2YJSA

Structure of c1156y mutant anaplastic lymphoma kinase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
308
structure length
286
Chain Sequence
PNYCFAGKTSSISDLKEVPRKNITLIRGLGEVYEGQVPLQVAVKTLPEVYSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Structure of C1156Y Mutant Anaplastic Lymphoma Kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 286
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yjsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yjsA01
2CPKE 4D0XA 3ZZWA 3FLYA 5AUTA 3LJ2A 5F1ZA 2QOHA 3LLTA 2E9NA 2WMSA 3F3VA 3P7CA 1FMKA 2VNYA 4JLCA 2VTJA 2GNGA 3KMMA 3QCYA 2ONLC 4M7IA 4B7TA 4ANSA 4EOLA 3EQCA 4J96A 4U3YA 2XCKA 1P4FA 4L3LA 3EB0A 4FODA 4JDJA 1OM1A 2F7EE 2YEXA 3W2SA 4CMOA 4DGGA 4C37A 4LRJA 5E8WA 3L1SA 4TTHB 2ITNA 3ZTXA 1QPJA 3QD2B 3TEIA 3UMXA 4JOAA 4G2FA 3VUGA 2B55A 2IO6A 4G6OA 3R73A 2PULA 5AM7A 4EZ5A 4X21A 3R21A 3QQLA 4ZSGA 4AWIA 2C4GA 2I1MA 2XCHA 2ZYBA 2OIQA 3EN7A 4W8EA 3DDQA 5D12A 4O96A 5K0KA 3VBWA 2QOCA 5DRDA 5IA1A 1CSNA 4NUSA 5HCZA 2C6EA 1Y57A 2YERA 3NIZA 4AN3A 5L3AA 2HZ0A 4RIYA 3FMDA 4RFZA 4I5MA 5IH4A 3A62A 1M2QA 4KRCA 5IQIA 3FYKX 3SAYA 3VQUA 2P2IA 4BC6A 3QLGA 5M06A 3EQBA 4IZ7A 1YHWA 4F0FA 2R3NA 5AWMA 5EQYA 3AQVA 2QCSA 4IW0A 5ANIA 2B7AA 2ITYA 5D1JA 2YHVA 1NY3A 4GIIA 4RVMA 5HESA 1BUHA 4BDDA 5FEEA 4BBFA 4NM5A 4FTJA 2UZDA 1YI4A 3RAIA 1OMWA 5CWZA 5ACKA 2R64A 3HV5A 4RJ6A 4IQ6A 1PHKA 4KIQA 4IVBA 4IB0A 5AV4A 4G9RA 3TIZA 4BCIA 4MYGA 2VAGA 3COMA 4EK4A 3D2IA 4NM3A 3KRLA 4C33A 2Z7LA 4JG6A 5KNJA 1YVJA 2ITTA 3QQUA 4WT6A 5LVOA 5C4KA 2C30A 3AG9A 1YHVA 3LMGA 2QODA 3PY3A 4NL0A 4ERWA 5CU3A 3A8WA 4V0GA 1K9AA 2UZBA 4NU1A 3W2OA 5HCYA 4FL1A 2ZDUA 2GQRA 2DS1A 4QMYA 3KULB 4CCUA 4AUAA 4FEUA 4YJQA 4YTCA 5A4EA 2J50A 3FSKA 3U8WA 2YZLA 5EM5A 5DNRA 5HLWA 1VYZA 3UPZA 3HLLA 3PJ1A 2ZMDA 1BKXA 3TKUA 1BI8A 3GVUA 4F1TA 4MXCA 2B0QA 1OB3A 1UVRA 5DGZA 5HTBA 3KCFA 4IC8A 2CHLA 3K5VA 3KFAA 4QP7A 1OPLA 3HL7A 5HX6A 4WD5A 1X8BA 5I9XA 5EQEA 5KX8A 3V5JA 1AGWA 3R8PA 2ZOQA 4JT3A 3QZHA 2DWBA 2XYUA 3A2CA 4H1JA 4QNYA 4BHNA 4FV7A 5KZIA 4MXOA 4CKRA 1CKJA 1FQ1B 4AZEA 3U87A 2J5FA 1Q3DA 3LAUA 4BCOA 3MV5A 2X4FA 4L7SA 4X2NA 2WTIA 3BIZA 1RJBA 2A0CX 3RINA 4CCBA 4BVUA 4FTIA 5DT0A 5IEVA 5JQ5A 3LPBA 1J1BA 4YNOA 5B2MA 2JIIA 4NIFB 5IEXA 3TDWA 2C6KA 2W17A 1ZWSA 3JUHA 5E8UA 4A9SA 4EWQA 3I79A 3FLNC 2CSNA 2VTIA 4ZIMA 1BX6A 1QL6A 2XVDA 3UZRA 3K54A 1WBOA 3HRCA 3O23A 1M52A 1XWSA 4C35A 2ZDTA 3DKGA 3RPRA 4ZP5A 1GZNA 2Y8OA 2HYYA 2RSVA 3GU8A 4QOXA 4O0YA 3EFJA 3Q2JA 3MFTA 4CEGA 1LP4A 2VV9A 3FKOA 2VGOA 4KWPA 5AA8A 3NYOA 3OBGA 2O65A 2CGUA 4E4LA 3U9CA 2W9FB 2OK1A 1YXUA 4P5ZA 1JKKA 3R6XA 3S0OA 4BIBA 3HGKA 4AA5A 4IX5A 1KV2A 4AGDA 2ITPA 3ZFYA 4AXAA 4UXLA 4DBNA 2PE2A 3E93A 4QYFA 2IG7A 4V01A 3BV2A 2X9FA 4OUCA 4RC4A 4MHAA 4IE9A 4WBOA 4IH8A 1XHAA 4PMSA 3UJGA 1H27A 1R78A 3DAJA 2BFXA 5A14A 2YITA 4BTJA 1BYGA 1WVYA 1NW1A 3HAMA 4IWQA 4O0RA 2OU7A 1ERKA 1SNXA 2GNHA 2IW6A 2XUUA 1S9IA 1Z5MA 3AMAA 3BEAA 3DKOA 2CJMA 3KL8A 3LXKA 2OBJA 4L45A 4MX9A 3MPTA 1Y8YA 2C1AA 2JKOA 5C26A 4ZS4A 4NM7A 1M2PA 3OFMA 1YXVA 2ITWA 3CKXA 4E6DA 4EKKA 4ZAUA 4GG5A 1PXMA 4ASEA 2XA4A 2V62A 4BL1A 4ZSLA 2X81A 5J95A 3R8MA 5AEPA 3G6GA 3RBWA 5J5TA 3MY1A 4H58A 1PXPA 1TVOA 2G15A 3ANQA 1DM2A 4KBKA 5BYZA 3CD3A 4C3PA 2R3IA 2JAMA 5I9ZA 3AD6A 5E90A 3MW1A 3DXQA 3C0HA 3FI8A 5DHJA 5I4NA 3EQDA 2G2HA 5FP6A 3O51A 3GBZA 3II5A 1GZOA 4MXAA 4IACA 4XV9A 2R3FA 3LCSA 3BQRA 3BU5A 4QYEA 3K3JA 4XG3A 2G1TA 4AU8A 2FH9A 1OKVA 4A7CA 1H08A 3HDMA 5M53A 2QOLA 1Z9XA 4MTAA 2JIUA 4RG0A 1PYEA 4QQJA 1U54A 4BI0A 4ZSEA 4FT7A 4JRVA 3FI3A 4IFGA 3A61A 3PXYA 4DEAA 4QTCA 4TY1A 3R00A 5F9EA 1SM2A 2C5OA 3BV3A 4WG5A 3RPVA 4BCJA 5K4JA 3V8SA 1JPAA 2J5EA 4PP9A 1PXOA 4WKQA 4FUXA 3SXFA 3CPBA 4PL4A 5HCXA 4NIFA 2XK6A 2HXLA 3DU8A 4HZSA 3MJ2A 4LQMA 4RJ8A 3MA3A 4WRSA 4ANNA 1B6CB 4EI4A 2BKKA 4FV3A 3BGQA 1YOLA 3QQKA 4I93A 4CD0A 4C4JA 4BYIA 3U54A 4YLLA 2FSLX 3QLFA 1H1PA 4FVRA 4K11A 4M97A 4E73A 4HVIA 3RALA 5J7BA 4Y46A 1Q8ZA 3BZ3A 3PG1A 3ZO2A 3ZZEA 5IUGA 3F3UA 3UQGA 4PTGA 4D4YA 4JBPA 3B8QA 3L8VA 1KSWA 4C7TA 2F7ZE 2GS7A 3WZJA 4X2GA 4H1MA 3SG9A 2PK9A 3KC3A 3SQQA 2GPHA 4LRMA 1P5EA 3EN9A 3FJQE 3FL5A 4I94A 5FD2A 4IB5A 4IEBA 5BUJA 5JGBA 4I1ZA 1A06A 3RM6A 3MFSA 5D9HA 4CV8A 1OL2A 3ZUTA 3ANRA 2J6MA 4FMQA 4D1ZA 3KCKA 5JFXA 4FE2A 2UW3A 3UZPA 3OZ6A 4M12A 2O63A 2VWZA 4YZBA 2IVUA 4YNEA 4WNKA 4TKSA 3WOWA 4R5YA 4BGQA 4QD6A 4HYIA 2XIKA 4D2SA 3KRXA 3TUCA 5JFSA 1O6KA 3G5DA 4J98A 2WTKB 3HUBA 2GSFA 4LI5A 5CVFA 5DT3A 3VS4A 3VW6A 4F4PA 3MYGA 3P0MA 2BHEA 2VX3A 2YIQA 4FTNA 4NFNA 5CSXA 2FO0A 1UNGA 2UVYA 4XV2A 4FOBA 3VJOA 3PRIA 1JSTA 3ORXA 5L2WA 4UN0C 4FKTA 2HZ4A 3KN5A 3R28A 2DUVA 1DS5A 1UU9A 1G8SA 4GH2A 3OG7A 2WXVA 2UW6A 5FEDA 2WAJA 2XS0A 4TN6A 4DLJA 4IWOA 4OTFA 4XUFA 2CLXA 3M42A 4G31A 4WG4A 2WHBA 1SVGA 5E92A 4ZOGA 3G2FA 1OKYA 4ASDA 1KE5A 2YWPA 3CQUA 4UXQA 2R3RA 3VRYA 4FTKA 4AX8A 2WZJA 4JBOA 4XG9A 3R7UA 3BBTB 3CGOA 5B2KA 3TXOA 5IU2A 3DS6A 4GEOA 4J7BA 2EXMA 4F7NA 4O21A 3V5PA 2C5VA 5EQPA 1SYKA 3CY3A 4NTTA 4R3CA 2WD1A 3GC0A 5EHOA 2FA2A 2J51A 3BWJA 3GI3A 3FXZA 5A46A 2WNTA 5HG7A 3ZLYA 2R3GA 5LMKC 4RFYA 3ORPA 