4AGDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sunitinib (su11248) (n-2-diethylaminoethyl)-5-((z)-(5- fluoro-2-oxo-1h-indol-3-ylidene)methyl)-2,4-dimethyl-1h-pyrrole-3- carboxamide)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
317
structure length
303
Chain Sequence
LSIVMDPDELPLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 303
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4agdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4agdA01
2IZSA 4QP6A 3EQPA 4JG6A 4UZHA 4BWKA 2XIXA 4RJ8A 3F3TA 2YHVA 3MH3A 3P0MA 3IDPA 3FI2A 3Q32A 4RC3A 2QNJA 4RX5A 4QMYA 1LPUA 2Z7RA 3OC1A 4I5CA 2R4BA 1H08A 3ZSIA 4GJ2A 4XG7A 3L8PA 4IADA 2OLCA 3R8ZA 1YW2A 4MKCA 2WQOA 4ACDA 1LEZA 5CQWA 5DT0A 5AAGA 4MBIA 5B2LA 2Z60A 4BDIA 4PMPA 2QO7A 2XEZA 2C6IA 4MXAA 3WOWA 3ZLYA 2ZYBA 3LXNA 4FYOA 4LL5A 4C3RA 3BIZA 3C13A 4FVQA 4JG8A 2OH0E 4AGCA 4ONAA 2YAAA 4DG0E 4R3PA 2QKWB 4FYNA 4HW7A 4EC9A 2WMRA 4EBVA 4F6SA 3ZMMA 4BVUA 1H27A 1STCE 2NRYA 3PVGA 1TQMA 4EOLA 1Q8WA 4I6QA 4IW0A 1FPUA 5IDPA 1J3HA 4IHPA 4BKJA 3E3BX 4KRCA 4C4FA 4QT1A 3UIBA 5E8SA 2VZ6A 2C6LA 3BYUA 1ZOHA 4ZZNA 2CHLA 2QOBA 1PMNA 1BI7A 2ITXA 3DLSA 4RIXB 4I92A 4WNOA 5EDQA 3I7CA 3CJFA 5L6WL 5AP0A 4AGWA 4E5AX 5A54A 4RGJA 5ITAA 4O7LA 4AWIA 3BWFA 5FP6A 5ANGA 4BZNA 4CZUA 4D55A 3QAME 4E20A 5ACBC 5IA1A 1OMWA 2WELA 3EL7A 1MP8A 4MF1A 5L2SA 4RT7A 4BBMA 4NCTC 5HU9A 3FZSA 5CLPA 2EB3A 4EHVA 1OKYA 4A07A 4IB5A 3NIZA 4OTDA 3QTRA 2HW6A 5D10A 4UV0A 5LVPA 4FEXA 3IGOA 4CLIA 2ONLC 4BCHA 4DH3A 2PWLA 3MN3A 3IO7A 2UZOA 3MA3A 4K11A 4UZDA 1RE8A 3HECA 3KCKA 1NY3A 5FD2A 3ZC5A 5AP4A 2UW9A 4RIYB 1PXNA 3LMIA 4EWQA 5F4NA 4P90A 3MTFA 2GHLA 4D1XA 4RBLA 4EH9A 4UWBA 3ZSGA 4O7YA 2PMNX 3G0EA 3RMFA 3UG1A 3UOJA 4XMOA 4FKRA 4DGNA 3FPQA 2A27A 4IB1A 4FSQA 1UNLA 3O8UA 4QP9A 4G9CA 4RVLA 5CQUA 2GNIA 3PIZA 4L7FA 3VS1A 3GCPA 3KMUA 4BBEA 3ZRKA 3A2CA 2XUUA 4ASXA 2BROA 5AADA 5EYKA 5KE0A 3SOCA 4F9WA 3IOKA 3D7TA 4YLKA 3GQIA 2V22A 4XG9A 4FV7A 3GOKA 3UQFA 1U5QA 2XK6A 3TNPC 4EK3A 4JI9A 5AP1A 1M2RA 2CGUA 2CNVA 3UIXA 3WZUA 4O7ZA 3EFKA 4N0SA 3ULIA 5GJFA 4C3FA 4O2PA 4UBAA 3OT3A 5M53A 2WOTA 4YZCA 2R3RA 2BKZA 1J7IA 3OG7A 3ZFYA 3BX5A 4FV9A 3KEXA 4FKOA 5FUTA 3AOXA 4KBCA 3QQGA 3F3WA 5HG8A 3K3IA 5EKNA 2X4ZA 4G6OA 3CTJA 3KY2A 3FQHA 4NM0A 4PMMA 3F9NA 4WG4A 4BDFA 4GRBA 4E8AA 3MPTA 3EN9A 4IX3A 3C4FA 4EWHA 3OT8A 2W4JA 3GEQA 5BVOA 2BRNA 2GS2A 3VVHA 5J7HA 2QI8A 2A0CX 2PVMA 3QGYA 3ZXTA 5CNNA 5JKGA 4PNKA 1PXLA 4QMPA 2VTLA 3KQ7A 4HPUE 4F63A 5IQAA 3W1FA 5BMMA 4APPA 5DYJA 4IAYA 4DFUA 5IEYA 5BPYA 4NIFA 1RQQA 4F7SA 5EQPA 1KV1A 3I6UA 2GQGA 4CKRA 2XEYA 3HKOA 2XM8A 2WQBA 3ZFMA 1FOTA 3MTLA 5IQIA 1DM2A 1Y8GA 3ZLXA 4H05A 4WKQA 2PK9A 2VTJA 3UOHA 2XNNA 5FP5A 4I21A 5JGAA 4D1SA 2OJIA 3VS3A 4CV9A 1NVQA 2QLUA 3KXXA 3EYHA 4QQ5A 3TKUA 5CENA 3DB6A 1KSWA 1M7NA 4BTJA 3NW6A 1H1SA 4KIQA 4RX8A 4RFYA 4EH4A 2PUPA 2WHBA 4EOMA 2REIA 2PSQA 4FOBA 2WB8A 3T8OA 4ERWA 5KMMA 2J5FA 4ZTRA 2X2KA 4FVPA 4ANNA 5CU3A 4CD0A 5AWMA 4M69A 4EKLA 3RAWA 3PIXA 5AR8A 1KWPA 3KXZA 3LPBA 4CKIA 1VYZA 3KU2A 2V55A 3V5LA 4FGRA 4ZZMA 3IPHA 4CMTA 5L3AA 3T3UA 4K6ZA 4I0SA 4TN6A 3FQSA 4I5MA 3O51A 3TXOA 3UO6A 3EL8A 2CGWA 3GQLA 1CKPA 3D94A 4NW6A 3D2IA 3DQWA 4RJ4A 3NUYA 1CM8A 5C9CA 3VBTA 3NMUF 5E8VA 4XX9A 2VO7A 2P0CA 3PP0A 4NKSA 2XM9A 4O96A 4FZFB 3NNXA 2OBJA 4Y95A 3ORXA 5H8EA 4BDKA 2R3GA 5C8NA 2X9EA 3C5UA 4QMWA 4AA4A 3LQ8A 4JVGA 1K2PA 5HEZA 2J0MB 3JY0A 3COMA 4JBVA 2YM5A 4TWCA 4QMSA 1OPLA 5JH6A 4D9TA 5HE2A 3VS5A 4J52A 3PXYA 4TRLA 3EMGA 5CALA 3BQCA 3F3ZA 4GUBA 5KBRA 3BGQA 3G9LX 3DJ7A 3QHRA 1GY3A 2WAJA 3P78A 4P2KA 3VBQA 4TL0A 3R71A 5GHVA 4CRLA 3HDNA 1S9IA 4R5SA 2IG7A 4F4PA 4AP7A 5L2WA 4B8MA 5CX9A 4ANQA 2GS6A 4AZFA 3F3VA 3LFEA 1ZZLA 4OW8A 1FINA 3L8XA 4GVAA 4S30A 1PXKA 3OY1A 2J51A 3NPCA 5M55A 3EH9A 4CEGA 2B54A 2R3LA 3ERKA 2HZIA 4YJTA 2JIVA 2RIOA 2CKQA 3HV5A 3KA0A 4ZY4A 1OKZA 4LMNA 2CN5A 2XCKA 4U6RA 1J7UA 1ZZ2A 4XH6A 1H25A 4FTCA 1CKIA 5AUVA 2C1BA 3MI9A 4JDJA 4BHZA 2XA4A 3U6HA 3P5KA 3SRVA 3F2RA 3OEZA 2XZSA 4KWPA 2P4IA 2FGIA 4C02A 3Q5ZA 2X81A 4J7BA 5EM5A 2BKKA 3JY9A 2IPXA 3B2TA 1XH4A 4JXFA 3RZFA 4NU1A 3CQEA 4F6WA 5HORA 3F7ZA 3FZOA 4J8NA 4QYGA 1BL7A 4WA9A 5T6KA 5AX3A 4WD5A 4ALVA 3D5VA 2J6MA 3UZTA 4MCVA 4RRVA 2BTSA 4QQJA 3UVRA 3HYHA 4TYJA 3KVWA 3V04A 4MNEB 4O0UA 2FB8A 3QCXA 5FXRA 4BFMA 5ANIA 3LM5A 2HWPA 3P08A 3CY3A 4K1BA 4MBJA 4KS8A 4DTKA 3A8WA 2XBJA 4KAOA 2W0JA 1OIYA 3ORLA 4GW8A 4FC0A 2XYNA 4KKHA 4BI2A 2OF2A 5LVNA 3A99A 3QUPA 2VO6A 4Q9SA 5LXMA 2RG5A 1TQIA 2ZB1A 3MH2A 4MVFA 1RJBA 1URWA 2QLQA 5E8XA 3VN9A 3LZBA 3WIKA 4NT4A 3BHVA 1JSVA 3QUDA 4RPVA 4A9RA 4DE4A 1KE9A 3Q2MA 5AR4A 2XK9A 4DEHA 4KUJA 1S9JA 2HK5A 4LGGA 3COHA 4RA5A 4S34A 5A4CA 4MH7A 3ENMA 3TDWA 4BTKA 2P2HA 4LOPA 5IUHA 3L1SA 3QLFA 4J53A 1REJA 1Q99A 4K9YA 4YHFA 