UZEA 1TZDA 3F7ZA 4OBPA 5EI8A 3LFDA 4BCIA 4O4CA 4YJUA 2Z60A 4DE4A 3ZLXA 4C36A 3QXPA 4ASXA 2VTPA 3M42A 4DBXA 3TNPC 4X2KA 5FEEA 3U9CA 3PY0A 3M1SA 2ZFYA 3MH3A 4D5KA 4XP0A 1ZWSA 4MNFA 4C33A 4OW8A 3BQCA 5LJJA 3ANRA 5TF9A 4NW6A 2B55A 5JKGA 3W0QA 4A4XA 1H24A 3RGFA 3MPTA 3CC6A 2VO0A 2FH9A 3H0YA 3KVWA 4YBJA 3WF6A 5AWMA 2E9UA 4QMUA 4WSQA 5DBXA 1X8BA 3DLSA 3HLLA 3QTZA 1V1KA 3F88A 4D4RA 1CM8A 5EOBA 3S1HA 3DJ7A 4RC3A 1M2RA 3VF9A 3VBTA 2J2IB 4EKLA 4L67A 3HRFA 4FV3A 2E9VA 4G9RA 3QUDA 2PL0A 4GW8A 4KABA 4FVPA 3TNIA 2QU6A 3C4CA 1BL6A 4GUEA 2W96B 2Y0AA 3HDNA 4X7QA 4ZLOA 3JVSA 2ITOA 5L2SA 3AXWA 3W8LA 5EM6A 5HO8A 4DEGA 3L8VA 3Q5IA 3MGYA 4C0TA 2OK1A 3TUDA 3B2WA 4I0SA 4TWOA 5DT3A 4AXEA 2W05A 2X2MA 3MTFA 4EZ5A 2FB8A 3I5ZA 3U8WA 3F2NA 1Y8YA 2W1CA 1IAHA 2X1NA 2WQMA 2QOQA 4FSUA 3R7UA 1XO2B 3ZUVA 4DEEA 3OG7A 3S0OA 4D9TA 4TKSA 5HTIA 4MXAA 4FGRA 5IQIA 1RW8A 1OGYA 3VN9A 3BI6A 5CT7A 3E88A 4IXPA 4BR3A 4MTAA 2JGZA 3T8OA 3L9NA 3ENHA 3KK9A 5ETCA 3D94A 5JMSA 1J7LA 2QI8A 3KU2A 4XV9A 3R01A 4LRKA 5C1QB 3PIYA 4JOAA 2R3FA 4FSNA 2AYPA 4YJRA 4A4LA 1NA7A 4M97A 1ZOHA 4GFMA 4DCEA 2UZWE 3EL7A 4BDAA 1AGWA 5BUIA 3OCSA 2X0QA 2YLEA 1JKKA 3WF5A 3MY5A 4EWQA 4F6UA 3ZSHA 1JBPE 5FEQA 3UPXA 4ANQA 2J51A 4MUQA 2VX3A 1YOLA 4YUQA 3DKOA 5JQ8A 1W82A 4NEUA 5E1SA 4C4HA 3GCQA 5CASA 3FV8A 3CY3A 3GVUA 2XBJA 3SGCA 3AGMA 3HP5A 2UW8A 1W0XC 3LCKA 3VUMA 4ZZNA 4IANA 1MRYA 2R3LA 2XP2A 3BU5A 3QUEA 3D2KA 4UB7A 4D2PA 5CZHA 4XP3A 4C4GA 5IEXA 4C3PA 2OJ9A 4O1OA 3WZJA 5I9UA 3II5A 4RFYA 4AZFA 4ZTMA 5AP0A 1ZZLA 5CQWA 2XM9A 2VWVA 3RAWA 2C6EA 4YZNA 1H1WA 2ITUA 2WO6A 1Y6AA 2JKMA 2XJ2A 5BVOA 1KOBA 3DTCA 4RPVA 3PJCA 5L8KA 5CI7A 2UZNA 2OG8A 4IJPA 3O0GA 3ZBFA 3BGZA 5B2MA 4FTCA 3QRUA 3ZS5A 4MNEB 4Y85A 3DJ6A 4BN1A 1Q99A 4DH8A 4H3QA 4BFMA 3AKJA 3I4BA 2YWPA 2X4ZA 4L52A 4M3QA 3FKNA 4DN5A 5K5NA 2GNIA 3FXXA 5IH4A 1OL7A 4D1ZA 2WTIA 4U40A 4YHTA 5EH0A 2PUNA 5HBHA 4YZBA 5ETAA 2WU7A 5FQDC 4AGDA 4YJNA 3ZFMA 4G17A 3CJGA 3QA8A 4FTKA 4FK3A 3CLYA 4RIWB 3DKGA 4ZZOA 3FZRA 2BAQA 3O2MA 3ZDIA 4BCKA 3D7ZA 3EWHA 2ZV9A 3OWJA 3PA3A 4E7WA 5IPJA 4Y5QA 2HAKA 3VAPA 3P0MA 4FV2A 5BVKA 3SG8A 4YSMA 5CU4A 1YQJA 3Q4CA 3NMUF 4A9UA 3HAVA 5KHWA 4UN0C 4FTTA 3FI4A 4MVFA 3L9PA 3R04A 4GJ2A 4NM7A 4GKIA 4OBQA 3EZVA 4IX6A 4WKQA 4ANOA 4PPAA 2XJ1A 