3ALNA 2X2KA 3IGOA 5HNGA 4DAWA 1A9UA 5AV1A 4DFNA 2XKEA 4U80A 4XOZA 4HVGA 5BPYA 4BDIA 1H1QA 1NA7A 4KABA 3REPA 3JR1A 2X7FA 4IAYA 4UMPA 2XRUA 4Z7HA 2OZOA 5AP6A 4NCTA 1MUOA 2V7OA 2Y4IC 3MFUA 2PVMA 4RIXB 2B54A 3QKLA 3BLRA 3QTRA 1VEBA 2JITA 3LXNA 3QZFA 5IKWA 4EBVA 3R9HA 4FIGA 1SZMA 3D5UA 4FNZA 4C4IA 4K8AA 4R3RA 3MGYA 3TN8A 4MNEB 5HIDA 4ALUA 1OUKA 1YW2A 2RL5A 1JKTA 4GL9A 4LOQA 1J7UA 4KIKB 2H6DA 3H3CA 5BVKA 3E92A 3FPMA 4EONA 4EH6A 3BHVA 4RQVA 2UW4A 4KBAA 1YOJA 5DOSA 5LCJA 4R3PA 3C13A 4C4EA 2FSTX 2E9UA 2WO6A 4K6ZA 3PXZA 3DB8A 3PJ8A 3OOMA 4U8ZA 1LEZA 4L7FA 5IH5A 4EQUA 4W4XA 2QVSE 1WZYA 2B52A 3R2BA 3L9NA 3DPKA 4CZUA 2GQSA 5CNOA 4UB7A 4BCNA 3QD0A 2PVNA 3NS9A 1JKSA 3FXXA 4O7RA 4ZZOA 4IX4A 3AXWA 4I6FA 4JR7A 4OBOA 4C4HA 1U46A 2BTSA 3CP9A 5J1WA 3I4BA 2C1BA 4IAKA 4QP3A 2PVLA 3C1XA 4U7ZA 5JZNA 3DB6A 4DH5A 5BVNA 5FXRA 5IA0A 4WO5A 5CAOA 2VN9A 1Z57A 4JIKA 3DQWA 3NIEA 3ITZA 2XNBA 2W7XA 4YJRA 4BCPA 2BDFA 3OY1A 2ESMA 4IB3A 3SOAA 3QGWA 1KOBA 3EIDA 4GIHA 4B99A 5CEKA 2ZV9A 3FXWA 3GCUA 4K18A 2VD5A 4WNMA 4BCMA 3OTVA 4W4VA 4Z7GA 3I60A 2ZB0A 4J52A 4IDTA 1H4LA 4F6SA 2X39A 1GIJA 3VC4A 3KXXA 2Y7JA 3F5UA 4BTFA 5D10A 5KBRA 4DFUA 3QRIA 1H0VA 3QX2A 4CRSA 4TYIA 3I6UA 2FYSA 3PJ3A 4E4XA 5BVFA 5LWNA 2GNLA 4WBBB 3MB7A 1J7LA 3AC8A 1UNHA 3B2TA 1H1SA 3BPRA 5EM8A 5JN2A 3FQEA 4EOQA 3HVCA 1NXKA 2OJJA 4C0TA 5JRSA 2XK4A 3WF9A 5C4LA 4DE4A 4X7QA 2PUIA 2XBJA 4FSWA 2YM6A 5JRQA 4YZMA 4FR4A 3G0FA 5AJQA 4TL0A 3NUPA 1YHSA 3CJGA 4XX9A 5TR6A 4GS6A 3PA3A 5GZ8A 1CDKA 3O8TA 4I3ZA 3BWFA 3WIGA 4YGAA 1P14A 3BQCA 3KN6A 3D0EA 3RNIA 2BDWA 2Q83A 2XM8A 1WVWA 2UZVA 5FUTA 1W0XC 5CEPA 2W1IA 3VS5A 5DLSA 2G2FA 3R63A 4RIXA 5T68A 2IVVA 5AR8A 3RWQA 4AF3A 4H39A 4QP4A 4E93A 3E8DA 1B39A 4BF2A 3MIYA 2HELA 2J90A 2BIKB 4WNOA 3EFWA 4R5SA 3MB6A 4FTMA 4M3QA 5AFVA 3IS5A 3MJ1A 4MNEA 4BKYA 3VIDA 3DTCA 4Q2AA 4Y95A 3RM7A 2HZNA 4D4SA 4PMMA 4KIKA 5HBEA 5AP0A 4LFIA 4QMUA 5AV2A 4ZZMA 1H24A 2R3PA 3SLSA 3O7LD 1F3MC 3RAHA 1W82A 2QHNA 5IZFA 4JNWA 4JX7A 5GZ9A 3F7ZA 4JXFA 3QYZA 5EDRA 2B53A 2JEDA 3A7FA 4OTHA 3LFDA 3NW5A 4QMMA 5TF9A 1DAWA 3PYYA 4LV5A 5T3QA 3KREA 5M07A 2J0LA 5TO8A 3PA4A 5C9CA 4DTBA 4RIWB 3TUDA 5AV0A 2OJIA 2X8IA 2A1AB 3NWWA 4ZEGA 3TZ8A 2HCKA 4B9DA 4IADA 4X3FB 5DIAA 2QOKA 1UWJA 3DJ5A 3EFLA 4RGJA 4XRLA 3R9DA 4EL9A 4M84A 4BI1A 4ZJVA 3IG7A 5I0BA 4CG9A 1PMVA 2ZV7A 4AG8A 4AGUA 2R5TA 3PXKA 4AGCA 5IQDA 3MSSA 3BRBA 1YXSA 2C6IA 3VHEA 1APME 2OH4A 5DT4A 2PMNX 3W2PA 2V55A 3F3WA 4QMZA 1REJA 4ZK5A 2JDTA 4TZRA 2OWBA 1FGIA 4Y5QA 2ITUA 3PLSA 4JBQA 4QYYA 1JAMA 2UVZA 3KXHA 3AD5A 5JMSA 2WGJA 4DEEA 4RWJA 2BFYA 4FV1A 3R22A 4A4OA 4TW9A 4U42A 3ZM9A 5AR4A 4CNHA 4QMVA 4PPBA 4AT5A 3SDJA 2P3GX 3AC4A 3F6XA 3MBLA 3KK9A 4P5QA 1OIRA 3UP2A 4AT3A 2QI8A 2W4OA 4DG3E 1CKPA 5JSMA 5CF6A 5JZJA 1UKIA 3F5GA 3TI1A 5HD4A 2RIOA 4D4VA 4EKLA 4U45A 3RK9A 3EZRA 4X2JA 2BKZA 4ONAA 4D9UA 2UZUE 4XCUA 2XKFA 1H26A 2JLDA 3AD4A 4FVQA 3F5PA 2QG7A 4K33A 4BDJA 4QMSA 3PP0A 3EYHA 2PZIA 2UZEA 3AGLA 3BEGA 3ETAA 1R0PA 2XNPA 4GRBA 4QRCA 1STCE 3BLHA 3KVXA 1S9JA 3QTZA 3DGKA 4EOJA 4M8TA 2C5XA 2KTYA 3HA8A 3HP2A 3IPHA 1M7QA 2GS6A 3DXNA 4FZFB 5M4IA 2FSMX 3BE9A 5IPJA 3QRTA 2VTSA 4PUZA 4EH3A 3U4UA 2PUPA 2OO8X 4AZWA 4N70A 1K3AA 3OT8A 3RGFA 3QGYA 2DYLA 3UC3A 1Q8WA 1XO2B 2GNJA 4FTQA 2J4ZA 4USDA 4R1VA 4O84A 4ZMEA 1W8CA 2CCIA 1FOTA 4H3PA 4WSQA 3OEFX 2VO0A 3LFAA 3KMUA 5DMZA 4TWCA 2J0MB 4TXCA 1Q4LA 3C7QA 5CX9A 2OIBA 2W1DA 4FGBA 2GDOA 3VUMA 1JQHA 2IJMA 5BUIA 5J7HA 1CTPE 2XZSA 1RQQA 5HE0A 3LCDA 4EOSA 3WYXA 5HVJA 4KRDA 3F61A 4L01A 3VUKA 4G1WA 4QP2A 2QR8A 3ZS5A 2UW0A 3LLAA 5E8ZA 2C5NA 2GTNA 1JOWB 3R1YA 3UIMA 5HZNA 2J9MA 4X3FA 3RTPA 3RPOA 3I1AA 5H8GA 3DY7A 4F7LA 2JDVA 2CMWA 2PE1A 5GJGA 5DE2A 3IECA 2VGPA 3VUIA 5DBXA 3TL8A 3C4EA 1Y6BA 4RBLA 3FY0A 5HNIX 5AX9A 4WHZA 3CC6A 2XNEA 3FUPA 4FEXA 4ZJIA 5J1VA 2CGWA 3DCVA 1UV5A 4QPMA 4BFMA 4XH6A 3ZBFA 4ACHA 3VWAA 2XYNA 2IW8A 5J9ZA 5CI6A 5EOLA 4BR3A 4ACMA 1KE9A 2QO7A 2Q0BA 3PZHA 3IOPA 3UOJA 3L9MA 3EKNA 4O22A 2UW5A 3HMPA 3IDPA 3MPMA 2F4JA 4U6RA 3O96A 5D11A 2QR7A 2XBAA 5KMIA 2ACXA 3L9LA 4S32A 4ZMFA 2FVDA 3ROCA 4ZY5A 1Q41A 5DVRA 3ZEPA 3ORNA 3OUNB 4P90A 4ASXA 3HUCA 4PPCA 4ZZNA 4XHKB 4Q9ZA 5IUIA 4LUDA 5BYLA 1ZZLA 3QWJA 4IDVA 4ACGA 4M15A 5LVNA 2BRHA 4CQGA 4DF3A 5C8KA 1OVEA 3MH1A 4KBCA 2XKCA 4M0ZA 1W83A 4L42A 4EHVA 3VRZA 5EKOA 1OL1A 2CN5A 3GOPA 5CSVA 3ZUVA 3HV7A 5E7RA 2X2MA 1P4OA 2H9VA 3F5XA 3HECA 2HK5A 2BRBA 3ORIA 1PXNA 4PY1A 2R0UA 3HYHA 4CLJA 1XH4A 1JVPP 2PTKA 3NAYA 4FV4A 3BBWA 3NYXA 4OBPA 2PYWA 1OIQA 3KU2A 4F6WA 3R9NA 5HVKA 3QUEA 2ONLA 4XLVA 4B6LA 3MH0A 3I0QA 2WKMA 3DTWA 1ND4A 4AA4A 3SX9A 4I0SA 4RJ7A 3CIKA 1YOMA 4TWOA 3D14A 2VTLA 1U59A 3RK5A 1ZY4A 3V04A 3O2MA 3V01A 4JS8A 3G0EA 5DR2A 2R7IA 3CLYA 4O86A 1IA9A 4JRNA 3BYMA 4WRGA 5HBHA 1UU3A 4XOYA 5CXZA 4HNIA 5GIPE 4NSTA 3VW8A 2BALA 2ZM4A 1O6YA 1IA8A 3HV4A 4I5HA 4CGAA 2EB2A 5E9EA 2B9FA 3TTIA 4MBIA 2R3HA 4WSYA 2C3IB 5FLFA 4TPTA 4HVSA 3ZFXA 2P55A 2LAVA 4J53A 4FT5A 5HE1A 2P33A 5J87A 5KBQA 4NT4A 3D5XA 2HY81 3FZOA 4ZS0A 4DEBA 3FC2A 3JY9A 3NCGA 4FKOA 3R8VA 4KB8A 4HZRA 2XJ2A 2YM5A 4ZY4A 1OIYA 4C62A 5AIKA 4CFNA 2OZAB 4RFMA 3KXNA 3ODYX 4UMTA 