5KZIA 5FTQA 4EZ7A 1J91A 4I93A 5BYLA 5HIEA 4ZS4A 5HNGA 5L2QA 5ETIA 4BCJA 2P2IA 3CBLA 4A7CA 3WI6A 1ZXEA 2QOIA 3U6IA 5LWNA 3CPCA 4MWIA 2B0QA 3AD4A 3SDJA 4B99A 2R3HA 4JDKA 4CFNA 2ZJWA 3ITZA 4GV1A 4LV8A 4XRLA 2HW7A 1BUHA 2WKMA 3FPMA 3ORKA 4IXPA 4RIOA 4J98A 4YJRA 3OBGA 4KINA 1IAHA 1PXJA 4WUNA 4L44A 3TN8A 4U41A 2E9PA 3LCKA 5FBOA 3LFNA 4AZSA 3QUEA 4FNYA 2VX0A 5C03A 1ZMUA 3I4BA 4O22A 4I0RA 1UU7A 2WIPA 4GT4A 4I5HA 3BYOA 3MY5A 3VAPA 3BWJA 5K4IA 4AT5A 5JFXA 4G3CA 3MB7A 3A7JA 1Y8YA 3AD6A 2Y4PA 4E26A 5BYYA 2Y8OA 3DFAA 3QQFA 3FI3A 3BYSA 3HVCA 2JDSA 5J95A 3UZPA 2V5QA 4DLJA 5HBJA 3EJ1A 3R1YA 5AR5A 4C4JA 3RHKA 2IW9A 4ASDA 3U87A 4WNPA 4X6RA 4JBOA 2C6KA 4FSRA 3ZSHA 4YSJA 3FLZA 2JDTA 3MPAA 4AQCA 3D7ZA 4F64A 3OMVA 2GFCA 1X8BA 3C1XA 3PA3A 4L8MA 5IH5A 2ITZA 3OFMA 5DN3A 4DFXE 3BLRA 4F9CA 3S1HA 3LFSA 2R3KA 3LFCA 4DH1A 3FXWA 4G16A 3NUSA 4RJ5A 4V05A 2Y4IB 4D2WA 3GBZA 1W7HA 2X2LA 2YCSA 4PTCA 1NW1A 3A60A 5E8ZA 3Q4CA 4V0GB 5FEDA 3IGGA 3WIGA 4A9TA 4AN2A 3PFQA 3BU6A 3DBDA 4EK8A 2GQSA 4IMYA 4OR5A 3R04A 5CU2A 4MXYA 2XRWA 3HGKA 3QCSA 4JQ8A 4FZ7A 4NWMA 4ANOA 4UMPA 3D9VA 3BHTA 4L43A 4A9YA 1P4FA 2PUNA 4BDAA 2VTRA 4RIWA 3LW0A 2ZMDA 2DS1A 3DXNA 2EB2A 4ITIA 2W96B 4MX9A 1UVRA 2PZ5A 3F5XA 1B39A 5GIPE 5EI2A 3EHAA 2VX1A 2HCKA 4LOQA 3LJ1A 2W06A 5JZNA 2PMOX 1XH6A 4YJUA 1IAJA 2H34A 4JJRA 4JAJA 2VWBA 3D5XA 3DY7A 3L8SA 4X3JA 1V0BA 4E6DA 3W2SA 1H26A 2UW6A 2VWUA 4MXOA 5JFVA 2X0GA 4X2JA 3RNYA 3A8XA 2EUFB 1ZMVA 3W8QA 3M11A 4P5ZA 3DK7A 4FNXA 4GJ3A 4E4MA 3FL5A 3R2BA 4FKSA 4MBLA 3V6SA 4AX8A 3OUKA 3PYYA 1XH9A 4DGLC 5JN2A 4IAIA 2ERZE 1MQ4A 2ITQA 4C61A 3FMJA 5TR6A 4L3JA 4EZ3A 5CEIA 5C8KA 3VS2A 3D0EA 3DZQA 4DFYA 3NDMA 3ORIA 4YHTA 3PUPA 5ACKA 4A4XA 2R3NA 3DJ5A 4Y73A 5KNJA 3N51A 5DA3A 3PVBA 2YM7A 4YSMA 4D4YA 5IQDA 3O71A 5BVNA 2E9OA 3OCGA 3Q6UA 3LFAA 5DNRA 4LOOA 3UE4A 3KK8A 4ZS0A 4UXQA 5I9XA 1XBCA 3OWJA 2CPKE 1OL7A 3LXLA 4KBKA 3RBWA 2X8EA 4IVCA 4BCFA 3C5IA 4AW2A 5BVWA 4FSNA 4CFVA 3C4CA 3LFFA 4D4SA 4JX3A 3UO5A 4YZDA 1SNXA 3FZ1A 3LKMA 4R78A 3TT0A 3ORPA 2E9NA 4YJOA 3W8LA 2XKCA 4U9AA 3DAJA 4HCTA 4ALUA 2G2IA 4E4NA 2NNWB 2YIYA 4W9WA 5BVDA 4EOKA 3OF0A 4GH2A 1HOWA 1F5QA 2OJ9A 3MVLA 1PXOA 2C47A 3E5AA 1OBGA 3OW4A 3HAMA 2V0DA 5IPJA 5J9ZA 2GNJA 3F66A 4BF2A 3H0YA 3QHWA 3BHUA 4W4WA 4PF4A 3QFVA 1H1RA 1SVHA 4MNFA 3MS9A 4C58A 4Y46A 2XNGA 5CF4A 5CEKA 3VC4A 2OZOA 3BEGA 4XV2A 4ZMEA 4FEWA 5K4JA 1SVGA 4R1YA 2BZKB 4NJ3A 3EN6A 2G01A 4O0XA 4AZEA 3QA0A 3PA5A 2O5KA 3Q96A 4JQ7A 3Q2JA 3I5NA 2VTHA 4Z9LA 4ZSAA 2BIKB 4EH3A 2CMWA 1ZARA 2W1DA 2W5AA 1U54A 3KXGA 4QP8A 2YDIA 3CQUA 3GC9A 5AM6A 5HLNA 3GT8A 2JLDA 1ZYSA 3HNGA 4RX9A 3L9PA 3MDYA 4W4YA 4YTFA 4XV3A 3PWYA 2XF0A 1ZMWA 3E92A 4LGHA 3R8UA 4E93A 5A14A 5CZIA 1PYXA 3UVQA 4R8QA 3CR0A 5H8GA 3TUBA 3ELJA 1GAGA 1OIUA 4HGSA 4O1PA 4OAVB 1RW8A 4CTCA 3R9RA 5K9IA 4ZJVA 2PVLA 5CI7A 4BC6A 2XVDA 4XLIA 3HMIA 2DQ7X 2VU3A 4HNIA 4RLKA 5KMNA 1Q62A 2QONA 4CFMA 3QF9A 4DINA 2VRXA 4N4SA 4QMQA 3C51A 4DBNA 4G5JA 1XKKA 5E92A 3L9LA 4ZLZA 3KXNA 4DCEA 3CTQA 4XV9A 4GVJA 3JXWA 3PDTA 4L6QA 4YC6A 3VQUA 3GU7A 3R63A 3AD5A 4D5KA 2WMXA 4F9BA 5ANDA 2Z2WA 2GNHA 2OZAB 3CKXA 3BKBA 3HP5A 3M42A 4U5JA 5DR6A 1YI6A 1V0OA 4CCBA 2WGJA 5HVYA 4M0YA 3V5QA 4G17A 4TYHB 4O21A 4R3RA 5KZ0A 2XRUA 4PTEA 2OJGA 4H1MA 3TZMA 4NL0A 4U97A 3BBWA 3Q5IA 1YKRA 4D2RA 4TYGA 5J8IA 3GCVA 4OT6A 2QC6A 2X6DA 2XKEA 3FZPA 4QMTA 4U7ZA 4B9DA 4UWCA 5EKOA 2XK8A 3IQ7A 3VJOA 4FL3A 4P7EA 4IACA 5H3QA 3U8WA 5IQHA 4YTCA 2QHMA 3PSDA 4HCUA 2JBPA 4IAAA 2JIIA 5LVOA 4IVDA 5IZFA 5M09A 3F61A 3V8SA 3PP1A 4YUQA 3CGFA 3F3UA 1JSTA 4M12A 4DFZE 5GJDA 4AU8A 3RWPA 2B7AA 2X7GA 4XV1A 3LLAA 4QNYA 4TZRA 4F9YA 4LV5A 2R3QA 4E6AA 4O0WA 4RJ6A 4OTQA 4C2WA 1OM1A 1OZ1A 3F5UA 4RIXA 4BYIA 3M1SA 2JITA 2QOKA 3C9WA 4AACA 2O63A 3F5GA 2Q83A 3BV2A 5J9YA 3WZKA 2C0OA 3TJCA 1H24A 3DDQA 4O0VA 4NJDA 4C4HA 3HA6A 3FMDA 4UALA 1MRVA 3HUCA 4FT9A 4PP9A 2WXVA 2WQNA 4WRGA 2QOCA 2B9HA 4UYNA 5LMAA 2JFMA 2XH5A 2VNYA 5BVEA 5IMXA 3DAEA 3RTPA 2J0KA 2W9ZB 3ZXZA 2ZAZA 3H0ZA 2QOLA 1LEWA 3RK7A 1PRYA 5CAQA 1FVRA 3SX9A 2R3IA 4KIOA 5EW3A 2PE0A 4IIRA 3T3VA 2EXEA 5JMSA 3LFQA 5KMJA 2HELA 2CN8A 4F1MA 2FUMA 3ORZA 4FV8A 4PDPA 1GZKA 4RIYA 3W2RA 4ORKA 4FKQA 4U42A 1W84A 4P5QA 4ZTNA 4BTFA 2XP2A 3R6XA 4XEYA 3OP5A 4PTGA 3NR9A 4EORA 5H9BA 3R9NA 3SLSA 3LXKA 3ACKA 2X8DA 2W1HA 2RL5A 2IWIA 2OH4A 3H3CA 5IKWA 4E73A 4ZTMA 3U54A 5HCZA 4OBPA 2UW8A 3EB0A 3QWKA 4I94A 4TT7A 4EHZA 3CS9A 5HZNA 3MESA 4GYIA 5HG7A 3CLYA 2GMXA 3UOKA 3PXQA 4QTEA 3DNDA 2BAKA 2UZLA 2UZWE 2YISA 5EDPA 5I9WA 2F4JA 2B9JA 3ZEWA 1PKDA 5DT3A 4FV3A 3QD3A 5EFQA 3FL4A 4FKVA 3ROYA 3RJCA 1SZMA 1WBOA 4RFZA 3PTGA 2BRBA 1M7QA 4DGOA 2PVKA 2RG6A 4BGQA 5CY3A 2IVVA 4FTQA 2C6OA 4UY9A 4BIDA 5E91A 5E8YA 4IX6A 5DHJA 4X0MA 3QTXA 3R7YA 5LCJA 1OPKA 5GINE 4F08A 2I1MA 3Q9ZA 4W4VA 