3TG1A 4C2WA 1IAJA 3R1QA 5DT4A 1SMHA 4DEHA 2C68A 4NWMA 4Q2AA 3CKXA 2JBPA 2YEXA 3BE2A 3KRJA 3OMVA 4X2GA 4FA2A 5IF1A 3NR9A 2F7XE 5AAEA 3WI6A 5AUVA 4DFLA 1BLXA 4EJNA 4E5AX 5M55A 3BYOA 3QQHA 3QTUA 4JG7A 4FUXA 2WMBA 3HVCA 2QOLA 4L3JA 3ZLWA 4S31A 4DLJA 2HW6A 4PDOA 4BBFA 4EYMA 4V0GA 5FTQA 1FVTA 4IDTA 4UWCA 1F3MC 4IVAA 3T3UA 5J9LA 3R1YA 5AR8A 4HVIA 5IISA 4O7YA 1OL6A 3R7EA 3UOJA 2G01A 4WSYA 1SZMA 1XH9A 2ZV8A 3BHVA 4CTBA 2JC6A 2OIDA 2A0CX 3P7AA 4NM0A 2V62A 3WZUA 4PMPA 2OH0E 5DRDA 3TJDA 5L3AA 3DKFA 4R7BA 2X2LA 5ANJA 3ROYA 4C37A 4F1TA 4XEYA 4DBNA 2GNJA 3FL5A 4GT3A 1YKRA 4IVDA 4O21A 4S2ZA 3TDVA 3SQQA 1PXMA 2YAAA 4O22A 4GSBA 4ZSLA 3OS3A 4JXFA 1MQ4A 3MDYA 3CBLA 4BI0A 2ZDTA 4FT7A 5C01A 2EXEA 3I7BA 4HYSA 4WOVA 1H27A 3MVMA 2XK7A 2C47A 4ZJJA 3UVRA 4DG2E 5HORA 2WMVA 2HENA 2PWLA 2X7GA 4ITIA 3Q32A 4FZAB 4J52A 2GHMA 3H3CA 3QZGA 4L7SA 2WKMA 4W4XA 5JGDA 4U3ZA 4QMZA 3BRBA 4NM3A 4ZSEA 3E62A 5M06A 1CKPA 4XG6A 3NNXA 5DGZA 1UV5A 2R3MA 4NIFB 4AFJA 5HX6A 4HYUA 4YJTA 2E9PA 4MYGA 2NNWB 5KUPA 3FBVA 3N4UA 5HD7A 5J9YA 5M44A 1HOWA 4FGBA 4HPTE 2OJIA 4I0TA 4QQCA 4XLIA 5AMNA 3L9LA 3BIZA 5JFXA 4GYIA 4RX9A 1GAGA 5AP6A 1YXXA 4QO9A 2GQGA 2R7BA 5EG3A 3BHYA 5HNBA 4F6WA 2CKPA 4HYIA 5EDRA 4R7IA 5HIEA 2ITXA 4LOPA 4TYHA 2P55A 5TKDA 5AUTA 3O71A 1OUKA 1GZKA 2VUWA 5GJGA 1K3AA 2BTRA 1BL7A 1XMMA 3V8WA 1O9UA 2VU3A 4YZ9A 5C26A 1OKVA 3KXXA 3OBGA 3OW3A 4G3FA 3ACKA 3UPZA 4AP7A 2ITZA 3RM6A 1YW2A 3OT3A 1UVRA 2NP8A 4RWKA 2H96A 1TQPA 1R0PA 2VTNA 4MNEA 3T3VA 3MFUA 4O0WA 5LMAA 3G90X 4GU9A 4M68A 4AT5A 1CTPE 3OFMA 4B7TA 5M4IA 4FJVA 5IA0A 2J0LA 1Y6BA 5HU3A 1VZOA 3ALOA 2R2PA 3ODYX 4K6ZA 3DAKA 5FDPA 4JDHA 4TYIA 2W5AA 4I5PA 4IM0A 2ZV2A 4M0ZA 3ATTA 3EQHA 4CKIA 5GJFA 5CU0A 4RIWA 3Q9XA 3DB8A 2C6OA 5BYLA 3P7CA 4FKIA 4PMMA 2YISA 4BCNA 5CU2A 5AX9A 3C4ZA 3PXYA 4YU2A 1U54A 5FRIA 4XRJA 3ORMA 4FG7A 4BIBA 5DR6A 1JSTA 3UP7A 4O7WA 2X6DA 1FMKA 3FZSA 3PXKA 3KRWA 4FNYA 4S33A 5E8TA 4GT4A 4NJ3A 3RAHA 1WZYA 2X8EA 4JIAA 4WG5A 4X3FC 4AN9A 4O0RA 3DDPA 4CFFA 3TV7A 4I21A 1OECA 4A06A 4TWNA 3QD2B 5M51A 3GQIA 4NU1A 4FICA 4NFNA 3FUPA 1YHVA 4DEBA 3P79A 1PMVA 3HRBA 3NUSA 3NS9A 4NCTA 5IQDA 2JFLA 4A4OA 5CT0A 1XBCA 2C6KA 3QCQA 4JT3A 2DQ7X 2Z7LA 4ENXA 2YIWA 1FMOE 1KWPA 4E6CA 4BWPA 4P7EA 3WYYA 3VHKA 3B2TA 3R71A 3TNHA 1JQHA