5HLPA 4AW2A 4KD1A 3UMWA 3VS7A 4MF0A 5CSHA 4FSUA 4RWLA 3MA6A 3QC9A 3D4QA 5C8NA 4JQEA 4A9RA 2VO3A 5AR5A 2O64A 3UOHA 4GUBA 3NMUF 5A4TA 2XJ1A 3GNIB 4GVJA 3UNJA 3QHWA 2Z60A 4O27B 3D9VA 5ANJA 5GJFA 3PFQA 4M69B 5L8LA 2BILB 3LQ8A 2UZTA 1TQIA 2XF0A 5AM6A 3UP7A 2Z8CA 3ACKA 3GFEA 5AA9A 1XBCA 2GU8A 3PXFA 2C0IA 3Q9XA 1GZKA 3KK8A 3Q5IA 4F1MA 4O7WA 3Q3BA 4NYEA 4Y85A 4AOIA 2OGVA 5AMNA 1YWRA 3ZONA 4EHEA 5KMNA 1OECA 4IAAA 5IQFA 4LV8A 3RMFA 4C38A 4DH3A 5EK7A 2WMTA 5CF5A 1SVHA 3UOLA 2F2UA 3PIYA 2XK9A 3DBEA 2RFDA 3ULIA 3ZBXA 4O82A 4YJVA 5ACBC 3LIJA 2PSQA 2WPAA 3JXWA 3KRJA 2Q0NA 3QL8A 5A4LA 2IZRA 2VX1A 1YDTE 3RCDA 5J79A 5ANGA 3V5LA 4FIEA 2GNFA 4NWMA 3DQXA 4DG2E 4A4XA 2X4ZA 3A60A 3TWJA 3LMHA 4N4SA 1V0PA 3VN9A 3ET7A 4BIEA 4O7SA 2CKEA 3NRMA 4I24A 4FTRA 3V6SA 1U54B 4QP8A 4C36A 5DA3A 2I40A 4PDPA 4ACCA 4D58A 5IQAA 3DKCA 4EJ7A 1H00A 1LPUA 4MQ1A 3Q5ZA 5H9BA 5C01A 1K2PA 3DAEA 3NUXA 3VUTA 3NNXA 1ZYLA 1W84A 5E1EA 3MS9A 2AUHA 3T3UA 3UZTA 4EC8A 1JSVA 2GNIA 2HENA 1OBDA 3N4UA 2ITOA 3IDBA 3QTSA 2XEYA 3SV0A 3I5ZA 2JBPA 4B0GA 4EOPA 3JS2A 2B9IA 2R9SA 4YBKA 4JAIA 4AOJA 1REKA 2XK8A 1UKHA 2OXDA 4RC3A 4U41A 4PNIA 3TNHA 1WBVA 5FM2A 4KSQA 3UTOA 3DA6A 3UQCA 5KMOA 3TNWA 3A99A 4AGWA 3FZTA 3GQLA 3UO5A 4JG8A 3DBQA 3NYVA 4G34A 3A7JA 5HG8A 2YCFA 3P86A 3QYWA 4UZDA 3NUAA 5G6VA 2X9EA 4QTAA 4H05A 4NK9A 4FT0A 3GEQA 2YDJA 3IW8A 5AP3A 3MH2A 2UZNA 4HGSA 2V5QA 1BL6A 2SRCA 3CS9A 2A27A 3WF6A 4FG7A 5F20A 2OZAA 4MVFA 4GMYA 3OCSA 3NVKI 3O50A 4YTHA 3EQGA 5AP4A 4J97A 1OPJA 1MRUA 3UGCA 3PE2A 2YA9A 3OUKA 3V5WA 4DLIA 3KY2A 3MI9A 4OTGA 4KIPA 4YHJA 1GY3A 1CMKE 2PVHA 3BYSA 1FPUA 3FI2A 3N9XA 4GCJA 4M69A 2O3PA 3U9NA 1OUYA 4R1YA 4EOMA 2BRNA 5IA2A 4JL9A 3FAAA 4GV1A 2CLQA 3R2YA 2PMLX 3BX5A 2R3OA 4YMJA 4I22A 4FG8A 4GK4A 4EC9A 4M0YA 4QP1A 3KRRA 3OP5A 4J1RA 4J99A 4RVTA 4D2VA 4G6NA 5EYKA 2J7TA 5BX0A 2PMOX 2WMRA 2W1ZA 3U6HA 5K9IA 4ZSJA 2R3QA 3CPCA 3OCGA 4UMRA 5M09A 5IQBA 5J9YA 3OXIA 4DFZE 2BZKB 3FQHA 4FVPA 4ITJA 3H30A 4XNEA 3ZYAA 5JT2A 5B2LA 3ZSHA 4DFXE 2QC6A 4CFFA 4D55A 3AGMA 3ODZX 2QO9A 2W1HA 1AQ1A 4C4GA 2ETKA 4RJ5A 4FSYA 4F1OA 4GUEA 4C2VA 3A7HA 1KE8A 3DLZA 2WEIA 4I20A 4EHZA 2RFEA 1MP8A 5EYMA 2OICA 4XG2A 3UC4A 4FT3A 5EW9A 1JBPE 1BMKA 2QKWB 3O7LB 3I81A 5CU2A 5GHVA 4IAZA 5CEOA 5M4CA 4G3GA 5CLPA 4B8LA 5IDNA 3F7WA 1Y91A 3H4JA 3I7CA 4UZHA 4XS2A 5JGDA 4KA3A 4YJNA 1KV1A 4QQCA 3QKMA 4QP9A 4YHTA 4BCFA 4E3CA 2Y4IB 1YI3A 3CTHA 4YU2A 1G5SA 1MQBA 5BUEA 4Q5EA 4DGOA 4HOKA 1ZMUA 1GJOA 1UU8A 3TNQB 5HE3A 2OF4A 4OW8A 1Q24A 4I5CA 3GU7A 4QMXA 4OAUC 1BI7A 1GNGA 3JVRA 4FTAA 2YCQA 4FIHA 4U97A 2IN6A 1CM8A 5CSPA 3FLSA 5EOBA 4U79A 5KO1A 2ETMA 4PV0A 4HPUE 4LL0A 3PUPA 3E63A 3C4XA 5HIBA 1J1CA 3PTGA 3FKNA 3KGAA 5JFWA 3QBNA 3GQIA 5B7VA 4EH7A 3IW6A 3NDMA 4TYGA 2WMWA 4F99A 5M57A 4CT1A 3IQ7A 4DG0E 4EOIA 4D4RA 4AZTA 1NT2A 2W0JA 4KKGA 3BI6A 4NKAA 4ID7A 4XP0A 1PXKA 1VZOA 3VUDA 4MAOA 3UBDA 2YWVA 1IRKA 2PVYA 3UIXA 2I0HA 1URCA 2WELA 1UU7A 4KUJA 3UQFA 2VTAA 1WMKA 5JH6A 1QCFA 3IW4A 1ZARA 5FBOA 4L3PA 1DI9A 4EEVA 5HU3A 4L6QA 3ZRLA 2RG5A 1PXJA 5CANA 4D2WA 4FKPA 5CU6A 4LMNA 4QMPA 4BWPA 4C57A 4DH7A 3BE2A 4EQCA 3MDYA 2QU6A 1Q8UA 3FPQA 1KE6A 3MFRA 4RPVA 3R71A 1ZMWA 4WUNA 4W4WA 1A48A 4IM3A 3P7AA 4KINA 3KA0A 4AA0A 4LRKA 1G8AA 2XNGA 2HW7A 2V22A 5L6PA 5KMKA 1SMHA 4QPSA 3EHAA 1EH4A 4IZAA 4CTCA 4P7EA 3G33A 4F0IA 4X6QC 5AADA 1I09A 2UW9A 1WBSA 2ZM1A 4O0SA 4FI1A 3HRFA 3Q52A 4UEUA 5FG8A 3N4VA 4NJ3A 3TV4A 4S34A 3WYYA 5A9UA 3RAKA 5L6OA 3SXSA 4YLJA 4USFA 4AW5A 3KF4A 5ETCA 4Z16A 4ACDA 4BN1A 2YIRA 4FNYA 3DZQA 2WTDA 3QF9A 4QNAA 2OJFE 3R1NA 3VO3A 3DK7A 3VS2A 4YURA 5LMKA 2BAQA 3OXTA 1RW8A 4FKQA 4U3ZA 5KKRC 3F82A 4OTDA 4GT3A 5M55A 3IGGA 2HIWA 3PJ2A 3AC3A 5AP2A 3W55A 5HHWA 2UW7A 4CFVA 4DHFA 5CAPA 5M51A 3Q6WA 3BCEA 1O9UA 4G3FA 5FXSA 2J0KA 4FK3A 4EWHA 3CXWA 3ENMA 4H3BA 3KKVA 5AUWA 4AZVA 3TJCA 3RK7A 2NRUA 3ATSA 1KOAA 1V1KA 4HCUA 4R78A 4L8MA 2UW8A 2QLUA 2HZIA 3VBQA 4AAAA 3P7BA 5GZAA 4CV9A 4ZTNA 2ZB1A 3KB7A 3NEWA 2I0EA 2BUJA 4HYSA 2F2CB 3UODA 1Q5KA 3E64A 3EN5A 1VJYA 3CCNA 4XV3A 5BVOA 5EG3A 2NO3A 3VS1A 4XYFA 3TT0A 4CFXA 2IZTA 1M17A 4FICA 2OF2A 3T9IA 3WZKA 2CGVA 4D5HA 4RRVA 1H1RA 4I41A 3CE3A 4PDOA 1Q97A 4BWKA 5ETFA 4DH8A 2CNUA 5JFVA 1UNLA 3IKAA 3H0ZA 4IM0A 2PZ5A 4GVAA 4V05A 3UIUA 4AE6A 3OHTA 5F95A 3HMMA 4KKEA 5AAFA 2PVRA 4IJPA 4I21A 4PTEA 4RIOA 4TT7A 3ID6C 3M2WA 5HGIA 2VWBA 3TG1A 2IPXA 1UA2A 1IEPA 2YM3A 4II5A 3I0OA 2H34A 2J0JA 4D0WA 3U6IA 5FTQA 3FE3A 2W05A 4RVLA 4C59A 3LFQA 1H25A 3G9NA 4O91A 4RVKA 5GNKA 5LMAA 3QC4A 2CNQA 3D94A 2P2HA 4FSTA 3VF9A 5AAEA 1OKZA 3VUHA 2ITZA 4BDHA 4F09A 3OC1A 4N6ZA 3R0TA 5IMXA 4LGHA 1Q62A 4LG4A 3QXOA 4XG4A 2HOGA 3BHTA 4FV6A 4CQEA 4ANBA 4DEGA 3U4WA 5M44A 3GC8A 4LL5A 3TDVA 2O5KA 4I0TA 3L9PA 4GW8A 2XIZA 4FEWA 3EKKA 4AW1A 2YM8A 4OTQA 3QALE 1PRYA 5K4IA 3C4FA 3P08A 2GCDA 4CVAA 5IA4A 5FRIA 2YCRA 3NUNA 2RFNA 2YDKA 3BU6A 3ZCLA 4QYHA 4XP2A 2YISA 4IVDA 3W33A 4BDGA 4CXAA 3E7OA 1LUFA 3FSFA 2GS2A 4NFMA 3OW3A 4OTIA 4PDSA 3VJNA 4HVDA 3QCSA 3WF5A 5JGAA 1YQJA 3Q4TA 5CENA 2NP8A 1O6LA 5DPVA 2GHLA 3NZ0A 4ZTSA 3UNKA 4E5WA 3LXPA 4FKIA 5JEBA 3NUUA 5I3RA 3PDTA 1PXLA 4PMTA 3U6JA 4ENXA 