2YJSA

Structure of c1156y mutant anaplastic lymphoma kinase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
308
structure length
286
Chain Sequence
PNYCFAGKTSSISDLKEVPRKNITLIRGLGEVYEGQVPLQVAVKTLPEVYSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Structure of C1156Y Mutant Anaplastic Lymphoma Kinase
rcsb
source organism Homo sapiens
total genus 95
structure length 286
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yjsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yjsA01
1F0QA 4QMPA 3TKIA 1W83A 5TOZA 3NRMA 1BI8A 3ENHA 4PL4A 4B7TA 2PY3A 4F0IA 2J50A 5KMNA 5HZNA 4MD9E 2WTJA 4M3QA 4RZWA 3BRBA 4NIFB 4M15A 4PY1A 3NVMB 2QO9A 4KIOA 4EOIA 4ASXA 2OSCA 2XRWA 1WBNA 3SAYA 4TYHB 3EQIA 4AGUA 3ZO3A 5ICPA 4O84A 5BUIA 1OITA 4DEDA 3MYGA 5IDNA 3SW7A 4NUSA 4EOPA 5J79A 3IDCA 3K54A 3R04A 2CJMA 2RFEA 3EL8A 3TEIA 2X6EA 4IC7A 3PRIA 4D4VA 4WKQA 1UU9A 2WOTA 3R1SA 5HKMA 4YTCA 3F2AA 1FQ1B 4FIFA 4RPVA 2XK3A 5JQ8A 1OGUA 5M4IA 4EHEA 2CHLA 4ANMA 3PFQA 4E6QA 4NT4A 5F94A 4BTJA 3KVWA 2DQ7X 3RK7A 3MWUA 3BEAA 3QA0A 2J0JA 4TYGA 5CVHA 3W8LA 3PUPA 2EVAA 2B52A 4BIDA 3Q4CA 1FVRA 4DFUA 5HBJA 3UC3A 4YR8A 4U80A 4XBRA 3K2LA 5BVEA 2C5XA 3PRFA 5I9ZA 2QC6A 2PMLX 3OFMA 4OUCA 4EH2A 3N51A 4ZLZA 2WO6A 4ZTSA 3AC1A 3VBXA 2X9EA 3RWPA 1NVQA 1WBSA 1H28A 2JDRA 3DLZA 3MFUA 4BCQA 5AADA 1UV5A 2HY0A 2WQEA 2ZDUA 2OJIA 3MV5A 4KIPA 1DI8A 4U41A 4I6QA 4L42A 4D2TA 1OUYA 3P08A 5C03A 4UMPA 5LMBA 5I0BA 5FRIA 4KSQA 3PG3A 4OTFA 1JKLA 1H01A 3G9NA 4J1RA 2WEVA 5HU3A 2WMXA 2QOBA 3W16A 2YEXA 2C5NA 3P79A 3Q4UA 4XV1A 4E8AA 1YXVA 4IAFA 4IVDA 3MFSA 3PIZA 1ZYLA 2ETKA 4AU8A 2OZAB 2XA4A 4FIEA 4IWPA 1WVXA 4L8MA 5EKOA 4PMMA 2NRYA 4EHZA 4F7JA 4FTAA 4NJ3A 4TWNA 2PVKA 1M52A 2C69A 3NYVA 4IC8A 3A2CA 4IDTA 4U43A 3NUAA 5GJDA 4L3PA 3FZTA 3K5VA 4RQKA 4MK0A 3A7JA 5LMKA 3DDPA 4DTBA 2OH0E 3CQUA 5IISA 4FKRA 4QMWA 3VVHA 3ENMA 1PY5A 1OZ1A 2JITA 3BHYA 3G2FA 3LXKA 3PXQA 2VTHA 3QC4A 4TYEA 3RVGA 4AACA 4U6RA 3O8UA 3P78A 3DS6A 3TNQB 1YRPA 4KKEA 5GIOE 3VS6A 5HE2A 4FZ7A 4QD6A 4NWMA 3MN3A 4C2VA 2VU3A 5ANGA 5CAUA 2CNQA 2W9ZB 3ZEWA 3ZFXA 1OBGA 3NAYA 3KA0A 4XNEA 4ANOA 1W84A 4V0GB 5A4TA 3FAAA 1O6LA 3ZYAA 1XH5A 3O8PA 2HXQA 4L3JA 4QQ5A 3U55A 3DLSA 1XBCA 2ITVA 1OKZA 1UVRA 2W5BA 3JY9A 3QYZA 5GIPE 3A4PA 1UWHA 4I94A 2YCFA 3GC8A 4D4SA 3SRVB 1JBPE 3PA3A 5BYZA 4I41A 4YTIA 4UB7A 3SD0A 2JDVA 2QOOA 4O0VA 5K0KA 2LAVA 3GB2A 4TL0A 2Z02A 4PTCA 3FMLA 4RG0A 5HORA 4AUAA 3K3IA 4JJRA 4OTGA 4I6HA 2UW5A 4MF1A 4RJ5A 1M2PA 2OH4A 3LCTA 1PMUA 3PSBA 4O7LA 3NNXA 4FKWA 4NFNA 3BU3A 3V8TA 3FKNA 5KMKA 3LJ1A 4KBKA 4AF3A 3R63A 2WTDA 3R9DA 1AQ1A 4BGHA 4EWHA 4JT3A 2VTPA 4QP9A 3DCVA 3G90X 5EW9A 4EOOA 3FLQA 3ZC6A 3DY7A 4Y5QA 1FOTA 3V5TA 1OKYA 2OIBA 4KKHA 3QD3A 4ZJJA 3SG8A 2X2KA 3F5GA 3E62A 4OR5A 4H39A 5GJGA 4PNKA 5C9CA 5JT2A 3RM7A 4JR3A 5GHVA 3BLQA 2GNHA 4B0GA 3C4EA 1KE9A 3ITZA 2C5VA 3PJ3A 1JKTA 3EQHA 4LFIA 3G15A 4FTNA 5C8NA 3FZPA 4EOLA 3VHEA 3KXXA 2PULA 1M2QA 4FKLA 4G2FA 2IO6A 1W98A 3HUBA 2Q83A 4ZTQA 5BX0A 5EQPA 4ALVA 2HELA 4LMUA 1URWA 4BL1A 2W5HA 1OPJA 2QHMA 4V04A 4QYFA 2PZPA 2RG5A 4RIXB 3RAHA 3KRRA 4S34A 3VBQA 4KWPA 4BZDA 4DHFA 2CNUA 5I3OA 3Q2JA 3MH3A 4U44A 3PLAE 3FMHA 5IUGA 2KULA 1OUKA 3HX4A 3TZMA 3UQCA 2WMSA 3CY3A 4G3EA 3GC0A 4BDCA 5EYCA 2W1ZA 4EHGA 4PP7A 5AA9A 2XM9A 5AP6A 4W4VA 4BYJA 1YW2A 1IAJA 2GHMA 4QP8A 4NM0A 4U81A 3D9VA 2BFXA 3QUDA 4O91A 3DPKA 3GCUA 2R3NA 4TT7A 4PQNA 4EZ5A 3DBDA 4ACGA 2WQMA 4O27B 2W1DA 1ZRZA 4UXLA 4YJVA 1GZKA 5A4LA 4YPSA 3QWJA 4F0GA 2JKKA 1TQMA 3OC1A 4AT5A 4Q2AA 4OBOA 3IQ7A 1REJA 2ITQA 2J5EA 4BI1A 4C61A 5TKDA 3WARA 4BGGA 4DA5A 2BFYA 4BRXA 3QL8A 3FI4A 1YI3A 4KKGA 3C4CA 4I5HA 5JSMA 3R8UA 4FEUA 2P33A 1HOWA 4N6ZA 2E9UA 3KMMA 4EQUA 2XNGA 4IB1A 4JBQA 3MVJA 5AP0A 5CEPA 4MBLA 4K33A 4MCVA 5CSPA 4E7WA 1KE6A 4RFMA 4TN6A 5DEWA 3E92A 3KL8A 2GPHA 3L9MA 3PXZA 3PPKA 2UZEA 3R1YA 5D1JA 3MGYA 4DT9A 2Q0BA 1JAMA 2JKMA 4YTFA 2W1HA 4CGAA 1JSVA 4QPMA 3TCPA 5HX8A 3ZZWA 2XK9A 1Q8UA 2FUMA 1BKXA 1Q8TA 5AV1A 2XIRA 3QTWA 4YBKA 3RNYA 3OW3A 5HESA 3ZDIA 5CI6A 5HG7A 4IDVA 4FA2A 2QU6A 1YXTA 4PMSA 5HBHA 5LARA 4KRDA 5KUPA 4JDJA 2WIHA 3P0MA 3VULA 3CIKA 4B6LA 4P7EA 2OZOA 3ZOSA 3LKMA 3EQGA 3DU8A 5CU3A 2X81A 3WZKA 4IW0A 1OL6A 4L7FA 3PE2A 4IFCA 1KSWA 4NKSA 3BYMA 2EB3A 1TKIA 4W8DA 5CENA 1U5QA 4BIBA 5HEZA 4C4EA 5KMLA 1M7NA 3LCDA 4G3CA 2E9NA 4X6QC 3BLRA 4EC9A 5CQUA 4DH5A 4C7TA 4K77A 2WD1A 3E8EA 4GG7A 3TKHA 2Y4PA 3CGFA 3OY3A 4FSZA 4BCPA 4UYAA 5JQ5A 1BI7A 3G0EA 3H3CA 2VGOA 2RFSA 4RIWB 4RLKA 4IB5A 4MXOA 2VWIA 4ZZNA 5BPYA 1PRYA 4Z9LA 3RK9A 3ZFMA 3ZONA 4CEGA 5CX9A 5DEYA 1H4LA 2JAVA 4ZIMA 3RAKA 4E20A 4GL9A 1H25A 3IW6A 5H8GA 4ZSLA 4A7CA 4M14A 4N70A 4I0SA 4R5YA 1H07A 5BVWA 3HV7A 5IA0A 5HO8A 5I9VA 3QGYA 1QL6A 4DGMA 3FXXA 5JGDA 5HNGA 1F3MC 1M17A 4FV1A 4FGRA 3VUKA 4U97A 3ZLWA 4XG6A 3UP2A 4ITJA 3T9IA 3R7IA 4RVKA 3RJCA 3DBFA 4GVAA 2AUHA 2RKUA 5CZIA 5E90A 3UYTA 5E8ZA 3VAPA 2BAJA 4HVSA 4YBJA 4ZAUA 1S9JA 4IAKA 3AMYA 3H30A 5DR2A 3ZXTA 4DITA 3BYSA 2JFLA 1A9UA 4FKGA 4GG5A 4LRJA 3ZUUA 4ERWA 5C8MA 1CKJA 4I0TA 3MVMA 4N6YA 1WBVA 1SNXA 2YLEA 2XNPA 3HDNA 2HW7A 1MRYA 2OICA 2OW3A 3LFAA 1GIHA 5CZHA 1OB3A 5FEDA 