2E2BA 3RP9A 4M84A 2O8YA 2GSFA 3AMAA 3FLNC 5HOAA 5CEPA 4FTIA 5J1WA 1L3RE 3GU4A 2IVTA 4IBMA 3G90X 4B0GA 5GZ8A 4IB0A 2Y6MA 2PE2A 2NP8A 4ZJJA 3KXHA 4OTHA 3R28A 4RWJA 4ALWA 4OBQA 3PY0A 3CIKA 4W4XA 2UZEA 2VGOA 3G2FA 2GNLA 4IZ7A 3TNIA 4O6EA 2PUIA 3L9MA 5KMIA 2OSCA 3QCQA 5HQ0A 3FMHA 3Q4ZA 5I4NA 3CGOA 4N70A 2XYUA 4DCAA 5IA3A 5D12A 5BVFA 4R5YA 5EK7A 5EYCA 4TXCA 3E93A 3FZRA 5H2UA 3LQ3A 2WPAA 2WU7A 3R0TA 3RM6A 4ZSLA 2VWXA 1OUYA 4D0WA 3F2AA 2HY0A 2W9FB 2OI4X 2PVNA 4MXZA 3FI4A 3AT2A 1DAWA 4QD6A 4YBJA 4DT9A 4ZSJA 4WOVA 4USDA 1YXSA 4IWOA 3ORMA 2QU5A 5CT7A 3HP2A 3PVWA 3DXPA 2CLQA 4NM7A 5LJJA 3IDBA 4X2KA 3FSFA 4ASEA 4GG5A 2I40A 2JKMA 4ITJA 4QYYA 3HAVA 2GCDA 3KMWA 3QXPA 1BLXA 3BPRA 3VO3A 4AN9A 3BE2A 4FTRA 1J1CA 4QYFA 1IRKA 3KL8A 3BYVA 4E5BA 2YM8A 3NX8A 3KREA 3R73A 4IJ9A 1WFCA 2W1EA 5IG1A 2ZB0A 3NUXA 2C30A 4L3PA 2GFSA 2JAMA 3QWJA 3VUDA 1CMKE 4FG8A 5EW9A 3Q60A 2QKRA 3WZDA 2JD5A 5LMBA 3QCYA 2CCIA 2YJSA 5EM6A 2VTNA 2UW3A 4XYFA 2WZJA 3I6WA 5IEVA 3CD8A 2ITYA 2ITPA 3K54A 5JFSA 2C5YA 2CGVA 2ITUA 4HNFA 2C1AA 5M56A 4O6LA 1U5RA 3D5UA 4DHFA 5HI2A 1WBTA 5AFVA 4AN3A 2GHMA 3KFAA 4EJNA 4PPCA 3BHYA 4QO9A 4X3FC 3TV6A 3PZEA 4B8LA 4XOZA 1JKSA 5CSHA 4ZOGA 2YDKA 1PJKA 3R1NA 2ESMA 3A7GA 5CT0A 3QGWA 4ANSA 4F7NA 4O7NA 3PLSA 2Y6OA 3G0FA 3TTIA 1VEBA 3I60A 5KX8A 1SNUA 4FGBA 4FKIA 2YEXA 4LYNA 5AP3A 5HNIX 2I7QA 2HY81 4NTSA 3VWAA 3PY3A 3W18A 3P23A 4FNWA 5JFWA 3FY2A 3RGFA 5HIBA 3MB6A 3FLQA 3V5TA 2QU6A 5C01A 4YC8A 2YLFA 3GOPA 4YNEA 2C5NA 4MQ1A 3N4VA 3BV3A 3AC2A 2OJJA 4EH7A 3VS0A 2VO0A 4D2TA 4AAAA 1PMEA 3FI8A 2ZV2A 2G1TA 3ORTA 4DFNA 3IS5A 3MGYA 2PYWA 4G34A 2PZPA 4DG2E 5AP5A 2BHHA 1VJYA 3TIYA 4FEVA 3NVKI 1W0XC 3RCJA 2IZUA 3ZO3A 4M0ZA 3WF9A 3QXOA 2CSNA 4RG0A 4BCIA 2BMCA 4YZNA 4C62A 2ZOQA 2HXLA 4O1OA 3BE9A 4OUCA 4EH6A 4EJ7A 4XJ0A 4KIKB 3OEFX 4EC8A 5IA4A 4ZZOA 4IAFA 2UVZA 3H9FA 2PVYA 3FMLA 5EI6A 4IANA 4CV8A 3FEGA 5BYZA 2J0IA 3P4KA 4IVBA 5IDNA 4ZXTA 4FICA 4Z7HA 1CSNA 3ATSA 3GI3A 3MVJA 1V1KA 3E3PA 4MNEA 5AUYA 3OXZA 1UA2A 1OI9A 2AC3A 3EQFA 4FIEA 4MXCA 5B2MA 3TI1A 4B7TA 1GOLA 1NVSA 3IDCA 2OXXA 4FEUA 4BICA 4ZTQA 3HDMA 2X1NA 2C0IA 4QP1A 5DPVA 5HE1A 3NYOA 3UNJA 1WBWA 4JDIA 3KGAA 4K2RA 2PUUA 3C4XA 1OIQA 3EQGA 4IDTA 4K8AA 1Q8UA 5IU2A 2J7TA 5EOLA 3KRLA 1PY5A 3KVXA 1Q4LA 3PE1A 5JSMA 3LVPA 4FKUA 3SAYA 5M07A 4FTOA 3KRRA 4M8TA 5HNBA 4BI0A 1R1WA 5C27A 2HIWA 2C6EA 2LGCA 5JK3A 5CVHA 4WIHA 5L2IA 5CU6A 3E63A 2XKFA 4YBKA 4CQEA 2NRUA 2QD9A 2QHNA 4CT1A 3TUDA 2DWBA 2WO6A 3EZVA 5CNOA 2XIYA 4YJVA 2QO2A 4LRJA 5EG3A 4IM3A 3NZ0A 5HD4A 4O91A 3DBFA 3L9NA 2VD5A 3PSCA 5L8KA 2B9FA 3FMKA 3LJ2A 3MFTA 3IW7A 3CE3A 4DFLA 4PNIA 4QMXA 4HVIA 5DVRA 3ID6C 4NUSA 3NGAA 4H3QA 4ANBA 2WOUA 2JKOA 3KKVA 1WVWA 4QRCA 3U51A 3QD0A 5FLFA 2JDRA 3QA8A 4NFNA 1DI9A 2XKDA 4M66A 3R9DA 4I4EA 3U9NA 4UN0C 3I0OA 4DGMA 2ACXA 3KF7A 4RZVA 2WTDA 1K9AA 3ZHPC 3F5PA 4R6VA 1UKHA 5J79A 2C5VA 2UVXA 4RJ7A 2J0LA 4Q5HA 3AT3A 2W05A 2WEVA 3DKOA 2R0UA 1F3MC 4H39A 3MIAA 4G6LA 5J9LA 5I3OA 2JIUA 3FQEA 1QPEA 3LAUA 3CD3A 4FT7A 4FTNA 5HICA 3OOGA 5D41A 5TE0A 2VTIA 2ITWA 3P9JA 4BCGA 2E9UA 1T46A 3TKIA 4AZTA 2UZNA 2GS7A 2B53A 3H30A 3DKCA 3WE4A 4ZTHA 3TCPA 4XRJA 2A2AA 5CVFA 5DFPA 5DG5A 4R77A 2OKRA 4YGAA 3EN5A 1IA9A 4HYUA 4F7LA 4X21A 4BDGA 3OXIA 4C7TA 3I81A 3R2YA 4YU2A 5F9EA 3HLLA 2EXMA 3PY1A 3HV7A 4MD8E 4C4EA 2RSVA 2C3LA 5FTOA 1TKIA 3MSSA 4V0GA 3ZRMA 4QQTA 5ANOA 5KKRB 3QRIA 4USFA 4F0GA 2OO8X 4L46A 5DIAA 4DAWA 4RWIA 1QL6A 5EI8A 2BCJA 4FZ6A 2RFSA 4TKSA 4U3YA 5HO6A 2YWPA 3PJ1A 3AXWA 3E62A 4DEDA 3QC9A 2BILB 2G2FA 3E8NA 2UZBA 4F1OA 5CSVA 4TWPA 1MQBA 4X2GA 4DF3A 4CFFA 3UQCA 4YO6A 1YI3A 4Z7GA 4FTJA 5DRDA 2X7FA 3LJ0A 2HZ0A 1ZOEA 3DPKA 4S2ZA 4CYIA 1DS5A 3DDPA 4C35A 3FXXA 5AP6A 5FQDC 4FBXA 2H9VA 2YM6A 4BCMA 1L8TA 3DU8A 5LCKA 2WMUA 3PSBA 4AUAA 4BDHA 5ANJA 2B55A 3MH1A 4BL1A 1HCLA 5HX6A 2BVAA 2IJMA 3ZO4A 4MQ2A 4FV5A 3F7WA 4ZEGA 4BBFA 4G3EA 1YI4A 4KD1A 3GB2A 1A06A 4XG6A 4J97A 1PXIA 3B8RA 3R8PA 3GC7A 3N9XA 1WBPA 4BDCA 4BRXA 4DGGA 3HV4A 1YXTA 2PVHA 4AT3A 1G3NA 3PXKA 3W32A 1JAMA 1YHSA 2HYYA 2P55A 4AGDA 4M14A 2JFLA 2BRGA 1AGWA 1JSUA 2HAKA 4RWLA 2O2UA 5AIRA 5B0XA 4OTPA 3RPVA 3POOA 2I0VA 4FIHA 4G3GA 4MF0A 5AMNA 5I9UA 3A7HA 2ZDUA 5M4FA 1UV5A 3GU5A 3OD6X 3P86A 3QZFA 5CAPA 3UJGA 4PQNA 4D2VA 4RMZA 1M17A 3OXTA 2C6MA 5D1JA 2C69A 2C5XA 4G3DA 4MTAA 4OT5A 4FT5A 3OVVA 2QR8A 5EYDA 2VGPA 4GSBA 3TKHA 3TL8A 1WMKA 4K0YA 5KMKA 4J96A 2VWIA 3FY0A 3ACJA 5T68A 4I3ZA 3UPXA 3NYVA 4IC7A 3FE3A 2ZV7A 4JT3A 3UG2A 4MD9E 3SOAA 4BCKA 1TVOA 2ZV8A 4YP8A 3ZDUA 4BHNA 3LFDA 3IKAA 4FV2A 5K3YA 2OFVA 3QBNA 4BGGA 1QPDA 4J71A 4J95A 4OTIA 4PUZA 5L2TA 4YPSA 3K2LA 4M13A 2CLXA 3NUUA 4AOJA 3VUGA 2BDWA 4IWPA 5I9VA 2JKQA 3KRWA 1JBPE 2H8HA 3K5VA 4FOCA 1R78A 2GTMA 1SMHA 2X2MA 3GU8A 5HVJA 3GUBA 4XG2A 3W2PA 3F2NA 3QTZA 3TNQB 