5H3QA 3UVPA 4L67A 3O0GA 2YZAA 3PXQA 3CBLA 2VX0A 2W5HA 5CQWA 5ANKA 5TOZA 3UG1A 4I92A 2FB8A 3LJ0A 4LGDA 3F2RA 2JD5A 3QQGA 5CYIA 4BDCA 2OW3A 3E87A 4FKVA 4RWKA 4BZDA 3LQ3A 3A7GA 4ZY6A 5AUVA 3OBJA 4DBXA 3NSZA 3HRBA 4HPTE 1JSUA 4A07A 1OIUA 4BDAA 5F4NA 3FZSA 4F9CA 4D2RA 3WILA 3FWQA 2JDSA 5L2IA 2C3KA 4JG7A 2R3LA 5IQHA 2WMUA 2OKRA 2RKUA 1XH8A 3PIXA 2GMXA 3CEKA 4L3JA 4BWXA 3CTQA 1WBNA 2PZRA 1R0EA 3FZRA 3EMGA 3O8PA 5EFQA 4QMLA 3SW4A 3DJ6A 4Y5HA 1OPKA 5E8SA 3RKBA 2HAKA 2YM4A 2PUUA 4GT5A 1ZLTA 4MQ2A 4EOKA 2FGIA 2XKDA 2YIWA 1VR2A 3E62A 1VYWA 4BBMA 4HGLA 3NW6A 4NW6A 3JY0A 5AR3A 2WQMA 2ZMCA 3LOKA 2E2BA 5DEWA 4R77A 4AZFA 4F7SA 4I0RA 3ULZA 4L00A 3QFVA 4YC8A 4C2WA 1YDSE 4BKZA 4QMOA 5EDQA 3WIKA 5E4HA 1YWNA 5EM7A 3LW0A 4FV0A 4QMNA 2ZVAA 4FZDB 4QYGA 5AUYA 4D9TA 3BGZA 4RX5A 4G9CA 4J8NA 4PPAA 5ANEA 3Q96A 4DA5A 5J8IA 4QQ5A 3DFAA 3R04A 2PZYA 2ERZE 5AP7A 4CMTA 4EBWA 3C4WA 3PZEA 3LXLA 4DTAA 5CAUA 2WMAA 3NX8A 3QKKA 5CTPA 2QO2A 3UIBA 2F7XE 4U81A 3TKHA 4N6YA 2XK3A 4GSBA 4NJDA 3E8EA 4YJSA 2QHMA 4EJNA 4ANQA 1OL6A 3I6WA 3GXLA 4ZLZA 3QQHA 1OL7A 3Q4CA 3PWDA 2RFSA 3D5VA 4J71A 2IZUA 5H2UA 4OGRA 2C0OA 1GAGA 4Y83A 5FTGA 2VWVA 3AOXA 4C3RA 4YJTA 3Q4ZA 1KUTA 1ZYDA 3FMKA 3C0GA 4HGEA 4W4YA 4YP8A 3QX4A 2C6LA 4X3JA 5ANOA 4CFWA 4NEUA 4S2ZA 1XQZA 5M4UA 3NW7A 4FV9A 3QXPA 3QUDA 1ZZ2A 1ZXEA 4Y73A 4PP7A 5KMMA 3VQHA 2JGZA 4K77A 3ZC5A 3LJ1A 4KSPA 3L8XA 5CQUA 4AN2A 2QQ7A 1NVSA 1W7HA 4FKGA 2Y0AA 2ZJWA 4QTEA 1T45A 3RJCA 4BCKA 1JWHA 2XIRA 3PRFA 3GCSA 2CNVA 3P78A 5IQGA 4HNFA 3TCPA 2C69A 3U51A 5FGKA 4BTKA 1J3HA 3TNIA 1XH5A 4U0IA 4U44A 4EUUA 3ROYA 2RG6A 3EQHA 3EZVA 4O7NA 2OH0E 1M2RA 3AT4A 3ZEWA 3BHHA 4BKJA 2IVSA 3DV3A 4WUAA 4P4CA 2WU7A 3ALOA 3ZLWA 5C1QB 3LKMA 4O83A 4USEA 4O81A 2E9OA 3D2KA 3G6HA 4E26A 3RHXA 2CCHA 4IFCA 3TTJA 4ALVA 1H0WA 1YXTA 2VWXA 2WIPA 3CQWA 3GFWA 3LQ5A 3W18A 5EW8A 4NKSA 3O17A 1YKRA 4IJ9A 5KHWA 3H9OA 5HO7A 3W16A 3AMYA 4TYJA 4IWPA 4FV8A 2I6LA 3W2RA 4ERKA 4GU9A 4K9YA 5L2SA 4L68A 3HV3A 4H36A 4H3QA 4CMUA 4OAVB 2OFVA 4YO4A 2XIYA 4GJ3A 4R8QA 4UMUA 3OOGA 1XH6A 4L46A 3POOA 4DEDA 2GQGA 1L8TA 4O1PA 4QT1A 5A6OA 4FK6A 3RCJA 3IO7A 4P2KA 4JAJA 4FL2A 3RVGA 4RJ4A 4G3EA 1IAHA 2X0GA 3KQ7A 2B9HA 3E88A 4L43A 2ITVA 1H8FA 3L8PA 4BRXA 1GOLA 5LMBA 3OTUA 2VZ6A 3MVHA 2GTMA 5LOHA 2R2PA 3QQFA 4DT8A 5DR9A 3GC7A 4IAIA 4O6LA 5T6KA 3UO6A 4E20A 2BRGA 3QRJA 2O2UA 1WVXA 4GYGA 2VU3A 2PU8A 4GKHA 3BGPA 3P4KA 5K3YA 3TUBA 3BKBA 3PXRA 3W1FA 4BZOA 2W4JA 4RZVA 4Y72A 5AUZA 1NVQA 4ITHA 3R8LA 3OT3A 3R7GA 4FEVA 3UYTA 3MWUA 3A4OX 4GFOA 5FP5A 3D7TB 1B38A 4GFGA 5AUXA 4JVGA 4QMWA 3EFKA 4K1BA 4TWNA 1U5RA 3R7YA 3ZM4A 4QMQA 4MBJA 4LYNA 1H01A 1PMUA 2W1FA 3M11A 2UVXA 1QPEA 3OWPA 4E7WA 3AT3A 4GG7A 1YI6A 4YC6A 4O1OA 3IW5A 3R02A 3ACJA 5EI8A 4BCHA 4XMOA 5K5XA 1MRYA 3NVMB 2HY0A 3ERKA 4AACA 3DLSA 3MVJA 3V5TA 4M13A 3FMJA 4XG7A 4TRLA 2QOBA 5EW3A 1R3CA 2G9XA 5CAVA 3GU6A 2Z2WA 3LM5A 3F2NA 3OY3A 5ETIA 3LFFA 5AV3A 3WE4A 2BZJA 2QONA 2BPMA 2OFUA 3GCQA 2R7BA 4ALWA 3HEGA 2VTMA 4FKWA 2IW9A 3SKCA 4FZ6A 3VAPA 3FL4A 1QMZA 2WTJA 3HDNA 4HGTA 4DGLC 4JDKA 4UWYA 4FV5A 3ZOSA 4YZNA 3EQIA 5AR7A 4V04A 1PMNA 4GK3A 3SXRA 4Y8DA 4C61A 3Q9YA 4FKRA 4MD8E 4IIRA 1URWA 3E8CA 3TJDA 3E5AA 4FIIA 5CVHA 2BAJA 3DOGA 5IUHA 4FSRA 3G90X 5A6NA 1G3NA 1I44A 4I5PA 4O0VA 4XV1A 4E5AX 3CD8A 4FTOA 3FBVA 3B8RA 2WMVA 4YJOA 5GIOE 5EDPA 3FHIA 5HO8A 4W9XA 5FBNC 1V0OA 2QOQA 3HZTA 1KE7A 2OI4X 1ZOHA 5EI6A 4BIDA 3N4TA 3QU0A 3R7EA 2BR1A 3WF8A 3TM0A 3V6RA 4BICA 4AN9A 2P0CA 5J9LA 5M08A 1YWVA 1Q3WA 2QU5A 1PY5A 3IW7A 4O0UA 4G16A 1ZYCA 1QPCA 4F9AA 3FEGA 4FBXA 1XKKA 5CNNA 5HQ0A 4BTMA 3O71A 3NUYA 4FX3A 1WFCA 1DI8A 2PZPA 4CFMA 5HEZA 4MNFA 4E4NA 5HIEA 4M66A 4UY9A 4BI2A 2R3MA 3HMIA 3FZ1A 3PPZA 4TYHA 5DEYA 4U40A 2OXXA 3DXPA 4PDYA 5JKGA 4MWIA 3R8ZA 5HNBA 5DG5A 5HI2A 2X1NA 5TKDA 4L53A 3TACA 1PF8A 5CF4A 3QHRA 3G15A 2WTCA 3MVLA 4I6HA 4CFUA 3PJCA 3OW4A 4G3DA 3D7TA 3R01A 3Q6UA 4DITA 3KXGA 4WOVA 4D28A 3PPJA 2PVJA 3QTXA 4F0GA 3GC9A 3C4ZA 5LARA 5IISA 4OT5A 2YLFA 3LFCA 3FHRA 4BGHA 5FXQA 3E7VA 3SD0A 4ENYA 4MF1A 4IWDA 3RPSA 2VWUA 4E8AA 4G5JA 2Z02A 3RWPA 4E1ZA 3PSCA 5FWKK 4XG8A 2J0IA 2CDZA 3KXZA 4PWNA 2W99B 2BRMA 4YBJA 3W10A 2BTRA 4ZTMA 4BYJA 3PWYA 3DT1A 4JR3A 3Q4UA 4YO6A 3SHEA 3VF8A 3ZU7A 1XJDA 4RA5A 4ASZA 4CTBA 5HU9A 1R1WA 5F94A 5BVWA 2XMYA 4E4MA 5A3XA 4J95A 3ZRMA 4YJPA 3TIYA 4W8DA 3ZC6A 3KF7A 4D1XA 5ETAA 3BHUA 3OMVA 4S33A 2JKMA 4GU6A 2G01A 3F9NA 4FG9A 2VUWA 1M7NA 2OIDA 2IZSA 5FTOA 3LFEA 4FYNA 3COKA 4I4FA 5EI2A 2X8EA 4MCVA 2REIA 4ZLYA 2VWYA 5EM6A 4RQKA 4FTUA 5HD7A 5CASA 5HO6A 3QTIA 4JJRA 4RJ3A 3F3ZA 2XRWA 3QA0A 2QLQA 3FMMA 2XIXA 2LGCA 1E1VA 3NR9A 1Q8TA 4DGNA 2XH5A 3R83A 4IBMA 2HXQA 3PE1A 5E91A 3B2WA 4YJUA 3FYJX 1MQ4A 2OXYA 4NZWB 4F63A 3OVVA 2JKQA 3AC1A 3BYOA 3MY0A 4LUEA 5L8JA 3BU3A 4OR5A 1XR1A 2C6MA 3G9LX 4BZNA 4PNKA 2VWWA 5CZIA 2C5YA 2ERKA 3QZIA 2VTNA 1XBAA 3FI4A 5BQ0A 4G3CA 2A2AA 3EYGA 3NLBA 3M1SA 4PX6A 3DBFA 5LVMA 1OZ1A 1RDQE 3V3VA 3RNYA 2E9VA 2V0DA 5ICPA 3OWJA 1PKGA 4BDEA 5CXHA 3D83A 4DCEA 1ZYJA 3WZDA 2QOIA 3CGFA 4HYUA 4C3FA 4FKSA 4AZSA 1LEWA 1L3RE 4XG6A 3F2AA 2B9JA 4BCGA 2ZV2A 3OWKA 4JBVA 3VS3A 3MVMA 3QA8A 