3T8OA 3R22A 4KB8A 3VS5A 1QPCA 3L8SA 4BDBA 3AD6A 3PE1A 5KX8A 3H4JA 5L2IA 3FMDA 4CT1A 3M42A 1CMKE 3CKXA 5I9XA 5IQDA 1OPLA 3PVBA 3PP0A 3PY1A 2F49A 4BICA 1OIYA 2QU5A 4F70A 4I22A 1VEBA 2ZDTA 3CGOA 2W17A 3N9XA 4N4SA 4J8NA 2ERZE 3C0IA 4FKVA 5DIAA 3TWJA 4IWDA 4I6FA 4LL5A 4FV3A 3FL4A 4RQVA 5CU0A 2XVDA 3Q6WA 5E91A 1IA9A 3LHJA 2PE1A 5J8IA 3V8SA 4LUEA 4KRCA 4OT6A 5C26A 4ZMFA 3TT0A 2X2MA 1UKHA 4E6CA 2EUFB 4E26A 4PP9A 4RA5A 4AXAA 3MB7A 4AT4A 3RWQA 2OF2A 5H8BA 4JDIA 3KK8A 4TWCA 5A46A 2IVVA 3O50A 2W06A 4EK3A 5D7AA 4K18A 3W10A 3FSFA 5HG8A 4CLJA 5BQ0A 3OXTA 4BBFA 3DOGA 3VBVA 2HY81 1VR2A 4LOOA 2UZBA 4LGHA 2X7GA 3LCSA 3ZSHA 3B8QA 1H00A 2PVJA 3RPSA 3ZO4A 4EZ7A 3R7YA 4YZ9A 2PPQA 1FGKA 3FMNA 4H3QA 5IQGA 4TYIA 3IDBA 2YACA 4Z7GA 2XS0A 2EXCX 4RC3A 4FT9A 5CF5A 4C57A 3RGFA 3QX2A 2QR8A 1TVOA 3R6XA 4I92A 4EH9A 3OF0A 4ZMEA 3SKCA 3OG7A 3QHRA 5HHWA 2X1NA 4GT3A 4O7RA 3SOCA 3A60A 4XCUA 2GHGA 4BCNA 4DFBA 3VUMA 3R83A 4XS2A 4FV0A 5DT4A 2C3KA 1WVWA 4GS6A 5AMNA 3FMMA 3GT8A 3KULA 4D9UA 2CKPA 1NVSA 2C30A 4DC2A 5A9UA 5IDPA 5JEBA 2XM8A 3IGGA 3C50A 3EQCA 4WG3A 5HIDA 2QR7A 3QQKA 4KS7A 2V7AA 4H36A 4AX8A 5GZ8A 1H1RA 1TQPA 2XNBA 3MPMA 4I1ZA 2CGVA 5IQHA 4X3FA 5AP3A 2QURA 1P2AA 4C02A 3D7TA 4GK3A 2Z2WA 3R30A 3DGKA 2JD5A 4D2SA 2W96B 2WXVA 5KKRC 2IVTA 3TUDA 4BB4A 2IG7A 2PVLA 4UY9A 3VRZA 1ZARA 4DLIA 3C4ZA 1LP4A 2JKOA 3HKOA 3W2OA 5CAQA 3CCNA 3A62A 4Q5EA 3PVWA 4C34A 4E4XA 4BDKA 5CY3A 1CSNA 2Y6OA 3EWHA 2OI4X 1Y8GA 1H27A 4C4HA 3ZDUA 3OCTA 4M0YA 2C5OA 3VUDA 5D11A 5T6KA 4EONA 2EXEA 4YLKA 1XKKA 2X7FA 5IQAA 3NAXA 2FSLX 4O7ZA 3GUBA 4FV2A 3ZZEA 3FLNC 2R3PA 4FTUA 3C5UA 4R7BA 3IKAA 1YI6A 3MY1A 2C3LA 3OEZA 4L44A 4M69A 5EM5A 4IXPA 4TPTA 3UIMA 4Z16A 3BELA 2FGIA 3F82A 3R2YA 4FZDB 4MNFA 4CFXA 4WRSA 3CQWA 5LMAA 1V0BA 5EQEA 3NSZA 1Q3WA 5L3AA 4EOJA 3W33A 3KGAA 3AXWA 3UO5A 4MXZA 3KCKA 5KE0A 3A99A 3I5ZA 4JX3A 5AM6A 4PDPA 4EQMA 2BVAA 4ITHA 2PZYA 4NW5A 4F1MA 4K9YA 4G17A 1JPAA 3GU4A 2H96A 2NO3A 4HYHA 3R1QA 2VN9A 4DGGA 3FLWA 1YOJA 3UNJA 4FTLA 3JVSA 4TZRA 3M2WA 2WIPA 4G6OA 4E93A 3BKBA 2XZSA 5J9ZA 2Y7JA 4XV2A 1SMHA 2C6TA 2YISA 2QOLA 2ACXA 4Q9SA 4QQJA 3WF6A 4TRLA 1Q8YA 2V62A 4XEYA 3E3BX 4IAYA 4RX8A 3FY2A 4IQ6A 5CSWA 5IA4A 2WKMA 3NCGA 4S33A 5EDPA 3GU5A 4DBXA 3SV0A 3SLSA 4AAAA 4MNEB 4O1PA 4Z7HA 5AR8A 3OUKA 1ATPE 4EZ3A 1XO2B 5AR2A 2O5KA 2BZHB 2IW8A 5EHOA 1H1SA 3UOHA 3LXPA 2FB8A 3CEKA 3E87A 4C4GA 3MESA 4WUNA 2GU8A 2C6IA 3CY2A 3WI6A 5HG9A 3LJ2A 1W0XC 2AC3A 2BPMA 3UTOA 3H10A 4O81A 3LFSA 4L46A 2WQOA 3MY0A 4EH8A 3JUHA 4DH3A 3DZOA 5L6PA 1U59A 2OJJA 2YWVA 4F64A 2XIYA 3HV5A 4E4NA 3LFFA 4CMOA 4A4LA 2WFYA 3H9RA 4IVAA 3U4WA 4AOJA 1MP8A 3I0QA 5KO1A 4X7QA 2R3GA 4FTKA 1PXMA 3QALE 3R00A 4ZZOA 2JDTA 1IA8A 4M13A 3RAIA 3UZTA 3LFDA 3VWAA 3F3ZA 4IVBA 4AP7A 4FSTA 5DI1A 3ZCLA 3QKLA 3EYHA 4XV3A 3TNWA 3VUHA 3F5PA 3FC1X 4IANA 4NFMA 3ZSGA 5ANJA 4F6WA 5BUJA 4G5JA 3TUBA 4W4YA 2ZMCA 2C0TA 2XNOA 3UNZA 3UVQA 4FOCA 4DGLC 2WMQA 2G1TA 1H24A 2OJFE 4BDGA 5CU2A 4IACA 2C6EA 3CSVA 3DTCA 4X3JA 1XR1A 3OROA 2R3MA 4H3BA 3RI1A 4B99A 2X39A 4XLVA 3ZHPC 2R7BA 4EUTA 5KCVA 3CXWA 4NTTA 2QOQA 3R7GA 5AUWA 2C68A 2J2IB 5ETAA 4IFGA 3WYYA 4IZ5A 2W0JA 4I3ZA 3AGLA 1OKWA 2UW8A 3RAWA 3MIYA 3FZ1A 2VO0A 4DFXE 3HYHA 4QMUA 4F1TA 1WBWA 3EIDA 4O1OA 2XF0A 2UV2A 5DA3A 4UWYA 4DAWA 3KXMA 4YUQA 3QD0A 5LVMA 4MTAA 4JOAA 4FX3A 4LI5A 1G5SA 4AZFA 5IEYA 3VS3A 2BILB 4UZDA 4JVGA 2GNLA 5AIKA 1IASA 4QTCA 1Q5KA 1GIJA 2VWUA 3MDYA 4G34A 3VS0A 4D1ZA 2GDOA 4D58A 4DF3A 3GU7A 4I4EA 1YOMA 5AAFA 1L8TA 4J97A 5M51A 3ZM9A 2ERKA 2YHVA 4FG9A 5BVOA 3PZEA 4PPCA 2XH5A 2QLUA 4F9AA 4CNHA 5AA8A 5LXMA 3NW7A 4YZMA 3V8WA 5IQEA 3ORNA 5IG1A 3OWLA 4FZFB 4JBVA 4JG6A 3UODA 4C4JA 4CRSA 5AV2A 4FUYA 3P1AA 3ZU7A 4J96A 4WG4A 2CLQA 2QKWB 5FBNC 2FA2A 2XKEA 4IZYA 4C3PA 4Y83A 5CF8A 3NNVA 5EYKA 5HNBA 2BRBA 3REPA 5TT7A 4GEOA 3LPBA 1GZ8A 4EWQA 4KUJA 2HZIA 2J5FA 2PZ5A 2YITA 4I23A 5DBXA 4FSRA 4CFNA 4CYIA 1LR4A 1S9IA 1ZOEA 3BEGA 3PJ2A 4HYSA 3SHEA 4QTAA 4EH5A 4YHFA 2OIQA 4B4LA 3CJFA 5ANEA 4ANSA 5EYDA 3F88A 3GQLA 4Z3VA 2O8YA 3E64A 1FVTA 3CBLA 4HGTA 2YJSA 1OL1A 3FQSA 1OMWA 3PTGA 2GTNA 1VYWA 5HI2A 1Q62A 2ZB1A 5CXZA 1OI9A 3COIA 2OJGA 3I6UA 4KIKB 3KN6A 2ZOQA 2A2AA 3VW8A 4Z55A 4OAVB 3R1NA 5B2KA 2UW0A 4B8LA 4PDYA 3A61A 3ORXA 2CCHA 4FKUA 1HCKA 2H34A 2ZM1A 3QFVA 3RP9A 2QG7A 1QPDA 3BHHA 4U42A 3KQ7A 4J71A 5IKWA 2I0VA 5CEKA 3PYYA 3DKFA 4RJ3A 4XP0A 3KKVA 5DG5A 4FBXA 3I0OA 3KRXA 4BTMA 4XOYA 1XWSA 3KC3A 3UC4A 4KBAA 5C8KA 4UX9A 4FE2A 5IMEA 3G5DA 3EFLA 5CSHA 4EEVA 1NVRA 1ZOHA 4TYJA 3POOA 3DAEA 4JG7A 2IVUA 4EK5A 4X0MA 2XRUA 4RX5A 4GT4A 4LGGA 4G3GA 3VHKA 4R7IA 2PE2A 3CTHA 3R71A 3FZRA 2YZLA 5HVJA 1Z57A 3RBWA 3U4UA 4P90A 2XEYA 4PMTA 3ORLA 3GQIA 4FV7A 1H1QA 3VUIA 2JIUA 4HVDA 2CSNA 2DUVA 3G6GA 3SQQA 2PL0A 5H3QA 2ZMDA 5IEXA 2R3JA 2VO6A 2ZAZA 3D94A 4I24A 5EI8A 4ANQA 1Y57A 3BIZA 4MQ1A 3QQFA 3HAVA 2AYPA 5EOLA 5DOSA 5E7RA 5LWNA 2YN8A 1OL5A 1J3HA 4NM3A 3I7CA 4I5PA 3ERKA 4FT0A 4FIHA 3W8QA 4DFLA 4LGDA 3PIXA 3OS3A 2BRGA 3NIEA 4QQCA 2OXYA 1UU8A 4G31A 4D5KA 4LV5A 4CZTA 3TV4A 5JZJA 3P9JA 4O0UA 2R0UA 1UWJA 2BRMA 3F2RA 4M7IA 4RLLA 3SG9A 1BL7A 4H3PA 3EOCA 3BYOA 3FKLA 2CGUA 