2YJSA

Structure of c1156y mutant anaplastic lymphoma kinase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
308
structure length
286
Chain Sequence
PNYCFAGKTSSISDLKEVPRKNITLIRGLGEVYEGQVPLQVAVKTLPEVYSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Structure of C1156Y Mutant Anaplastic Lymphoma Kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 286
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yjsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yjsA01
3THBA 3HX4A 3OW3A 4KBKA 3G6HA 4N6YA 4XRLA 2VD5A 4PUZA 3S3IA 5LCKA 3SAYA 2WXVA 4ZJJA 3UZRA 2Z2WA 5AMNA 4FV3A 4J52A 2EWAA 4IDTA 3RAHA 3F5GA 2XJ2A 3FHIA 4A9SA 4EH6A 4PDYA 3IDPA 2W9FB 2LAVA 1NVSA 4F64A 3MJ2A 2CN8A 4QTDA 3DB8A 2BMCA 3R1QA 2Y4IC 4EOIA 4CG9A 1Z5MA 3OCGA 3AGMA 2VTQA 4MTAA 3TT0A 4EQUA 1KE5A 3KXHA 3P78A 4ACCA 1FGKA 4GG5A 3DOGA 3OT3A 4YHFA 2ITNA 4FTNA 3ZS5A 4NU1A 4DGGA 5EHYA 2VTNA 5KMJA 3GI3A 2I7QA 1UWJA 1WZYA 4CQGA 2R9SA 3MWUA 2BZIB 1P4FA 2XCHA 2W1ZA 3UP2A 4EKKA 4QMUA 1WBWA 3MY0A 3U6IA 4L7FA 4PNIA 4RFYA 3QF9A 4NM0A 4D5HA 2A27A 1LP4A 4E20A 2P3GX 3KA0A 5KZ0A 4EKLA 3SA0A 4O6EA 2UW7A 1LR4A 2IO6A 3FLYA 5EW3A 4XBRA 4M84A 5E8SA 5IQDA 4FV2A 4CFWA 1KE7A 5DH3A 4U0IA 5I5ZA 1Q4LA 5CU0A 1V0OA 5DNRA 2OXDA 3GC0A 4C34A 3HKOA 2REIA 5CX9A 4GEOA 3VULA 4EJNA 1P5EA 2C6EA 2J0MB 2Z60A 2YM3A 4D9TA 2QOCA 3ALOA 2XBAA 4ZMEA 1SVGA 3A8WA 3PA5A 4N57A 3LHJA 3BU6A 2WMAA 2NPQA 3OBGA 4JVGA 2BFYA 4TYEA 4J8NA 3TXOA 5L2TA 1Y8YA 4PQNA 3D14A 5E8XA 4EZ7A 4IVBA 4QMSA 4FT9A 3VUMA 5AUWA 3NIZA 4R3PA 1OPKA 4F9YA 3LFSA 1H27A 2VWBA 4ALUA 4BDEA 4BZNA 3FV8A 3UIMA 4HVDA 2GTNA 2GS6A 3LXLA 2ZV7A 4J71A 3QHWA 4HZSA 2VRXA 4FKTA 4YBJA 4MK0A 2X8IA 2EVAA 3VBXA 4C3RA 2KULA 2IVUA 2I0EA 2GQSA 5HG9A 4L00A 4YMJA 2CGXA 2B53A 1H24A 5HHWA 3U54A 3V6RA 5HGIA 3VBQA 4FE2A 5AWMA 4R6VA 4ACHA 5AX3A 2OO8X 3PXQA 3L8VA 3DS6A 4W4YA 4WBBB 3EQDA 4EHGA 2XYUA 3ROCA 4F6WA 2VTMA 3LFCA 4QQTA 3FMDA 3II5A 4RMZA 3CKXA 3F69A 2JD5A 3FPMA 3LM0A 4R3CA 5I9YA 4ZJIA 5IISA 4AW2A 5CEOA 4MNEB 3NUXA 2C5NA 3DLSA 5CF8A 3NVMB 4UBAA 4YJOA 3VUKA 4YURA 5EOLA 1P4OA 3O7LB 3HV5A 3QKLA 3KULB 4MXXA 3RHXA 4ANLA 3R8MA 1DI8A 2ZVAA 4Q9SA 1CMKE 4BKYA 3TJCA 3R2BA 4ZZMA 3LJ2A 3GQLA 5AUXA 4BBFA 2JIUA 3N9XA 3DFAA 3D4QA 1CSNA 3L8SA 3RPOA 5HG8A 3EN4A 4JDKA 5ANJA 4ZY6A 5FXRA 5HNIX 4AOIA 4GJ3A 4FIHA 4FEVA 3QGWA 1H28A 3NYXA 3P08A 3UZTA 4RIXB 4QYGA 4LV5A 4ORKA 4FKRA 3NR9A 4PV0A 2ETRA 4FT0A 5I9UA 1JBPE 2RIOA 3ODYX 4QTBA 3G0FA 4F7SA 2B1PA 4KBAA 4FKOA 4U3YA 4FL1A 4Z55A 4A4OA 3RZFA 4E4MA 2XNBA 3NUUA 2YEXA 3KXGA 3D0EA 5L6OA 3RMFA 4QPAA 3VS7A 4F9BA 3R8ZA 2C5VA 3C5UA 4I22A 3ANQA 4ZEGA 2I0HA 1FGIA 1QPJA 4K11A 4KRDA 2PE2A 3GCSA 3A99A 4O21A 4XHKB 4Z9LA 4EZ5A 2PUPA 4DCAA 1XBCA 4JS8A 5AV0A 3BHYA 2VAGA 2YIRA 3F9NA 3FL5A 2XM9A 3MTLA 4BWXA 4ANSA 4X2NA 2R4BA 3HMIA 2WZJA 3PUPA 4JBOA 3G0EA 4QP1A 1JKTA 3HAMA 3COHA 4LRKA 1PMUA 4U42A 3C4FA 5BUJA 3OY1A 3VBTA 4AS0A 4RZWA 3QZIA 4ZXTA 1IAJA 2VTJA 2HWOA 3F2NA 2R3MA 3DJ7A 3R71A 4NIFA 4ZTLA 2UZWE 4KKEA 4D5KA 4F4PA 4FV4A 3I79A 2WMTA 3U8WA 5AA8A 3NNWA 3BYSA 4BCGA 3MYGA 3MVHA 3GC9A 2ZDUA 2WTDA 2G2IA 4DH7A 2RFNA 2DS1A 2XIRA 2W1EA 5M4UA 2W99B 1NW1A 3PXYA 3EFWA 3TDVA 3LXKA 3OCSA 5EYDA 1YWVA 4JJRA 4ASZA 4EH9A 3EZRA 2BTSA 5M4IA 2E9OA 5M4FA 4CG8A 5A4CA 2ZV9A 4RJ4A 2EB3A 2SRCA 4XOYA 2WMRA 3TTJA 3WZKA 4BI1A 3PLAE 4QD6A 4L52A 5DYJA 1PRYA 2W17A 4U9AA 1ZAOA 4JIKA 3VUIA 2IZTA 2ETKA 1B38A 4X3FB 5TR6A 2QURA 3W55A 5HIEA 5GINE 4AW5A 1I09A 3JUHA 5TT7A 2H34A 4I4EA 5DFPA 1KE8A 4O1OA 5CSHA 5IZFA 3C4WA 2GNGA 3MPAA 4R5YA 2DQ7X 2XNMA 1ATPE 4GFMA 2F7XE 2IVSA 3PVBA 3LM5A 5CU6A 3MA3A 2XKCA 4OTWA 4FSNA 3OCTA 2CCIA 4TWCA 4HVIA 5FG8A 4PMPA 2YZAA 2O5KA 1YDTE 2IZSA 3R7YA 4EI4A 5DHJA 2W1IA 4EK6A 1JKSA 2YCQA 1RW8A 1SMHA 1GZKA 1F0QA 2UZEA 3PPKA 3UNKA 3F3TA 1UU3A 3FUPA 3R9HA 3MY5A 3E63A 4GG7A 5EM6A 2WAJA 3DZOA 4UMTA 4EC8A 4WA9A 5HD7A 4FKUA 2V7AA 3UPXA 4Y73A 5M09A 2WELA 3PJCA 4LUDA 1JLUE 2HWPA 1SNXA 3NYNA 3UOKA 3ZLWA 2ITVA 4X0MA 1UU7A 5D9HA 4FKPA 2RKUA 3R7IA 4YZDA 3GOKA 2PZPA 3PJ2A 1YXTA 3FE3A 1XO2B 1XBBA 4ZTSA 5GIOE 3MFSA 1JKLA 4YO6A 5H9BA 3MH0A 4O6LA 4QTCA 3W10A 3VWAA 5H8EA 3FZOA 5F95A 4FTUA 2WQNA 2R3QA 3GVUA 3MY1A 3NNUA 5EM8A 4II5A 1TQMA 3BI6A 5DT0A 2BILB 1ZY4A 3P4KA 4V01A 4IWQA 2ONLA 2W5HA 5F94A 3BELA 2GS7A 3VQUA 3Q4TA 2Q0NA 3NW6A 4OTRA 4FTOA 4CT2A 3ENHA 4EH3A 3F3UA 3FMMA 1E1XA 1M17A 3BYOA 4JG6A 3KN5A 4JBVA 3WZDA 2WU6A 4IB3A 1PW2A 3MVJA 2Q0BA 4WSQA 3FBVA 3HLLA 3UO6A 3EL7A 3HV7A 5FEEA 3AOXA 4CKIA 1YDSE 3TACA 4FTCA 4F9AA 4AZFA 4BZOA 5AR5A 2HY0A 5GJGA 5FDPA 4TW9A 2W1CA 5GJFA 1YHVA 3WF8A 5JFWA 2GNIA 3NYOA 4DCEA 2WIPA 4RA5A 1AGWA 4PY1A 5HE1A 2BALA 4A9TA 5B0XA 4C33A 4AT4A 4IX5A 1OPLA 4FKWA 4EK3A 1UKIA 3DNEA 5EDRA 3TZMA 3CTHA 4N0SA 3QTWA 3ZM4A 3QZFA 1H8FA 2WB8A 4QTAA 5FXSA 1M7QA 1W84A 5CEIA 4CV8A 2GCDA 1TVOA 2YDJA 3OBJA 4O1PA 3FI3A 2HZ0A 1PXLA 4K9YA 4U6RA 3IK3A 5H2UA 4AX8A 4WIHA 3A2CA 3QQHA 4O7TA 3UOHA 5HD4A 4CV9A 3S95A 3S1HA 5JGBA 2JIVA 3W16A 4JR3A 3IGOA 3IW8A 5CQWA 2UZNA 4FZAB 3LQ3A 4AP7A 5CSWA 4YC3A 4D2VA 4IADA 4M3QA 2I0VA 1IASA 1L8TA 4U80A 3B8QA 4XMOA 2F7EE 2JAMA 4MAOA 3TJDA 3V8TA 4HYIA 