2H8HA 4E6CA 3ZLXA 1ATPE 4FT9A 2UZWE 1H1WA 3PPKA 2HWPA 4FTCA 3S3IA 3ORMA 3TZ9A 3V5QA 5LXMA 3R8UA 1FGKA 2YLEA 5I9VA 4IHPA 4OT6A 3S95A 2C3LA 4X6RA 3VS6A 3T3VA 2C6OA 3TKIA 5H8BA 5LCKA 3G51A 4FA2A 2YAAA 3LCTA 3O8UA 4JDHA 4OTRA 4JDIA 4HW7A 3KULA 4C4FA 3LHJA 4BB4A 2B1PA 2GFCA 4TWPA 3WZEA 3QD3A 4ZTHA 2Y6MA 2C68A 2WQOA 5GJDA 1WBTA 3DFCB 3DKFA 2IVTA 5ANDA 4E6AA 3HKOA 2F9GA 3DK6A 4MD7E 4C02A 3VULA 1OKWA 4A9UA 4EK6A 4EUTA 2BZHB 2QURA 3EL7A 3IDCA 4HCTA 5DR6A 3ZH8A 3R30A 5KUPA 2XB7A 2GHMA 2PE0A 3PP1A 3RPYA 4D2PA 2YCSA 5AUUA 3C9WA 3IK3A 1H07A 5IQEA 5AAGA 1M14A 1WAKA 2C6TA 2ZM3A 4QPAA 1TQPA 3ZFMA 4ANMA 2O0UA 2W5AA 3VBTA 5EYDA 3W8QA 3MIAA 5BVDA 3LFBA 5KCVA 3MTFA 2G2IA 4EK8A 4TNDA 2WU6A 4FKUA 2FSOX 3VBVA 4CZTA 3GUBA 5CEQA 3VNTA 1T46A 3D5WA 4IB1A 5I9WA 5LQFA 2YDIA 4S31A 4X2KA 5TE0A 4OTPA 1F0QA 3QTQA 1UWHA 2CGXA 4LMUA 5IF1A 5KKRB 3GB2A 3DNEA 3GT8A 3HX4A 1QPDA 1IR3A 4NW5A 5DN3A 5E8VA 5AX3A 4CZYB 3BELA 5BNJA 3HMNA 3Q9ZA 2X2LA 5A4CA 2BHHA 1J7IA 2QG5A 3KMWA 3WF7A 5BMSA 2B4SB 1BLXA 4KNBA 5D7VA 1PW2A 2XNMA 4U43A 4YTIA 2JFMA 4PMPA 2W1EA 4O6EA 2R3KA 3Q53A 5CY3A 4EZ3A 4GKIA 2Y9QA 5IA3A 3EQFA 3Q9WA 3F69A 3U55A 2BIYA 4XRJA 5CI7A 2ITQA 2Z7RA 4FSZA 3W8LA 4FIJA 1FVVA 2VTRA 2XM9A 3QWKA 4FV2A 3CKWA 1AD5A 4CT2A 2W1GA 3NNVA 5KHXA 4YZDA 4FKJA 5HX8A 3FMEA 3FKLA 2EVAA 5DI1A 1FBNA 1Y6AA 4EK5A 2W9ZB 5DFPA 3S1HA 4O7VA 4DCAA 4UX9A 3C5UA 2RF9A 1GZ8A 2ZV8A 3EQRA 4KIOA 4QQTA 3LFSA 3V8TA 3Q32A 3PA5A 5B0XA 2YIYA 2R0IA 3PVWA 2W96B 1IG1A 5I9UA 4U5JA 4GYIA 3BHYA 3FMNA 3LCKA 1YDRE 4L9IA 4XEYA 4O2PA 4RC2A 4MH7A 3NPCA 3HMOA 3SW7A 4Q9SA 4ZLOA 2VO7A 2Y6OA 4FKLA 2WFYA 4YZ9A 4IXPA 4IZYA 5L2QA 4RLKA 5E8YA 5CVGA 3GU4A 4E6QA 5HG5A 4FSMA 4A9TA 3QUPA 4WIHA 3H0YA 3UNZA 3E3PA 4RT7A 3K3IA 2GHGA 4K0YA 4CG8A 4RX9A 1YRPA 1ZY5A 4O38A 4F08A 4DEIA 4TNBA 2WEVA 3COHA 3FV8A 3ZDIA 3DBDA 2X7OA 2YAKA 4XP3A 3Q04A 3KRWA 2I0YA 3LFNA 2UZOA 4ITIA 3UDBA 4YC3A 4N57A 4NH1A 4EYJA 2YACA 3P79A 4LM5A 2AC5A 5DH3A 4F70A 4YR8A 4NCTC 4ZSAA 2CN8A 3KEXA 2PPQA 3WBLA 4YPSA 1YXXA 3PVBA 1XH7A 2WMBA 4A4LA 5BMMA 3DZOA 1PKDA 4HYHA 5HICA 4QMTA 5EH0A 4BBEA 4DC2A 2Y4PA 2WMXA 3ZMMA 3S2PA 3PG3A 3ELJA 4FYOA 4I6QA 4XBRA 4FNWA 4ZTRA 3QRUA 4BGGA 3P5KA 1JLUE 2FUMA 4DINA 2A4LA 2XK7A 3MN3A 4GFMA 5LJJA 3OCTA 2OJ9A 4QTDA 1OGUA 4YSMA 4D2TA 2I7QA 3PY1A 3SOCA 3CJFA 1WBPA 4M67A 2VO6A 1BL7A 3ZUUA 1MRVA 2EUFB 4NM0A 3C0IA 2ZAZA 4I4EA 4N0SA 4XLIA 3Q2MA 4UWCA 4AOTA 4FOCA 5KMJA 2YFXA 3VVHA 4DH1A 1PJKA 5CS6A 2NRYA 2WQBA 4C34A 2VNWA 5CSWA 3UPXA 2WQEA 2C0TA 4DN5A 4G17A 4A9YA 3D7ZA 4UBAA 3UO4A 5HLNA 3KXMA 1P2AA 4ANLA 4GT4A 1FVRA 4O7YA 3UYSA 4O7ZA 4YTFA 2X7GA 3FY2A 4KKHA 5BVEA 5I9YA 4KS7A 4UALA 2EB3A 2QNJA 2WTKC 3RI1A 4DYMA 2VTPA 3E3BX 3OROA 5JQ8A 4BDBA 4Q5HA 3GOKA 2EWAA 5H8EA 4K2RA 4EYMA 3FLWA 3W32A 4BY9E 1JNKA 3LMIA 2VWIA 4AFJA 3SA0A 5KE0A 3A7IA 4W9WA 2CKOA 3WARA 3R9OA 3RZFA 4F6UA 2JDOA 1ZOGA 3Q60A 4AFEA 4QTBA 1GIIA 4AT4A 2QOOA 3H10A 4CKIA 4O0XA 5FEQA 3EL8A 3IOKA 1W98A 4LGGA 3ZLSA 4GK2A 5HTCA 3FMHA 3QAME 3DNDA 4OBQA 3SRVB 4CYIA 4G6LA 4HJOA 4O7TA 4M68A 4TYEA 4DT9A 3DBCA 3JVSA 3UVQA 4IM2A 1Q61A 3ZSIA 4RMZA 5IA5A 1FINA 3OWLA 3THBA 5A54A 4J8MA 1FVTA 4FUYA 4O0WA 4F9WA 5CEMA 4YPDA 4F65A 5CEIA 1OBGA 2BROA 2BDJA 3QQJA 4RWIA 4ANOA 3LE6A 4FZ7A 4MD9E 3QRKA 4FC0A 5G1XA 1Y8GA 2X6DA 5HG9A 2JFLA 2R3JA 2JAVA 3ZO4A 3ZRKA 3UOKA 4U9AA 4PTCA 2WOTA 2IWIA 2PY3A 3AC5A 4IAFA 3P1AA 1JKLA 3RAWA 3SVVA 3SGCA 1Q8YA 3UE4A 3H9RA 4ZTQA 3PVGA 2PUNA 3OS3A 3FDNA 2UV2A 2OJGA 5CAQA 3HA6A 3QTUA 4EH5A 3HAVA 4F7JA 3AT2A 3TZ7A 2PVFA 3GU5A 4IVAA 4BDFA 4EH4A 4Z55A 4O7LA 2EXCX 4APPA 3P9JA 2F49A 3QCQA 4R6VA 3UVRA 4S30A 1PXIA 3ZO3A 1ZMVA 4PL3A 4BHZA 5C27A 2VTQA 2XEZA 3HNGA 4FNXA 4LOPA 2HW6A 5IG1A 3PLAE 4F9YA 3F3TA 3CSVA 1HCKA 4PF4A 3ZDUA 4HVHA 2OLCA 1ZRZA 3EOCA 4IC7A 3R7IA 3EWHA 1R39A 5HKMA 5IQCA 1H28A 3COIA 4JQ8A 4AS0A 2A19B 3PY0A 3T9TA 3H9FA 3TV7A 2JDRA 3EN6A 5K0XA 5HOAA 4Z9LA 2EXEA 3HP5A 5CF8A 3NGAA 1NVRA 3PSBA 4MBLA 5FDXA 5L4QA 2QKRA 4WA9A 1FMOE 5CALA 5EYCA 3V8WA 3BYUA 4MXZA 4CKJA 4I6BA 2WIHA 3C5IA 1HCLA 1V0BA 1HOWA 3F88A 3GCPA 4EZ7A 4F9BA 3NUSA 4OTWA 3VBYA 3S4QA 2XJ0A 3I5NA 4IZ5A 2J2IB 4FTTA 2WQNA 4IX3A 4NTSA 4O0TA 3VS0A 4E5BA 2WB8A 3N51A 5EHLA 4BDKA 5J5SA 4EH2A 1TKIA 3JPVA 3LVPA 3P23A 4PRJA 4AQCA 3RHKA 3FQSA 1E1XA 3HV6A 5LVPA 3PSDA 1OL5A 3CQEA 1IASA 3FLQA 3ZO1A 2VTHA 1GIHA 4FF8A 5AIRA 4R7IA 3R1SA 4DEHA 1ZOEA 2C6DA 1E9HA 4FSQA 3WZUA 1SNUA 2C47A 4L52A 1ZAOA 3LCOA 2X8DA 4C58A 5E8TA 5IMEA 4UMQA 4YLKA 2YM7A 2XNNA 5CT0A 4EHGA 2UUEA 2YN8A 1XBBA 4GJ2A 3R7VA 5EKNA 2WTWA 1F5QA 2WOUA 4MXXA 1SVEA 2W4KA 3GCVA 2PL0A 3OD6X 3RZBA 3SRVA 3NAXA 3RP9A 5HTIA 3K2LA 1RE8A 2RGPA 2Z7QA 2UZLA 2YABA 3MY5A 4FZAB 4RX8A 3OEZA 3WE8A 4IX6A 2JKKA 3PIZA 4LOOA 2BMCA 3CTJA 3I7BA 4PL5A 2EU9A 5E1SA 4D1SA 2XNOA 5DYJA 3FLZA 4RZWA 2XP2A 3OXZA 5IDPA 2X6EA 2F57A 4YZCA 4IMYA 4L44A 4UWBA 4I23A 4UYAA 3ORTA 5CU0A 5A4QA 3C51A 2VTOA 3R9RA 5IH6A 4MK0A 2QD9A 5BYYA 4O2ZA 3FMLA 1WBWA 2H96A 3JYAA 3MTLA 4PQNA 2ITXA 2R4BA 2OSCA 3L8SA 3ENHA 4QP6A 3TZMA 3R7OA 3OCBA 4DGMA 4X2FA 1DAYA 3KVWA 3DK3A 3W2QA 5GINE 3QTWA 3BYVA 3DDPA 2VTTA 4EQMA 5KMLA 1IAJA 3EH9A 