1OKVA 2V5QA 4J99A 3ZXZA 1SZMA 5C4KA 1NA7A 4BDJA 2YM7A 3ORMA 4AA4A 2WQNA 4YHTA 1PXLA 4ZY6A 4YURA 3MY5A 2R3IA 2OZAA 3V5JA 4E5AX 2QCSA 2OXXA 4ZTHA 4ZXTA 2PU8A 2I40A 4JRVA 4FTJA 5IQBA 5HE0A 4AGCA 3IECA 5IQFA 2XIZA 4JAJA 3WZJA 4Y8DA 5AV0A 1VYZA 2W1EA 3ROCA 3ZTXA 3OY1A 3EN9A 3O17A 2XCHA 3DV3A 2BKKA 1J1CA 3OBGA 1B38A 4FMQA 3QRJA 4NCTC 1J1BA 3DAKA 3OWKA 4ZK5A 5T68A 2GTMA 4QT1A 2OO8X 4IM3A 4TWPA 4YC8A 1JQHA 3P7BA 3RZFA 3B2WA 4HGLA 5D10A 1GAGA 1ZLTA 1KV1A 2ZV2A 2J0KA 3I79A 3V04A 4YPDA 3PLSA 3QKMA 4UALA 1KUTA 2J0MB 2P2IA 4R5SA 3FHIA 4C38A 3EZVA 4QTDA 1MRVA 4RWKA 4Y73A 4AZEA 2R3FA 2UZLA 2XKDA 4HZSA 2GQSA 2VO3A 1JKSA 1SM2A 3SC1A 4NW6A 4CKIA 2W4OA 4HJOA 2LGCA 2OLCA 4QP6A 3UO4A 3P86A 5HIBA 3ZO2A 5L4QA 3TV7A 5CWZA 4C58A 2Z7QA 5GZAA 4O96A 4FEXA 1RJBA 3BV2A 4GKHA 4FKQA 4FZ6A 4QP3A 1YHSA 3FV8A 1KV2A 4LG4A 3LJ0A 3PIYA 1LEZA 1W7HA 4AN9A 4HOKA 4U0IA 2WOUA 4BCJA 3SXSA 3PPZA 3SA0A 5DPVA 3FKOA 4RJ4A 2C1BA 4O6LA 5K0XA 4LMNA 2BRNA 4RBLA 4O0TA 5EI6A 4A07A 3PA4A 4FR4A 4XMOA 5CNOA 2XK7A 4FKPA 2HZNA 2Z7RA 4QPAA 3BBTB 4IE9A 4FV6A 2UVXA 4DN5A 4APPA 1WVYA 5CEOA 5AP4A 4FTOA 4GT5A 2W99B 5C27A 3LM5A 3QGWA 1FPUA 3E8CA 3HZTA 3RHXA 4JQEA 3FXWA 3EKNA 3NUYA 3MPTA 4K8AA 3ORZA 5DT0A 3BGPA 1VJYA 1E9HA 2VWVA 4AW2A 5A54A 5JRSA 2XJ0A 1E1VA 3BGZA 3CPBA 3UVPA 4YU2A 4WNKA 5BMMA 5BYLA 4PV0A 2H8HA 3G9LX 3VNTA 5EKNA 4EOQA 2BTSA 2W1IA 3NDMA 4G3DA 4PWNA 2CNVA 5ETIA 5BVKA 1JKKA 5CVFA 4ORKA 5IZFA 3NPCA 2WMVA 2BMCA 3G33A 4P4CA 5KHXA 3D7ZA 4ZSJA 2VAGA 4BHZA 1R1WA 2QG5A 4ACHA 1XH8A 4DGOA 2YERA 4AA5A 4O21A 5FDXA 4FTMA 3PSCA 2ITPA 5CEIA 3CJGA 3QXPA 5DT3A 4K1BA 1ZMWA 4R6VA 1W82A 4CVAA 1ZY4A 3TV6A 3WILA 2VTNA 2E2BA 3H9OA 4A9UA 5IA5A 3S1HA 2IW9A 2Z60A 3ETAA 3I1AA 5EFQA 4ACCA 3F3UA 5J7HA 1E1XA 1JSTA 3GFEA 2F7EE 2FSOX 3FYKX 3MTLA 2XK8A 5FM2A 4ZY4A 2EB2A 4EOKA 1PW2A 3DKOA 4CV8A 4ALWA 4J52A 2Y4IB 5CT0A 1BLXA 3AD5A 3F7ZA 4WBBB 4CTBA 2OIDA 2VNWA 3UDBA 3V5LA 4RJ6A 3ID6C 4JQ8A 5JK3A 3ZRMA 5IPJA 4OBQA 5DLSA 3BBWA 3HA6A 5CVGA 4IB0A 3R2BA 4JDKA 3MTFA 4BBMA 5KMJA 2BROA 2VZ6A 4MHAA 2BR1A 1R39A 2W9FB 4BDFA 3PWDA 4HZRA 4G9RA 3V01A 4QYGA 3EZRA 3ZUTA 5B2MA 1H1WA 3TG1A 4O7YA 4J7BA 3GU8A 4QMZA 2H6DA 3PXRA 4CKJA 5B2LA 1H26A 1RDQE 1YKRA 3LXLA 3LQ8A 4O22A 1ZAOA 3Q2MA 4O6EA 2C0IA 3GNIB 4TTHB 3RINA 1PHKA 5A6OA 1B39A 4DINA 4WHZA 4ZTLA 3AQVA 3G0FA 3VO3A 3P7CA 4YJTA 5AR4A 2JEDA 1HCLA 4FICA 1YDRE 3TUCA 3L8VA 5ETFA 3F9NA 3RPRA 3JVRA 2BAQA 4B9DA 2A4LA 3R8LA 4F9WA 2UW4A 3OXIA 5AUZA 1GY3A 1WZYA 4LRMA 3SDJA 3DXPA 4CZYB 4TW9A 2CKOA 3GCQA 5HTBA 2A27A 3FZSA 4ZTMA 3GC9A 4ZLYA 3A7HA 3O23A 2PVFA 4XP2A 4GIHA 5E4HA 5M57A 3EQBA 3HP2A 5HCXA 2CN5A 2X9FA 3QRKA 5CSVA 4AZVA 4RIWA 3W2QA 5IH4A 3R9HA 1CDKA 1UU7A 3C4XA 2CCIA 3HP5A 4BI0A 1XBAA 3WIGA 5M08A 4PRJA 2R64A 2A0CX 1U54A 2VTAA 2YM4A 5EH0A 3FXZA 4RIYA 3TIZA 3LFEA 2B0QA 3W2SA 4EKLA 4Y46A 2B9IA 3L9PA 4NSTA 3RPVA 5CF4A 4AE6A 3GVUA 4EBVA 3ODYX 3L8XA 2WAJA 5J1VA 2YM5A 3KU2A 3EYGA 4O7SA 4MBIA 4USFA 3UP7A 4R7HA 3A7IA 3I81A 5E8XA 3VUGA 4XHKB 5M56A 4AGWA 4A9RA 5AUUA 5CANA 3EKKA 2QOKA 3QTQA 5DFPA 4ACMA 1MQ4A 4NK9A 1YQJA 4FK3A 4XLIA 2CMWA 3HUCA 3LOKA 4F63A 2OBJA 3Q53A 4ERKA 4MVFA 3OCSA 2PUUA 2YLFA 4Y72A 4BZOA 3N4UA 1CTPE 5M07A 3ZMMA 3C0GA 1PXKA 4FL2A 5HTCA 2GHLA 3VJNA 3E7OA 3QRIA 5A14A 3RNIA 5J1WA 3BCEA 3AMBA 3E63A 4AFJA 3BE9A 4CFWA 1G8AA 1DM2A 3MPAA 4JBPA 5F1ZA 4C36A 1R0EA 5CAPA 3RPYA 2BHHA 4OTQA 2I0EA 4X21A 4CSVA 3IO7A 2AC5A 4D2WA 4QMTA 3COMA 4ZSAA 4BWXA 5HO6A 2RG6A 4M84A 2GNFA 5JGAA 3UG2A 5M09A 3AG9A 4BR3A 4QO9A 1H1PA 5EQYA 5FEEA 3R7EA 4E3CA 2QQ7A 4EKKA 3DZQA 2WGJA 2HWOA 4RRVA 3Q3BA 3NZ0A 2RIOA 3DK3A 4RT7A 4HYIA 5DGZA 3TKUA 5KMOA 4XH6A 5I9WA 1ZY5A 4O0SA 5DN3A 1YWRA 5DRBA 4K6ZA 5M55A 3GEQA 1SVGA 4OW8A 3WYXA 2X4ZA 3R9NA 3PXFA 4HNFA 3MJ2A 3O7LB 4EK8A 2W1FA 2P4IA 4DTKA 4FIJA 5EOBA 4D1SA 3NUPA 5KBQA 4BIEA 2GQRA 4UV0A 2XEZA 4AA0A 3SW4A 4RVMA 2PMIA 3MBLA 2ETMA 5H2UA 2B54A 3IOKA 3TNIA 2WU6A 4YSMA 5LVLA 2DYLA 1PYEA 4UYNA 2ONLC 2UZOA 3NW5A 5M4FA 5DNRA 3QYWA 4B8MA 4W4WA 3VQUA 4F6SA 2IVSA 3CLYA 5EHLA 5K4IA 5EDQA 4WSYA 1BL6A 4BGQA 2UZVA 4F9CA 3N4TA 4RWJA 4GUEA 4BZNA 1P5EA 3TM0A 2I7QA 1PF8A 4TNDA 5IA2A 4BDAA 4D9TA 3IOPA 3BYVA 4PPAA 4FK6A 4ZEGA 4S32A 4NJDA 4QP7A 2ZJWA 3Q96A 2E9OA 4XG3A 2WMRA 2PVHA 3KFAA 3BZ3A 3KXNA 4H1MA 3D4QA 1RW8A 4ZP5A 4CFFA 5I5ZA 3HRCA 1URCA 2ITTA 5BNJA 1T46A 4PNIA 4FSWA 3ULZA 5ITAA 1FGIA 2BHEA 2VWZA 3Q4TA 4IMYA 2C4GA 2GQGA 4MWIA 3ET7A 4EL9A 1GZOA 4CFUA 3S4QA 2IW6A 3T3UA 2BZKB 5I4NA 2BCJA 2IN6A 1IEPA 4KD1A 2PVYA 2WU7A 2WZJA 3QLGA 2R0IA 5L6OA 4IADA 1OM1A 4GFOA 4XG7A 5JFVA 1YI4A 3K3JA 2G15A 4L7SA 2J0LA 4KA3A 4TKSA 4GUBA 3QCYA 4L52A 4BY9E 3QQJA 3NX8A 5CS6A 4FZAB 4LOQA 3R8PA 4A9SA 3LMHA 2OFUA 1X8BA 4XBUA 3GCSA 3P23A 2VTTA 3UZPA 1SYKA 4FKJA 3D0EA 4BCFA 4RX7A 5CSXA 3R7OA 3H0YA 1PKDA 3EQRA 3BWFA 2R3HA 3BWJA 2ITUA 3D5VA 3EN6A 2XNNA 4D2PA 4BFMA 5B7VA 4FOBA 5IH5A 1OECA 5HIEA 1R0PA 2P3GX 3E8DA 3OHTA 2BDJA 2WMWA 3HECA 4W8EA 4R78A 2PK9A 5HE3A 3NYOA 3HA8A 3KULB 2HK5A 2V7OA 3QUPA 4FODA 3BU6A 3VF9A 2ITWA 3HMMA 2WB8A 3II5A 4EH3A 4Q9ZA 3AMAA 4JIKA 3G51A 1PXPA 3KK9A 3OVVA 5IEVA 3QQHA 3O96A 1OPKA 4YHJA 4XG9A 2F2CB 