3DFCB 2HWOA 3NRMA 1FQ1B 1JQHA 2X8IA 2YERA 3KB7A 1GNGA 3KCFA 2BAQA 3Q6WA 3BCEA 2BHEA 2XIKA 5D11A 1UNHA 1JWHA 3VUIA 4E5WA 5E1SA 4AA5A 4UXLA 3PG3A 1YOMA 2V62A 1Q24A 5IF1A 1MRUA 3BLQA 1FGKA 4O0RA 2QCSA 2H96A 3QX2A 1PKGA 3O17A 4PV0A 5A46A 4ZLYA 5IEXA 3O7LB 4AXAA 3UNZA 4BYJA 5IA0A 4AW0A 1PMUA 2C3KA 4FSYA 4QMVA 3A62A 5T3QA 5B2KA 4O0SA 5M06A 4JNWA 2ZVAA 1U59A 1JKKA 4FTTA 4GEOA 3DK6A 2YCRA 1JPAA 1WZYA 4WG5A 3D15A 4XP2A 3VF8A 3R22A 1OL5A 2RFDA 3R1SA 5FRIA 4UMQA 2X6EA 1SM2A 3KMMA 3JVRA 5BX0A 2CNQA 3V6RA 4BWPA 5ETAA 4HZSA 3RWQA 3A61A 5HE3A 4CNHA 1V0PA 4U44A 1ZYDA 1OPJA 1YQJA 4OTFA 2YM4A 3QD2B 3UMXA 3TZ7A 4A4LA 3EQDA 1SYKA 2YIQA 3MVMA 3PPJA 4QMLA 1XH7A 3QYWA 4TYIA 3VS6A 4FMQA 3ZYAA 4RVKA 4F7JA 2RGPA 4FT3A 5CZHA 4ZSGA 2OZAA 2VTOA 4GL9A 5J87A 3TACA 3W55A 4H58A 4RJ3A 3R9OA 4AW5A 2W17A 4TYHA 3B2WA 4AS0A 4KBAA 5J5TA 1YOJA 3OTUA 3BELA 4MAOA 3KULB 2JGZA 2YDJA 2YITA 4PMSA 2H6DA 4R1VA 5M4IA 3SW7A 4MD7E 1M14A 3KXMA 1F0QA 1ZWSA 4Y85A 3TUCA 4S32A 4C8BA 1KE5A 2R0IA 3GCUA 3PIYA 5IMEA 3HUBA 2EWAA 2VV9A 4ASZA 2PMIA 4ZK5A 3GU6A 4I22A 5KMOA 1XBBA 4EH8A 2C4GA 4C2VA 2VO3A 3GXLA 2CKPA 1H1PA 4GFGA 4KIPA 3D83A 3U6JA 3QLGA 3VRZA 3WARA 1OVEA 2JBOA 5AA9A 2XK3A 2YABA 1UWJA 4IM0A 4WNKA 3R7EA 3UP2A 3R30A 2RKUA 3CPBA 4XP3A 4FTMA 3E7VA 3LFBA 2WMWA 4O84A 4BB4A 3S00A 4AFJA 2IW6A 5AV3A 4O2ZA 1GIHA 2BDJA 2XNEA 3RAKA 4ZY5A 4FIFA 3RKBA 5JQ5A 2QO9A 2Y4IC 4YLLA 4RQVA 3UC3A 2BFXA 3FLYA 4NM3A 4Z55A 3W2QA 3LCTA 3VIDA 3RVGA 1FVTA 4CMOA 4XLVA 1IG1A 4GKHA 3RI1A 4RSSA 4QP4A 3QRUA 5L8LA 4I24A 2A1AB 3MYGA 4TPTA 4NCTA 2YA9A 3R02A 3C0HA 4AF3A 2VX3A 3NVMB 3FLSA 3ZM4A 3VUKA 3DBQA 3P7BA 1M52A 4MEDA 4EZ5A 4K18A 2B4SB 4HGTA 4NSTA 2VTPA 4EH5A 2B1PA 2JEDA 5AR3A 4EONA 2J0JA 3EQIA 3LE6A 3MY0A 4WG3A 3GP0A 4ZSEA 2OF4A 2VWVA 1OL1A 2J50A 2J5EA 3K3JA 2BFYA 4K33A 3ZDIA 1YVJA 3RAIA 3WYXA 4RQKA 4C3PA 4QPMA 4FSUA 4KNBA 5DE2A 3FXZA 3RHXA 2IZTA 1OBDA 2W5BA 3I79A 3S0OA 1XBAA 3PJCA 3ZRLA 3QALE 2I0EA 2OK1A 2JDVA 5FM3A 5DRBA 2V7OA 3QTIA 4FKPA 5HESA 4F70A 5J5SA 3UZRA 2ITNA 5K5XA 2FSOX 1FMKA 5CI6A 5AEPA 5M4UA 3NNVA 4ARKA 4FL2A 4YZBA 2CJMA 1YDRE 3C50A 4CLJA 4LUEA 5AIKA 4DH8A 2YN8A 3DBEA 2X7OA 1BX6A 2R7BA 2Y7JA 2BIYA 4FKLA 2QG5A 1VZOA 4O7WA 2ETMA 5CSWA 2EXCX 3NWWA 2IVUA 1XWSA 5CWZA 4F6UA 5HD7A 2WU6A 4KRDA 4EOQA 4YURA 3NSZA 5HG5A 4E4LA 5A9UA 4IEBA 1H8FA 3VS7A 4AOTA 1WVYA 3OCSA 4R3CA 3R83A 1XH8A 2JKKA 3LQ5A 4JRNA 5BUIA 4JL9A 3TM0A 5JGDA 1KE8A 5AUWA 2V7AA 4KA3A 3EKNA 4UEUA 5DT4A 2HZNA 5A4TA 3NW7A 3N4UA 4HOKA 3W16A 3FDNA 2XJ0A 4GUEA 3A4PA 4HGLA 1R39A 1QPCA 3UO4A 2VTTA 3HMMA 4IFCA 3DLZA 3PRFA 3DTWA 1UU8A 3OTVA 4PL3A 5IA5A 4ZIMA 5CEOA 2R64A 2C5OA 4JS8A 4FTUA 5HU3A 3T9IA 2VNWA 4L3LA 3NLBA 4QMUA 5C8MA 3NYXA 4CTBA 1T45A 3GFWA 1P2AA 4G3FA 4C4GA 2R3JA 3TZ8A 1QMZA 5CYIA 2ETKA 3DQXA 1KE6A 3ZBXA 1UNGA 4QTCA 2YCFA 1Y6BA 4YJQA 3FYKX 4DC2A 2OWBA 2XIRA 3AMBA 5D9HA 2WMQA 4PP7A 5AM7A 4EQCA 4IWQA 5K0KA 2C6TA 4Q9ZA 3R7VA 5C26A 3R00A 3EFLA 5GNKA 3G15A 5IQGA 2FYSA 2WTKC 3D5WA 3DKFA 3ZOSA 3DS6A 2CGXA 5LWMA 5IQEA 2WMAA 4XCUA 2VAGA 5AV2A 5FGKA 3WF6A 4D5HA 2YIWA 2Q0BA 3FYJX 4YJPA 3DKGA 3UMWA 2G2HA 4EOPA 5DMZA 1G8AA 4GK3A 4PX6A 5E8UA 3FHIA 4FIJA 4QQCA 2R9SA 3D14A 3FJQE 5ANEA 4P4CA 2GU8A 4WUAA 2GNGA 4PL5A 5CXZA 3QZIA 4RX7A 4CXAA 1JLUE 5KCVA 5AX9A 3OOMA 4ID7A 4DTBA 5G6VA 2RF9A 1YWRA 4F99A 2IZRA 5HTIA 1Q8ZA 2UZDA 3MWUA 4FL1A 4I6HA 1M2PA 3ZZWA 4C37A 3QZHA 5HIDA 2BAJA 4UB7A 3R8LA 1OKWA 3TG1A 3F6XA 5EH0A 2W1ZA 1JNKA 3UC4A 4EK6A 3Q3BA 4HYHA 2IN6A 4TYEA 3ANQA 4QP3A 5BMSA 2IO6A 2YM3A 1NVRA 4ACHA 3R8VA 4BI1A 1H0VA 4PDOA 4BWXA 3VRYA 1ZRZA 2QQ7A 3PPKA 5HGIA 4CFUA 5JQ8A 4CG9A 2DYLA 4FVRA 4G1WA 4OTWA 4X3FB 3QQKA 5FTGA 4QP7A 4ENXA 1YXXA 5DEYA 5J7BA 4M3QA 5LVMA 4EK5A 4XUFA 2R3FA 3BEAA 4S31A 3ET7A 1OL6A 3RM7A 2PVJA 3V8TA 3U9CA 1JOWB 3KRXA 5CU0A 3IG7A 4H1JA 4DEBA 5AAEA 4BCNA 1Q5KA 2G15A 3ATTA 2F57A 4FG9A 3C0IA 5HO8A 1Q8YA 4FUXA 5HBEA 4FV0A 4Y5HA 4AFEA 1R0PA 5CEQA 4ACCA 3NEWA 1AQ1A 4EKKA 5M44A 3GNIB 5DEWA 4APCA 5FXQA 3HMNA 3UNKA 4I5PA 3ANRA 3LLTA 3NW5A 4NK9A 3E88A 3HZTA 1H28A 2UW7A 1YWVA 4E6CA 1IR3A 2F7ZE 2G9XA 3EQCA 4HYSA 3NCGA 3OY3A 4QTBA 4PL4A 2NO3A 5CF5A 3GCQA 4FX3A 2O64A 3QL8A 3MV5A 4D9UA 4IZ5A 3DCVA 4GCJA 3LIJA 3MFSA 3THBA 3WF5A 3CP9A 3LCDA 4J1RA 4R7IA 2W1GA 4KIKA 4Q2AA 2QOQA 5IH4A 2WTJA 3UPZA 2GTNA 4BGHA 3AMYA 3QQJA 5I9ZA 5J1VA 2O3PA 2YIRA 4E3CA 5I3RA 4YHJA 3ZM9A 4DLIA 2WTIA 5CS6A 1IASA 2VTSA 5DI1A 5CF8A 4I6FA 3R7GA 4N57A 4FKJA 4TW9A 2Z7QA 4QOXA 3GC0A 4G9RA 4GIIA 4RZWA 5BUEA 4IWDA 3P7AA 3V5PA 3AC8A 5DLSA 5LMKA 1UU9A 3UVPA 4AE6A 3H9OA 3BHHA 3MVHA 4Q5EA 2LAVA 4XG8A 2VTMA 4TWNA 4E6QA 4PY1A 4FSMA 4DT8A 2AUHA 2FSMX 3DNEA 1REKA 3TIZA 5A6OA 5M57A 1BYGA 5TO8A 1GZOA 1PHKA 3DBCA 3GGFA 3HV3A 1JKLA 3SHEA 1JVPP 3FUPA 4FKWA 3VQHA 4AW1A 3PLAE 4QMOA 4M7IA 