3NYNA 4DTKA 1LR4A 4IVCA 3QCXA 3C50A 4FL3A 3FZPA 4YHFA 4CLIA 3K5UA 3ORKA 2BCJA 2JC6A 5AP5A 5I3OA 5HE2A 3BLQA 4C8BA 1OI9A 4MKCA 4BCQA 3GGFA 1XH9A 2WTVA 3QZGA 2YJSA 2AYPA 3OF0A 3W2CA 1KWPA 5DRBA 3ZXTA 4MEDA 3S00A 4UYNA 2WMQA 2CKQA 3SG8A 4ZTLA 5CT7A 3UG2A 2AC3A 3ZHPC 1CKIA 4X0MA 5L8KA 2OG8A 3ZXZA 3IONA 3D15A 5C8MA 4FEQA 3R1QA 2NNWB 4ORKA 4EORA 1PYXA 1U5QA 2YJRA 4A06A 2PVKA 3ORZA 2BZIB 4CYJA 5FQDC 3MPAA 3AC2A 4WG3A 1Q99A 1TQMA 4CSVA 2O8YA 4IANA 4MWHA 3POZA 4AP7A 4RX7A 5EHYA 1U4DA 5ITAA 1PMEA 3DJ7A 3EQPA 4FIFA 5AR2A 2C3JA 3LZBA 4RIYB 5IEYA 3C4CA 4X3FC 2P4IA 3NNWA 3LM0A 3A8XA 3ORLA 4JIAA 3NCZA 4EH8A 4DFBA 4CRLA 5TT7A 3EN4A 3VHKA 5FDPA 4B4LA 5AP1A 5LWMA 3WI6A 3SC1A 5L6WL 2ETRA 5K5NA 2BVAA 3GP0A 3GENA 4B8MA 4AW0A 5DWRA 4DFYA 4QO9A 4RIWA 3CR0A 5LVLA 3DAKA 4FSNA 4EH9A 4JI9A 2HWOA 4XJ0A 4F64A 2BAKA 4TYHB 1J91A 5CZHA 4DFLA 5JK3A 5HVYA 4JX3A 4UV0A 4YUQA 3V51A 4HCVA 2PMIA 4KS8A 5FM3A 2V7AA 3QD4A 2PHKA 2W1CA 3EJ1A 4YSJA 4AE9A 4ARKA 5M4FA 3MH3A 4G5PA 3VBXA 4R7HA 4EK3A 3TV6A 4R7BA 3PVUA 5CU4A 3NNUA 2I0VA 1ZYSA 2DQ7X 4Z3VA 3A4PA 5HORA 4RA4A 3F66A 4V0GB 2NPQA 4FGRA 4MXYA 2JBOA 4OLIA 2QOFA 4JQ7A 2W5BA 3ATTA 4ZXTA 1WCCA 2CKPA 5L2TA 2YIXA 4ZJJA 5M56A 3TNPC 4RLLA 2JIVA 2GFSA 3FC1X 5C03A 4APCA 5KZ0A 4EOOA 5I5ZA 3MESA 4RSSA 2VRXA 4KAOA 4FTLA 4D5KA 3E8NA 2PWLA 2W06A 4XBUA 5E8XA 2E9PA 2KULA 3ZSGA 3T8OA 2Z7SA 4WNPA 5D41A 4M14A 5HBJA 1OITA 3CY2A 3AMBA 5D7AA
chains in the Genus database with same CATH superfamily
2CPKE 4D0XA 3ZZWA 3FLYA 5AUTA 3LJ2A 5F1ZA 2QOHA 3LLTA 2E9NA 2WMSA 3F3VA 3P7CA 1FMKA 2VNYA 4JLCA 2VTJA 2GNGA 3KMMA 3QCYA 2ONLC 4M7IA 4B7TA 4ANSA 4EOLA 3EQCA 4J96A 4U3YA 2XCKA 1P4FA 4L3LA 3EB0A 4FODA 4JDJA 1OM1A 2F7EE 2YEXA 3W2SA 4CMOA 4DGGA 4C37A 4LRJA 5E8WA 2AEGA 3L1SA 4TTHB 2ITNA 3ZTXA 1QPJA 3QD2B 3TEIA 3UMXA 4JOAA 4G2FA 3VUGA 2B55A 2IO6A 4G6OA 3R73A 2PULA 5AM7A 4EZ5A 4X21A 3R21A 3QQLA 4ZSGA 4AWIA 2C4GA 2I1MA 2XCHA 2ZYBA 2OIQA 3EN7A 4W8EA 3DDQA 5D12A 4O96A 5K0KA 3VBWA 2QOCA 5DRDA 5IA1A 1CSNA 4NUSA 5HCZA 2C6EA 1Y57A 2YERA 3NIZA 4AN3A 5L3AA 2HZ0A 4RIYA 3FMDA 4RFZA 4I5MA 4DDGA 5IH4A 3A62A 1M2QA 4KRCA 5IQIA 3FYKX 3SAYA 3VQUA 2P2IA 4BC6A 3QLGA 5M06A 3EQBA 4IZ7A 1YHWA 4F0FA 2R3NA 5AWMA 5EQYA 3PFYA 3AQVA 2QCSA 4IW0A 5ANIA 2B7AA 2ITYA 5D1JA 2YHVA 1NY3A 4GIIA 4RVMA 5HESA 1BUHA 4BDDA 5FEEA 4BBFA 4NM5A 4FTJA 2UZDA 1YI4A 3RAIA 1OMWA 5CWZA 5ACKA 3KIOC 2R64A 3HV5A 4RJ6A 4IQ6A 1PHKA 4KIQA 4IVBA 4IB0A 5AV4A 4G9RA 3TIZA 4BCIA 4MYGA 2VAGA 3COMA 4EK4A 3D2IA 4NM3A 3KRLA 4C33A 2Z7LA 4JG6A 5KNJA 1YVJA 2ITTA 3QQUA 4WT6A 5LVOA 5C4KA 2C30A 3AG9A 1YHVA 3LMGA 2QODA 3PY3A 4NL0A 4ERWA 5CU3A 2A98A 3A8WA 4V0GA 1K9AA 2UZBA 4NU1A 3W2OA 5HCYA 4FL1A 2ZDUA 2GQRA 2DS1A 4QMYA 3KULB 4CCUA 4AUAA 4FEUA 4YJQA 4YTCA 5A4EA 2J50A 3FSKA 3U8WA 2YZLA 5EM5A 5DNRA 5HLWA 1VYZA 3UPZA 3HLLA 3W0MA 3PJ1A 2ZMDA 1BKXA 3TKUA 1BI8A 3GVUA 4F1TA 1TFFA 4MXCA 2B0QA 1OB3A 1UVRA 5DGZA 5HTBA 3KCFA 4IC8A 2CHLA 3K5VA 3KFAA 4QP7A 1OPLA 3HL7A 5HX6A 4WD5A 1X8BA 5I9XA 5EQEA 4DHIB 5KX8A 3V5JA 1AGWA 3R8PA 2ZOQA 4JT3A 3QZHA 2DWBA 2XYUA 3A2CA 4H1JA 4QNYA 4BHNA 4FV7A 5KZIA 4MXOA 4CKRA 1CKJA 1FQ1B 4AZEA 3U87A 2J5FA 2XAOA 1Q3DA 3LAUA 4BCOA 3MV5A 2X4FA 4L7SA 4X2NA 2WTIA 3BIZA 1RJBA 2A0CX 3RINA 4CCBA 4BVUA 4FTIA 5DT0A 5IEVA 5JQ5A 3LPBA 1J1BA 4YNOA 5B2MA 2JIIA 4NIFB 5IEXA 3TDWA 2C6KA 2W17A 1ZWSA 3JUHA 5E8UA 4A9SA 4EWQA 3I79A 3FLNC 2CSNA 2VTIA 4ZIMA 1BX6A 1QL6A 2XVDA 3UZRA 3K54A 1WBOA 3HRCA 3O23A 1M52A 1XWSA 4C35A 2ZDTA 3DKGA 3RPRA 4ZP5A 1GZNA 2Y8OA 2HYYA 2RSVA 3GU8A 4QOXA 4O0YA 3EFJA 3Q2JA 3MFTA 4CEGA 1LP4A 2VV9A 3FKOA 2VGOA 4KWPA 5AA8A 3NYOA 3OBGA 2O65A 2CGUA 4E4LA 3U9CA 2W9FB 2OK1A 1YXUA 4P5ZA 4LDTA 1JKKA 3R6XA 3S0OA 4BIBA 3HGKA 4AA5A 4IX5A 1KV2A 4AGDA 4AXEA 2ITPA 3ZFYA 4AXAA 4UXLA 4DBNA 2PE2A 3E93A 4QYFA 2IG7A 4V01A 3BV2A 2X9FA 4OUCA 4RC4A 4MHAA 4IE9A 4WBOA 4IH8A 1XHAA 4PMSA 3UJGA 1H27A 1R78A 3DAJA 2BFXA 5A14A 2YITA 4BTJA 1BYGA 1WVYA 1NW1A 3HAMA 4IWQA 4O0RA 2OU7A 1ERKA 1SNXA 2GNHA 2IW6A 2XUUA 1S9IA 1Z5MA 3AMAA 3BEAA 3DKOA 2CJMA 3KL8A 3LXKA 2OBJA 4L45A 4MX9A 3MPTA 1Y8YA 2C1AA 2JKOA 5C26A 4ZS4A 4NM7A 1M2PA 3OFMA 1YXVA 2ITWA 3CKXA 4E6DA 4EKKA 4ZAUA 4GG5A 1PXMA 4ASEA 2XA4A 2V62A 4BL1A 4ZSLA 2X81A 5J95A 3R8MA 5AEPA 3G6GA 3RBWA 5J5TA 3MY1A 4H58A 1PXPA 1TVOA 2G15A 3ANQA 1DM2A 4KBKA 5BYZA 3CD3A 4C3PA 2R3IA 2JAMA 3PUFC 5I9ZA 3AD6A 5E90A 3MW1A 3DXQA 3C0HA 3FI8A 5DHJA 5I4NA 3EQDA 2G2HA 5FP6A 3O51A 3GBZA 3II5A 1GZOA 4MXAA 4IACA 4XV9A 2R3FA 3LCSA 3BQRA 3BU5A 4QYEA 3K3JA 4XG3A 2G1TA 4AU8A 2FH9A 1OKVA 4A7CA 1H08A 3HDMA 5M53A 2QOLA 1Z9XA 4MTAA 2JIUA 4RG0A 1PYEA 4QQJA 1U54A 4BI0A 4ZSEA 4FT7A 4JRVA 3FI3A 4IFGA 3A61A 3PXYA 4DEAA 4QTCA 4TY1A 3R00A 5F9EA 1SM2A 2C5OA 3BV3A 4WG5A 3RPVA 4BCJA 5K4JA 4DHJA 3V8SA 1JPAA 2J5EA 4PP9A 1PXOA 4WKQA 4FUXA 3SXFA 3CPBA 4PL4A 5HCXA 4NIFA 2XK6A 2HXLA 3DU8A 4HZSA 3MJ2A 4LQMA 4RJ8A 3MA3A 4WRSA 4ANNA 1B6CB 4EI4A 2BKKA 4FV3A 3BGQA 1YOLA 3QQKA 4I93A 4CD0A 4C4JA 4BYIA 3U54A 4YLLA 2FSLX 3QLFA 1H1PA 4FVRA 4K11A 4M97A 4E73A 4HVIA 3RALA 5J7BA 4Y46A 2XALA 1Q8ZA 3BZ3A 3PG1A 3ZO2A 3ZZEA 5IUGA 3F3UA 3UQGA 4PTGA 4D4YA 4JBPA 3B8QA 