4M68A 4GK4A 4X3FB 1XBBA 1M14A 1XH9A 3D7TB 5K5XA 2HZ4A 3CD8A 3DBQA 3KMWA 4FIGA 4QNYA 3CQEA 4O86A 4DCAA 3GBZA 4DFNA 4HCVA 2FYSA 4EJNA 3BU5A 2UZDA 2X2LA 4RA4A 4X2KA 4Y95A 5EM6A 3I60A 2B9JA 3M11A 1UNGA 5AR3A 3ZLSA 4BCHA 1Z9XA 5ACKA 1JLUE 5GNKA 4F7LA 2XNEA 2IZUA 5EDRA 2PE0A 4GCJA 2R7IA 2ZV7A 3KN5A 4R3RA 5HGIA 5JFXA 3NWWA 4NKAA 4O2ZA 3QTUA 2XCKA 4IIRA 4D2VA 1JWHA 4GFGA 3KREA 5IQIA 3EFWA 3D83A 1P4FA 2DWBA 3BE2A 4MNEA 1H0VA 3L9NA 4IH8A 2YA9A 3QWKA 1GNGA 4EUUA 5AR5A 4EOSA 3KRJA 3P5KA 4ZY5A 4FKTA 2IPXA 4GU6A 3S2PA 4FYOA 3A7GA 3HV4A 2VD5A 4F6UA 1CKIA 3O71A 4HVIA 4JG8A 2ZM3A 5TE0A 5J5SA 3V5WA 4BDIA 2P0CA 4MYGA 3UE4A 1FBNA 3W55A 3OUNB 1Q41A 4OTPA 3F3TA 4OAUC 4CQGA 4D55A 1AGWA 3F5UA 4ARKA 2YWPA 1K9AA 3E8NA 3WF9A 1P4OA 4L01A 4I4FA 3L8PA 4IX3A 3C7QA 5E1SA 4AZSA 3R7VA 3MIAA 1FVVA 3FDNA 4FGBA 3HRFA 3QQUA 3WF5A 3ZO1A 2WELA 1R78A 3LFCA 2BAKA 4PDSA 3SXFA 2CGXA 4IM2A 4FSYA 4QYHA 3U9CA 4RMZA 4WG5A 4FYNA 3QUEA 2JKQA 3AC8A 4OTWA 3DAJA 3MI9A 2B4SB 5FGKA 2BRHA 3QD2B 4YTHA 3NW6A 1XQZA 3ANQA 3GCPA 3LFQA 4FNYA 2VTJA 4BTFA 2PSQA 4FSUA 2X8IA 1Q4LA 3O51A 1YWVA 4OTRA 4LM5A 3BI6A 3GFWA 3FEGA 3I6WA 5AFVA 3EH9A 4V01A 3QU0A 4R1VA 4CG9A 3F69A 2GSFA 4FC0A 4RWLA 4MXYA 5F95A 4BKZA 4ZS4A 4J8MA 2XMYA 3RCJA 3TJCA 5I3RA 1B6CB 2ZV9A 1SVEA 4MAOA 2VWWA 3Q5ZA 4AOTA 5M53A 4KINA 2I0YA 3U6JA 2X8DA 3NNUA 2HENA 2UUEA 2XNMA 3DFCB 4QTEA 4X2JA 2BDWA 4D4RA 3HNGA 2F4JA 3HMNA 3IK3A 3LVPA 2A1AB 4YZCA 5CT7A 5CU4A 3R8MA 3OTUA 5FWKK 3B2TA 4AGDA 4EJ7A 1PXNA 4CRLA 2C6DA 4FT5A 2OFVA 4QQTA 5L8JA 1PMEA 5FG8A 2E9VA 3F6XA 4G3FA 4TY1A 2HYYA 2OF4A 2VTQA 3QTIA 2WTWA 4FL1A 4J98A 2Y8OA 1K3AA 4FKSA 3UQFA 4L00A 5HTIA 2G2HA 4U9AA 4HVGA 5KHWA 3DJ7A 4L6QA 5KBRA 4KSPA 2ESMA 1EH4A 1PKGA 2UZUE 1STCE 2RGPA 4ZJVA 4FEVA 2J51A 1XJDA 3Q32A 5CYIA 2UVYA 4G9CA 5HBEA 3OMVA 3QZIA 5L8LA 4CCUA 4BCGA 5M4CA 3Q6UA 4WIHA 1WBPA 2QD9A 1Y6AA 3C13A 5AP5A 2YJRA 5FTQA 3EB0A 5ANKA 4UMUA 4MD8E 4YNEA 5HLPA 5LVNA 3UPZA 5C4LA 5L6WL 4IWOA 3LW0A 3QF9A 4AW5A 1OBDA 2C6LA 3EQFA 3E88A 5ANDA 3RALA 5IA1A 3E3PA 1YDTE 3AC4A 4WA9A 4C4FA 5HX6A 4WNOA 3TACA 4ZTRA 3OD6X 1ZZLA 3GI3A 3NYXA 3R02A 3F66A 2WMTA 3MA6A 1LPUA 2HW6A 2PMNX 2YFXA 4QMVA 5EHYA 4CV9A 2PUIA 3KF4A 4ZSGA 2BKZA 2DS1A 2HZ0A 4FKIA 4FTTA 4II5A 4BI2A 2YAKA 5DH3A 2F7XE 1I09A 2F57A 3NGAA 4IB3A 4O82A 4FF8A 2WTIA 1GJOA 2I0HA 1UNHA 1V0OA 5ANOA 1UNLA 2C6OA 2B1PA 4YP8A 4BDDA 1QPEA 3PPJA 1XH4A 4QMOA 5J95A 3VS2A 4D0XA 2IZTA 4BCKA 4DEBA 3P7AA 4QMNA 2W7XA 4AW0A 2YIQA 4L67A 3TJDA 3QZGA 2V22A 4NIFA 1WFCA 4BC6A 3AGMA 5JGBA 1BYGA 2BIYA 3CP9A 4R1YA 4V05A 4EH6A 1MUOA 3EMGA 3FLYA 4HCUA 4FTIA 4QOXA 4TYHA 4FVPA 1U4DA 4LL0A 1YXXA 2G01A 3VN9A 5I9YA 1W8CA 5EM7A 2NNWB 2ZV8A 3HV3A 2CLXA 1RE8A 2PZRA 4DEEA 3BLHA 3LZBA 3CE3A 5K3YA 2C3JA 3K5UA 4YGAA 5DR9A 2F9GA 3M1SA 4D1XA 4EYJA 2GFSA 3QQLA 3DK6A 4U7ZA 4AE9A 4AN3A 2B55A 4X2GA 3ZSIA 5J5TA 1IR3A 3C0HA 4FT7A 2WMUA 5LMKC 3TL8A 4BKJA 2RSVA 4JRNA 4RJ7A 4ID7A 3FY0A 3HMOA 3CC6A 4BCOA 4YO4A 4M12A 2BIKB 4P5QA 3VIDA 4CZUA 5LJJA 4W9XA 3TI1A 4A4OA 3IDPA 4MBJA 4U79A 3ZFYA 5JMSA 3PVGA 4I0RA 3QCSA 4YJRA 4QTBA 4A06A 5CF6A 2GMXA 4CXAA 2J90A 4DLJA 3TDVA 3UNKA 4O7TA 5G6VA 4F7NA 4WD5A 1NXKA 3ANRA 5EM8A 3DNEA 4YC3A 2GS7A 2WTKC 3GU6A 4I21A 4I5MA 4IX6A 4DH1A 2WQBA 5HO7A 3D5UA 1I44A 1BMKA 4AG8A 3ATTA 5FEQA 2QODA 4U3ZA 1ZYSA 4I6BA 3ZH8A 3DB6A 5C01A 3ORTA 3BV3A 4ZTNA 5EYMA 3ACKA 3LE6A 3QA8A 5HE1A 3ZLYA 1O9UA 4O7VA 3Q9XA 3MS9A 2VTOA 3FI3A 3OCBA 3PJ8A 3I7BA 2Z7SA 1NT2A 3THBA 3ORKA 4JDHA 5JRQA 3JPVA 5D12A 3MFTA 5E8WA 5JH6A 3U6IA 3AT2A 4S30A 2VWXA 2OG8A 5CNNA 5HLNA 4QMYA 5L8KA 5JKGA 3F7WA 5AP1A 1YHWA 5AUTA 3VS7A 1DI9A 3LFBA 5G1XA 1XHAA 2FO0A 5D9HA 3DB8A 3E93A 3HVCA 3BX5A 3NIZA 2JC6A 5AUYA 5DHJA 4BTKA 1V0PA 2YCQA 4PX6A 3ELJA 4FNWA 1SNUA 4XX9A 3WIKA 4HW7A 1JSUA 1J7LA 3LQ3A 5FTOA 2WMAA 1LEWA 3DXNA 2REIA 3Q04A 3FL5A 3NYNA 5E8UA 2GFCA 3PG1A 3DK7A 3LFNA 4FTRA 3EJ1A 3HLLA 2WHBA 2R9SA 5FDPA 3VJOA 1L3RE 3DJ6A 3MH2A 4NL0A 4PL3A 3GP0A 3EFJA 3CPCA 3TTIA 4S2ZA 4BWKA 5KZ0A 5M4UA 4V0GA 2FSTX 3ROYA 4DG0E 4U45A 3W2RA 5BUEA 3ZBFA 2PVRA 2ITYA 2RL5A 2Y4IC 3B8RA 3EHAA 4BF2A 5GZ9A 2V0DA 3BQCA 3KB7A 2R3QA 4HVHA 3ORIA 3NUSA 4FV4A 1G3NA 3QD4A 4AFEA 4G5PA 1MQBA 4F09A 4USEA 2P55A 1ZYJA 4C35A 2JDOA 4RJ8A 2VV9A 1V1KA 2BDFA 2FVDA 2O64A 4YZBA 4C3FA 5E1EA 3WZUA 3JR1A 3SRVA 4EI4A 1XH7A 3PXKA 4W4XA 2Y9QA 1Y8YA 5B0XA 5LCKA 3C51A 5L2SA 4H58A 1UA2A 4WOVA 3UJGA 4ALUA 4LYNA 3H0ZA 3VUTA 4FVRA 3WBLA 1PMVA 4U3YA 5K4JA 1T45A 3PVUA 3LQ5A 5K9IA 2YCSA 4LQMA 4BWPA 4NU1A 4ANLA 5ANIA 4CYJA 4M97A 4YZDA 3UPXA 4ENXA 4E4MA 4QP2A 3DKCA 4KAOA 4MX9A 3FZOA 4O2PA 5J7BA 3FLSA 3VS4A 4DG2E 2OK1A 3Q60A 4L53A 4KABA 4DEGA 3Q52A 5CAVA 2VNYA 4UMRA 1PYXA 3PZHA 2WTKB 2YM6A 2YABA 4AT3A 3Q9WA 5CU6A 3GOKA 4KS8A 5CLPA 4BCMA 1WBTA 1DAWA 3NUUA 1U46A 4EQCA 2QOFA 2W1CA 2XIKA 5CALA 1WMKA 3E5AA 4XG2A 1JNKA 5A3XA 3FI2A 2YIWA 2YM3A 3GGFA 1NW1A 2R2PA 4IHPA 4E5WA 2X4FA 3C4FA 1FINA 4R3PA 2ETRA 2ITXA 4OTHA 3R8VA 2YDJA 3OOGA 4UWCA 3NUNA 4GIIA 2Y6MA 5AP7A 3VC4A 3IGOA 2X0GA 5AV3A 4AS0A 5JN2A 1BX6A 2BUJA 4OLIA 3VQHA 2W4JA 5FXSA 1M2RA 2G2FA 2GNGA 4UN0C 4RIXA 4E6AA 5IUHA 4FSMA 3POZA 2WMBA 3GCVA 