3PJ3A 3TNWA 4QMMA 1FMOE 2AYPA 2B52A 4YZMA 2YACA 3G33A 1I09A 3CXWA 3ODYX 4FIGA 4MXXA 5AUXA 3ZC6A 3OZ6A 5L6OA 4GFMA 4EOJA 3BGPA 3CEKA 4C0TA 2Z7SA 3MIYA 2XMYA 3W2OA 4I4FA 4WBOA 4BDDA 3JVSA 3DA6A 1Q41A 3VUTA 1YHWA 3SVVA 4QNAA 4S33A 4FEQA 3TDVA 3LCSA 2R3MA 3UYSA 3HV6A 3EWHA 2OG8A 5CU4A 4L52A 4O7SA 2QOOA 2XIZA 4GS6A 5EDRA 1XJDA 3UODA 4GK2A 2J90A 1E1XA 3GENA 3HA8A 3WZEA 4CCUA 2P3GX 5CANA 4X2FA 4GFOA 4FUYA 2FH9A 1BMKA 5IA2A 1VYWA 3E7OA 1Z9XA 3SXSA 4RA4A 3C4WA 1R0EA 5AUUA 2OFUA 2PMLX 2RFNA 4IFGA 2WTWA 4M67A 4G6NA 2B9IA 3ODZX 3QD4A 4M97A 3NUNA 4YZ9A 4BN1A 1OB3A 3ZO1A 3QRTA 3R8MA 4NM5A 5F20A 4Y8DA 3PXFA 3REPA 4D1ZA 3TJDA 2I6LA 5IISA 2J4ZA 2X4FA 4YJNA 2QURA 4YJSA 5HTCA 4J8MA 3I5ZA 1Q3WA 3E8EA 5AV0A 3V51A 3VW8A 3ZZEA 5K0XA 3V3VA 5BNJA 2KULA 3EQBA 3G51A 4GKIA 4CRSA 3COIA 5JEBA 1G5SA 3O8PA 1YXVA 1U46A 3BRBA 2ZV9A 4DTAA 3AGLA 4KKEA 4ERKA 3U4UA 2JDOA 3LHJA 3RPYA 4TNDA 2BRHA 3GC8A 3O50A 3P7CA 4FKGA 1BI8A 3G9NA 4IE9A 1Q97A 1FBNA 5C4LA 4KS7A 1OECA 1XQZA 2C0TA 2XBAA 3Q9WA 2Q0NA 3ENHA 3QYZA 2YZAA 4FA2A 4GU6A 1UKIA 3IONA 4KB8A 4WO5A 5A6NA 1XR1A 5AA8A 3ROCA 2W4OA 4G2FA 4D0XA 4II5A 3EQRA 4NFMA 1Z5MA 3R9HA 4NEUA 1YDTE 4WRSA 3UTOA 5M51A 2XNMA 2ZMCA 3FSKA 3NNWA 4F0FA 3AT4A 2GPHA 2WMVA 2FSLX 2FVDA 3BQRA 3OHTA 4IX5A 4BCQA 2GQRA 2UZTA 5CVGA 3PXRA 3PZHA 2BZJA 3M2WA 4BIEA 2W4KA 3R1QA 4D4RA 4L01A 3H4JA 1UWHA 4H3PA 3FV8A 1Y6AA 3ZFXA 3RCDA 2W5HA 4JBPA 3QRJA 1E9HA 3LM0A 4UWYA 3ZU7A 5FDPA 5GZAA 1KUTA 3SGCA 2OIBA 1PF8A 4AE9A 4C59A 3VBXA 4LI5A 4EQMA 2HOGA 4CG8A 3FHRA 3LOKA 4MYGA 3DAKA 5FBNC 2CNUA 4FSTA 4OTGA 2GNFA 3ZBFA 3QC4A 4O0TA 4EEVA 4LUDA 3QZGA 3UBDA 1Z57A 2BUJA 3HX4A 1PXPA 1SVEA 3OWKA 1ZYLA 2F2CB 4PPBA 4PWNA 3OUNB 2Y0AA 2QVSE 1H01A 5AAFA 1YWNA 3P79A 3CCNA 3DTCA 5FEQA 5A3XA 3Q9XA 2IVSA 3FC1X 4EOOA 2YIXA 3UIUA 4JAIA 3D7TB 4O7VA 3ZH8A 5KUPA 3F69A 3I1AA 5DR2A 1BL6A 3D2KA 3FC2A 5F1ZA 2CKEA 2WTCA 4XHKB 3SQQA 5AV4A 3O8TA 5ICPA 4RVMA 3SC1A 1YRPA 2XNOA 4EOIA 2Z02A 4W8EA 1W98A 3T9TA 4WNMA 5GIOE 4QMNA 3NAXA 3TV4A 2CKOA 2XK7A 3PPZA 3OW3A 3VF9A 3F82A 3FWQA 4ACGA 5A4EA 5I0BA 4HGEA 3OCTA 3FKOA 4DFBA 3SKCA 1J1BA 3ZLWA 1DI8A 3EFWA 3OCBA 4ENYA 3KN5A 1OGUA 1NXKA 3BI6A 4EUTA 1FVVA 4EQUA 3PVUA 3SXFA 3DJ6A 2P33A 2BDFA 4EHGA 5JGBA 4U0IA 5HLWA 2BR1A 2XJ2A 5F94A 1YXUA 3ZS5A 5AP7A 3V01A 5AJQA 3SD0A 1E1VA 2R3PA 2W1FA 3EZRA 4C4IA 3R7UA 3S4QA 4QYHA 4D2SA 3OROA 2O65A 3AC4A 4XOYA 4C33A 4U79A 4FK3A 3JR1A 3DB8A 2PY3A 3IW4A 2WQEA 4NIFB 4XP0A 4BDJA 3CTHA 4OAUC 4DN5A 5F95A 4ZMFA 3VNTA 1ZYJA 4QPAA 4OTRA 4AGUA 4EI4A 2F9GA 3II5A 1CTPE 3VBVA 2EU9A 3E8CA 5BUJA 3CY2A 4A9UA 4FSWA 3SA0A 2YWVA 5C1QB 3R7IA 2R7IA 3KF4A 3ZTXA 5E90A 5ETFA 4U8ZA 2C68A 4R7BA 5IUIA 3H9RA 4ZY6A 5KO1A 4CQGA 3LMGA 3WF7A 4L42A 3KN6A 3BZ3A 4F9AA 3PG1A 4AA0A 2OIDA 3EIDA 3NAYA 4HPTE 4L53A 5EQYA 4MK0A 2HXQA 1ZY4A 3A7IA 4EK4A 3W10A 3OBJA 4X2NA 3SV0A 3B8QA 5E4HA 5LMKC 4IDVA 4O7RA 2XS0A 4M69B 5A4QA 4CT2A 5IQFA 5KHXA 3EQHA 1NT2A 3IK3A 3VS4A 3Q9YA 5EOBA 5A4LA 3SXRA 5E8TA 5LQFA 5HHWA 1O9UA 2YJRA 3O7LD 3UIMA 1G8SA 5EHYA 4O81A 4LRKA 5HO7A 3CC6A 3ALNA 3NS9A 3VHEA 3WYYA 2SRCA 3ZUTA 4IZYA 3MH0A 5EM8A 3AC5A 2VWZA 2XNBA 4FI1A 4QPSA 4RC2A 3BYMA 2VTQA 5HCXA 1H0WA 5CSXA 3NUPA 3ZUUA 3AC3A 2CDZA 2UW0A 4IAZA 2BZHB 2UZVA 3RK9A 4I41A 1GIIA 4AOIA 4DBXA 4HJOA 5D7VA 2NPQA 4M15A 2HENA 3P1AA 4F65A 3O96A 1I44A 5AV1A 3MW1A 1MRYA 4BY9E 3FBVA 4PPAA 4DITA 3DK3A 3ZCLA 2UW5A 1Q61A 3C7QA 1M2QA 2QR7A 4BKZA 2WEIA 1XO2B 4J99A 1U4DA 3QTQA 3FMMA 4W9XA 5CASA 3VW6A 2OXDA 4LRMA 3NYNA 3QRKA 5KMLA 5HX8A 2OXYA 4FNZA 3G5DA 1IA8A 4MHAA 3O0GA 4GYGA 4B4LA 4YO4A 4HCVA 4O38A 4ZTSA 1KOAA 2F49A 4L00A 3KULA 3A7FA 4KSPA 5IQCA 3QTSA 5G1XA 2WQMA 3EKKA 4O27B 5GJGA 3PJ2A 2QODA 4BZDA 5EQEA 4O83A 4DEEA 2C3JA 3Q04A 3RALA 3UDBA 2DUVA 4BR3A 3JS2A 4B6LA 5H8BA 3EN4A 3VBWA 3H10A 4ITHA 3BGZA 2C3IB 2AC5A 3L8VA 3OWPA 3LMHA 5IH6A 4O82A 1PMVA 2I0YA 2PL0A 4V04A 4JRVA 5AR7A 1GZ8A 4JIAA 4QP2A 4RWKA 3V5JA 4U81A 3AQVA 5HE0A 4X6QC 2QG7A 5DBXA 2F7XE 3BU5A 3FZTA 3SRVB 2ZM4A 3WE8A 4RFMA 4IM2A 4C36A 5HKMA 4I1ZA 1LUFA 4HVHA 2UVYA 3V8WA 3TNHA 4YMJA 3ZO2A 3VJNA 4ANLA 3PE2A 3MJ1A 5D7AA 5JZJA 4JLCA 5HVKA 3C0GA 1P14A 4FKTA 2ZDTA 4L7SA 4Y72A 3A4OX 5FG8A 2FSTX 5CEMA 5KKRC 4JX7A 2WNTA 2W1IA 4W8DA 4DEAA 1IEPA 4IC8A 3AG9A 5DOSA 4CKJA 4BZOA 2PVRA 4YLJA 2R5TA 4NZWB 1A9UA 3KC3A 4FE2A 2X9FA 2WD1A 4UMTA 5HTBA 4AG8A 4FIIA 4FODA 5L8JA 3VUHA 4HVSA 4A06A 5CSPA 4ZLOA 1ZYCA 1QPJA 1H1WA 1WBSA 2PPQA 5M4CA 3ALOA 1AD5A 1XHAA 3QKLA 3BBTB 4IAKA 4WBBB 2XK4A 1W82A 3TTJA 3VHKA 4A4OA 2BZIB 2RFEA 4FG7A 4FK6A 4JBQA 3R01A 4LQMA 4O86A 2XJ1A 4BCPA 3OWLA 3Q4TA 3CJGA 3HRBA 3TV7A 2R2PA 4D4VA 5I5ZA 2HZ4A 2W1CA 4FTAA 4FV4A 3E8DA 4WHZA 2Z8CA 4KABA 4KSQA 4LMUA 4DH5A 2Y9QA 3COKA 4JDHA 4R7HA 4IB3A 4D58A 1A48A 5IQBA 4QMZA 2KTYA 3UOLA 2O0UA 4CVAA 