5KCVA 1BUHA 4LL5A 5K4IA 5GZ9A 1JQHA 4G1WA 2GPHA 4QYHA 5CASA 3K2LA 2BTRA 3BQRA 4GS6A 4DBNA 1XBAA 2BKKA 2XNNA 3R00A 3Q60A 3UC4A 1JAMA 1ZYJA 5BNJA 2YISA 5DG5A 1CKPA 2E2BA 2BAQA 3FC2A 1FQ1B 4FTMA 4MYGA 4GSBA 5HTBA 2XP2A 3R73A 5AX9A 2OW3A 2X7FA 5IEXA 5LJJA 3NUAA 4JL9A 3OF0A 3MFTA 3FI8A 3O7LD 2VTPA 2ZB0A 4EK4A 1APME 1ZY5A 3KVXA 3CY3A 3ITZA 3VS1A 3SW4A 2OIQA 1ZMUA 2IZRA 4IAYA 1OL1A 3Q4ZA 4TYHA 4WG5A 4Y85A 4YJQA 5D41A 5DEYA 3IDCA 4FYNA 3SRVB 4NH1A 3QD2B 4RWKA 5EQEA 4C58A 4WRSA 3KL8A 4FBXA 4D2PA 1W82A 4BGGA 1OIRA 2X7GA 3QHRA 4FV1A 4BIEA 4D2SA 3MESA 2XRWA 5E92A 5CEMA 2VTAA 4KB8A 3WIGA 3RAWA 4KUJA 1OI9A 4IEBA 4YPSA 4EH8A 3UVPA 2OZAB 3ZFXA 1ZOGA 4BGQA 4G9RA 2W1DA 2UW5A 5AAFA 4HVHA 3CKWA 2Z02A 4FVRA 2XKEA 3S00A 4XUFA 2OSCA 5A46A 4Q9ZA 4J96A 4O91A 1PXOA 1YXUA 2J0KA 2EU9A 4DF3A 2CGVA 2I6LA 2JKQA 2JEDA 4NFMA 3DAEA 2JDOA 2G01A 3LLAA 3RWQA 4ZSJA 4IWOA 4BTKA 5A4EA 3LFAA 5ETFA 4GIIA 4I5HA 3EQFA 3ORNA 4C62A 4H05A 3FMNA 1U59A 4FTQA 4O0UA 3RP9A 5HIBA 3DGKA 3Q6WA 4G17A 4DG3E 4HGLA 3W32A 4ERKA 2AUHA 3CJFA 4I0SA 2ITXA 3FMLA 4I0TA 5I0BA 3D9VA 3DA6A 2PULA 2VO0A 4E6QA 4M15A 3UQGA 3VS5A 3VS4A 2HXLA 2C1AA 4QMXA 3BEGA 4E6AA 4X21A 3KRLA 5T6KA 2J4ZA 3VBVA 4IC7A 2QG7A 1ERKA 4KINA 4X6RA 4FOCA 4LOPA 2H96A 5DN3A 3RM6A 3FZ1A 5ANKA 2PZ5A 1O9UA 3CTJA 4Z3VA 2PUNA 5BYYA 4O0VA 3PYYA 3ET7A 4UEUA 4EOQA 4IX4A 4U40A 5HCYA 2ITYA 4BWPA 4KWPA 5AV1A 3R1YA 2CN5A 3QX2A 4FTJA 5KNJA 3SD0A 1PJKA 2PUUA 2CJMA 2QOKA 2WEVA 3U6JA 4BTFA 5ETIA 5D11A 4FGBA 4IFGA 2F7ZE 4FZ7A 2RG6A 2OGVA 3RKBA 3MI9A 4APPA 2BHEA 3QXOA 4HYHA 4DEIA 1Y57A 4CMTA 4O84A 5HVKA 3EIDA 3FKLA 3UQCA 4CKRA 3F88A 3OWPA 3QQKA 1KV2A 4LYNA 4R5SA 5I9VA 4NM7A 3ZZWA 1PXJA 1OITA 4FG9A 4XX9A 1Q24A 1J91A 4HW7A 4QYFA 3IONA 4FTLA 3LOKA 3R8VA 2WTKC 4S30A 4D1XA 2J50A 1REKA 2BDJA 3V3VA 4L46A 2PMNX 3DKCA 5AV4A 3DFCB 3D7ZA 3FMJA 4OW8A 2H9VA 4I6QA 2VGPA 2OFUA 3F6XA 5AP0A 3KY2A 3RI1A 1UV5A 5BVKA 2V62A 1IRKA 4F0GA 4BCMA 1IEPA 2O65A 2XJ1A 3ERKA 4RIYB 1PHKA 3ZLYA 4WNOA 2O63A 4IAFA 5BPYA 4CT1A 4D1ZA 2HXQA 5IG1A 1U46A 4JI9A 4LI5A 2I0YA 4PWNA 3F7ZA 4O0YA 4PTEA 3E64A 3E3BX 3FAAA 4DFBA 3PIXA 1XWSA 2BHHA 2G15A 2XS0A 4FMQA 4WT6A 4XYFA 1W98A 2P55A 5ACKA 4YLLA 1YWNA 3SVVA 2FYSA 2QU6A 3R9NA 4O0SA 2OG8A 1ZLTA 5GZ8A 3F7WA 4LRJA 5DGZA 3RK9A 4KIKB 4D9UA 5M57A 4G34A 2WNTA 3UO5A 2VWYA 2OF2A 4YNOA 4FL3A 1H1SA 3SHEA 4BCPA 3PSCA 4D0WA 5HBJA 2CHLA 3BEAA 1PMVA 1Z9XA 2JDSA 3BHVA 2YM7A 3LFQA 4OTGA 4A9UA 4ZY4A 5JKGA 3DXPA 3NUPA 2JDRA 2XIKA 2OH4A 1LEWA 4QOXA 3JVSA 4W4WA 4WKQA 2XNPA 4ENYA 2X9FA 3Q52A 2OWBA 4C3FA 3KB7A 1KE6A 4IB5A 4CFFA 4MF1A 4L01A 2CNQA 3QAME 3V04A 3BE2A 5AUUA 3WZEA 3PPJA 3QGYA 3QU0A 4IAZA 1Z57A 4RFZA 5KX8A 5CAPA 2GHMA 3MVLA 3FXWA 3FZSA 4C7TA 5L4QA 4XG4A 2QQ7A 3EYGA 2YIXA 3ATSA 1ZZ2A 3MFRA 5BVDA 2CNVA 4S2ZA 4LOOA 4GUEA 4O2ZA 3LCSA 3KKVA 3OC1A 4FKGA 2GS2A 4EHZA 5HG5A 1J7IA 4FSRA 2GHLA 4GKHA 1ZYSA 3T3UA 3TUCA 4GK3A 2XCKA 4RIWA 5CSXA 2W7XA 4FC0A 4MCVA 4E5AX 3KCKA 4RIOA 4MWHA 3DY7A 3EQHA 2VTTA 3LMGA 3R7OA 5BMMA 5IQAA 4BF2A 3W2RA 4JBQA 3UG2A 4J98A 3WOWA 5HOAA 3LFEA 5BYLA 3FC1X 4NJDA 4FUYA 3ZFMA 3WE8A 2NO3A 3C0GA 3FSKA 1MQ4A 1R1WA 4EOKA 2XRUA 3PVWA 4QP8A 3RPYA 4D0XA 3D5XA 2F4JA 5AP5A 2UW4A 4C4EA 4UMPA 3A7JA 4MWIA 3VRZA 3U4WA 3EN7A 3QD4A 4IZ7A 4QNAA 4PF4A 3FLNC 5IMXA 3UBDA 3QRJA 1ZYDA 4L43A 3GENA 4AGUA 4C4HA 4FL2A 2YN8A 5EK7A 5HIDA 3OHTA 4JAIA 1MQBA 4NM5A 4RWJA 5EHLA 3ZEPA 4UYAA 3QALE 2UVZA 4QMOA 5HBHA 1JNKA 3HV3A 2BR1A 4FR4A 3HEGA 3WF5A 4I6FA 4F63A 1OBGA 2YCRA 4E5BA 4S31A 2HCKA 4AACA 2B4SB 5FP6A 1X8BA 3WZJA 3ZO2A 2PMIA 2X1NA 4FK6A 5FLFA 3LQ8A 4AN3A 3NCZA 3MV5A 3P7BA 1BI8A 2BZJA 3D7TA 3GU8A 3O8UA 4G16A 4LGDA 4TXCA 4AW1A 2OXXA 2ITZA 3OVVA 3R1NA 4FT3A 4JNWA 1OUYA 2HENA 4IWDA 4AZSA 5CAUA 3KC3A 2B0QA 1K9AA 5ETCA 2R0IA 4I94A 3ROYA 3LZBA 4F70A 5JEBA 2HW7A 5KBQA 1O6KA 3IOPA 4EC9A 4QTEA 4AXAA 1A06A 4USDA 3KRWA 2C6MA 4IFCA 2CKOA 2QR8A 5C4LA 4KS7A 5BYZA 1OB3A 3PJ8A 5DWRA 2JKMA 3ZEWA 2QOOA 3MB6A 1WVWA 2BAJA 1Q8YA 2BRGA 2OK1A 3ZBFA 3OT8A 3UNJA 1O6YA 3MPMA 4QMNA 5F4NA 3CGOA 5KHWA 1WBPA 4P7EA 4GIHA 2C0OA 4IJ9A 3Q4UA 4Z7GA 4IXPA 3C9WA 3WBLA 4FV0A 2NNWB 4BDFA 2X8EA 2P2HA 3DB6A 5BVEA 3AC4A 3EWHA 4S32A 3ZO4A 3OY3A 4PTCA 2YIQA 5JN2A 2YM8A 4L8MA 2YHVA 3VHEA 5HORA 5IA0A 2YZLA 5TO8A 2YCSA 2G2HA 4R7BA 3C7QA 3BBTB 3NSZA 3S4QA 3COMA 4RSSA 3ALNA 1F5QA 4PMTA 2Z7QA 1H00A 3CEKA 5IQEA 3P1AA 3PA3A 5DR9A 1TKIA 4KSQA 4QMPA 3QXPA 4ACMA 4FEUA 1B39A 2R3PA 1H0VA 4FZFB 3W18A 1BL6A 5CEKA 3AC5A 4WRGA 1Q3DA 2C4GA 4KIPA 2VN9A 3QQLA 4G31A 4NW5A 3NAXA 3D5UA 4E26A 3W2QA 5J7BA 4M67A 5L8JA 2WU7A 4BYIA 5J9YA 3FQHA 4L3LA 3VN9A 5HBEA 3LFFA 5HLWA 2C5OA 3NS9A 4YTFA 5LMAA 3JY0A 3HNGA 2EXEA 3Q5IA 3EB0A 4GU6A 3UO4A 3TG1A 4FK3A 4AG8A 4YJNA 5IA1A 5A4LA 2X39A 3OUKA 5TF9A 3GB2A 2GDOA 4L42A 4ZSEA 5AV3A 2X4FA 4YZ9A 4AN9A 4BCNA 3FHRA 2NP8A 4ZS0A 3UMXA 5CAVA 4QP4A 4RVTA 5FGKA 3TIYA 3OWKA 4DITA 4GH2A 3NW5A 5M56A 1YOMA 2C68A 2WD1A 3EH9A 4HPTE 1IR3A 2A4LA 4HCVA 2UZDA 5JZNA 2Y4IB 4I93A 5AIRA 4R7IA 2C0TA 2O0UA 4M66A 4V04A 4GJ2A 4RVKA 4GT4A 5D12A 4YPDA 2PVKA 4A4LA 3HGKA 3QRIA 2XUUA 2VTOA 3ACKA 3OCBA 4W4VA 4DTBA 4X3JA 2QCSA 5B2MA 5IPJA 