5AP2A 4ANNA 3D15A 4CLIA 3QCXA 4IVCA 3MJ1A 2XB7A 3OT3A 4RIOA 2WTCA 4NCTA 3R9OA 4RGJA 5J9YA 5E8TA 4RFZA 4QNAA 5I9UA 4E1ZA 4F08A 2OJ9A 5CTPA 4FTCA 5HICA 4O0YA 2QKRA 3KF7A 3CTQA 3FWQA 4GMYA 4UWBA 3ZBXA 3QBNA 3CS9A 4TXCA 4AZTA 4CFVA 4CQEA 4P5ZA 5E92A 4FV8A 5M06A 3KEXA 3LLTA 4GW8A 5E8YA 3VS1A 3UG1A 2JBOA 3Q9YA 4GVJA 3QTSA 2G9XA 4HPUE 4L68A 4PF4A 4WUAA 4DE4A 3C5IA 2IZSA 4X2FA 2PZIA 4C2WA 2YAAA 3HDMA 2VX0A 2QNJA 4OTIA 4MWHA 2Q0NA 1Z5MA 3UGCA 3QLFA 3JYAA 4JIAA 1OIUA 3TNPC 4QP4A 3NS9A 4FSQA 4MF0A 4BHNA 4GU9A 3OXZA 3CKWA 4DFZE 5A6NA 5EW3A 5HQ0A 2P2HA 4C37A 3I5NA 2XK4A 4DFYA 5C1QB 2B9FA 3MH1A 4IZ7A 4U40A 4U8ZA 3F2NA 2XBJA 5TF9A 4IX5A 3V5PA 2CKEA 4GKIA 2F7ZE 3DJ5A 2NPQA 2O65A 2QOHA 4CMTA 2JBPA 1F5QA 4HPTE 3F61A 1Q97A 4G6LA 4AWIA 3SGCA 3FMKA 1YVJA 2PMOX 2Z8CA 3OP5A 4USDA 5JZNA 5IU2A 4IX4A 5AV4A 3BQRA 2CGWA 4GJ2A 4XP3A 4EORA 2PVMA 3QTXA 3TTJA 4ONAA 5IA3A 4EK4A 4O38A 4E5BA 4IWQA 3OWPA 3FPQA 3UQGA 5A4EA 3HAMA 3A8WA 4PTGA 5IUIA 2W1GA 4G6NA 3FSKA 4CTCA 3VF8A 4DBNA 4KNBA 2VRXA 2EWAA 2XJ2A 2O2UA 2PTKA 2JLDA 4O0XA 4QP1A 2YZAA 5AAEA 5K5NA 1XH6A 2UZTA 2GNIA 2RFNA 2FH9A 3SX9A 3S00A 2VGPA 2HCKA 2R3KA 3EQPA 1AD5A 2B9HA 3FI8A 1IRKA 3HMPA 2WEIA 3D5WA 3FLZA 3EN7A 3PP1A 4BN1A 3A4OX 4GV1A 3EL7A 3AT4A 3PY3A 1LUFA 2A19B 2GCDA 4A4XA 2C1AA 3IW5A 3P4KA 5GINE 4FG8A 4RWIA 5FQDC 4TNBA 3ODZX 1DS5A 4D5HA 5ACBC 2KTYA 4E73A 3PXYA 2C6MA 5L2TA 4MXAA 4P2KA 3DFAA 4J53A 4FV9A 1O6KA 4OGRA 1ERKA 3QAME 4MQ2A 4M8TA 4DG3E 1BUHA 3R73A 4ZOGA 5CI7A 2UZWE 4JL9A 4C62A 4F9YA 3S0OA 4O7WA 4PTEA 4LOPA 1H8FA 4DH8A 1Q99A 3QTZA 4FVQA 4F0FA 5JFSA 3V3VA 2IWIA 3DT1A 2RFDA 4CMUA 4HGSA 3UYSA 4FIIA 1K2PA 4ZS0A 3Q5IA 4YLJA 1J91A 2YDKA 1YDSE 2R5TA 3DQXA 4L45A 5KMMA 4L9IA 4UBAA 4JXFA 3T3VA 3DBEA 4QMQA 5HCZA 4CT2A 5BMSA 3UOLA 2VTIA 2UW6A 5LVOA 5TR6A 4ZZMA 4C0TA 3WF7A 5KNJA 2R3RA 1GOLA 1Q24A 3BHTA 3NEWA 1OL7A 5AUXA 4D2RA 2V55A 3FHRA 4G16A 3VBWA 3T9TA 4IM0A 4RC2A 3PWYA 4QYEA 1U54B 4DH7A 1J7UA 4RIYB 5LWMA 3CTJA 2QOIA 3IW8A 3EN5A 2J9MA 2VTRA 4JAIA 4JI9A 4A9YA 5KMIA 1A06A 1YOLA 3MB6A 2GNJA 3DA6A 4H1JA 4U5JA 5HCYA 5A4CA 2EXMA 3OT8A 4XYFA 2I6LA 3DTWA 5HOAA 2VTSA 5HD7A 2B7AA 3AT3A 1CKPA 4I20A 3TZ9A 2H9VA 1OL2A 2ITNA 3HL7A 4XUFA 5FM3A 2YIRA 3U51A 1QMZA 1PXIA 4IAIA 4WNPA 4ZSEA 1ZYCA 4EH4A 3ORPA 4LV8A 3UIUA 4C8BA 1KOBA 3QHWA 4LUDA 3RMFA 2QVSE 4DEIA 5IMXA 3N4VA 2QO7A 4JX7A 3ZUVA 1KE7A 4PUZA 2CKQA 3TN8A 4QMLA 3PJ1A 2W05A 5DE2A 1FMOE 4NM7A 1JOWB 2XKFA 2NRUA 3WE4A 3S3IA 4ASZA 4NH1A 2YM8A 3L1SA 2FSMX 5F4NA 2YIYA 3NNWA 2W5AA 3OCGA 3GENA 4X3FC 3R8ZA 4BCIA 3RKBA 4AZWA 3GOPA 3LIJA 4X2NA 1GIIA 3PY0A 4C3RA 4XG8A 1OIQA 3NR9A 3RZBA 2VWYA 4C4IA 5EG3A 2C6KA 3CD3A 2R3OA 3NUXA 4UEUA 3QXOA 4K11A 5HVKA 5FP5A 3D2IA 4MXXA 4HCTA 4IEBA 3FE3A 1ZXEA 4RVLA 3KXGA 4M67A 5CASA 2C5YA 3ACJA 4E4LA 2I1MA 4ENYA 2XBAA 1DAYA 2WNTA 1ZMUA 2XUUA 5BVFA 4RVTA 4PPBA 2OWBA 3HEGA 4BKYA 1PXOA 5LOHA 3AC3A 2HWPA 2PVNA 2X6DA 4MH7A 4N0SA 5CQWA 4UXQA 5L2QA 1GZNA 4WRGA 3QX4A 2PUNA 4N57A 3GXLA 4XRJA 5AWMA 4X6RA 3ZRLA 3AC2A 4M66A 4YO6A 2XK6A 4NTSA 4AOIA 5D41A 5EW8A 3R7UA 2BZJA 3FJQE 3W32A 3U9NA 5JFWA 1Q8WA 4OBPA 4YJSA 1A48A 1JVPP 4PMPA 3VRYA 5GJFA 3Q4ZA 5FP6A 4D28A 1APME 3BHUA 3E7VA 3ALOA 1IAHA 2VTLA 4OT5A 4EC8A 3AD4A 4Y85A 2JAMA 4FT3A 4AW1A 3KRWA 1Q8ZA 2ZVAA 4JQ7A 3ATSA 3FMEA 4YJQA 4APCA 4UZHA 4EK6A 4W9WA 2XJ1A 3FPMA 2SRCA 2XYUA 2O0UA 2BALA 5TO8A 1ZYDA 4YMJA 3FYJX 3O2MA 3TIYA 3OW4A 4CD0A 5DRDA 1ZOGA 4D4YA 3UIXA 3QC9A 3NMUF 5F9EA 3LXNA 5FD2A 5FXQA 1KWPA 1U5RA 5AJQA 4FNZA 4R8QA 5J87A 4IJ9A 1H0WA 2UZNA 4O0RA 3Q9ZA 3LAUA 4M0ZA 4XRLA 2E9PA 3KRLA 3PSDA 3UO6A 4C33A 4MD7E 4YJPA 4YLLA 5AAGA 5BYYA 3HV6A 5D7VA 3ZM4A 4XOZA 3HMIA 4G1WA 2NP8A 3OOMA 3O8TA 3UMXA 3JY0A 1RQQA 4YJNA 3MA3A 4WSQA 4HYUA 2YCRA 2GS2A 4L3LA 3W2PA 4O83A 1MRUA 1PXJA 2YIXA 4DGNA 3RHKA 4WT6A 3ZLXA 3IW7A 4KBCA 3D2KA 2YDIA 3OZ6A 4RZVA 3FUPA 2HIWA 3VBTA 1Y91A 3R21A 1YXUA 3MSSA 5FBOA 4DEHA 3A8XA 2HAKA 5HVYA 2BTRA 2EU9A 2ONLA 2R3LA 4IAZA 2R4BA 2PUPA 4FEWA 4RSSA 5LQFA 3GC7A 3H9FA 5CEQA 3F3WA 4BDEA 4L43A 1Q61A 3LLAA 5AX3A 3HRBA 3NCZA 4R77A 3SVVA 4YJOA 3R0TA 3IG7A 4F99A 4BVUA 3AOXA 1PJKA 3EQDA 5HD4A 2RF9A 4JS8A 4GYIA 4EYMA 2WTVA 4O0WA 4K0YA 2J4ZA 3WE8A 4J95A 3PDTA 5CAOA 4FV5A 4PDOA 3W18A 1H08A 4M69B 3FMJA 3BPRA 2WPAA 3F5XA 2HOGA 3UIBA 3AC5A 4JR7A 5BVDA 5AM7A 3COHA 4QPSA 3UOJA 2G2IA 4ANBA 3DDQA 4NM5A 4ACDA 4NYEA 4F4PA 4QRCA 3ZC5A 2VWBA 3TDWA 3V6SA 4CFMA 4IJPA 4XJ0A 4DCEA 5A4QA 3ULIA 1KOAA 2BZIB 3KY2A 3L9LA 3LCOA 3U8WA 2QHNA 4FG7A 4EH7A 2C3IB 2JGZA 5DR6A 3QKKA 3QRTA 4F1OA 5AEPA 1J7IA 3LMGA 2F2UA 4BBEA 3WF8A 4MKCA 3RM6A 2OGVA 4WO5A 3RTPA 2OU7A 4CG8A 3FQHA 4EOMA 5HU9A 5EK7A 3NVKI 1QPJA 4FI1A 3KVXA 5FLFA 1G8SA 4YNOA 4ZJIA 4NZWB 1O6YA 2X8EA 3UVRA 3IW4A 4MEDA 1WBOA 4JBOA 3HGKA 1WAKA 5HLWA 2J7TA 2UW7A 3OTVA 3R01A 4UMQA 4YC6A 2Z7LA 4F9BA 5DMZA 5L2WA 4JNWA 5E9EA 5AX9A 4BYIA 2VO7A 5HNIX 1ZWSA 4F7SA 3WOWA 1OIRA 4C59A 3TZ7A 4WNMA 5J9LA 2QI8A 3IONA 3UZRA 3KXZA 2ZYBA 2IJMA 2QLQA 3SXRA 2XKCA 3VW6A 4WBOA 3SOAA 3EN4A 3ALNA 4Y5HA 3BYUA 3FQEA 4I5CA 5LVPA 5M44A 3U54A 2XP2A 3NLBA 3ZS5A 5BVNA 4CKRA 4ZLOA 3U6HA 3TZ8A 3CR0A 3W1FA 3MVLA 5KKRB 