4LL0A 2UUEA 2PTKA 3UQGA 5M08A 5JT2A 2A19B 1FGIA 2YZLA 5HCYA 5E8WA 5CAVA 4DG3E 5E9EA 4DH7A 2ITVA 3Q4UA 4JOAA 3U55A 1EH4A 2ZM1A 5FWKK 4MWHA 4NYEA 4EHEA 2WMBA 2JC6A 3I7BA 4FTLA 5E1EA 4AT4A 4E1ZA 1YOLA 3PA4A 5DR9A 4CMUA 4Z16A 5JRQA 4QTDA 3QU0A 3KK9A 3S95A 2A4LA 3S3IA 4FTKA 3PXZA 5EHOA 3V5WA 3N4TA 5L6PA 1APME 2ETRA 3Q53A 2XB7A 4V01A 3VULA 1ZY5A 3SW4A 4LGDA 4Z3VA 2FA2A 1HCKA 4GMYA 3RPSA 3I0QA 1K3AA 1MUOA 4GK4A 2W7XA 4U80A 4C34A 4WSQA 3WF8A 2BALA 2I0HA 1NA7A 3FLWA 4IZAA 3FKLA 5CTPA 3SG8A 1KE7A 1ZOGA 4JR3A 1O6YA 4YTHA 3UYTA 3MY1A 3SG9A 4FZDB 1P4OA 3KRJA 3TZ9A 4N6ZA 4FZAB 3EN7A 2YCQA 4X7QA 5ANKA 1URCA 4HVGA 3PWDA 4XNEA 4TTHB 1CDKA 3C4EA 3WZJA 4IX4A 4D2PA 3F88A 4RC4A 3GFEA 5I9YA 1UU3A 4FV1A 3VUMA 3ZUVA 4UMUA 1GJOA 2GDOA 4UX9A 4CFWA 4JR7A 1CKJA 4DEIA 4XS2A 1H4LA 3IW8A 2YLEA 3QX4A 2R3OA 1XH5A 3UP7A 4D28A 2C6DA 2J2IB 4JQEA 5GZ9A 4U3ZA 4BCOA 4N6YA 5LVLA 3U4WA 4CZTA 1W8CA 5JRSA 2WFYA 3QQUA 4L9IA 4EH2A 4I20A 4I6BA 4LG4A 4ZTLA 3DGKA 5EW8A 3LCOA 4XBUA 1PYEA 4EOSA 4FF8A 5HBHA 3LXPA 4I0TA 4WT6A 5DH3A 5K5NA 1LR4A 3HRFA 4Y83A 5AUTA 4PDSA 4GT5A 4E7WA 1OL2A 1OIRA 2YFXA 5CAOA 3QKMA 3WBLA 4KKGA 2PZRA 3MPMA 2ONLA 3NIEA 3R7OA 3E64A 3R21A 3TWJA 2OGVA 4DEGA 1H00A 4RIWB 2PZYA 4PRJA 3PRIA 3DZOA 4CSVA 2WTKB 2OIQA 1YHVA 5AR2A 3WILA 3JUHA 2WIHA 3AGMA 1DAYA 4XG4A 4CZYB 3MA6A 3O23A 5E7RA 4JG7A 3RZBA 3W2CA 2W99B 1QCFA 1RDQE 4L68A 1OKVA 1ZAOA 2VWYA 3OS3A 2BRMA 2F2UA 4JIKA 5LARA 3RPOA 5EM7A 4YTIA 4UMRA 1PW2A 4K77A 3G6GA 3MFRA 5TT7A 2BTRA 2WMSA 1O6LA 3FAAA 4H36A 4NH1A 4BKYA 5HG9A 1WVXA 5LOHA 5FM2A 4PMTA 3ZEPA 2VN9A 3EYGA 3NNUA 4IQ6A 4G31A 4OBOA 4DYMA 4EUUA 3HMPA 5EYMA 1YDSE 5TF9A 4G5PA 2OJFE 5HLPA 1B6CB 2PE1A 2YAKA 3QQHA 3HEGA 4HVDA 4O7TA 3POZA 1ND4A 4YC3A 3W33A 3O2MA 3JYAA 4X3FA 4XBRA 4BDBA 5IUGA 2CCHA 1KOBA 3HRCA 4E4XA 5KBQA 1GIJA 3IOPA 3UGCA 1O6KA 5ETCA 5BVKA 3S2PA 2OICA 2F7EE 1WCCA 3K5UA 4OGRA 5AUZA 3RK5A 3EFJA 3TEIA 1TQPA 3RPRA 2OW3A 4CGAA 1Q3DA 2BPMA 4QTAA 4LM5A 4QYEA 1ZLTA 5FEEA 2E9VA 3ZONA 4USEA 1J7LA 5L4QA 2PVFA 3E87A 3ULZA 2Z7LA 2PZIA 2OU7A 3MFUA 2EVAA 5FDXA 3CSVA 2QOFA 4M68A 4UYAA 4BIBA 2WMTA 1ERKA 2J9MA 5KHWA 5BQ0A 4YR8A 4PDYA 1P5EA 2PHKA 2XCHA 4EYMA 5CF6A 4FSZA 2ITTA 4HYIA 3IW5A 4CFXA 4C57A 3VBYA 1JKTA 1WAKA 3ETAA 3DV3A 3G6HA 3PJ8A 4U43A 4LFIA 2UZUE 1VR2A 4IJPA 4AZWA 4XG3A 2ERKA 5EHLA 2WTVA 4GG7A 4F0IA 1OUKA 4GIHA 2XNPA 3DT1A 1PXMA 5FXSA 4GT3A 4RLLA 4F1TA 1KV2A 3CKWA 1H07A 5CAUA 3CQWA 4YPDA 3RINA 4NTTA 4O0YA 4L45A 3QTUA 5CXHA 5AP2A 4IVAA 5DWRA 1B38A 4FV6A 5TKDA 2FO0A 3FKNA 4BTMA 1OITA 2IW8A 4EBWA 5B7VA 4IH8A 4ANMA 1R3CA 4AZVA 1Y91A 3NCZA 2VTAA 2UV2A 4CYJA 3FMNA 3IECA 1WBVA 4L67A 4NKAA 5DGZA 4U45A 4U40A 3QKKA 1W83A 2ITOA 2QOHA 4TY1A 3NUAA 3FMEA 4ZP5A 3QQLA 4EYJA 3HL7A 2PU8A 3RNIA 2JAVA 3GVUA 3HMOA 3C4ZA 4I23A 3RAHA 2VUWA 4ACMA 4BDEA 4EL9A 4C38A 4OLIA 1U54B 2X39A 3AC1A 3JPVA 4Y5QA 4RVTA 1GZNA 2GHGA 4WSYA 4TWOA 1BKXA 1ATPE 3ZLSA 3IW6A 4A9SA 3D4QA 1WBNA 3GCSA 1H1QA 4GU9A 3Q52A 2ZM3A 2UW4A 3DOGA 3MJ2A 2PULA 4ZJIA 4TNBA 4NW5A 4ZAUA 3EOCA 3DXQA 3BLHA 4F09A 4YNOA 3MBLA 3BU3A 4FT0A 2VWWA 4DA5A 4H3BA 5C4KA 1Q8TA 5TOZA 4HZRA 1LP4A 3QTWA 1Y57A 3ORNA 4FR4A
chains in the Genus database with same CATH superfamily
2IZSA 4QP6A 3EQPA 4JG6A 4UZHA 4BWKA 2XIXA 4RJ8A 3F3TA 2YHVA 3MH3A 3P0MA 3IDPA 3FI2A 3Q32A 4RC3A 2QNJA 4RX5A 4QMYA 1LPUA 2Z7RA 3OC1A 4I5CA 2R4BA 1H08A 3ZSIA 4GJ2A 4XG7A 3L8PA 4IADA 2OLCA 3R8ZA 1YW2A 4MKCA 2WQOA 4ACDA 1LEZA 5CQWA 5DT0A 5AAGA 4MBIA 5B2LA 2Z60A 4BDIA 4PMPA 2QO7A 2XEZA 2C6IA 4MXAA 3WOWA 3ZLYA 2ZYBA 3LXNA 4FYOA 4LL5A 4C3RA 3BIZA 3C13A 4FVQA 4JG8A 2OH0E 4AGCA 4ONAA 2YAAA 4DG0E 4R3PA 2QKWB 4FYNA 4HW7A 4EC9A 2WMRA 4EBVA 4F6SA 3ZMMA 4BVUA 1H27A 1STCE 2NRYA 3PVGA 1TQMA 4EOLA 1Q8WA 4I6QA 4IW0A 1FPUA 5IDPA 1J3HA 4IHPA 4BKJA 3E3BX 4KRCA 4C4FA 4QT1A 3UIBA 5E8SA 2VZ6A 2C6LA 3BYUA 1ZOHA 4ZZNA 2CHLA 2QOBA 1PMNA 1BI7A 2ITXA 3DLSA 4RIXB 4I92A 4WNOA 5EDQA 3I7CA 3CJFA 5L6WL 5AP0A 4AGWA 4E5AX 5A54A 4RGJA 5ITAA 4O7LA 4AWIA 3BWFA 5FP6A 5ANGA 4BZNA 4CZUA 4D55A 3QAME 4E20A 5ACBC 5IA1A 1OMWA 2WELA 3EL7A 1MP8A 4MF1A 5L2SA 4RT7A 4BBMA 4NCTC 5HU9A 3FZSA 5CLPA 2EB3A 4EHVA 1OKYA 4A07A 4IB5A 3NIZA 4OTDA 3QTRA 2HW6A 5D10A 4UV0A 5LVPA 4FEXA 3IGOA 4CLIA 2ONLC 4BCHA 4DH3A 2PWLA 3MN3A 3IO7A 2UZOA 3MA3A 4K11A 4UZDA 1RE8A 3HECA 3KCKA 1NY3A 5FD2A 3ZC5A 5AP4A 2UW9A 4RIYB 1PXNA 3LMIA 4EWQA 5F4NA 4P90A 3MTFA 2GHLA 4D1XA 4RBLA 4EH9A 4UWBA 3ZSGA 4O7YA 2PMNX 3G0EA 3RMFA 3UG1A 3UOJA 4XMOA 4FKRA 4DGNA 3FPQA 2A27A 4IB1A 4FSQA 1UNLA 3O8UA 4QP9A 4G9CA 4RVLA 5CQUA 2GNIA 3PIZA 4L7FA 3VS1A 3GCPA 3KMUA 4BBEA 3ZRKA 3A2CA 2XUUA 4ASXA 2BROA 5AADA 5EYKA 5KE0A 3SOCA 4F9WA 3IOKA 3D7TA 4YLKA 3W0NA 3GQIA 4BJJB 2V22A 4XG9A 4FV7A 3GOKA 3UQFA 1U5QA 2XK6A 3TNPC 4EK3A 4JI9A 5AP1A 1M2RA 2CGUA 2CNVA 