5L6PA 3EQBA 3VO3A 4FV8A 3DKOA 1ZMVA 3FQEA 4EZ3A 4AZVA 1PXMA 5ICPA 5KUPA 2RFEA 1URCA 2QKWB 3HDNA 3DJ5A 3TI1A 2JKKA 4XG8A 4IVAA 3C1XA 4QMLA 4BDCA 3E7VA 4YZNA 3GFWA 4DLJA 3N4TA 3AD5A 5AAGA 1YQJA 3Q2MA 2X8DA 4ID7A 3ORXA 5K3YA 2CNUA 4JQ8A 3UDBA 3GCQA 4Y95A 5J5TA 2VV9A 3S0OA 3G5DA 4IX6A 4GVJA 3VS2A 2WTIA 5I4NA 3W2SA 3LXPA 4TL0A 3G90X 3QCSA 4YLKA 3OOGA 4MBJA 3WF6A 3R0TA 4JDIA 2ZMDA 4G5JA 3KF4A 5EI2A 4D4YA 3MS9A 3UTOA 4DH3A 2X2MA 3ZFYA 5IH5A 5B7VA 4FSTA 4TWOA 1ZWSA 3Q5ZA 1ZRZA 4FG8A 4QO9A 5CANA 2YIWA 4C4FA 3D5VA 1Y6AA 5CF6A 4R78A 4D1SA 3U4UA 4M13A 5AJQA 3O17A 1WVXA 3SX9A 2VTSA 3REPA 3PDTA 1OL5A 4C4IA 4DA5A 2PVHA 4H58A 4G2FA 4JLCA 3DQXA 4FKVA 1NY3A 4FIGA 3BKBA 3PZEA 1P14A 1YOJA 4F7NA 5AR8A 5AP3A 3EQCA 4FEWA 4RWIA 3Q9ZA 4LMNA 1Y91A 3DNDA 5HE3A 4FV7A 1H1QA 1XH5A 2F49A 5AA9A 2C6IA 3A62A 4BCFA 4D4SA 4PRJA 3FYKX 3QTRA 4O7LA 3FXXA 1M14A 1YI6A 5JFXA 3RBWA 2R3HA 1PXIA 1GIIA 3R6XA 4N4SA 2QOLA 3OG7A 3CC6A 4DGMA 2OJIA 3TN8A 3BWJA 5J95A 1PKDA 4YHJA 4BKJA 3KN6A 2UZVA 4YGAA 4DFUA 5LVPA 4BDGA 4NIFB 1SM2A 5DLSA 2VNWA 4ZP5A 2OXYA 3FMHA 3I7CA 3V51A 2G1TA 1TQPA 4FSQA 4I5MA 2BVAA 2R3OA 4OTDA 5ANGA 4PL3A 4BDBA 5EKNA 2J0JA 3HRBA 3OEFX 4ITJA 3W2PA 3C4XA 4DFXE 2QODA 3O96A 2I1MA 5G1XA 1YWRA 5CI6A 2E9UA 3KCFA 3VW6A 4QMTA 3ZLXA 2JFLA 3BHTA 4YZMA 3K54A 4DH8A 5K5XA 4NTTA 2J90A 1UKHA 4LGGA 2X81A 4DN5A 5DMZA 5AIKA 2PVFA 1XH9A 5DBXA 4TYJA 1E9HA 3L9NA 5KMLA 4PDSA 3ORTA 4YSMA 2OJFE 3HDMA 3SKCA 5AADA 2BFXA 1DS5A 2YWPA 4TWPA 3GXLA 3KXXA 2XVDA 3PRFA 4J95A 2IG7A 3Q53A 2ZM3A 3R04A 3I81A 3CIKA 1Y6BA 2RGPA 3Q4CA 5J79A 4AA4A 3PXRA 3UGCA 4OTPA 4BCJA 3TL8A 5IH4A 3SG9A 2YACA 2HK5A 3IW5A 4U8ZA 1U5QA 4KIOA 5GHVA 4E5WA 3DCVA 4MX9A 3KULA 5L2QA 4EUUA 5BX0A 5AAEA 3IW6A 4RJ8A 4K6ZA 4U79A 5JFSA 3PA4A 2CKEA 4RLKA 4C61A 3MJ1A 4H39A 3RNIA 2R0UA 2V7OA 3NVKI 4ZAUA 3DTWA 3TNWA 2PZRA 3H3CA 4QMMA 4RIXA 3LW0A 2PY3A 3K3JA 3WYYA 3QUEA 4LGHA 4BBMA 1GNGA 4BL1A 2J5EA 1Q5KA 3MW1A 4YU2A 5AV2A 4FEXA 4AOJA 1OKWA 2X9EA 2B7AA 3MSSA 3R9OA 4DBXA 2ONLC 4H3QA 4RC3A 4DTAA 1Q41A 2C3LA 4HYUA 4K77A 2O8YA 4GKIA 2B52A 3V5PA 4QMYA 3DBQA 3R22A 3SQQA 5JK3A 4FNYA 1DAWA 2JAVA 3LXNA 3QQGA 2ZM1A 4BHNA 4DAWA 3A60A 4PDPA 3R1SA 4LOQA 4QMZA 3WZUA 4CMOA 3AC2A 4JQEA 3SXSA 2QVSE 3GNIB 2ZDTA 3UNZA 3OXIA 3EN9A 2IZUA 5IUHA 2VTRA 5EH0A 2O3PA 5FTOA 2E9NA 3QWJA 5JZJA 4APCA 5CU3A 2OJGA 4O0WA 5D7VA 4JDJA 4ENXA 5L3AA 5BUIA 4EWQA 3P5KA 4AW0A 4ACDA 1XH6A 2XKDA 4IZ5A 4M97A 5AUTA 5GZAA 3OTUA 3PWYA 4USEA 4CTCA 4RJ3A 2YERA 4A7CA 3R30A 2WIHA 3GP0A 3R28A 1IA9A 4Y46A 3KXNA 5JQ5A 4FT7A 3FMEA 5GIPE 4HVGA 3RZBA 3EQIA 4OGRA 4FGRA 5KMOA 4FV9A 3LMIA 5LWMA 4DEEA 1YDRE 2VZ6A 3OW4A 2YM4A 3AGLA 4O27B 4U5JA 5ANOA 4O7YA 4QT1A 4QP3A 3FI2A 3R83A 2UW0A 2ACXA 2FSOX 5HEZA 3ZSGA 3FSFA 5AUVA 3OWJA 4QQCA 3VS3A 3G9LX 5LXMA 4NYEA 5HU9A 2VO6A 5ANDA 3ZXZA 3HVCA 3QTQA 4AT5A 3KK9A 4FTRA 5KMMA 4RBLA 4XEYA 5HU3A 2W0JA 3QX4A 5E8TA 1XR1A 2XB7A 3R8LA 3U87A 3OUNB 4IM0A 1U4DA 4CNHA 2RFSA 4HYSA 3KXMA 3POZA 2XJ0A 3BHUA 4JDHA 4EH7A 3CPBA 3OEZA 1KSWA 2EXCX 2OI4X 5CU4A 2LGCA 1R78A 5E90A 5K5NA 4XG9A 2UVYA 3V8WA 3AT2A 3IECA 2JLDA 4A9YA 2JIIA 4TYHB 3BYMA 3QA0A 4NW6A 1B6CB 2JC6A 4B99A 5LVLA 2R3NA 2QOIA 4RA4A 2H8HA 5L8LA 2XIYA 2J5FA 2J2IB 4B0GA 2G9XA 3R63A 3VQHA 4OLIA 3E8DA 2V55A 3P7AA 4FG7A 4ZTRA 4DEDA 1RE8A 3QD0A 5J9LA 4KABA 3CD8A 2WPAA 2WFYA 5KMKA 3FZRA 2ZMCA 5FM3A 3JPVA 3VUDA 1QL6A 2WTWA 4AE6A 2C0IA 3BLQA 4Y8DA 2C5XA 1OL6A 2XK4A 5TE0A 4DFLA 2OU7A 5A6NA 3GBZA 4FNXA 4QP6A 5AFVA 5M08A 2ZYBA 2Z7RA 4NM3A 4HNFA 4CFMA 1WBNA 3CQEA 2J6MA 3GU6A 4NT4A 2VWXA 3F2AA 5DI1A 2BRBA 2UZBA 2XBJA 3D2KA 5I9ZA 3E7OA 4GL9A 4ZSAA 4AFEA 1H1RA 3UQFA 3ZDUA 1MUOA 2PE1A 1GZNA 4F9WA 4K8AA 4DE4A 3COIA 3ZRMA 2YM5A 3VUTA 3UMWA 2CKPA 5L8KA 5DT4A 4BVUA 4CFUA 2CCHA 3PG1A 1ZZLA 2R3GA 4AU8A 4EYJA 3GU4A 2QHMA 4UY9A 4FSUA 5IH6A 2QG5A 3ORLA 1Q61A 1IAHA 2B54A 3GC7A 3RTPA 5JSMA 2R3FA 4HGEA 4UMUA 4YR8A 2J0LA 3KMWA 2NRUA 2GMXA 4C36A 2XA4A 4MXYA 4YJSA 4E8AA 3ZM9A 2XYNA 3PVUA 4UXQA 3MDYA 4IM3A 2OJJA 1IA8A 3QUDA 4CZTA 4TPTA 4BCIA 3TUDA 4Z16A 3TV6A 1ZXEA 4LRMA 3QCXA 5IA3A 2X6DA 1U5RA 5E7RA 2CPKE 3PP1A 2W96B 3PTGA 4BRXA 2PMLX 4F7LA 3I0OA 1FMOE 4H3PA 3V5LA 4ZS4A 4NJ3A 4C3PA 3IQ7A 4FYOA 4IAAA 4KA3A 4U44A 1XHAA 3O23A 5AUZA 4CCBA 4GU9A 5H8GA 4U97A 3AMAA 3UJGA 5K0XA 4LUEA 3O71A 3PJ1A 4UMRA 3E62A 4M68A 4YZBA 3QD3A 2PZYA 4F08A 1PMNA 1VEBA 2QNJA 3NMUF 5GNKA 1CTPE 3CGFA 4L9IA 2GFSA 4J7BA 1F3MC 4FNWA 2CLXA 5A4QA 1XQZA 5IA4A 4J99A 3UYTA 3QL8A 3I60A 3R01A 4E4XA 3UC3A 3ZMMA 4WBOA 3QQJA 1OIYA 3AD6A 4OTFA 5KZIA 1O6LA 4WO5A 3RNYA 3R8PA 2W1FA 5DR6A 2V0DA 4V0GB 5FEDA 5M55A 5HO7A 3D5WA 3ACJA 3PE2A 3G51A 3SRVA 5CAOA 3L9LA 4C37A 4V05A 4O7NA 2FVDA 2BCJA 3NW7A 3OMVA 4MD8E 3VAPA 4AN2A 2C69A 4GV1A 4WSYA 4PMSA 4B7TA 3C5IA 3L8XA 1M52A 5CVHA 4FSWA 4U81A 2Z7LA 5FRIA 2XKFA 2OZAA 3U9NA 4AQCA 2W4KA 3R7EA 4DG0E 3CLYA 3CCNA 2QD9A 5CF4A 3C51A 3LFNA 4HCTA 2RG5A 2F2UA 3O8PA 3PRIA 4KS8A 5IQCA 1JSUA 2AC5A 3W2OA 1Q62A 4BKZA 4DLIA 4CRLA 2Z8CA 3ZU7A 3W1FA 4XV9A 2A0CX 4RFMA 4K1BA 4K18A 2WKMA 4G3DA 4IZAA 2BKZA 2X4ZA 4EOPA 3RK7A 3CR0A 4YP8A 5EYMA 4R1YA 4ERWA 4F1TA 1LUFA 3FY0A 2WTKB 