3JXWA 4IZAA 1ND4A 5DWRA 3O7LD 2UW9A 3VBYA 5DYJA 3UMWA 4GFMA 4GK2A 2HXLA 4QMMA 4RFYA 1YHVA 3QTRA 4TWOA 1M7QA 3OBJA 1VZOA 2CDZA 4MXCA 2CPKE 3S95A 1SVHA 4CCBA 4QMSA 4E6DA 3JS2A 3LCKA 3DQWA 4R3CA 4YZNA 2JFMA 1NY3A 2VX1A 2GS6A 4XV9A 4GH2A 4BDHA 4YSJA 4I93A 4RX9A 2QO2A 2PHKA 5KZIA 3V5QA 5H8EA 1P14A 3DNDA 1YWNA 5E8VA 5IQCA 4S31A 1IG1A 3DKGA 5FXRA 1KE5A 3G6HA 2UW3A 4HGEA 3OEFX 2CN8A 3F3VA 4DT8A 2ITOA 4KIQA 1ZZ2A 3QQGA 4GRBA 4JLCA 4EHVA 4H05A 4FTQA 3TXOA 2W4KA 1REKA 2O3PA 3KCFA 1CM8A 5CXHA 4NEUA 4A9TA 2Y0AA 1Y6BA 2OXDA 5EI2A 4IBMA 5F20A 3U87A 4K2RA 3D5XA 2X7OA 4FKOA 4DEAA 3MH0A 3C1XA 3TNHA 4AQCA 1YXSA 5E8SA 3QZHA 4YJUA 5AUVA 4ASEA 3W2CA 2J0IA 1KE8A 3WZEA 2JDSA 5HG5A 3UOKA 5T3QA 3D14A 4ITIA 5LCJA 4UMTA 3WZDA 3QRUA 2ZM4A 1R3CA 1WCCA 2PWLA 5AR7A 3R28A 3ZRKA 2J6MA 3LM0A 3LMIA 2XIXA 4RC4A 3IPHA 2PYWA 4PL5A 3PA5A 3C9WA 4QMXA 4QYYA 3V51A 2ZB0A 4KIKA 2UVZA 3RK5A 2JIVA 4FUXA 4IAAA 4LRKA 4F65A 5IH6A 4DTAA 2QOCA 3BGQA 4FSNA 3V6RA 4XG4A 1ZMVA 1QCFA 4FEQA 4FL3A 4GJ3A 2O63A 4DYMA 4ASDA 3QZFA 1FMKA 1UKIA 2XYNA 4EBWA 3MFRA 1PMNA 2VTMA 2IZRA 2VX3A 4Q5HA 5ETCA 4GSBA 5CEMA 3FBVA 3OWJA 3MW1A 4D0WA 3RPOA 3MVHA 3IS5A 4GYGA 4OTDA 4FNXA 3O0GA 5FUTA 3ZEPA 5IF1A 3DBCA 3FC2A 3C4WA 4HNIA 4AN2A 3R9RA 1UU3A 2C0OA 3QCQA 4O7NA 2OKRA 2B53A 3UBDA 3RCDA 3I4BA 1OVEA 2VUWA 5AIRA 3DXQA 3COKA 5FTGA 5DVRA 5H9BA 3EFKA 3PJCA 3KXHA 2C47A 2ITZA 3A7FA 3KMUA 2JIIA 1Q3DA 2QONA 3BHVA 1TQIA
chains in the Genus database with same CATH superfamily
1F0QA 4QMPA 3TKIA 1W83A 5TOZA 3NRMA 1BI8A 3ENHA 4PL4A 4B7TA 2PY3A 4F0IA 2J50A 5KMNA 5HZNA 4MD9E 2WTJA 4M3QA 4RZWA 3BRBA 4NIFB 4M15A 4PY1A 3NVMB 2QO9A 4KIOA 4EOIA 4ASXA 2OSCA 2XRWA 1WBNA 3SAYA 4TYHB 3EQIA 4AGUA 3ZO3A 5ICPA 4O84A 5BUIA 1OITA 4DEDA 3MYGA 5IDNA 3SW7A 4NUSA 4EOPA 5J79A 3IDCA 3K54A 3R04A 2CJMA 2RFEA 3EL8A 3TEIA 2X6EA 4IC7A 3PRIA 4D4VA 4WKQA 1UU9A 2WOTA 3R1SA 5HKMA 4YTCA 3F2AA 1FQ1B 4FIFA 4RPVA 2XK3A 5JQ8A 1OGUA 5M4IA 4EHEA 2CHLA 4ANMA 3PFQA 4E6QA 4NT4A 4O4CA 5F94A 4BTJA 3KVWA 2DQ7X 3RK7A 3MWUA 3BEAA 3QA0A 2J0JA 4TYGA 5CVHA 3W8LA 2XAMA 3PUPA 2EVAA 2B52A 4BIDA 3Q4CA 1FVRA 4DFUA 5HBJA 3UC3A 4YR8A 4U80A 4XBRA 2AEGA 3K2LA 5BVEA 2C5XA 3PRFA 5I9ZA 2QC6A 2PMLX 3OFMA 4OUCA 4EH2A 3N51A 4ZLZA 2WO6A 4ZTSA 3AC1A 3VBXA 2X9EA 3RWPA 1NVQA 1WBSA 1H28A 2JDRA 3DLZA 3MFUA 4BCQA 5AADA 1UV5A 2HY0A 2WQEA 2ZDUA 2OJIA 3MV5A 4KIPA 1DI8A 3PFYA 4U41A 4I6QA 4L42A 4D2TA 1OUYA 3P08A 5C03A 4UMPA 5LMBA 5I0BA 5FRIA 4KSQA 3PG3A 4OTFA 1JKLA 1H01A 3G9NA 4J1RA 4QDVA 2WEVA 5HU3A 2WMXA 2QOBA 3W16A 2YEXA 2C5NA 3P79A 3Q4UA 4XV1A 4E8AA 1YXVA 4IAFA 4IVDA 3MFSA 3PIZA 1ZYLA 1TZDA 2ETKA 4AU8A 2OZAB 2XA4A 4FIEA 4IWPA 1WVXA 4L8MA 5EKOA 4PMMA 2NRYA 4EHZA 4F7JA 4FTAA 4NJ3A 4TWNA 2PVKA 1M52A 2C69A 3NYVA 4IC8A 3A2CA 4IDTA 4U43A 3BL9A 5GJDA 3NUAA 4L3PA 3FZTA 3K5VA 4RQKA 4MK0A 3A7JA 5LMKA 3DDPA 4DTBA 2OH0E 3CQUA 5IISA 4FKRA 4QMWA 3VVHA 3ENMA 1PY5A 1OZ1A 2JITA 3BHYA 3G2FA 3LXKA 3PXQA 2VTHA 3QC4A 4TYEA 3RVGA 4AACA 4U6RA 3O8UA 3P78A 3DS6A 3TNQB 4AXFA 1YRPA 4KKEA 5GIOE 3VS6A 5HE2A 4FZ7A 4QD6A 4NWMA 3MN3A 4C2VA 2VU3A 5ANGA 5CAUA 2CNQA 2W9ZB 3ZEWA 3ZFXA 1OBGA 3NAYA 3KA0A 4XNEA 4ANOA 1W84A 4V0GB 5A4TA 3FAAA 1O6LA 3ZYAA 1XH5A 3O8PA 2HXQA 4L3JA 4QQ5A 3U55A 3DLSA 1XBCA 2ITVA 1OKZA 1UVRA 2W5BA 3JY9A 3QYZA 5GIPE 3A4PA 1UWHA 4I94A 4I6LA 2YCFA 3GC8A 4D4SA 3SRVB 1JBPE 3PA3A 5BYZA 4I41A 4YTIA 4UB7A 3SD0A 2JDVA 2QOOA 4O0VA 5K0KA 2LAVA 3GB2A 4TL0A 2Z02A 3W0NA 4PTCA 3FMLA 4RG0A 5HORA 4AUAA 3K3IA 4JJRA 4OTGA 4I6HA 2UW5A 4MF1A 4RJ5A 1M2PA 2OH4A 3LCTA 1PMUA 3PSBA 4O7LA 3NNXA 4FKWA 4NFNA 3BU3A 3V8TA 3FKNA 5KMKA 3LJ1A 4KBKA 4AF3A 3R63A 2WTDA 3R9DA 1AQ1A 4BGHA 4EWHA 4JT3A 2VTPA 4QP9A 3DCVA 3G90X 5EW9A 4EOOA 3FLQA 3ZC6A 3DY7A 4Y5QA 3W0MA 1FOTA 3V5TA 1OKYA 2OIBA 4KKHA 3QD3A 4ZJJA 3AKLA 2X2KA 3SG8A 3F5GA 3E62A 4OR5A 4H39A 5GJGA 4PNKA 5C9CA 5JT2A 3RM7A 4JR3A 5GHVA 3BLQA 2GNHA 4B0GA 3C4EA 1KE9A 3ITZA 2C5VA 3PJ3A 1JKTA 3EQHA 4LFIA 3G15A 4FTNA 5C8NA 3FZPA 4EOLA 3VHEA 3KXXA 2PULA 1M2QA 4FKLA 4G2FA 2IO6A 1W98A 3HUBA 2Q83A 4ZTQA 5BX0A 5EQPA 4ALVA 2HELA 4LMUA 1URWA 4BL1A 2W5HA 1OPJA 2QHMA 4V04A 4QYFA 2PZPA 2RG5A 4RIXB 3RAHA 3KRRA 4S34A 3VBQA 4KWPA 4BZDA 4DHFA 2CNUA 5I3OA 3Q2JA 3MH3A 4U44A 3PLAE 3FMHA 5IUGA 2KULA 1OUKA 3W0PA 3W0QA 3HX4A 3TZMA 3UQCA 2WMSA 3CY3A 4G3EA 3GC0A 4BDCA 5EYCA 2W1ZA 4EHGA 4PP7A 5AA9A 2XM9A 5AP6A 4W4VA 4BYJA 1YW2A 1IAJA 2GHMA 4QP8A 4NM0A 4U81A 3D9VA 2BFXA 3QUDA 4O91A 3DPKA 3GCUA 2R3NA 4TT7A 4PQNA 4EZ5A 3DBDA 4ACGA 2WQMA 4O27B 2W1DA 1ZRZA 4UXLA 4YJVA 1GZKA 5A4LA 4YPSA 3QWJA 4F0GA 2JKKA 1TQMA 3OC1A 4AT5A 4Q2AA 4OBOA 3IQ7A 1REJA 2ITQA 2J5EA 4BI1A 4C61A 5TKDA 3WARA 4BGGA 4DA5A 2BFYA 4BRXA 3QL8A 3FI4A 1YI3A 2A98A 4KKGA 3C4CA 4I5HA 5JSMA 3R8UA 4FEUA 2P33A 1HOWA 4N6ZA 2E9UA 3KMMA 4EQUA 2XNGA 4IB1A 4JBQA 3MVJA 5AP0A 5CEPA 4MBLA 4K33A 4MCVA 1W2DA 5CSPA 4E7WA 4O4DA 1KE6A 4RFMA 4TN6A 5DEWA 3E92A 3KL8A 2GPHA 3L9MA 3PXZA 3PPKA 2UZEA 3R1YA 5D1JA 2X0QA 3MGYA 4DT9A 2Q0BA 1JAMA 2JKMA 4YTFA 2W1HA 4CGAA 1JSVA 4QPMA 3TCPA 5HX8A 3ZZWA 2XK9A 1Q8UA 2FUMA 1BKXA 1Q8TA 5AV1A 2XIRA 3QTWA 4YBKA 3RNYA 3OW3A 5HESA 3ZDIA 5CI6A 5HG7A 4IDVA 