3UIXA 3WZUA 4O7ZA 3EFKA 4N0SA 3ULIA 5GJFA 4C3FA 4O2PA 4UBAA 3OT3A 5M53A 2WOTA 1W2FA 4YZCA 2R3RA 2BKZA 1J7IA 3OG7A 3ZFYA 3BX5A 4FV9A 3KEXA 4FKOA 5FUTA 3AOXA 4KBCA 3QQGA 3F3WA 5HG8A 3K3IA 5EKNA 2X4ZA 4G6OA 3CTJA 3KY2A 3FQHA 4NM0A 4PMMA 3F9NA 4WG4A 4BDFA 4GRBA 4E8AA 3MPTA 3EN9A 4IX3A 3C4FA 4EWHA 3OT8A 2W4JA 3GEQA 5BVOA 2BRNA 2GS2A 3VVHA 5J7HA 2QI8A 2A0CX 2PVMA 3QGYA 3ZXTA 3TYKA 5CNNA 5JKGA 4PNKA 1PXLA 4QMPA 2VTLA 3KQ7A 4HPUE 4F63A 5IQAA 3W1FA 5BMMA 4APPA 5DYJA 4IAYA 4DFUA 5IEYA 5BPYA 4NIFA 1RQQA 4F7SA 5EQPA 1KV1A 3I6UA 2GQGA 4CKRA 2XEYA 3HKOA 2XM8A 2WQBA 3ZFMA 1FOTA 3MTLA 5IQIA 1DM2A 1Y8GA 3ZLXA 4H05A 4WKQA 2PK9A 2VTJA 3UOHA 2XNNA 5FP5A 4I21A 5JGAA 4D1SA 2OJIA 3VS3A 4CV9A 1NVQA 2QLUA 3KXXA 3EYHA 4QQ5A 3TKUA 5CENA 3DB6A 1KSWA 1M7NA 4BTJA 3NW6A 1VLRA 1H1SA 4KIQA 4RX8A 4RFYA 4EH4A 4AXFA 2PUPA 2WHBA 4EOMA 2REIA 2PSQA 4FOBA 2WB8A 3T8OA 4ERWA 5KMMA 2J5FA 4ZTRA 2X2KA 4FVPA 4ANNA 5CU3A 4CD0A 5AWMA 4M69A 4EKLA 3RAWA 3PIXA 5AR8A 1KWPA 3KXZA 3LPBA 4CKIA 1VYZA 3KU2A 2V55A 3V5LA 4FGRA 4AQKA 4ZZMA 3IPHA 4CMTA 5L3AA 3T3UA 4K6ZA 4I0SA 4TN6A 3FQSA 4I5MA 3O51A 3TXOA 3UO6A 3EL8A 2CGWA 3GQLA 1CKPA 3D94A 4NW6A 3D2IA 3DQWA 4RJ4A 3NUYA 1CM8A 5C9CA 3VBTA 3NMUF 5E8VA 4XX9A 2VO7A 2P0CA 3PP0A 4NKSA 2XM9A 4O96A 4FZFB 2X0PA 2OBJA 3NNXA 3ORXA 4Y95A 5H8EA 2R3GA 5C8NA 2X9EA 3C5UA 4QMWA 4AA4A 3LQ8A 4JVGA 1K2PA 5HEZA 2J0MB 3JY0A 3COMA 4JBVA 2YM5A 4TWCA 4QMSA 1OPLA 5JH6A 4D9TA 5HE2A 3VS5A 4J52A 3PXYA 4TRLA 3EMGA 5CALA 3BQCA 3F3ZA 4GUBA 5KBRA 3BGQA 3G9LX 3DJ7A 3QHRA 1GY3A 2WAJA 3P78A 4P2KA 3VBQA 4TL0A 3R71A 5GHVA 1PRYA 4CRLA 3HDNA 1S9IA 4R5SA 2IG7A 4F4PA 4AP7A 5L2WA 4B8MA 5CX9A 4ANQA 2GS6A 4AZFA 3F3VA 3LFEA 1ZZLA 4OW8A 1FINA 3L8XA 4GVAA 4S30A 1PXKA 3OY1A 2J51A 3NPCA 5M55A 3EH9A 4CEGA 2B54A 2R3LA 3ERKA 2HZIA 4YJTA 2JIVA 2RIOA 2CKQA 3HV5A 2AQXA 3KA0A 4ZY4A 1OKZA 4LMNA 2CN5A 2XCKA 4U6RA 1J7UA 1ZZ2A 4XH6A 1H25A 4FTCA 1CKIA 5AUVA 2C1BA 3MI9A 4JDJA 4BHZA 2XA4A 3U6HA 3P5KA 3SRVA 3F2RA 3OEZA 2XZSA 4KWPA 2P4IA 2FGIA 4C02A 3Q5ZA 2X81A 4J7BA 5EM5A 2BKKA 3JY9A 2IPXA 3B2TA 1XH4A 4JXFA 3RZFA 3AKLA 4NU1A 3CQEA 4F6WA 5HORA 3F7ZA 3FZOA 3BL9A 4J8NA 4QYGA 1BL7A 4O4CA 4WA9A 5T6KA 5AX3A 4WD5A 4ALVA 3D5VA 2J6MA 3UZTA 4MCVA 4RRVA 2BTSA 4QQJA 3UVRA 3HYHA 4TYJA 3KVWA 3V04A 4MNEB 4O0UA 2FB8A 3QCXA 1W2CA 5FXRA 4BFMA 5ANIA 3LM5A 2HWPA 3P08A 3CY3A 4K1BA 4MBJA 4KS8A 4DTKA 3A8WA 2XBJA 4KAOA 2W0JA 1OIYA 3ORLA 4GW8A 4FC0A 2XYNA 4KKHA 4BI2A 2OF2A 5LVNA 3A99A 3QUPA 2VO6A 4Q9SA 5LXMA 2RG5A 1TQIA 2ZB1A 3MH2A 4MVFA 1RJBA 1URWA 2QLQA 5E8XA 3VN9A 3LZBA 3WIKA 4NT4A 3BHVA 1JSVA 3QUDA 4RPVA 4A9RA 4DE4A 1KE9A 3Q2MA 5AR4A 2XK9A 4DEHA 4KUJA 1S9JA 2HK5A 4LGGA 3COHA 4RA5A 4S34A 5A4CA 4MH7A 3ENMA 3TDWA 4BTKA 2P2HA 4LOPA 5IUHA 3L1SA 3QLFA 4J53A 1REJA 1Q99A 4K9YA 4YHFA 5KZIA 5FTQA 4EZ7A 1J91A 4I93A 5BYLA 5HIEA 4ZS4A 5HNGA 5L2QA 5ETIA 4BCJA 2P2IA 3CBLA 4A7CA 3WI6A 1ZXEA 2QOIA 3U6IA 5LWNA 3CPCA 4MWIA 2B0QA 3AD4A 3SDJA 4B99A 2R3HA 4JDKA 4CFNA 2ZJWA 3ITZA 4GV1A 4LV8A 4XRLA 2HW7A 1BUHA 2WKMA 3FPMA 3ORKA 4IXPA 2IEWA 4J98A 4RIOA 4YJRA 3OBGA 4KINA 1IAHA 1PXJA 4WUNA 4L44A 3TN8A 4U41A 2E9PA 3LCKA 5FBOA 3LFNA 4AZSA 3QUEA 4FNYA 2VX0A 5C03A 1ZMUA 3I4BA 4O22A 4I0RA 1UU7A 2WIPA 4GT4A 4I5HA 3BYOA 3MY5A 3VAPA 3BWJA 5K4IA 4AT5A 5JFXA 4G3CA 3MB7A 3A7JA 1Y8YA 3AD6A 2Y4PA 4E26A 5BYYA 2Y8OA 3DFAA 3QQFA 3FI3A 3BYSA 3HVCA 2JDSA 5J95A 3UZPA 2V5QA 4DLJA 5HBJA 3EJ1A 3R1YA 5AR5A 4C4JA 3RHKA 2IW9A 4ASDA 3U87A 4WNPA 4X6RA 4JBOA 2C6KA 4FSRA 3ZSHA 4YSJA 3FLZA 2JDTA 3MPAA 4AQCA 3D7ZA 4F64A 3OMVA 2GFCA 1X8BA 3C1XA 3PA3A 4L8MA 5IH5A 2ITZA 5BV3A 3OFMA 5DN3A 4DFXE 3BLRA 4F9CA 3S1HA 3LFSA 2R3KA 3LFCA 3AKJA 4DH1A 3FXWA 4G16A 3NUSA 4RJ5A 4V05A 2Y4IB 4D2WA 3GBZA 1W7HA 2X2LA 2YCSA 4PTCA 1NW1A 3A60A 5E8ZA 3Q4CA 4V0GB 5FEDA 3IGGA 3WIGA 4A9TA 4AN2A 3PFQA 3BU6A 3DBDA 4EK8A 2GQSA 4IMYA 4OR5A 3R04A 5CU2A 4MXYA 2XRWA 3HGKA 3QCSA 4JQ8A 4FZ7A 4NWMA 4ANOA 4UMPA 3D9VA 3BHTA 4L43A 4A9YA 1P4FA 2PUNA 4BDAA 2VTRA 4RIWA 3LW0A 2ZMDA 2DS1A 3DXNA 2EB2A 4ITIA 2W96B 4MX9A 1UVRA 2PZ5A 3F5XA 1B39A 5GIPE 5EI2A 3EHAA 2VX1A 2HCKA 4LOQA 3LJ1A 2W06A 5JZNA 2PMOX 1XH6A 4YJUA 1IAJA 2H34A 4JJRA 4JAJA 2VWBA 3D5XA 3DY7A 3L8SA 4X3JA 1V0BA 4E6DA 2XANA 3W2SA 1H26A 2UW6A 2VWUA 4MXOA 5JFVA 2X0GA 4X2JA 3RNYA 3A8XA 2EUFB 1ZMVA 3W8QA 3M11A 4P5ZA 3DK7A 4FNXA 4GJ3A 4E4MA 3FL5A 3R2BA 4FKSA 4MBLA 3V6SA 4AX8A 3OUKA 3PYYA 1XH9A 4DGLC 5JN2A 4IAIA 2XARA 2ERZE 1MQ4A 2ITQA 4C61A 3FMJA 5TR6A 4L3JA 4EZ3A 5CEIA 5C8KA 3VS2A 3D0EA 3DZQA 4DFYA 3NDMA 3ORIA 4YHTA 3PUPA 5ACKA 4A4XA 2R3NA 3DJ5A 4Y73A 5KNJA 3N51A 5DA3A 3PVBA 2YM7A 4YSMA 4D4YA 5IQDA 3O71A 5BVNA 2E9OA 3OCGA 3Q6UA 3LFAA 5DNRA 4LOOA 3UE4A 3KK8A 4ZS0A 4UXQA 5I9XA 1XBCA 3OWJA 2CPKE 1OL7A 3LXLA 4KBKA 3RBWA 3TMOA 2X8EA 4IVCA 4BCFA 3C5IA 4AW2A 