3F3WA 3E3PA 4B4LA 4D2RA 4AOTA 2C5YA 2Y7JA 4TKSA 3H0ZA 4GCJA 4O0RA 3SOCA 3AC8A 2G2FA 4M8TA 1CKJA 4YC8A 2OFVA 4EOOA 3OOMA 4IACA 4L45A 4XH6A 1W83A 1WBTA 5ACBC 1VZOA 5EYKA 5LVOA 3PXFA 3QQUA 2XNGA 5EI8A 5M4CA 5HE0A 3AT3A 3BRBA 5CVGA 2EUFB 1XJDA 3BGQA 5LVNA 3P79A 3R9RA 4IWPA 1H4LA 3UYSA 1XKKA 2QLUA 2XIXA 1WVYA 2CMWA 3AQVA 4BDHA 3EYHA 3R7VA 3CSVA 4AZWA 3VW8A 4IVDA 3I5ZA 4IM2A 3ZOSA 3FLSA 4GYGA 4B8LA 3R7GA 4WNPA 4EUTA 2IN6A 1H01A 2PVJA 2RFDA 4FI1A 4GK2A 1KOAA 1E1VA 1ZOEA 3R02A 4FV5A 5CZIA 4BHZA 2XH5A 5FXQA 4C2WA 4X2KA 5GJDA 4LMUA 4DGNA 3Q9WA 2C6DA 3EFKA 3AC3A 3IGGA 2ITTA 3NEWA 4IB0A 5BMSA 5EDQA 2P4IA 3MN3A 3PJ3A 1Q8TA 3RK5A 4XJ0A 3SDJA 1JOWB 2C6OA 2YAKA 2ITUA 3M11A 4JIAA 5FTQA 1XH4A 1GAGA 2IWIA 3LLTA 3DBEA 1R0EA 4ANNA 3DJ6A 3M42A 1BLXA 3H9RA 3GT8A 4IB1A 3UOJA 4IJPA 2XK7A 5CSPA 5AUYA 4EWHA 4XG6A 1I44A 1WBSA 4E4NA 2BROA 4UYNA 4MKCA 4PL4A 5D10A 5KKRB 2XNEA 4L7SA 2J7TA 1WAKA 4BDAA 3Q32A 4PNKA 5BQ0A 4FVQA 2BRHA 3IW7A 5EI6A 5AR7A 3U55A 3DBDA 4MF0A 4XNEA 5CALA 3ORKA 4RRVA 3RPVA 4QPSA 4QP2A 1OKZA 5CLPA 4OUCA 1BYGA 1R3CA 3DU8A 3CQWA 5HLPA 4GFGA 3PXZA 2BZHB 4YHTA 4KKGA 3DXNA 2ZJWA 3HRCA 5J1WA 3PIYA 2JFMA 4NCTA 5IUIA 3ZUUA 1S9JA 4KIKA 2ZB1A 3QC4A 2GNJA 5E8WA 4DINA 2QU5A 3H4JA 3IPHA 3NX8A 4UZHA 3QA8A 4UXLA 2C30A 1GIHA 5J7HA 3H0YA 2VUWA 1PYXA 3A7FA 2WO6A 3G9NA 5ITAA 4RVMA 2QHNA 3QC9A 3FDNA 3NCGA 1KE9A 2OBJA 1FMKA 3BQCA 4XP0A 4MQ2A 5A3XA 4BIDA 5TOZA 1XH7A 3DK3A 4FIJA 3DK7A 4L67A 5CENA 2WQOA 2AC3A 5DIAA 4JBPA 3VNTA 5EHOA 5CTPA 4YJUA 5G6VA 2C6KA 1U54A 4RC4A 2P33A 3VBWA 5HESA 4CZYB 4OT6A 4R77A 3GCVA 3BE9A 1V1KA 1P2AA 4CGAA 3TKIA 2VWUA 4I5PA 1VR2A 1OGUA 4IBMA 4RJ6A 1K2PA 1H26A 4E6CA 1CKIA 1PF8A 3ORIA 4P5ZA 4Q2AA 4MXCA 4W9WA 2UZLA 3HMOA 5DT3A 5HKMA 3RCDA 3V6SA 4DFYA 2QOHA 3G6GA 1OL7A 1PXNA 3KVWA 4XCUA 3F5PA 4JQ7A 2WTVA 4KD1A 3T9IA 4QYEA 3MH1A 5HNGA 2IVVA 2WMXA 5J1VA 1NVRA 3LAUA 4F6UA 1J1BA 4QRCA 5LMKA 3FY2A 4NFNA 3ZBXA 3ZTXA 2QKRA 4AE9A 3MH3A 3JS2A 1Q8UA 3CS9A 2WQMA 3KRJA 3QKMA 4I21A 3H30A 4K33A 4ZSGA 4MH7A 1PXPA 3HA8A 4Y83A 1JKKA 1VYZA 3HV6A 4C4JA 5E9EA 4H3BA 3IW4A 5H3QA 4XLIA 4JRNA 4WNMA 2JBOA 3LIJA 5H8BA 4O0XA 3VRYA 4D28A 5EQPA 4JRVA 3QCYA 5HLNA 4BBEA 3TZ9A 4EOLA 5IQGA 3DAJA 1KWPA 2VX0A 1UWHA 1NT2A 2HAKA 3DZQA 2R64A 5AM6A 3HZTA 3QKKA 4Y5HA 2PSQA 2VGOA 5AR2A 4MBLA 1FVTA 2OKRA 2PHKA 2X6EA 3T9TA 3WF7A 2Q83A 3SXRA 5M06A 3DBCA 3OWLA 4IMYA 2ITPA 4I6BA 3ZH8A 2Y6MA 1L3RE 1GJOA 2A19B 3FZPA 4G3FA 2I40A 4JAJA 5HI2A 3E8NA 3FJQE 3UODA 4EHVA 3U6HA 4D58A 1UA2A 5M44A 3QTZA 5E4HA 4C2VA 3HMPA 4C8BA 2XNOA 2WQEA 3BU3A 2FB8A 2XK3A 3PY1A 4L53A 1QPDA 2W1HA 2IVTA 2VWIA 5D1JA 5B2LA 4HGSA 3UG1A 4DEHA 2YWVA 1DM2A 1J1CA 4FSZA 1QPEA 1SVHA 2XK8A 4FIFA 4MEDA 1KV1A 3B2TA 4OBOA 4R1VA 4TWNA 3ULIA 4CCUA 4O86A 3LQ5A 3OZ6A 4O38A 3BCEA 4F7JA 2WEIA 5I3RA 4XG7A 2UW6A 3PIZA 5F1ZA 4XP2A 3UIBA 2O64A 2ZV8A 4ANQA 4CLJA 4CFNA 5ANIA 3ZCLA 3WF9A 5E8VA 3ZYAA 4LV8A 1MRYA 1QPCA 3MGYA 4F6SA 4Q5HA 5CU2A 2BUJA 3E93A 4PDOA 2W06A 4FX3A 5HO8A 3FLWA 5AP2A 3P0MA 4HJOA 2VWVA 3UVRA 4OTHA 4RZVA 3POOA 3VF9A 5HQ0A 3GUBA 3OXTA 1H0WA 4MQ1A 2UVXA 4LQMA 4PPAA 2UW3A 3COKA 1UVRA 1WBOA 2J51A 4RX7A 5KMIA 3PXKA 3AXWA 3F5XA 2CKQA 2ESMA 3DXQA 2QLQA 3R21A 4ASXA 4WG3A 5E91A 5HTCA 4BB4A 1OPJA 4GRBA 3UPZA 2BIKB 4HNIA 4M69A 3TKHA 2C3JA 3EZVA 3L9MA 2UZOA 5ANEA 4NUSA 2Y4PA 5JMSA 2C6TA 4ALVA 1KUTA 2WMWA 3KXZA 2ZM4A 4FIIA 2PVNA 3BHHA 3C4EA 4RWLA 5LVMA 5I3OA 4PPBA 5JRQA 3M1SA 2IW8A 2HELA 2YA9A 5BVWA 4AZEA 3F5UA 5DE2A 3ANRA 4G5PA 2QONA 3P7CA 3WYXA 1H07A 1W7HA 3BBWA 4AZTA 5AEPA 3NPCA 5C9CA 4O81A 4Q5EA 4X2FA 5HX6A 4I3ZA 3SG8A 4PP7A 4CRSA 3FYJX 2OH0E 4CKJA 5IDPA 1FBNA 3DQWA 4QNYA 4RVLA 2W5BA 3ZLSA 3ETAA 4PP9A 5HE2A 3RPRA 5L2WA 3U9CA 5JGAA 3VHKA 3PSBA 5J87A 3FQSA 4J97A 2VWZA 5ETAA 1JSVA 5CY3A 4E73A 3ZXTA 3HECA 4EONA 1ZOHA 3EFJA 4RX5A 3HUCA 5CEQA 4G6OA 3L8PA 4IDVA 1JWHA 4RJ5A 3PWDA 4GT3A 3H9FA 4XV1A 2Y0AA 1FOTA 2V5QA 4DT9A 3DKGA 1WFCA 4BC6A 1YXSA 1T45A 2GSFA 3GU5A 3JXWA 4JR7A 3ZRLA 4BTJA 5IA5A 3KREA 1MRVA 1AQ1A 4LL0A 2FH9A 4I1ZA 2JDTA 3DTCA 5CYIA 3VIDA 5FM2A 4C57A 3ID6C 3TKUA 2XEZA 4FSYA 4EBWA 4L44A 2IW9A 4HVSA 5CNNA 3EJ1A 4XV3A 3PLSA 1YHWA 4L3PA 4TT7A 3WILA 3PVGA 4TYIA 3DLZA 2J0IA 3W8LA 4ACGA 3C4CA 5IQBA 5C26A 4FTKA 3E5AA 3NDMA 5JH6A 1OL2A 3HMNA 3TZ7A 3NGAA 1BL7A 4NK9A 4CFVA 3QRTA 3PE1A 2OLCA 3TCPA 4ANOA 1V0PA 4ZLYA 3MB7A 3CE3A 4P2KA 3HRFA 5JRSA 3OFMA 3R2YA 2BDWA 4KRCA 2JKOA 4N6ZA 3FLZA 4QMWA 5AP6A 3WARA 3Q3BA 4BCKA 5M07A 3CBLA 2HIWA 1URWA 5CZHA 3QWKA 2AYPA 5IEYA 3CXWA 1QCFA 4AA0A 5FEQA 3O51A 2X0GA 4FTTA 4OTIA 3HUBA 3BGZA 2Z7SA 4F99A 4ZJVA 1ZMWA 4NKAA 5JFVA 3KMMA 4BFMA 4O7VA 3LCKA 3S2PA 4BGHA 5BUEA 2PVMA 4KIQA 1OIQA 1EH4A 3ORZA 2QC6A 2R3IA 3E92A 3MVMA 2WOTA 4ASDA 4F1OA 4A06A 1Y8GA 1YW2A 4TRLA 4E93A 2R3LA 3O0GA 3HYHA 4L3JA 1G5SA 3VJOA 3QZGA 5B2KA 5IA2A 3A8XA 5T68A 3V8SA 5K0KA 3E87A 3A7IA 2BPMA 5C01A 2FSMX 3MH2A 5I9WA 2J9MA 4MNEA 5KHXA 2RL5A 3NAYA 4E3CA 4QQJA 1GIJA 1SYKA 4J1RA 3LCOA 4AGDA 3A7GA 4FEQA 5DRBA 2W4OA 3FMKA 4GMYA 4X6QC 4I41A 1R39A 3TIZA 4YTHA 3G33A 3SC1A 4ZTMA 2PL0A 4W8EA 2O2UA 5KMNA 4IH8A 4JG7A 2EB2A 5F20A 3PFQA 4NEUA 3IS5A 2CDZA 