4FA2A 2QU6A 1YXTA 4PMSA 5HBHA 5LARA 4KRDA 5KUPA 4JDJA 2WIHA 3P0MA 3VULA 3CIKA 4B6LA 4P7EA 2OZOA 3ZOSA 3LKMA 3EQGA 3DU8A 5CU3A 2X81A 3WZKA 4IW0A 1OL6A 4L7FA 3PE2A 4IFCA 1KSWA 4NKSA 3BYMA 2EB3A 1TKIA 4W8DA 5CENA 1U5QA 4BIBA 5HEZA 4C4EA 5KMLA 1M7NA 3LCDA 4G3CA 2E9NA 4X6QC 3BLRA 4EC9A 5CQUA 4DH5A 4C7TA 4K77A 3UDTA 2WD1A 3E8EA 4GG7A 3TKHA 2Y4PA 3CGFA 3OY3A 4FSZA 4BCPA 4AXCA 4UYAA 5JQ5A 1BI7A 3G0EA 3H3CA 4O4EA 2VGOA 2RFSA 4RIWB 4RLKA 3W0OA 4IB5A 4MXOA 2VWIA 4ZZNA 5BPYA 1PRYA 4Z9LA 3RK9A 3ZFMA 3ZONA 4CEGA 5CX9A 5DEYA 1H4LA 2JAVA 4ZIMA 3RAKA 4E20A 4JMQA 4GL9A 1H25A 3IW6A 3VONA 5H8GA 4ZSLA 4A7CA 4M14A 4N70A 4I0SA 4R5YA 1H07A 5BVWA 3HV7A 5IA0A 5HO8A 5I9VA 3QGYA 1QL6A 4DGMA 3FXXA 5JGDA 5HNGA 1F3MC 1M17A 4FV1A 4FGRA 3VUKA 4U97A 3ZLWA 4XG6A 3UP2A 4O4BB 4ITJA 3T9IA 3R7IA 4RVKA 3RJCA 3DBFA 4GVAA 2AUHA 2RKUA 5CZIA 5E90A 3UYTA 5E8ZA 3VAPA 2BAJA 4HVSA 4YBJA 4ZAUA 1S9JA 4IAKA 3AMYA 3H30A 5DR2A 3ZXTA 4DITA 3BYSA 2JFLA 1A9UA 4FKGA 4GG5A 4LRJA 3ZUUA 4ERWA 5C8MA 1CKJA 4I0TA 3MVMA 4N6YA 1WBVA 1SNXA 2YLEA 2XNPA 3HDNA 2HW7A 1MRYA 2OICA 2OW3A 3LFAA 1GIHA 5CZHA 1OB3A 5FEDA 3T8OA 3R22A 4KB8A 3VS5A 1QPCA 3L8SA 4BDBA 3AD6A 3PE1A 5KX8A 3H4JA 5L2IA 3FMDA 4CT1A 3M42A 1CMKE 3CKXA 5I9XA 5IQDA 1OPLA 3PVBA 3PP0A 3PY1A 2F49A 4BICA 1OIYA 2QU5A 4F70A 4I22A 1VEBA 2ZDTA 3CGOA 2W17A 3N9XA 4N4SA 4J8NA 2ERZE 3C0IA 4FKVA 5DIAA 3TWJA 4IWDA 4I6FA 4LL5A 4FV3A 3FL4A 4RQVA 5CU0A 2XVDA 3Q6WA 5E91A 1IA9A 3LHJA 2PE1A 5J8IA 3V8SA 4LUEA 4KRCA 4OT6A 5C26A 4ZMFA 3TT0A 2X2MA 1UKHA 4E6CA 2EUFB 4E26A 4PP9A 4RA5A 4AXAA 3MB7A 4AT4A 3RWQA 2OF2A 5H8BA 4JDIA 3KK8A 4TWCA 5A46A 2IVVA 3O50A 2W06A 4EK3A 5D7AA 4K18A 3W10A 3FSFA 5HG8A 4CLJA 5BQ0A 3OXTA 4BBFA 3DOGA 3VBVA 2HY81 1VR2A 4LOOA 2NYAA 2UZBA 4LGHA 2X7GA 3LCSA 3ZSHA 3B8QA 1H00A 2PVJA 3RPSA 3ZO4A 4EZ7A 3R7YA 4YZ9A 2PPQA 1FGKA 3FMNA 4H3QA 5IQGA 4TYIA 3IDBA 2YACA 4Z7GA 2XS0A 2EXCX 4RC3A 4FT9A 5CF5A 4C57A 3RGFA 3QX2A 2QR8A 1TVOA 3R6XA 4I92A 4EH9A 3OF0A 4ZMEA 3SKCA 3OG7A 3QHRA 5HHWA 2X1NA 4GT3A 4O7RA 3SOCA 3A60A 4XCUA 2GHGA 4BCNA 4DFBA 3VUMA 3R83A 4XS2A 4FV0A 5DT4A 2C3KA 1WVWA 4GS6A 5AMNA 3FMMA 3GT8A 3KULA 4D9UA 2CKPA 1NVSA 2C30A 4DC2A 5A9UA 5IDPA 5JEBA 2XM8A 3IGGA 3C50A 3EQCA 4WG3A 5HIDA 2QR7A 3QQKA 4KS7A 2V7AA 4H36A 4AX8A 5GZ8A 1H1RA 1TQPA 2XNBA 3MPMA 4I1ZA 2CGVA 5IQHA 4X3FA 5AP3A 2QURA 1P2AA 4C02A 3D7TA 4GK3A 2Z2WA 3R30A 3DGKA 2JD5A 4D2SA 2W96B 2WXVA 5KKRC 2IVTA 3TUDA 4BB4A 2IG7A 2PVLA 4UY9A 3VRZA 1ZARA 4DLIA 3C4ZA 1LP4A 2JKOA 3HKOA 3W2OA 5CAQA 3CCNA 3A62A 4Q5EA 3PVWA 4C34A 4E4XA 4BDKA 5CY3A 1CSNA 2Y6OA 3EWHA 2OI4X 1Y8GA 1H27A 4C4HA 1XMMA 3ZDUA 3OCTA 4M0YA 2C5OA 3VUDA 5D11A 5T6KA 4EONA 2EXEA 4YLKA 1XKKA 2X7FA 5IQAA 3NAXA 2FSLX 4O7ZA 3GUBA 4FV2A 3UG1A 3ZZEA 3FLNC 2R3PA 4FTUA 3C5UA 4R7BA 3IKAA 1YI6A 3MY1A 2C3LA 3OEZA 4L44A 4M69A 5EM5A 4IXPA 4TPTA 3UIMA 4Z16A 3BELA 2FGIA 3F82A 3R2YA 4FZDB 4MNFA 4CFXA 4WRSA 3CQWA 5LMAA 1V0BA 5EQEA 3NSZA 1Q3WA 5L3AA 4EOJA 3W33A 3KGAA 3AXWA 3UO5A 4MXZA 3KCKA 5KE0A 3A99A 3I5ZA 4JX3A 5AM6A 4PDPA 4EQMA 2BVAA 4ITHA 2PZYA 4NW5A 4F1MA 4K9YA 4G17A 1JPAA 3GU4A 2H96A 2NO3A 4HYHA 3R1QA 2VN9A 4DGGA 3FLWA 1YOJA 3UNJA 4FTLA 3JVSA 4TZRA 3M2WA 2WIPA 4G6OA 4E93A 3BKBA 2XZSA 5J9ZA 2Y7JA 4XV2A 1SMHA 2C6TA 2YISA 2QOLA 2ACXA 4Q9SA 4QQJA 3WF6A 4TRLA 1Q8YA 2V62A 4XEYA 3E3BX 4IAYA 4RX8A 3FY2A 4IQ6A 5CSWA 5IA4A 2WKMA 3NCGA 4S33A 5EDPA 3GU5A 4DBXA 3SV0A 3SLSA 4AAAA 4MNEB 4O1PA 4Z7HA 5AR8A 3OUKA 1ATPE 4EZ3A 1XO2B 5AR2A 2O5KA 2BZHB 2IW8A 5EHOA 1H1SA 3UOHA 3LXPA 2FB8A 4DDGA 3CEKA 3E87A 4C4GA 3MESA 4WUNA 2GU8A 4FRFA 2C6IA 3CY2A 3WI6A 5HG9A 3LJ2A 1W0XC 2AC3A 2BPMA 3UTOA 3H10A 4O81A 3LFSA 4L46A 2WQOA 3MY0A 4EH8A 3JUHA 4DH3A 3DZOA 5L6PA 1U59A 2OJJA 2YWVA 4F64A 2XIYA 3HV5A 4E4NA 3LFFA 4CMOA 4A4LA 2WFYA 3H9RA 4IVAA 3U4WA 4AOJA 1MP8A 3I0QA 5KO1A 4X7QA 2R3GA 4FTKA 1PXMA 3QALE 3R00A 4ZZOA 2JDTA 1IA8A 4M13A 3RAIA 3UZTA 3LFDA 3VWAA 3F3ZA 4IVBA 4AP7A 4FSTA 5DI1A 3ZCLA 3QKLA 3EYHA 4XV3A 3TNWA 3VUHA 3F5PA 3FC1X 4IANA 4NFMA 3ZSGA 5ANJA 4F6WA 5BUJA 4G5JA 3TUBA 4W4YA 2ZMCA 2C0TA 2XNOA 3UNZA 3UVQA 4FOCA 4DGLC 2WMQA 2G1TA 1H24A 2OJFE 4BDGA 5CU2A 4IACA 2C6EA 3CSVA 3DTCA 4X3JA 1XR1A 4AXEA 3OROA 2R3MA 4H3BA 3RI1A 4B99A 2X39A 3NFFB 4XLVA 3ZHPC 2R7BA 4EUTA 5KCVA 3CXWA 4NTTA 2QOQA 3R7GA 5AUWA 2C68A 2J2IB 5ETAA 4IFGA 3WYYA 4IZ5A 2W0JA 4I3ZA 3AGLA 1OKWA 2UW8A 3RAWA 3MIYA 3FZ1A 2VO0A 4DFXE 3HYHA 4QMUA 4F1TA 4DHJA 1WBWA 3EIDA 4O1OA 2XF0A 2UV2A 5DA3A 4UWYA 4DAWA 3KXMA 4YUQA 3QD0A 5LVMA 4MTAA 4JOAA 4FX3A 4LI5A 1G5SA 4AZFA 5IEYA 3VS3A 2BILB 2X0OA 4UZDA 4JVGA 2GNLA 5AIKA 1IASA 3W0SA 4QTCA 1Q5KA 1GIJA 2VWUA 3MDYA 4G34A 3VS0A 4D1ZA 2GDOA 4D58A 4DF3A 3GU7A 4I4EA 1YOMA 5AAFA 1L8TA 4J97A 5M51A 3ZM9A 2ERKA 2YHVA 4FG9A 5BVOA 3PZEA 4PPCA 2XH5A 2QLUA 4F9AA 4CNHA 5AA8A 5LXMA 3NW7A 4YZMA 3V8WA 5IQEA 3ORNA 5IG1A 3OWLA 4FZFB 4JBVA 4JG6A 3UODA 4C4JA 4CRSA 5AV2A 4FUYA 3P1AA 3ZU7A 4J96A 4WG4A 2CLQA 2QKWB 5FBNC 2FA2A 2XKEA 4IZYA 4C3PA 4Y83A 5CF8A 2ZFYA 3NNVA 5EYKA 5HNBA 2BRBA 3REPA 5TT7A 4GEOA 3LPBA 1GZ8A 4EWQA 4KUJA 2HZIA 2J5FA 2PZ5A 2YITA 4I23A 5DBXA 4FSRA 4CFNA 4CYIA 1LR4A 1S9IA 1ZOEA 3BEGA 