3L8VA 1KSWA 4C7TA 2F7ZE 2GS7A 3WZJA 4X2GA 2X0PA 4H1MA 3SG9A 2PK9A 3KC3A 3SQQA 2GPHA 4LRMA 1P5EA 3EN9A 3FJQE 3FL5A 4I94A 5FD2A 4IB5A 4IEBA 5BUJA 5JGBA 4I1ZA 1A06A 3RM6A 3MFSA 5D9HA 4CV8A 1OL2A 3ZUTA 3ANRA 2J6MA 4FMQA 4D1ZA 3KCKA 5JFXA 4FE2A 3P5JC 2UW3A 3UZPA 3OZ6A 4M12A 2O63A 2VWZA 4YZBA 2IVUA 4YNEA 4WNKA 4TKSA 3WOWA 4R5YA 3W0QA 4BGQA 4QD6A 4HYIA 2XIKA 4D2SA 3KRXA 3TUCA 5JFSA 1O6KA 3G5DA 4J98A 2WTKB 3HUBA 2GSFA 4LI5A 5CVFA 5DT3A 3VS4A 3VW6A 4F4PA 3MYGA 3P0MA 2BHEA 2VX3A 2YIQA 4FTNA 4NFNA 5CSXA 2FO0A 1UNGA 2UVYA 4XV2A 4FOBA 3VJOA 3PRIA 1JSTA 3ORXA 4O4CA 4UN0C 5L2WA 4FKTA 2HZ4A 3KN5A 3R28A 2DUVA 1DS5A 1UU9A 1G8SA 4GH2A 3OG7A 2WXVA 2UW6A 5FEDA 2WAJA 2XS0A 4TN6A 4DLJA 4IWOA 4OTFA 4XUFA 2CLXA 3M42A 4G31A 4WG4A 2WHBA 1SVGA 5E92A 4ZOGA 3G2FA 1OKYA 4ASDA 1KE5A 2YWPA 3CQUA 4UXQA 2R3RA 3VRYA 4FTKA 4AX8A 2WZJA 4JBOA 4XG9A 3R7UA 3BBTB 3CGOA 5B2KA 3TXOA 5IU2A 3DS6A 4GEOA 4J7BA 2EXMA 4F7NA 4O21A 3V5PA 2C5VA 5EQPA 1SYKA 3CY3A 4NTTA 4R3CA 2WD1A 3GC0A 5EHOA 2FA2A 2J51A 3BWJA 3GI3A 3FXZA 5A46A 2WNTA 5HG7A 3ZLYA 2R3GA 5LMKC 4RFYA 3ORPA 3ALNA 2X2KA 3IGOA 5HNGA 4DAWA 1A9UA 5AV1A 4DFNA 2XKEA 4U80A 4XOZA 4HVGA 5BPYA 4BDIA 1H1QA 1NA7A 4KABA 3REPA 3JR1A 2X7FA 4IAYA 4UMPA 2XRUA 4Z7HA 2OZOA 5AP6A 4NCTA 1MUOA 2V7OA 2Y4IC 3MFUA 2PVMA 4RIXB 2B54A 3QKLA 3BLRA 3QTRA 1VEBA 2JITA 3LXNA 3QZFA 5IKWA 4EBVA 3R9HA 4FIGA 4O4DA 1SZMA 3D5UA 4FNZA 4C4IA 4K8AA 4R3RA 3MGYA 3TN8A 4MNEB 5HIDA 4ALUA 3W0PA 1OUKA 1YW2A 2RL5A 1JKTA 4GL9A 4LOQA 1J7UA 4KIKB 2H6DA 3H3CA 5BVKA 3E92A 3FPMA 4EONA 1G8JA 4EH6A 3BHVA 4RQVA 2UW4A 4KBAA 1YOJA 5DOSA 5LCJA 4R3PA 3C13A 4C4EA 2FSTX 2E9UA 2WO6A 4K6ZA 4LV7A 3PXZA 3DB8A 3PJ8A 3OOMA 4U8ZA 1LEZA 4L7FA 5IH5A 4EQUA 4W4XA 2QVSE 1WZYA 2B52A 3R2BA 3L9NA 3DPKA 4CZUA 2GQSA 5CNOA 4UB7A 4BCNA 3QD0A 2PVNA 3NS9A 1JKSA 3FXXA 4O7RA 4ZZOA 4IX4A 3AXWA 4I6FA 4JR7A 4OBOA 4C4HA 1U46A 2BTSA 3CP9A 5J1WA 3I4BA 2C1BA 4IAKA 4QP3A 2PVLA 3C1XA 4U7ZA 5JZNA 3DB6A 4DH5A 5BVNA 5FXRA 5IA0A 4WO5A 5CAOA 2VN9A 1Z57A 4JIKA 3DQWA 3NIEA 3ITZA 2XNBA 2W7XA 4YJRA 4BCPA 2BDFA 3OY1A 2ESMA 4IB3A 3SOAA 3QGWA 1KOBA 3EIDA 4GIHA 3BLAA 4B99A 5CEKA 2ZV9A 3FXWA 3GCUA 4K18A 2VD5A 4WNMA 4BCMA 3OTVA 4W4VA 4Z7GA 3I60A 2ZB0A 4J52A 4IDTA 1H4LA 4F6SA 2X39A 1GIJA 3VC4A 3KXXA 2Y7JA 3F5UA 4AXFA 4BTFA 5D10A 5KBRA 4DFUA 3QRIA 1H0VA 3QX2A 4CRSA 4TYIA 3I6UA 2FYSA 3PJ3A 4E4XA 5BVFA 5LWNA 2GNLA 4WBBB 3MB7A 1J7LA 3AC8A 1UNHA 3B2TA 1H1SA 3BPRA 5EM8A 5JN2A 3FQEA 4EOQA 3HVCA 1NXKA 2OJJA 4C0TA 5JRSA 2XK4A 3WF9A 5C4LA 4DE4A 4X7QA 2PUIA 2XBJA 4FSWA 2YM6A 5JRQA 4YZMA 4FR4A 3G0FA 5AJQA 4TL0A 3NUPA 1YHSA 3CJGA 4XX9A 5TR6A 4GS6A 3PA3A 5GZ8A 1CDKA 3O8TA 4I3ZA 3BWFA 3WIGA 4YGAA 1P14A 3BQCA 3KN6A 3D0EA 3RNIA 3NFGB 3UDSA 2BDWA 2Q83A 2XM8A 1WVWA 2UZVA 5FUTA 1W0XC 5CEPA 2W1IA 3VS5A 5DLSA 2G2FA 3R63A 4RIXA 5T68A 2IVVA 5AR8A 3RWQA 4AF3A 4H39A 4QP4A 4E93A 3E8DA 1B39A 4BF2A 3MIYA 2HELA 2J90A 2BIKB 4WNOA 3EFWA 4R5SA 3MB6A 4FTMA 4M3QA 5AFVA 3IS5A 3MJ1A 4MNEA 4BKYA 3VIDA 3DTCA 4Q2AA 4Y95A 3RM7A 2HZNA 4D4SA 4PMMA 4KIKA 5HBEA 5AP0A 4LFIA 4QMUA 5AV2A 4ZZMA 1H24A 2R3PA 3SLSA 3O7LD 1F3MC 3RAHA 1W82A 2QHNA 5IZFA 4JNWA 4JX7A 5GZ9A 3F7ZA 4JXFA 3QYZA 5EDRA 2B53A 2JEDA 3A7FA 4OTHA 3LFDA 3NW5A 4QMMA 5TF9A 1DAWA 3PYYA 4LV5A 5T3QA 2XANA 3KREA 5M07A 2J0LA 5TO8A 3PA4A 5C9CA 4DTBA 4RIWB 3TUDA 5AV0A 2OJIA 2X8IA 2A1AB 3NWWA 4ZEGA 3TZ8A 2HCKA 4B9DA 4IADA 4X3FB 5DIAA 2QOKA 1UWJA 3DJ5A 3EFLA 4RGJA 4XRLA 3R9DA 4EL9A 4M84A 4BI1A 4ZJVA 3IG7A 5I0BA 4CG9A 1PMVA 2ZV7A 4AG8A 4AGUA 2R5TA 3PXKA 4AGCA 5IQDA 3MSSA 3BRBA 1YXSA 2C6IA 3VHEA 1APME 2OH4A 5DT4A 2PMNX 3W2PA 2V55A 3F3WA 4QMZA 1REJA 4ZK5A 2JDTA 4TZRA 2OWBA 1FGIA 4Y5QA 2ITUA 3PLSA 4JBQA 4QYYA 1JAMA 2UVZA 3KXHA 3AD5A 5JMSA 2WGJA 4DEEA 4RWJA 2BFYA 4FV1A 3R22A 4A4OA 4TW9A 3ML1A 4U42A 3ZM9A 5AR4A 4CNHA 4QMVA 4PPBA 4AT5A 3SDJA 2P3GX 3AC4A 3F6XA 3MBLA 3KK9A 4P5QA 1OIRA 3UP2A 4AT3A 2QI8A 2W4OA 4DG3E 1CKPA 5JSMA 1VLRA 5CF6A 5JZJA 1UKIA 3F5GA 3TI1A 5HD4A 2RIOA 4D4VA 4EKLA 4U45A 3RK9A 3EZRA 4X2JA 2BKZA 4ONAA 4D9UA 2UZUE 4XCUA 2XKFA 1H26A 2JLDA 3AD4A 4FVQA 3F5PA 2QG7A 4K33A 4BDJA 4QMSA 3PP0A 3EYHA 2PZIA 2UZEA 3AGLA 3BEGA 4DDIA 3ETAA 1R0PA 2XNPA 4GRBA 4QRCA 1STCE 3BLHA 3KVXA 1S9JA 3QTZA 3DGKA 4EOJA 4M8TA 2C5XA 2KTYA 3HA8A 3HP2A 3IPHA 1M7QA 2GS6A 3DXNA 4FZFB 5M4IA 2FSMX 3BE9A 5IPJA 3QRTA 2VTSA 4PUZA 4EH3A 3U4UA 2PUPA 2OO8X 4AZWA 4N70A 1W2DA 1K3AA 3OT8A 3RGFA 3QGYA 2DYLA 3UC3A 1Q8WA 1XO2B 2GNJA 4FTQA 2J4ZA 4USDA 4R1VA 4O84A 4ZMEA 1W8CA 2CCIA 1FOTA 4H3PA 4WSQA 3OEFX 2VO0A 3LFAA 3KMUA 5DMZA 4FJVA 4TWCA 2J0MB 4TXCA 2NYAA 1Q4LA 3C7QA 5CX9A 2OIBA 2W1DA 4FGBA 2GDOA 3VUMA 1JQHA 2IJMA 5BUIA 5J7HA 2X0OA 1CTPE 2XZSA 1RQQA 5HE0A 3LCDA 4EOSA 3WYXA 5HVJA 4KRDA 3F61A 4L01A 3VUKA 4G1WA 4QP2A 2QR8A 3ZS5A 2UW0A 3LLAA 5E8ZA 2C5NA 2GTNA 1JOWB 3R1YA 3UIMA 5HZNA 2J9MA 4X3FA 3RTPA 3RPOA 3I1AA 5H8GA 3DY7A 4F7LA 2JDVA 2CMWA 2PE1A 5GJGA 5DE2A 3IECA 2VGPA 3VUIA 5DBXA 3TL8A 3C4EA 1Y6BA 4RBLA 3FY0A 5HNIX 5AX9A 4WHZA 3CC6A 2XNEA 3FUPA 4FEXA 3VONA 4ZJIA 5J1VA 2CGWA 3DCVA 1UV5A 4QPMA 4BFMA 4XH6A 3ZBFA 4ACHA 3VWAA 2XYNA 2IW8A 5J9ZA 5CI6A 5EOLA 4BR3A 4ACMA 1KE9A 