4HPUE 4QMVA 4BCHA 5C1QB 4FZ6A 4I24A 4M0YA 4NKSA 2PWLA 1YI4A 2VX1A 4U41A 1M7NA 1A9UA 1NA7A 2QOFA 2R3KA 3ATTA 4BCOA 4EK8A 4NZWB 5DOSA 3B2WA 4MD7E 3O2MA 3V5QA 2EXMA 3V01A 4CSVA 5A9UA 2NRYA 5IMEA 5E8ZA 4X3FC 4Y5QA 4WOVA 4DHFA 5IDNA 4FODA 3PG3A 4IHPA 3R8UA 1LEZA 3I0QA 4YLJA 3QUPA 4CFXA 3NIEA 4YNEA 4EOSA 5EKOA 5EQYA 2RSVA 4FKLA 3RPSA 4C0TA 1BX6A 1YI3A 5IQHA 3ZHPC 4BWKA 4L68A 3KRXA 5L6WL 3EHAA 3QFVA 4ANBA 2PUIA 5KO1A 3IO7A 2CSNA 1UU9A 5DR2A 4CEGA 3QYWA 4YBKA 2GU8A 3D94A 2UUEA 3VVHA 3ORMA 3AMYA 1BMKA 3AD4A 2WGJA 3DAKA 3GOPA 1Q8WA 2X2KA 4QP9A 4X2GA 5LWNA 4QP7A 5HX8A 4C59A 4L6QA 2CLQA 3GEQA 4CVAA 4S34A 2HZIA 3RAKA 3NNXA 3UIUA 4F65A 3MA6A 4E1ZA 1PMEA 5FDXA 2GNLA 1HCKA 4FSMA 5EM5A 4AT3A 2JGZA 1W0XC 4WD5A 2HW6A 2JBPA 1VYWA 4IIRA 2CGUA 2ZOQA 4Y72A 3BWFA 3NLBA 3V5TA 5HNBA 4R8QA 5A14A 4U43A 4XOZA 3RINA 4DFZE 1Q8ZA 1HCLA 3D15A 4RQVA 1CM8A 2Y8OA 4TN6A 3EN5A 1PXKA 1REJA 2VNYA 4BY9E 5A4TA 4I20A 4X3FA 2C1BA 4YTCA 2XZSA 2H6DA 3T8OA 2C3IB 5BVOA 2YM6A 2UZTA 3DV3A 3LKMA 3HP5A 2UW8A 1OKVA 3KK8A 4O83A 4H36A 3JY9A 5CI7A 2WMBA 3LCTA 3TWJA 4C02A 4EL9A 4UB7A 1G3NA 4JXFA 1VJYA 3FKOA 3I1AA 3L1SA 3M2WA 2GNHA 4JOAA 1ZYCA 4ARKA 1RDQE 5C4KA 5C8MA 1YOLA 2VTIA 4EH4A 3AC1A 4ANMA 4RT7A 3OP5A 4QPMA 5C27A 2HZNA 3C0IA 3QCQA 3KF7A 3WE4A 3L9PA 1FVVA 3F66A 1QMZA 2W4JA 2GQRA 1T46A 3E88A 4GK4A 4HOKA 4I4FA 4OAUC 4FIEA 5CF5A 4K0YA 4WNKA 4YSJA 2WTCA 4ALWA 4EOMA 3DBFA 4AA5A 2YLEA 2QOBA 4ZTQA 1ND4A 5AP4A 1MP8A 4F09A 4X2JA 5HVYA 3UE4A 2BRMA 3WI6A 1UNLA 3CPCA 2CGWA 4FTAA 3UOLA 4YC6A 2GQGA 2VU3A 4CYJA 5K4JA 1S9IA 2B9IA 1G8SA 1Q3WA 4G3GA 4CD0A 5HTIA 3D2IA 1SNUA 3FPQA 3O8TA 2B9JA 3JVRA 1YHSA 3HP2A 4UWCA 3D83A 4ZY5A 4XG3A 1OUKA 2VO3A 1NVQA 4DEGA 1YRPA 3Q6UA 5EM7A 2YABA 1SVEA 3QLFA 5CVFA 3I5NA 1H1WA 2XK9A 2GHGA 1OKYA 4RX8A 4W4XA 5FP5A 1OMWA 5K9IA 2FA2A 4B6LA 4ZZNA 4DT8A 2WMSA 4OAVB 3I7BA 3ZUTA 2V22A 3EN6A 3LFBA 3HV4A 3H9OA 5FBOA 1W8CA 2YCFA 2OZOA 4DG2E 4F1MA 3NUNA 2R3JA 5EG3A 4R3RA 4ONAA 3K5UA 3UVQA 1STCE 5EOBA 4F9CA 3IOKA 3PPZA 4DTKA 2XIZA 4U3ZA 1YVJA 4M14A 1ZYLA 2A2AA 1M2QA 3FLQA 2ETMA 3QBNA 2FO0A 4ZSLA 3UIXA 2GNFA 3EKKA 3QYZA 5A54A 5IU2A 3LE6A 4FICA 4RC2A 3OROA 4EK5A 3PSDA 3F3VA 4BR3A 4FT5A 4RGJA 1GY3A 3RHKA 3RVGA 3RM7A 4HGTA 4N70A 3BYVA 4CMUA 4D4VA 5IQIA 2YITA 5AP7A 2YIYA 4IQ6A 4MVFA 5FBNC 1PYEA 2X2LA 2F9GA 3QLGA 2OJ9A 2YFXA 2PK9A 5LMBA 2IW6A 3F3ZA 2HZ4A 2XMYA 4CQEA 4D55A 5EDPA 2GTMA 3Q04A 3SW7A 3EQRA 4FKSA 4J53A 4O7WA 2B9HA 4PTGA 4EJ7A 4M0ZA 4E6DA 3TM0A 3G15A 3CJGA 2WOUA 4BI2A 4K2RA 3F61A 3NWWA 2KTYA 4G3CA 3LVPA 5HZNA 4O0TA 4IW0A 4RX9A 4RPVA 4LM5A 3R9DA 3TDWA 4PL5A 2JDVA 3KU2A 4IE9A 3ORPA 4JX7A 3FKNA 2C47A 4UX9A 5DA3A 5DPVA 3TV4A 1PY5A 3Q9XA 3N4UA 2PYWA 3JR1A 4WHZA 4I6HA 4GUBA 5LOHA 3MFUA 4ZIMA 5IKWA 3TNPC 4DH1A 3C4ZA 3VUHA 2VTLA 5E8UA 3QTXA 4AGWA 1JSTA 1H25A 2PVYA 1K3AA 1G8AA 4I5CA 3HMMA 2YJSA 4BIBA 1ZARA 2R7BA 2WTJA 3LJ1A 2XF0A 4ZLOA 4YJPA 4JX3A 2BDFA 4ZLZA 1HOWA 2P2IA 3DT1A 2W1GA 3BV2A 3RJCA 4E7WA 4KNBA 5J9ZA 4UZDA 3T3VA 3KRRA 5FD2A 2R5TA 4IAKA 2BRNA 1WMKA 1OZ1A 5M51A 2OICA 3LJ0A 5HVJA 3Q9YA 5AR4A 4BN1A 5CT7A 4EH5A 4F0FA 3QRUA 1YXVA 3EFLA 2Y9QA 4KBCA 3UZPA 4EEVA 2YDKA 3C50A 4NSTA 2QOQA 4G6NA 1MRUA 2UW9A 3Q96A 2VTHA 3TZ8A 4EORA 1OIUA 1YXXA 3DKFA 3NNVA 5FTGA 4M7IA 4QQ5A 3U51A 3K5VA 1GZOA 1FINA 5CS6A 1H08A 5CSVA 4AGCA 4EHEA 1GZ8A 3SV0A 3BLRA 4ITHA 3C13A 3SOAA 4ZOGA 5DEWA 3HA6A 1DI9A 3GFEA 2B9FA 4JG8A 3RGFA 4EYMA 5J5SA 5CT0A 2VX3A 3BGPA 5C03A 3EL8A 4DFNA 1OECA 1BI7A 3O50A 3V5WA 4OTQA 1OVEA 2UV2A 4TY1A 5IUGA 3DDPA 4FKQA 2F57A 3HL7A 3CTQA 4OBQA 3G2FA 4ZTHA 3CQUA 4FKJA 5JGDA 4YO4A 4IANA 5HG7A 3DPKA 2FSLX 4U7ZA 4GYIA 4CZUA 4DEAA 4G9CA 5AM7A 3CP9A 4B8MA 3W2CA 1LPUA 3TNHA 4J8MA 2ZAZA 3K3IA 5TKDA 4C4GA 3TUBA 2C3KA 4YTIA 3LCDA 3QTSA 4PX6A 4WUAA 5HCXA 4D4RA 1UNHA 5A6OA 4DC2A 2ITQA 2PE0A 3A61A 4TTHB 5FWKK 5L2SA 4CYIA 4V0GA 5E1EA 4MHAA 3LFDA 5T3QA 5I9XA 2OF4A 2YAAA 5FQDC 4TNBA 2W05A 4UWBA 2E9VA 3N51A 2OIBA 3LPBA 4RIWB 4KSPA 4BICA 5JT2A 2Y6OA 4JT3A 4EQMA 4HZRA 4G6LA 3ENMA 4DEBA 4NCTC 3MIYA 3R7UA 3I6WA 3UP7A 3VS0A 4XS2A 4BZDA 4FV6A 4LG4A 4XV2A 4R7HA 4AF3A 4IX3A 3VF8A 4TZRA 4AUAA 1FPUA 3ODZX 3ZZEA 1A48A 3I6UA 3ZRKA 2IPXA 3ZSHA 1M2RA 4RLLA 5AP1A 3EMGA 4S33A 3SGCA 4RG0A 3ULZA 1J3HA 3WIKA 4FZDB 3BYUA 3MTFA 3TV7A 4BYJA 2A1AB 4F0IA 3HAVA 5CNOA 3NYVA 3DK6A 2FGIA 3IG7A 4P90A 4P5QA 4O22A 3QTUA 4DGLC 1WCCA 4A4XA 2WHBA 3FEGA 4GFOA 2W5AA 4KKHA 5HCZA 4IVCA 5M53A 4PMMA 5BVNA 4FF8A 2WQBA 3P9JA 5F9EA 5EW9A 2PVLA 1YKRA 5CWZA 5J8IA 2W9ZB 3BV3A 4OR5A 4RIYA 4PPCA 4ZZOA 3NUSA 4ZK5A 3F2RA 2WMQA 1U54B 4H1JA 2BIYA 2ITOA 4MXOA 4RQKA 2BZKB 3B8RA 3VC4A 4I23A 3I4BA 1PKGA 3MIAA 2XM8A 3BIZA 4IAIA 3D7TB 2BAKA 3JYAA 3GCPA 4P4CA 4YJRA 5HO6A 4GW8A 4USFA 3OTVA 4G3EA 4WUNA 4D2TA 3N4VA 3NZ0A 1GOLA 3SLSA 2UZUE 4E4LA 5KKRC 3RAIA 4UWYA 3ZSIA 4D2WA 1FVRA 4GVAA 5LMKC 3GQIA 1DAYA 4QYYA 3TEIA 4QMQA 4O7ZA 4XLVA 3QZHA 4CXAA 4B9DA 4CLIA 4YJVA 4BTMA 3OXZA 4XP3A 3EOCA 5IQFA 4BDIA 3ELJA 3W8QA 4FTIA 4DH5A 3DDQA 5HICA 3PZHA 4AFJA 5FUTA 1H1PA 3MPTA 1UNGA 2WMVA 1IG1A 3GC8A 3QRKA 2QO7A 4FOBA 4KAOA 3TTIA 3AMBA 1CDKA 1J7UA 2IJMA 3EQGA 4YUQA 2YJRA 3TNIA 