3PJ2A 4HYSA 3SHEA 4QTAA 4EH5A 4YHFA 2OIQA 4B4LA 3CJFA 5ANEA 4ANSA 5EYDA 3F88A 3GQLA 4Z3VA 2O8YA 3E64A 1FVTA 3CBLA 4HGTA 2YJSA 1OL1A 3FQSA 1OMWA 3PTGA 2GTNA 1VYWA 5HI2A 1Q62A 2ZB1A 5CXZA 1OI9A 3COIA 2OJGA 3I6UA 4KIKB 3KN6A 2ZOQA 2A2AA 3VW8A 4Z55A 4OAVB 3R1NA 5B2KA 2UW0A 4B8LA 4PDYA 3A61A 3ORXA 2CCHA 4FKUA 1HCKA 2H34A 2ZM1A 3QFVA 3RP9A 2QG7A 1QPDA 3BHHA 4U42A 3KQ7A 4J71A 5IKWA 2I0VA 5CEKA 3PYYA 3DKFA 4RJ3A 4XP0A 3KKVA 5DG5A 4FBXA 3I0OA 3KRXA 4BTMA 4XOYA 1XWSA 3KC3A 3UC4A 4KBAA 5C8KA 4UX9A 4FE2A 5IMEA 3G5DA 3EFLA 5CSHA 4EEVA 1NVRA 1ZOHA 4TYJA 3POOA 3DAEA 4JG7A 2IVUA 4EK5A 4X0MA 1W2CA 2XRUA 4RX5A 4GT4A 4LGGA 4G3GA 3VHKA 4R7IA 2PE2A 3CTHA 3R71A 3FZRA 2YZLA 5HVJA 1Z57A 3RBWA 3U4UA 4P90A 2XEYA 4PMTA 3ORLA 3GQIA 4FV7A 1H1QA 3VUIA 2JIUA 4HVDA 2CSNA 2DUVA 3G6GA 3SQQA 2PL0A 5H3QA 2ZMDA 5IEXA 2R3JA 2VO6A 2ZAZA 3D94A 4I24A 5EI8A 4ANQA 1Y57A 3BIZA 4MQ1A 3QQFA 3HAVA 2AYPA 5EOLA 5DOSA 5E7RA 5LWNA 2YN8A 1OL5A 1J3HA 4NM3A 3I7CA 4I5PA 3ERKA 4FT0A 3O5AA 4FIHA 3W8QA 4DFLA 4LGDA 3PIXA 3OS3A 2BRGA 3NIEA 4QQCA 2OXYA 1UU8A 4G31A 4D5KA 4LV5A 4CZTA 3TV4A 5JZJA 3P9JA 4O0UA 2R0UA 1UWJA 2BRMA 3F2RA 4M7IA 4RLLA 3SG9A 1BL7A 4H3PA 3EOCA 3BYOA 3FKLA 2CGUA 1OKVA 2V5QA 4J99A 3ZXZA 1SZMA 5C4KA 1NA7A 4BDJA 2YM7A 3ORMA 4AA4A 2WQNA 4YHTA 1PXLA 4ZY6A 4YURA 3MY5A 2R3IA 3UDZA 2OZAA 3V5JA 4E5AX 2QCSA 2OXXA 4ZTHA 4ZXTA 2PU8A 2I40A 4JRVA 4FTJA 5IQBA 5HE0A 4AGCA 3IECA 5IQFA 2XIZA 4JAJA 3WZJA 4Y8DA 5AV0A 1VYZA 2W1EA 3ROCA 3ZTXA 3OY1A 3EN9A 3O17A 2XCHA 3DV3A 2BKKA 1J1CA 3OBGA 1B38A 4FMQA 3QRJA 4NCTC 1J1BA 3DAKA 3OWKA 4ZK5A 5T68A 2GTMA 4QT1A 2OO8X 4IM3A 4TWPA 4YC8A 1JQHA 3P7BA 3RZFA 3B2WA 4HGLA 5D10A 1GAGA 1ZLTA 1KV1A 2ZV2A 2J0KA 3I79A 3V04A 4YPDA 3PLSA 3QKMA 4UALA 1KUTA 2J0MB 2P2IA 4R5SA 3FHIA 4C38A 3EZVA 4QTDA 1MRVA 4RWKA 4Y73A 4AZEA 2R3FA 2UZLA 2XKDA 4HZSA 2GQSA 2VO3A 1JKSA 1SM2A 3SC1A 4NW6A 4CKIA 2W4OA 4HJOA 2LGCA 2OLCA 4QP6A 3UO4A 3P86A 5HIBA 3ZO2A 5L4QA 3TV7A 5CWZA 4C58A 2Z7QA 5GZAA 4O96A 4FEXA 1RJBA 3BV2A 4GKHA 3NFGB 4AXDA 4FKQA 4FZ6A 4QP3A 1YHSA 3FV8A 1KV2A 4LG4A 3LJ0A 3PIYA 1LEZA 1W7HA 4AN9A 4HOKA 4U0IA 2WOUA 4BCJA 3SXSA 3PPZA 3SA0A 5DPVA 3FKOA 4RJ4A 2C1BA 4O6LA 5K0XA 4LMNA 2BRNA 4RBLA 4O0TA 5EI6A 4A07A 3PA4A 4FR4A 4XMOA 5CNOA 2XK7A 4FKPA 2HZNA 2Z7RA 4QPAA 3BBTB 4IE9A 4FV6A 2UVXA 4DN5A 4APPA 1WVYA 5CEOA 5AP4A 4FTOA 4GT5A 2W99B 5C27A 1OGYA 3LM5A 3QGWA 1FPUA 3E8CA 3HZTA 3RHXA 4JQEA 3FXWA 3EKNA 3NUYA 3MPTA 4K8AA 3ORZA 5DT0A 3BGPA 1VJYA 1E9HA 2VWVA 4AW2A 5A54A 5JRSA 2XJ0A 1E1VA 3BGZA 3CPBA 3UVPA 4YU2A 4WNKA 5BMMA 5BYLA 4PV0A 2H8HA 3G9LX 3VNTA 5EKNA 4EOQA 2BTSA 2W1IA 3NDMA 4G3DA 4PWNA 2CNVA 5ETIA 3BL7A 5BVKA 1JKKA 5CVFA 4ORKA 5IZFA 3NPCA 3W0RA 2WMVA 2BMCA 3G33A 4P4CA 5KHXA 3D7ZA 4ZSJA 2VAGA 4BHZA 1R1WA 2QG5A 4ACHA 1XH8A 4DGOA 2YERA 4AA5A 4O21A 5FDXA 4FTMA 3PSCA 2ITPA 5CEIA 4LV7A 3CJGA 3QXPA 5DT3A 4K1BA 1ZMWA 4R6VA 1W82A 4CVAA 1ZY4A 3TV6A 3WILA 2VTNA 2E2BA 3H9OA 4A9UA 5IA5A 3S1HA 2IW9A 1VLRA 2Z60A 3ETAA 3I1AA 5EFQA 4ACCA 3F3UA 5J7HA 1E1XA 1JSTA 3GFEA 2F7EE 2FSOX 3FYKX 3MTLA 2XK8A 5FM2A 4ZY4A 2EB2A 4EOKA 1PW2A 3DKOA 4CV8A 4ALWA 4J52A 2Y4IB 5CT0A 1BLXA 3AD5A 3F7ZA 4WBBB 4CTBA 2OIDA 2VNWA 3UDBA 3V5LA 4RJ6A 3ID6C 4JQ8A 5JK3A 3ZRMA 5IPJA 4OBQA 5DLSA 3UDSA 3BBWA 3HA6A 5CVGA 4IB0A 3R2BA 4JDKA 3MTFA 4BBMA 5KMJA 2BROA 2VZ6A 4MHAA 2BR1A 1R39A 2W9FB 4BDFA 3PWDA 4HZRA 4G9RA 3V01A 4QYGA 3EZRA 3ZUTA 5B2MA 1H1WA 3TG1A 4O7YA 4J7BA 3GU8A 4QMZA 2H6DA 3PXRA 4CKJA 5B2LA 1H26A 1RDQE 1YKRA 3LXLA 3LQ8A 4O22A 1ZAOA 3Q2MA 4O6EA 2C0IA 3GNIB 4TTHB 3RINA 1PHKA 5A6OA 1B39A 4DINA 4WHZA 4ZTLA 3AQVA 3G0FA 3VO3A 3P7CA 4YJTA 5AR4A 2JEDA 1HCLA 4FICA 4FJVA 1YDRE 3TUCA 3L8VA 5ETFA 3F9NA 3RPRA 3JVRA 2BAQA 4B9DA 2A4LA 3R8LA 4F9WA 2UW4A 3OXIA 5AUZA 1GY3A 1WZYA 4LRMA 3SDJA 3DXPA 4CZYB 4TW9A 2CKOA 3GCQA 5HTBA 2A27A 3FZSA 4ZTMA 3GC9A 4ZLYA 3A7HA 3O23A 2PVFA 4XP2A 4GIHA 5E4HA 5M57A 3EQBA 3HP2A 5HCXA 2CN5A 2X9FA 4DHZA 3QRKA 5CSVA 4AZVA 4RIWA 3W2QA 5IH4A 3R9HA 1CDKA 1UU7A 3C4XA 2CCIA 3HP5A 4BI0A 1XBAA 3WIGA 5M08A 4PRJA 2R64A 2XAOA 2A0CX 1U54A 2VTAA 2YM4A 5EH0A 3FXZA 4RIYA 3TIZA 3LFEA 2B0QA 3W2SA 4EKLA 4Y46A 2B9IA 3L9PA 4NSTA 3RPVA 5CF4A 4AE6A 3GVUA 4EBVA 3ODYX 3L8XA 4AQKA 2WAJA 5J1VA 2YM5A 3KU2A 3EYGA 4O7SA 4MBIA 4USFA 3UP7A 4R7HA 3A7IA 3I81A 5E8XA 3VUGA 4XHKB 5M56A 4AGWA 4A9RA 5AUUA 5CANA 3EKKA 2QOKA 3QTQA 5DFPA 4ACMA 1MQ4A 4NK9A 1YQJA 4FK3A 4XLIA 2CMWA 3HUCA 3LOKA 4F63A 2OBJA 3Q53A 4ERKA 4MVFA 3OCSA 2PUUA 2YLFA 4Y72A 4BZOA 3N4UA 1CTPE 5M07A 3ZMMA 3C0GA 1PXKA 4FL2A 5HTCA 2GHLA 3VJNA 3E7OA 3QRIA 5A14A 3RNIA 5J1WA 3BCEA 3AMBA 3E63A 4AFJA 3BE9A 4CFWA 1G8AA 1DM2A 3MPAA 4JBPA 5F1ZA 4C36A 1R0EA 5CAPA 3RPYA 2BHHA 4OTQA 2I0EA 4X21A 4CSVA 3IO7A 2AC5A 4D2WA 4QMTA 3COMA 4QEBA 4ZSAA 4BWXA 5HO6A 2RG6A 4M84A 2GNFA 5JGAA 3UG2A 5M09A 3AG9A 4BR3A 4QO9A 1H1PA 5EQYA 5FEEA 3R7EA 4E3CA 2QQ7A 4EKKA 3DZQA 2WGJA 2HWOA 4RRVA 3Q3BA 3NZ0A 2RIOA 3DK3A 4RT7A 4HYIA 5DGZA 3TKUA 5KMOA 4XH6A 5I9WA 1ZY5A 4O0SA 5DN3A 1YWRA 5DRBA 4K6ZA 5M55A 3GEQA 1SVGA 4OW8A 3WYXA 2X4ZA 3R9NA 3PXFA 4HNFA 3MJ2A 3O7LB 4EK8A 2W1FA 2P4IA 4DTKA 4FIJA 5EOBA 4D1SA 3NUPA 5KBQA 4BIEA