2QO7A 2Q0BA 3PZHA 3IOPA 3UOJA 3L9MA 3EKNA 4O22A 2UW5A 3HMPA 3IDPA 3MPMA 2F4JA 4U6RA 3O96A 5D11A 2QR7A 2XBAA 5KMIA 2ACXA 3L9LA 4S32A 4ZMFA 2FVDA 3ROCA 4ZY5A 1Q41A 5DVRA 3ZEPA 3ORNA 3OUNB 4P90A 4ASXA 3HUCA 4PPCA 4ZZNA 4XHKB 4Q9ZA 5IUIA 4LUDA 5BYLA 1ZZLA 3QWJA 4IDVA 4ACGA 4M15A 5LVNA 2BRHA 4CQGA 3W0OA 4DF3A 5C8KA 1OVEA 3MH1A 4KBCA 2XKCA 4M0ZA 1W83A 4L42A 4EHVA 3VRZA 5EKOA 1OL1A 2CN5A 3GOPA 5CSVA 3ZUVA 3HV7A 1W2FA 5E7RA 2X2MA 1P4OA 2H9VA 3F5XA 3HECA 2HK5A 2BRBA 3ORIA 1PXNA 4PY1A 2R0UA 3HYHA 4CLJA 1XH4A 1JVPP 2PTKA 3NAYA 4FV4A 3BBWA 3NYXA 4OBPA 2PYWA 1OIQA 3KU2A 4F6WA 3R9NA 5HVKA 3QUEA 2ONLA 4XLVA 4B6LA 3MH0A 3I0QA 2WKMA 3DTWA 1ND4A 4AA4A 3SX9A 4I0SA 4RJ7A 3CIKA 1YOMA 4TWOA 3D14A 2VTLA 1U59A 3RK5A 1ZY4A 3V04A 3O2MA 3V01A 4JS8A 3G0EA 3TMOA 5DR2A 2R7IA 3CLYA 4O86A 1IA9A 4JRNA 3BYMA 4WRGA 5HBHA 1UU3A 4XOYA 4AAYA 5CXZA 4HNIA 5GIPE 4NSTA 3VW8A 2BALA 2ZM4A 1O6YA 1IA8A 3HV4A 4I5HA 4CGAA 2EB2A 5E9EA 2B9FA 3TTIA 4MBIA 2R3HA 4WSYA 2C3IB 5FLFA 4TPTA 4HVSA 3ZFXA 2P55A 2LAVA 4J53A 4FT5A 5HE1A 2P33A 5J87A 5KBQA 4NT4A 3D5XA 2HY81 3FZOA 4AXDA 4ZS0A 4DEBA 3FC2A 3JY9A 3NCGA 4FKOA 3R8VA 4KB8A 4HZRA 2XJ2A 2YM5A 4ZY4A 1OIYA 4C62A 5AIKA 4CFNA 2OZAB 4RFMA 3KXNA 3ODYX 4UMTA 5HLPA 4AW2A 4KD1A 3UMWA 3VS7A 4MF0A 5CSHA 4FSUA 4RWLA 3MA6A 3QC9A 3D4QA 5C8NA 4JQEA 4A9RA 2VO3A 5AR5A 2O64A 3UOHA 4GUBA 3NMUF 5A4TA 2XJ1A 3GNIB 4GVJA 3UNJA 3QHWA 2Z60A 4O27B 3D9VA 5ANJA 5GJFA 3PFQA 4M69B 5L8LA 2BILB 3LQ8A 2UZTA 1TQIA 2XF0A 5AM6A 3UP7A 2Z8CA 3ACKA 3GFEA 5AA9A 1XBCA 2GU8A 3PXFA 2C0IA 3Q9XA 1GZKA 3KK8A 3Q5IA 4F1MA 4O7WA 3Q3BA 4NYEA 4Y85A 4AOIA 2OGVA 5AMNA 1YWRA 3ZONA 4EHEA 5KMNA 1OECA 4IAAA 5IQFA 4LV8A 3RMFA 4C38A 4DH3A 5EK7A 2WMTA 5CF5A 1SVHA 3UOLA 2F2UA 3PIYA 2XK9A 3DBEA 2RFDA 3ULIA 3ZBXA 4O82A 4YJVA 5ACBC 3LIJA 2PSQA 2WPAA 3JXWA 3KRJA 2Q0NA 3QL8A 5A4LA 2IZRA 2VX1A 1YDTE 3RCDA 5J79A 5ANGA 3V5LA 4FIEA 2GNFA 4NWMA 3DQXA 4DG2E 4A4XA 2X4ZA 3A60A 3TWJA 3LMHA 4N4SA 1V0PA 3VN9A 3ET7A 4BIEA 4O7SA 2CKEA 3NRMA 4I24A 4FTRA 3V6SA 1U54B 4QP8A 4C36A 5DA3A 2I40A 4PDPA 4ACCA 4D58A 5IQAA 3DKCA 4EJ7A 1H00A 1LPUA 4MQ1A 3Q5ZA 5H9BA 1XMMA 5C01A 1K2PA 3DAEA 3NUXA 3VUTA 3NNXA 1ZYLA 1W84A 5E1EA 3MS9A 2AUHA 3T3UA 3UZTA 4EC8A 1JSVA 2GNIA 2HENA 1OBDA 3N4UA 2ITOA 3IDBA 3QTSA 2XEYA 3SV0A 3I5ZA 2JBPA 4B0GA 4EOPA 3JS2A 2B9IA 2R9SA 4YBKA 4JAIA 4AOJA 1REKA 2XK8A 4BJJB 1UKHA 2OXDA 4RC3A 4U41A 4PNIA 3TNHA 1WBVA 3W0RA 5FM2A 4KSQA 3UTOA 3DA6A 3UQCA 5KMOA 3TNWA 3A99A 4AGWA 3FZTA 3GQLA 3UO5A 4JG8A 3DBQA 3NYVA 4G34A 3A7JA 5HG8A 2YCFA 3P86A 3QYWA 4UZDA 3NUAA 5G6VA 2X9EA 4QTAA 4H05A 4NK9A 4FT0A 3GEQA 2YDJA 3IW8A 5AP3A 3MH2A 2UZNA 4HGSA 2V5QA 1BL6A 2SRCA 3CS9A 2A27A 3WF6A 4FG7A 5F20A 2OZAA 4MVFA 4GMYA 3OCSA 3NVKI 3O50A 4YTHA 3EQGA 5AP4A 4J97A 1OPJA 1MRUA 3UGCA 3PE2A 2YA9A 3OUKA 3V5WA 4DLIA 3KY2A 3MI9A 4OTGA 4KIPA 4YHJA 1GY3A 1CMKE 2PVHA 3BYSA 1FPUA 3FI2A 3N9XA 4GCJA 4M69A 2O3PA 3U9NA 1OUYA 4R1YA 4EOMA 2BRNA 5IA2A 4JL9A 3FAAA 4GV1A 2CLQA 3R2YA 2PMLX 3BX5A 2R3OA 4YMJA 4I22A 4FG8A 4GK4A 4EC9A 4M0YA 4QP1A 3KRRA 3OP5A 4J1RA 4J99A 4RVTA 4D2VA 4G6NA 5EYKA 2J7TA 5BX0A 2PMOX 2WMRA 2W1ZA 3U6HA 5K9IA 4ZSJA 2R3QA 3CPCA 3OCGA 4UMRA 5M09A 5IQBA 5J9YA 3OXIA 4DFZE 2BZKB 3FQHA 4FVPA 4ITJA 3H30A 4XNEA 3ZYAA 5JT2A 5B2LA 3ZSHA 4DFXE 2QC6A 4CFFA 4D55A 3AGMA 3ODZX 2QO9A 2W1HA 1AQ1A 4C4GA 2ETKA 4RJ5A 4FSYA 4F1OA 4GUEA 4C2VA 3A7HA 1KE8A 3DLZA 2WEIA 4I20A 4EHZA 2RFEA 1MP8A 5EYMA 2OICA 4XG2A 3UC4A 4FT3A 1TZDA 5EW9A 1JBPE 1BMKA 2QKWB 3O7LB 3I81A 5CU2A 5GHVA 4IAZA 5CEOA 5M4CA 4G3GA 5CLPA 4B8LA 5IDNA 3F7WA 1Y91A 3H4JA 3I7CA 4UZHA 4XS2A 5JGDA 4KA3A 4YJNA 1KV1A 4QQCA 3QKMA 4QP9A 4YHTA 4BCFA 4E3CA 2Y4IB 1YI3A 3CTHA 4YU2A 1G5SA 1MQBA 5BUEA 4Q5EA 4DGOA 4HOKA 1ZMUA 4BJJA 1GJOA 1UU8A 3TNQB 5HE3A 2OF4A 4OW8A 1Q24A 4I5CA 3GU7A 4QMXA 4OAUC 1BI7A 1GNGA 3JVRA 4FTAA 2YCQA 2IEWA 4FIHA 2IN6A 1CM8A 4U97A 3FLSA 5EOBA 5CSPA 2XAMA 4U79A 5KO1A 2ETMA 4PV0A 4HPUE 4LL0A 3PUPA 3E63A 3C4XA 5HIBA 1J1CA 3PTGA 3FKNA 3KGAA 5JFWA 3QBNA 3GQIA 5B7VA 4EH7A 3IW6A 3NDMA 4TYGA 2WMWA 4F99A 5M57A 4CT1A 3IQ7A 4DG0E 4EOIA 4D4RA 4AZTA 1NT2A 2W0JA 4KKGA 3BI6A 4NKAA 4ID7A 4XP0A 1PXKA 1VZOA 3VUDA 4MAOA 3UBDA 2YWVA 1IRKA 2PVYA 3UIXA 2I0HA 1URCA 2WELA 1UU7A 4KUJA 3UQFA 2VTAA 1WMKA 5JH6A 1QCFA 3IW4A 1ZARA 5FBOA 4L3PA 1DI9A 4EEVA 5HU3A 4L6QA 3ZRLA 2RG5A 1PXJA 5CANA 4D2WA 4FKPA 5CU6A 4LMNA 4QMPA 4BWPA 4C57A 4DH7A 3BE2A 4EQCA 3MDYA 2QU6A 1Q8UA 3FPQA 1KE6A 3MFRA 4RPVA 3R71A 1ZMWA 4WUNA 4W4WA 1A48A 4IM3A 3P7AA 4KINA 3KA0A 4AA0A 4LRKA 1G8AA 2XNGA 2HW7A 2V22A 5L6PA 5KMKA 1SMHA 4QPSA 3EHAA 1EH4A 4IZAA 4CTCA 4P7EA 3G33A 4F0IA 4X6QC 5AADA 1I09A 2UW9A 1WBSA 2ZM1A 4O0SA 4FI1A 3HRFA 3Q52A 4UEUA 5FG8A 3N4VA 4NJ3A 3TV4A 1OGYA 4S34A 3WYYA 5A9UA 3RAKA 5L6OA 3SXSA 4YLJA 4USFA 4AW5A 3KF4A 5ETCA 4Z16A 4ACDA 4BN1A 2YIRA 4FNYA 3TYKA 3DZQA 2WTDA 3QF9A 4QNAA 1XMLA 2OJFE 3R1NA 3VO3A 3DK7A 3VS2A 4YURA 5LMKA 2BAQA 3OXTA 1RW8A 4FKQA 4U3ZA 5KKRC 3F82A 4OTDA 4GT3A 5M55A 3IGGA 2HIWA 3PJ2A 3AC3A 5AP2A 3W55A 5HHWA 2UW7A 4CFVA 4DHFA 5CAPA 5M51A 3Q6WA 3BCEA 1O9UA 4G3FA 5FXSA 2J0KA 4FK3A 4EWHA 3CXWA 3ENMA 4H3BA 3KKVA 5AUWA