3RCJA 4AWIA 4MXAA 1NXKA 1JPAA 1OM1A 2B55A 5CXHA 2DWBA 2DYLA 4IC8A 4M12A 2ERZE 4O96A 5EFQA 2YLFA 3RWPA 3CD3A 3GCUA 3P23A 5JQ8A 3ZUVA 3EKNA 1Q99A 2PU8A 1R0PA 1XH8A 5CEPA 5CQUA 3BPRA 3CY2A 3VJNA 5KBRA 3P86A 4GT5A 4C38A 2VO7A 3KQ7A 2ERKA 3KFAA 4LFIA 4W9XA 3GU7A 1BKXA 1M2PA 4XRJA 3PP0A 4NWMA 2ITWA 3V5JA 5LQFA 4A9RA 5L2IA 4FUXA 4MNFA 1KOBA 4NTSA 2DUVA 4EOJA 5IEVA 5IF1A 1RQQA 4BDDA 3ZC5A 4WG4A 3BZ3A 4U45A 2HYYA 4UMQA 4XG2A 4RJ7A 5CXZA 3ZO3A 1WBVA 3PY0A 3E8CA 3AT4A 5EW8A 4EH2A 2JITA 4UALA 1OBDA 3BLHA 3PY3A 4XBUA 3FZTA 4UN0C 4Z7HA 5LCJA 4O7SA 4FVPA 3ZONA 4FA2A 2HOGA 4DYMA 4NL0A 3VBYA 3VUGA 4HCUA 4MBIA 5DVRA 2PZIA 3W33A 4FNZA 5D7AA 3AG9A 3RALA 2R7IA 4EQCA 1Q97A 3MBLA 4IZYA 4MXZA 3ZC6A 4CTBA 3NRMA 4ZMFA 4X7QA 3VS6A 5E8YA 2E9PA 1RJBA 3E8EA 2FSTX 3FL4A 3NUYA 3ZO1A 4OT5A 4A07A 2XEYA 1JVPP 3A7HA 3QTIA 2ZV2A 2QO2A 5BVFA 4EBVA 3EQPA 1SZMA 2QO9A 5E1SA 4MD9E 4BCQA 2OIDA 2C6LA 2QR7A 4TYGA 4O2PA 4YZCA 4BI0A 4DGOA 1V0BA 5C8KA 4H1MA 2PTKA 2PMOX 3C0HA 1J7LA 4AAAA 2XK6A 4C35A 5AR3A 1AD5A 5C8NA 2PVRA 3KMUA 2R2PA 2WMUA 3FXZA 3F82A 3LMHA 3KGAA 4ASEA 2PPQA 4W8DA 3BU5A 2GFCA 4ITIA 4M69B 4BDKA 2FUMA 2HY81 4O7RA 3A4PA 3BX5A 2YDIA 2F2CB 2P0CA 2VWWA 2R3RA 4TNDA 3FWQA 3GGFA 5LARA 4BDJA 3FI4A 3OD6X 2QI8A 5KE0A 3TNQB 1TQIA 3IDBA 3OS3A 4YJTA 3KEXA 3IKAA 4UV0A 1UU8A 5EYCA 3A4OX 5CAQA 4FKIA 4ZTNA 3QQFA 2X7OA 3ZDIA 2RF9A 3SXFA 3H10A 4O82A 3Q2JA 4I0RA 4I92A 5DRDA 4OBPA
chains in the Genus database with same CATH superfamily
3THBA 3HX4A 3OW3A 4KBKA 3G6HA 4N6YA 4XRLA 2VD5A 4PUZA 3S3IA 5LCKA 3SAYA 2WXVA 4ZJJA 3UZRA 2Z2WA 5AMNA 4FV3A 4J52A 2EWAA 4IDTA 3RAHA 3F5GA 2XJ2A 3FHIA 4A9SA 4EH6A 4PDYA 3IDPA 2W9FB 2LAVA 1NVSA 4F64A 3MJ2A 2CN8A 4MUQA 4QTDA 3DB8A 2BMCA 3R1QA 2Y4IC 4EOIA 3NFGB 1Z5MA 3OCGA 3AGMA 2VTQA 3UDZA 4MTAA 3TT0A 4EQUA 1KE5A 3KXHA 3P78A 4ACCA 1FGKA 4GG5A 3DOGA 3OT3A 4YHFA 2ITNA 4FTNA 3ZS5A 4NU1A 4DGGA 5EHYA 2VTNA 5KMJA 3GI3A 2I7QA 1UWJA 1WZYA 4CQGA 2R9SA 3MWUA 2BZIB 1P4FA 2XCHA 2W1ZA 4AQKA 3UP2A 4EKKA 4QMUA 1WBWA 3MY0A 3U6IA 4L7FA 4PNIA 4RFYA 3QF9A 4NM0A 4D5HA 2A27A 1LP4A 4E20A 2P3GX 3KA0A 5KZ0A 4EKLA 3SA0A 4O6EA 2UW7A 1LR4A 2IO6A 3FLYA 5EW3A 4XBRA 4M84A 5E8SA 5IQDA 4FV2A 4CFWA 1KE7A 5DH3A 4U0IA 5I5ZA 1Q4LA 5CU0A 1V0OA 5DNRA 2OXDA 3GC0A 4C34A 3HKOA 2REIA 5CX9A 4GEOA 3VULA 4EJNA 1P5EA 2C6EA 2J0MB 2Z60A 2YM3A 4D9TA 2QOCA 3ALOA 2XBAA 3W0PA 1SVGA 3A8WA 3PA5A 4N57A 4ZMEA 3LHJA 3BU6A 2WMAA 2NPQA 3OBGA 4JVGA 2BFYA 4TYEA 4J8NA 3TXOA 5L2TA 1Y8YA 4PQNA 3D14A 5E8XA 4EZ7A 4IVBA 4QMSA 4FT9A 3VONA 3VUMA 5AUWA 3NIZA 4R3PA 1OPKA 4F9YA 3LFSA 1H27A 2VWBA 4ALUA 4BDEA 4BZNA 3FV8A 3UIMA 4HVDA 2GTNA 2GS6A 3LXLA 2ZV7A 4J71A 3QHWA 4HZSA 2VRXA 4FKTA 4YBJA 4MK0A 2X8IA 2EVAA 3VBXA 4C3RA 2KULA 2IVUA 2I0EA 2GQSA 5HG9A 4L00A 4YMJA 2CGXA 3W0RA 2B53A 1H24A 5HHWA 3U54A 3V6RA 5HGIA 3VBQA 4FE2A 5AWMA 4R6VA 4ACHA 5AX3A 2OO8X 3PXQA 3L8VA 3DS6A 4W4YA 4WBBB 3EQDA 4EHGA 2XYUA 3ROCA 4F6WA 2VTMA 3LFCA 4QQTA 3FMDA 3II5A 4RMZA 3CKXA 3F69A 2JD5A 3FPMA 3LM0A 4R3CA 5I9YA 4ZJIA 5IISA 4AW2A 5CEOA 4MNEB 3NUXA 2C5NA 3DLSA 5CF8A 3NVMB 4UBAA 4YJOA 3VUKA 4YURA 5EOLA 1P4OA 3O7LB 3HV5A 3QKLA 3KULB 4MXXA 3RHXA 4ANLA 3R8MA 1DI8A 2ZVAA 4Q9SA 1CMKE 4BKYA 3TJCA 3R2BA 4ZZMA 3LJ2A 3GQLA 5AUXA 4BBFA 2JIUA 3N9XA 3DFAA 3D4QA 1CSNA 3L8SA 3RPOA 5HG8A 3EN4A 4JDKA 5ANJA 4ZY6A 5FXRA 5HNIX 4AOIA 4GJ3A 4FIHA 1XMMA 3QGWA 4FEVA 1H28A 3NYXA 3P08A 3UZTA 3TMOA 4RIXB 4QYGA 4LV5A 4ORKA 4FKRA 3NR9A 4PV0A 2ETRA 4FT0A 5I9UA 1JBPE 2RIOA 3ODYX 4QTBA 3G0FA 4F7SA 2B1PA 4KBAA 4FKOA 4U3YA 4FL1A 4Z55A 4A4OA 3RZFA 4E4MA 2XNBA 3NUUA 2YEXA 3KXGA 3D0EA 5L6OA 3RMFA 4QPAA 3VS7A 4F9BA 3R8ZA 1G8KA 2C5VA 3C5UA 4I22A 3ANQA 4ZEGA 2I0HA 1FGIA 1QPJA 4K11A 4KRDA 2PE2A 3GCSA 3A99A 4O21A 4XHKB 4Z9LA 4EZ5A 2PUPA 4DCAA 1XBCA 4JS8A 5AV0A 3BHYA 2VAGA 2YIRA 3F9NA 3FL5A 2XM9A 3MTLA 4BWXA 4ANSA 4X2NA 2R4BA 3HMIA 2WZJA 3PUPA 4JBOA 3G0EA 4QP1A 1JKTA 1XMLA 3HAMA 3COHA 4LRKA 1PMUA 4U42A 3C4FA 5BUJA 3OY1A 3VBTA 4AS0A 4RZWA 3QZIA 4ZXTA 1IAJA 2VTJA 2HWOA 3F2NA 2R3MA 3DJ7A 3R71A 4NIFA 4ZTLA 2UZWE 4KKEA 4D5KA 4F4PA 4FV4A 3I79A 2WMTA 3U8WA 5AA8A 3NNWA 3BYSA 4BCGA 3MYGA 3MVHA 3GC9A 2ZDUA 2WTDA 2G2IA 4DH7A 2RFNA 2DS1A 2XIRA 2W1EA 5M4UA 2W99B 1NW1A 3PXYA 3EFWA 3TDVA 3LXKA 3OCSA 5EYDA 1YWVA 4JJRA 4ASZA 4EH9A 3EZRA 2BTSA 5M4IA 2E9OA 5M4FA 4CG8A 5A4CA 2ZV9A 4RJ4A 2EB3A 2SRCA 4XOYA 2WMRA 3TTJA 3WZKA 4BI1A 3PLAE 4QD6A 4L52A 5DYJA 1PRYA 2W17A 4U9AA 1ZAOA 4JIKA 3VUIA 2IZTA 2ETKA 1B38A 4X3FB 5TR6A 2QURA 3W55A 5HIEA 5GINE 4AW5A 1I09A 3JUHA 5TT7A 2H34A 4I4EA 5DFPA 1KE8A 4O1OA 5CSHA 5IZFA 3C4WA 2GNGA 3MPAA 4R5YA 2DQ7X 2XNMA 1ATPE 4GFMA 2F7XE 2IVSA 3PVBA 3LM5A 5CU6A 3MA3A 2XKCA 4OTWA 4FSNA 3OCTA 2CCIA 4TWCA 4HVIA 5FG8A 4PMPA 2YZAA 2O5KA 1YDTE 2IZSA 3R7YA 4EI4A 5DHJA 2W1IA 4EK6A 1JKSA 2YCQA 1RW8A 1SMHA 1GZKA 1F0QA 2UZEA 3PPKA 3UNKA 3F3TA 1UU3A 3FUPA 3R9HA 3MY5A 3E63A 4GG7A 5EM6A 2WAJA 3DZOA 4UMTA 4EC8A 4WA9A 5HD7A 4FKUA 2V7AA 3UPXA 4Y73A 5M09A 2WELA 3PJCA 4LUDA 1JLUE 2HWPA 1SNXA 3NYNA 3UOKA 3ZLWA 2ITVA 4X0MA 1UU7A 5D9HA 4FKPA 2RKUA 3R7IA 4YZDA 3GOKA 3W0SA 2PZPA 3PJ2A 1YXTA 3FE3A 1XO2B 1XBBA 4ZTSA 5GIOE 3MFSA 1JKLA 4YO6A 5H9BA 3MH0A 4O6LA 4QTCA 3W10A 3VWAA 5H8EA 3BLAA 3FZOA 5F95A 4FTUA 2WQNA 2R3QA 3GVUA 3MY1A 3NNUA 5EM8A 4II5A 1TQMA 3BI6A 5DT0A 2BILB 1ZY4A 3P4KA 4V01A 4IWQA 2ONLA 2W5HA 5F94A 3BELA 2GS7A 3VQUA 3Q4TA 2Q0NA 3NW6A 4OTRA 4FTOA 3P5JC 4CT2A 3ENHA 4EH3A 3F3UA 3FMMA 1E1XA 1M17A 3BYOA 4JG6A 3KN5A 4JBVA 3WZDA 2WU6A 4IB3A 1PW2A 3MVJA 2Q0BA 4WSQA 3FBVA 3HLLA 3UO6A 3EL7A 3HV7A 5FEEA 3AOXA 4CKIA 1YDSE 3TACA 4FTCA 4F9AA 4AZFA 4BZOA 5AR5A 2HY0A 5GJGA 5FDPA 1VLRA 4TW9A 2W1CA 5GJFA 1YHVA 3WF8A 5JFWA 2GNIA 3NYOA 4DCEA 2WIPA 4RA5A 1AGWA 4PY1A 5HE1A 2BALA 4A9TA 5B0XA 4C33A 4AT4A 4IX5A 1OPLA 4FKWA 4EK3A 1UKIA 3DNEA 5EDRA 3TZMA 3CTHA 4N0SA 3QTWA 3ZM4A 3QZFA 1H8FA 2WB8A 4QTAA 5FXSA 1M7QA 1W84A 5CEIA 4CV8A 2GCDA 1TVOA 2YDJA 3OBJA 4O1PA 4BJJA 3FI3A 2HZ0A 1PXLA 4K9YA 4U6RA 3IK3A 5H2UA 4AX8A 4WIHA 3A2CA 3QQHA 4O7TA 3UOHA 5HD4A 4CV9A 3S95A 3S1HA 5JGBA 2JIVA 3W16A 4JR3A 3IGOA 3IW8A 5CQWA 2UZNA 4FZAB 3LQ3A 4AP7A 5CSWA 4YC3A 4D2VA 4IADA 4M3QA 2I0VA 1IASA 1L8TA 4U80A 3B8QA 4XMOA 2F7EE 2JAMA 4MAOA 3TJDA 3V8TA 4HYIA 5KCVA 1BUHA 4LL5A 5K4IA 5GZ9A 1JQHA 4G1WA 2GPHA 4QYHA 5CASA 3K2LA 2BTRA 3BQRA 4GS6A 4DBNA 1XBAA 3UDTA 2BKKA 2XNNA 3R00A 3Q60A 3UC4A 1JAMA 1ZYJA 4I6LA 5BNJA 2YISA 5DG5A 1CKPA 2E2BA 2BAQA 3FC2A 1FQ1B 4FTMA 4MYGA 4GSBA 5HTBA 2XP2A 3R73A 5AX9A 2OW3A 2X7FA 5IEXA 5LJJA 3NUAA 4JL9A 3OF0A 3MFTA 3FI8A 3O7LD 2VTPA 2ZB0A 4EK4A 1APME 1ZY5A 3KVXA 3CY3A 3ITZA 3VS1A 3SW4A 2OIQA 1ZMUA 2IZRA 4IAYA 1OL1A 3Q4ZA 4TYHA 4WG5A 4Y85A 4YJQA 5D41A 5DEYA 3IDCA 4FYNA 3SRVB 4NH1A 3QD2B 4RWKA 5EQEA 4C58A 4WRSA 3KL8A 4FBXA 4D2PA 1W82A 4BGGA 1OIRA 2X7GA 3QHRA 4FV1A 4BIEA 4D2SA 3MESA 2XRWA 5E92A 5CEMA 2VTAA 4KB8A 3WIGA 3RAWA 4KUJA 1OI9A 4IEBA 4YPSA 4EH8A 2XALA 3UVPA 2OZAB 3ZFXA 1ZOGA 4BGQA 4G9RA 2W1DA 2UW5A 5AAFA 4HVHA 3CKWA 2Z02A 4FVRA 2XKEA 3S00A 4XUFA 2OSCA 5A46A 4Q9ZA 4J96A 4O91A 1PXOA 1YXUA 2J0KA 2EU9A 4DF3A 2CGVA 2I6LA 2JKQA 2JEDA 4NFMA 3DAEA 2JDOA 2G01A 3LLAA 3RWQA 4ZSJA 4IWOA 4BTKA 5A4EA 3W0OA 3LFAA 5ETFA 4GIIA 4I5HA 3EQFA 3ORNA 4C62A 4H05A 3FMNA 1U59A 4FTQA 4O0UA 3RP9A 5HIBA 3DGKA 3Q6WA 4G17A 4DG3E 4HGLA 3W32A 4ERKA 2AUHA 3CJFA 4I0SA 2ITXA 3FMLA 4I0TA 5I0BA 3D9VA 3DA6A 2PULA 2VO0A 4E6QA 4M15A 3UQGA 3VS5A 3VS4A 2HXLA 2C1AA 4QMXA 3BEGA 4E6AA 4X21A 3KRLA 5T6KA 2J4ZA 3VBVA 4IC7A 2QG7A 1ERKA 4KINA 4X6RA 4FOCA 4LOPA 2H96A 5DN3A 3RM6A 3FZ1A 5ANKA 2PZ5A 1O9UA 3CTJA 4AXFA 4Z3VA 2PUNA 5BYYA 4O0VA 3PYYA 3ET7A 4UEUA 4EOQA 4IX4A 4U40A 5HCYA 2ITYA 4BWPA 4KWPA 5AV1A 3R1YA 2CN5A 3QX2A 4FTJA 5KNJA 3SD0A 1PJKA 2PUUA 2CJMA 2QOKA 2WEVA 3U6JA 4BTFA 5ETIA 5D11A 4FGBA 4IFGA 2F7ZE 4FZ7A 2RG6A 2OGVA 3RKBA 3MI9A 4APPA 2BHEA 3QXOA 4HYHA 4DEIA 1Y57A 4CMTA 4O84A 5HVKA 3EIDA 3FKLA 3UQCA 4CKRA 3F88A 3OWPA 3QQKA 4F78A 1KV2A 4LYNA 4R5SA 5I9VA 4NM7A 2X0OA 3ZZWA 1PXJA 1OITA 4FG9A 4XX9A 4FRFA 1Q24A 1J91A 4HW7A 4QYFA 3IONA 4FTLA 3LOKA 3R8VA 2WTKC 4S30A 4D1XA 2J50A 1REKA 2BDJA 3V3VA 4L46A 2PMNX 3DKCA 5AV4A 3DFCB 3D7ZA 3FMJA 4OW8A 1TFFA 2H9VA 4I6QA 2VGPA 2OFUA 3F6XA 5AP0A 3KY2A 3RI1A 1UV5A 5BVKA 4FJVA 2V62A 1IRKA 4F0GA 4BCMA 1IEPA 2O65A 2XJ1A 3ERKA 4RIYB 1PHKA 3ZLYA 4WNOA 2O63A 4IAFA 5BPYA 4CT1A 4D1ZA 2HXQA 5IG1A 1U46A 4JI9A 4LI5A 2I0YA 4PWNA 3F7ZA 4O0YA 4PTEA 3E64A 3E3BX 3FAAA 4DFBA 3ML1A 3PIXA 1XWSA 2BHHA 2G15A 2XS0A 4FMQA 4WT6A 4XYFA 1W98A 2P55A 5ACKA 4YLLA 1YWNA 3SVVA 2FYSA 2QU6A 3R9NA 4O0SA 3AKJA 2OG8A 1ZLTA 5GZ8A 3F7WA 4LRJA 5DGZA 3RK9A 4KIKB 4D9UA 5M57A 4G34A 2WNTA 3UO5A 2A98A 2VWYA 2OF2A 4YNOA 4FL3A 1H1SA 3SHEA 4BCPA 3PSCA 4D0WA 5HBJA 2CHLA 3BEAA 1PMVA 1Z9XA 2JDSA 3BHVA 3W0QA 2YM7A 2IEWA 3LFQA 4OTGA 4A9UA 4ZY4A 5JKGA 3DXPA 3NUPA 2JDRA 2XIKA 2OH4A 1LEWA 4QOXA 3JVSA 4W4WA 4WKQA 2XNPA 4ENYA 2X9FA 3Q52A 2OWBA 4C3FA 3KB7A 1KE6A 4IB5A 4CFFA 4MF1A 4L01A 2CNQA 3QAME 3V04A 3BE2A 5AUUA 3WZEA 3PPJA 3QGYA 3QU0A 4IAZA 1Z57A 4RFZA 5KX8A 5CAPA 2GHMA 3MVLA 3FXWA 3FZSA 4C7TA 5L4QA 4XG4A 2QQ7A 3EYGA 2YIXA 3ATSA 1ZZ2A 3MFRA 5BVDA 2CNVA 4S2ZA 4LOOA 4GUEA 4O2ZA 3LCSA 3KKVA 3OC1A 4FKGA 2GS2A 4EHZA 5HG5A 1J7IA 4FSRA 2GHLA 4GKHA 1ZYSA 3T3UA 3TUCA 4GK3A 2XCKA 4RIWA 5CSXA 2W7XA 4FC0A 4MCVA 4E5AX 3KCKA 4RIOA 3NFFB 4MWHA 3DY7A 3EQHA 2VTTA 3LMGA 3R7OA 5BMMA 5IQAA 4BF2A 3W2RA 4JBQA 3UG2A 4J98A 3WOWA 5HOAA 3LFEA 5BYLA 3FC1X 4NJDA 4FUYA 3ZFMA 3WE8A 2NO3A 3C0GA 3FSKA 1MQ4A 1R1WA 4EOKA 2XRUA 3PVWA 4QP8A 3RPYA 4D0XA 3D5XA 2F4JA 5AP5A 2UW4A 4C4EA 4UMPA 3A7JA 4MWIA 3VRZA 3U4WA 3EN7A 3QD4A 4IZ7A 4QNAA 4PF4A 3FLNC 5IMXA 3UBDA 3QRJA 1ZYDA 4L43A 3GENA 4AGUA 4C4HA 4FL2A 2YN8A 5EK7A 5HIDA 3OHTA 4JAIA 1MQBA 4NM5A 4RWJA 5EHLA 3ZEPA 4UYAA 3QALE 2UVZA 4QMOA 5HBHA 1JNKA 3HV3A 2BR1A 4FR4A 3HEGA 3WF5A 4I6FA 4F63A 1OBGA 2YCRA 4E5BA 4S31A 2HCKA 4AACA 2B4SB 5FP6A 1X8BA 3WZJA 3ZO2A 2PMIA 2X1NA 4FK6A 5FLFA 3LQ8A 4AN3A 3NCZA 3MV5A 3P7BA 4AAYA 1BI8A 2BZJA 3D7TA 3GU8A 3O8UA 4G16A 4LGDA 4TXCA 4AW1A 2OXXA 2ITZA 3OVVA 3R1NA 4FT3A 4JNWA 1OUYA 2HENA 4IWDA 4AZSA 5CAUA 3KC3A 2B0QA 1K9AA 5ETCA 2R0IA 4I94A 3ROYA 3LZBA 4F70A 5JEBA 2HW7A 5KBQA 2ZFYA 1O6KA 3IOPA 4EC9A 4QTEA 4AXAA 1A06A 4USDA 3KRWA 2C6MA 4IFCA 2CKOA 2QR8A 5C4LA 4KS7A 5BYZA 1OB3A 3PJ8A 5DWRA 2JKMA 3ZEWA 2QOOA 3MB6A 1WVWA 2BAJA 1Q8YA 2BRGA 2OK1A 3ZBFA 3OT8A 3UNJA 1O6YA 3MPMA 4QMNA 5F4NA 3CGOA 5KHWA 1WBPA 4P7EA 4GIHA 2C0OA 4IJ9A 3Q4UA 4Z7GA 4IXPA 3C9WA 3WBLA 4FV0A 2NNWB 4BDFA 2X8EA 2P2HA 3DB6A 5BVEA 3AC4A 3EWHA 4S32A 3ZO4A 3OY3A 4PTCA 2YIQA 5JN2A 2YM8A 4L8MA 2YHVA 3VHEA 5HORA 5IA0A 2YZLA 5TO8A 2YCSA 2G2HA 4R7BA 3C7QA 3BBTB 3NSZA 3S4QA 3COMA 4RSSA 3ALNA 1F5QA 4PMTA 2Z7QA 1H00A 3CEKA 5IQEA 3P1AA 3PA3A 5DR9A 1TKIA 4KSQA 4QMPA 3QXPA 4ACMA 4FEUA 1B39A 2R3PA 1H0VA 4FZFB 3W18A 1BL6A 5CEKA 3AC5A 4WRGA 1Q3DA 2C4GA 4KIPA 2VN9A 3QQLA 4G31A 4NW5A 3NAXA 3D5UA 4E26A 3W2QA 5J7BA 4M67A 5L8JA 2WU7A 4BYIA 5J9YA 3FQHA 4L3LA 3VN9A 5HBEA 3LFFA 5HLWA 2C5OA 3NS9A 4YTFA 5LMAA 3JY0A 3HNGA 2EXEA 3Q5IA 3EB0A 4GU6A 3UO4A 3TG1A 4FK3A 4AG8A 4YJNA 5IA1A 5A4LA 2X39A 3OUKA 5TF9A 3GB2A 2GDOA 4L42A 4ZSEA 5AV3A 2X4FA 4YZ9A 4AN9A 4BCNA 3FHRA 2NP8A 4ZS0A 3UMXA 5CAVA 4QP4A 4RVTA 5FGKA 3TIYA 3OWKA 4DITA 2AEGA 4GH2A 3NW5A 5M56A 1YOMA 2C68A 2WD1A 3EH9A 4HPTE 1IR3A 2A4LA 2IF8A 2UZDA 4HCVA 5JZNA 2XAOA 2Y4IB 4I93A 5AIRA 4R7IA 2C0TA 2O0UA 4M66A 4V04A 4GJ2A 4RVKA 4GT4A 5D12A 4YPDA 2PVKA 4A4LA 3HGKA 3QRIA 2XUUA 2VTOA 3ACKA 3OCBA 4W4VA 4DTBA 4X3JA 2QCSA 5B2MA 5IPJA 5L6PA 3EQBA 3VO3A 4FV8A 3DKOA 1ZMVA 3FQEA 4EZ3A 4AZVA 1PXMA 5ICPA 5KUPA 2RFEA 1URCA 2QKWB 3HDNA 3DJ5A 3TI1A 2JKKA 4XG8A 4IVAA 3C1XA 4QMLA 4BDCA 3E7VA 4YZNA 3GFWA 4DLJA 3N4TA 1G8JA 3AD5A 5AAGA 1YQJA 3Q2MA 2X8DA 4ID7A 3ORXA 5K3YA 2CNUA 4JQ8A 3UDBA 3GCQA 4Y95A 5J5TA 2VV9A 3S0OA 3G5DA 4IX6A 4GVJA 3VS2A 2WTIA 5I4NA 3W2SA 3LXPA 4TL0A 3G90X 3QCSA 4YLKA 3OOGA 4MBJA 3WF6A 3R0TA 4JDIA 2ZMDA 4G5JA 3KF4A 5EI2A 4D4YA 3MS9A 3UTOA 4DH3A 2X2MA 3ZFYA 5IH5A 5B7VA 4FSTA 4TWOA 1ZWSA 3Q5ZA 1ZRZA 4FG8A 4QO9A 5CANA 2YIWA 4C4FA 3D5VA 1Y6AA 5CF6A 4R78A 4D1SA 3U4UA 4M13A 5AJQA 3O17A 1WVXA 3SX9A 2VTSA 3REPA 3PDTA 1OL5A 4C4IA 4DA5A 2PVHA 4H58A 4G2FA 4JLCA 3DQXA 4FKVA 1NY3A 4FIGA 3BKBA 3PZEA 1P14A 1YOJA 4F7NA 5AR8A 3W0NA 5AP3A 3EQCA 4FEWA 4RWIA 3Q9ZA 4LMNA 1Y91A 3DNDA 5HE3A 4FV7A 1H1QA 1XH5A 2F49A 5AA9A 2C6IA 3A62A 4BCFA 4D4SA 4PRJA 3FYKX 3QTRA 4O7LA 3FXXA 1M14A 1YI6A 5JFXA 3RBWA 2R3HA 1PXIA 1GIIA 3R6XA 4N4SA 2QOLA 3OG7A 3CC6A 4DGMA 2OJIA 3TN8A 3BWJA 5J95A 1PKDA 4YHJA 4BKJA 3KN6A 2UZVA 4YGAA 4DFUA 5LVPA 4BDGA 4NIFB 1SM2A 5DLSA 2VNWA 4ZP5A 2OXYA 3FMHA 3I7CA 3V51A 2G1TA 1TQPA 4FSQA 4I5MA 2BVAA 2R3OA 4OTDA 5ANGA 4PL3A 4BDBA 5EKNA 2J0JA 3HRBA 3OEFX 4ITJA 3W2PA 3C4XA 4DFXE 2QODA 3O96A 2I1MA 5G1XA 1YWRA 5CI6A 2E9UA 3KCFA 3VW6A 4QMTA 3ZLXA 2JFLA 3BHTA 4YZMA 3K54A 4DH8A 5K5XA 4NTTA 2J90A 4DDIA 1UKHA 4LGGA 2X81A 4DN5A 5DMZA 5AIKA 2PVFA 1XH9A 5DBXA 4TYJA 1E9HA 3L9NA 5KMLA 4PDSA 3ORTA 4YSMA 2OJFE 3HDMA 3SKCA 5AADA 2BFXA 1DS5A 2YWPA 4TWPA 3GXLA 3KXXA 2XVDA 3PRFA 4J95A 2IG7A 3Q53A 2ZM3A 3R04A 3I81A 3CIKA 1Y6BA 2RGPA 3Q4CA 5J79A 4AA4A 3PXRA 3UGCA 4OTPA 4BCJA 3TL8A 5IH4A 3SG9A 2YACA 2HK5A 3IW5A 4U8ZA 1U5QA 4KIOA 5GHVA 4E5WA 3DCVA 4MX9A 3KULA 5L2QA 4EUUA 5BX0A 5AAEA 3IW6A 4RJ8A 4K6ZA 4U79A 5JFSA 3PA4A 2CKEA 4RLKA 4C61A 3MJ1A 4H39A 3RNIA 2R0UA 2V7OA 3NVKI 4ZAUA 3DTWA 3TNWA 2PZRA 3H3CA 4QMMA 4RIXA 3LW0A 2PY3A 3K3JA 3WYYA 3QUEA 4LGHA 4BBMA 1GNGA 4BL1A 2J5EA 1Q5KA 3MW1A 4YU2A 5AV2A 4FEXA 4AOJA 1OKWA 2X9EA 2B7AA 3MSSA 3R9OA 4DBXA 2ONLC 4H3QA 4RC3A 4DTAA 1Q41A 2C3LA 4HYUA 4K77A 2O8YA 4GKIA 2B52A 3V5PA 4QMYA 3DBQA 3R22A 3SQQA 5JK3A 4FNYA 1DAWA 2JAVA 3LXNA 3QQGA 2ZM1A 4BHNA 4DAWA 3A60A 4PDPA 3R1SA 4LOQA 4QMZA 3WZUA 4CMOA 3AC2A 4JQEA 3SXSA 2QVSE 3GNIB 2ZDTA 3UNZA 3OXIA 3EN9A 2IZUA 5IUHA 2VTRA 5EH0A 2O3PA 5FTOA 2E9NA 3QWJA 5JZJA 4APCA 5CU3A 2OJGA 4O0WA 5D7VA 4JDJA 4ENXA 5L3AA 5BUIA 4EWQA 3P5KA 4AW0A 4ACDA 1XH6A 2XKDA 4IZ5A 4M97A 5AUTA 5GZAA 3OTUA 3PWYA 4USEA 4CTCA 4RJ3A 2YERA 4A7CA 3R30A 2WIHA 3GP0A 3R28A 1IA9A 4Y46A 3KXNA 5JQ5A 4FT7A 3FMEA 5GIPE 4HVGA 3RZBA 4BJJB 3EQIA 4OGRA 4FGRA 5KMOA 4FV9A 2X0PA 3LMIA 5LWMA 4DEEA 1YDRE 2VZ6A 3OW4A 2YM4A 3AGLA 4O27B 4U5JA 5ANOA 4O7YA 4QT1A 4QP3A 3FI2A 3R83A 2UW0A 2ACXA 2FSOX 5HEZA 3ZSGA 3FSFA 5AUVA 3OWJA 4QQCA 3VS3A 3G9LX 5LXMA 4NYEA 5HU9A 2VO6A 5ANDA 3ZXZA 3HVCA 3QTQA 4AT5A 3KK9A 4FTRA 5KMMA 4RBLA 4XEYA 5HU3A 2W0JA 3QX4A 5E8TA 1XR1A 2XB7A 3R8LA 3U87A 3OUNB 4IM0A 1U4DA 4CNHA 2RFSA 4HYSA 3KXMA 3POZA 2XJ0A 3BHUA 4JDHA 4EH7A 3CPBA 3OEZA 1KSWA 2EXCX 2OI4X 5CU4A 2LGCA 1R78A 5E90A 5K5NA 4XG9A 2UVYA 3V8WA 3AT2A 3IECA 2JLDA 4A9YA 2JIIA 4TYHB 3BYMA 3QA0A 4NW6A 1B6CB 2JC6A 4B99A 5LVLA 2R3NA 2QOIA 4RA4A 2H8HA 5L8LA 2XIYA 2J5FA 2J2IB 4B0GA 2G9XA 3R63A 3VQHA 4LV7A 4OLIA 3E8DA 2V55A 3P7AA 4FG7A 4ZTRA 4DEDA 1RE8A 3QD0A 5J9LA 4KABA 3CD8A 2WPAA 2WFYA 5KMKA 3FZRA 2ZMCA 5FM3A 3JPVA 3VUDA 1QL6A 2WTWA 4AE6A 2C0IA 3BLQA 4Y8DA 2C5XA 1OL6A 2XK4A 5TE0A 4DFLA 2OU7A 5A6NA 3GBZA 4FNXA 4QP6A 5AFVA 5M08A 2ZYBA 2Z7RA 4NM3A 4HNFA 4CFMA 1WBNA 3CQEA 2J6MA 3GU6A 4NT4A 2VWXA 3F2AA 5DI1A 2BRBA 2UZBA 2XBJA 3D2KA 5I9ZA 3E7OA 4GL9A 4ZSAA 4AFEA 1H1RA 3UQFA 3ZDUA 1MUOA 2PE1A 1GZNA 4F9WA 4K8AA 4DE4A 3COIA 3ZRMA 2YM5A 3VUTA 3UMWA 2CKPA 5L8KA 5DT4A 4AXCA 4BVUA 4CFUA 2CCHA 3PG1A 1ZZLA 2R3GA 4AU8A 4EYJA 3GU4A 2QHMA 4UY9A 4FSUA 5IH6A 2QG5A 3ORLA 1Q61A 1IAHA 2B54A 3GC7A 3RTPA