5BVWA 4FSNA 4CFVA 3C4CA 3LFFA 4D4SA 4JX3A 3UO5A 4YZDA 1SNXA 3FZ1A 3LKMA 4R78A 3TT0A 3ORPA 2E9NA 4YJOA 3W8LA 2XKCA 4U9AA 3DAJA 4HCTA 4ALUA 2G2IA 4E4NA 2NNWB 2YIYA 4W9WA 5BVDA 4EOKA 3OF0A 4GH2A 1HOWA 1F5QA 2OJ9A 3MVLA 1PXOA 2C47A 3E5AA 1OBGA 3OW4A 3HAMA 2V0DA 5IPJA 5J9ZA 2GNJA 3F66A 4BF2A 3H0YA 3QHWA 3BHUA 4W4WA 4PF4A 3QFVA 1H1RA 1SVHA 4MNFA 3MS9A 4C58A 4Y46A 2XNGA 5CF4A 5CEKA 3VC4A 2OZOA 3BEGA 4XV2A 4ZMEA 4FEWA 5K4JA 1SVGA 4R1YA 2BZKB 4NJ3A 3EN6A 2G01A 4O0XA 4AZEA 3QA0A 3PA5A 2O5KA 3Q96A 4JQ7A 3Q2JA 3BL7A 3I5NA 2VTHA 4Z9LA 4ZSAA 2BIKB 4EH3A 2CMWA 1ZARA 2W1DA 2W5AA 1U54A 3KXGA 4QP8A 2YDIA 3CQUA 3GC9A 5AM6A 5HLNA 3GT8A 2JLDA 1ZYSA 3HNGA 4RX9A 3L9PA 3MDYA 4W4YA 4YTFA 4XV3A 3PWYA 2XF0A 1ZMWA 3E92A 4LGHA 3R8UA 4E93A 5A14A 5CZIA 1PYXA 3UVQA 4R8QA 3CR0A 5H8GA 3TUBA 3ELJA 1GAGA 1OIUA 4HGSA 4O1PA 4OAVB 1RW8A 4CTCA 3R9RA 5K9IA 4ZJVA 2PVLA 5CI7A 4BC6A 2XVDA 4XLIA 3HMIA 2DQ7X 2VU3A 4HNIA 4RLKA 5KMNA 1Q62A 2QONA 4CFMA 3QF9A 4DINA 2VRXA 4N4SA 4QMQA 3C51A 4DBNA 4G5JA 1XKKA 5E92A 3L9LA 4ZLZA 3KXNA 2X0OA 3CTQA 4XV9A 4GVJA 4DCEA 3JXWA 2ZFYA 3PDTA 4L6QA 4YC6A 3VQUA 3GU7A 3R63A 3AD5A 4D5KA 2WMXA 4F9BA 5ANDA 2Z2WA 2GNHA 2OZAB 3CKXA 3BKBA 3HP5A 3M42A 4U5JA 5DR6A 1YI6A 1V0OA 4CCBA 2WGJA 5HVYA 4M0YA 3V5QA 4G17A 4TYHB 4O21A 4R3RA 5KZ0A 2XRUA 4PTEA 2OJGA 4H1MA 3TZMA 4NL0A 4U97A 3BBWA 3Q5IA 1YKRA 4D2RA 4TYGA 5J8IA 3GCVA 4OT6A 2QC6A 2X6DA 2XKEA 3FZPA 4QMTA 4U7ZA 4B9DA 4UWCA 5EKOA 2XK8A 3IQ7A 3VJOA 4FL3A 4P7EA 4IACA 5H3QA 3U8WA 1TFFA 5IQHA 4YTCA 2QHMA 3PSDA 4HCUA 2JBPA 4IAAA 2JIIA 5LVOA 4IVDA 5IZFA 5M09A 3F61A 3V8SA 3PP1A 4YUQA 3CGFA 3F3UA 1JSTA 4M12A 4DFZE 5GJDA 4AU8A 3RWPA 2B7AA 2X7GA 4XV1A 3LLAA 4QNYA 4TZRA 4F9YA 4LV5A 2R3QA 4E6AA 4O0WA 4RJ6A 4OTQA 4C2WA 1OM1A 1OZ1A 3F5UA 4RIXA 4BYIA 3M1SA 2JITA 2QOKA 3C9WA 4AACA 2O63A 3F5GA 2Q83A 3BV2A 5J9YA 3WZKA 2C0OA 3TJCA 1H24A 3DDQA 4O0VA 4NJDA 4C4HA 3HA6A 3FMDA 4UALA 1MRVA 3HUCA 4FT9A 4PP9A 2WXVA 2WQNA 4WRGA 2QOCA 2B9HA 4UYNA 5LMAA 2JFMA 2XH5A 2VNYA 5BVEA 5IMXA 3DAEA 3RTPA 2J0KA 2W9ZB 3ZXZA 2ZAZA 3H0ZA 2QOLA 1LEWA 3RK7A 1OGYA 5CAQA 1FVRA 3SX9A 2R3IA 4KIOA 5EW3A 2PE0A 4IIRA 3T3VA 2EXEA 5JMSA 3LFQA 5KMJA 2HELA 2CN8A 4F1MA 2FUMA 3ORZA 4FV8A 4PDPA 1GZKA 4RIYA 3W2RA 4ORKA 4FKQA 4U42A 1W84A 4P5QA 4ZTNA 3BLAA 4BTFA 2XP2A 3R6XA 4XEYA 3OP5A 4PTGA 3NR9A 4EORA 5H9BA 3R9NA 3SLSA 3LXKA 3ACKA 2X8DA 2W1HA 2RL5A 2IWIA 2OH4A 3H3CA 5IKWA 4E73A 4ZTMA 3U54A 5HCZA 4OBPA 2UW8A 3EB0A 3QWKA 4I94A 4TT7A 4EHZA 3CS9A 5HZNA 3MESA 4GYIA 5HG7A 3CLYA 2GMXA 3UOKA 3PXQA 4QTEA 3DNDA 2BAKA 2UZLA 2UZWE 2YISA 5EDPA 5I9WA 4BJJA 2F4JA 2B9JA 3ZEWA 1PKDA 5DT3A 4FV3A 3QD3A 5EFQA 3FL4A 4FKVA 2IF8A 3RJCA 3ROYA 1SZMA 1WBOA 4RFZA 3PTGA 2BRBA 1M7QA 4DGOA 2PVKA 2RG6A 4BGQA 5CY3A 2IVVA 4FTQA 2C6OA 4UY9A 4BIDA 5E91A 5E8YA 4IX6A 5DHJA 4X0MA 3QTXA 3R7YA 5LCJA 1OPKA 5GINE 4F08A 2I1MA 3Q9ZA 4W4VA 2E2BA 3RP9A 4M84A 2O8YA 2GSFA 4DHZA 3AMAA 3FLNC 5HOAA 5CEPA 4FTIA 5J1WA 1L3RE 3GU4A 2IVTA 4IBMA 3G90X 4O4EA 4B0GA 5GZ8A 4I6LA 4IB0A 2Y6MA 2PE2A 2NP8A 4ZJJA 3KXHA 4OTHA 3R28A 4RWJA 4ALWA 4OBQA 3PY0A 3CIKA 4W4XA 2UZEA 2VGOA 3G2FA 2GNLA 4IZ7A 3TNIA 4O6EA 2PUIA 3L9MA 5KMIA 2OSCA 3QCQA 5HQ0A 3FMHA 3Q4ZA 5I4NA 3CGOA 4N70A 2XYUA 4DCAA 5IA3A 5D12A 5BVFA 4R5YA 5EK7A 5EYCA 4TXCA 3E93A 3FZRA 5H2UA 3LQ3A 2WPAA 2WU7A 3R0TA 3RM6A 4ZSLA 2VWXA 1OUYA 4D0WA 3F2AA 2HY0A 2W9FB 2OI4X 2PVNA 4MXZA 3FI4A 3AT2A 1DAWA 4QD6A 4YBJA 4DT9A 4ZSJA 4WOVA 4USDA 1YXSA 4IWOA 3ORMA 2QU5A 5CT7A 3HP2A 3PVWA 3DXPA 2CLQA 4NM7A 5LJJA 3IDBA 4X2KA 3FSFA 4ASEA 4GG5A 2I40A 2JKMA 4ITJA 4QYYA 3HAVA 2GCDA 3KMWA 3QXPA 1BLXA 3BPRA 3VO3A 4AN9A 3BE2A 4FTRA 1J1CA 4QYFA 1IRKA 3KL8A 3BYVA 4O4FA 4E5BA 2YM8A 3NX8A 3KREA 3R73A 4IJ9A 1WFCA 2W1EA 5IG1A 2ZB0A 3NUXA 2C30A 4L3PA 2GFSA 2JAMA 3QWJA 3VUDA 1CMKE 4FG8A 5EW9A 3Q60A 2QKRA 3WZDA 2JD5A 5LMBA 3QCYA 2CCIA 2YJSA 5EM6A 2VTNA 2UW3A 4XYFA 2WZJA 1W2DA 3I6WA 5IEVA 3CD8A 2ITYA 2ITPA 3K54A 5JFSA 2C5YA 2CGVA 2ITUA 4HNFA 2C1AA 5M56A 4O6LA 1U5RA 3D5UA 4DHFA 5HI2A 1WBTA 5AFVA 4AN3A 2GHMA 3KFAA 4EJNA 4PPCA 3BHYA 4QO9A 4X3FC 3TV6A 3PZEA 4B8LA 4FJVA 4XOZA 1JKSA 5CSHA 4ZOGA 2YDKA 1PJKA 3R1NA 2ESMA 3A7GA 5CT0A 3QGWA 4ANSA 4F7NA 4O7NA 3PLSA 2Y6OA 3G0FA 3TTIA 1VEBA 3I60A 5KX8A 1SNUA 4FGBA 4FKIA 2YEXA 4LYNA 5AP3A 5HNIX 2I7QA 2HY81 4NTSA 3VWAA 3PY3A 3W18A 3P23A 4FNWA 5JFWA 3FY2A 3RGFA 5HIBA 3MB6A 3FLQA 3V5TA 2QU6A 5C01A 4YC8A 2YLFA 3GOPA 4YNEA 2C5NA 4MQ1A 3N4VA 3BV3A 3AC2A 2OJJA 4EH7A 3W0OA 3VS0A 2VO0A 4D2TA 4AAAA 1PMEA 3FI8A 2ZV2A 2G1TA 3ORTA 4DFNA 3IS5A 3MGYA 2PYWA 4G34A 2PZPA 4DG2E 5AP5A 2BHHA 1VJYA 3TIYA 4FEVA 3NVKI 1W0XC 3RCJA 2IZUA 3ZO3A 4M0ZA 3WF9A 3QXOA 2CSNA 4RG0A 4BCIA 2BMCA 4YZNA 4C62A 2ZOQA 2HXLA 4O1OA 3BE9A 4OUCA 4EH6A 4EJ7A 4XJ0A 4KIKB 3OEFX 4EC8A 5IA4A 4ZZOA 4IAFA 2UVZA 3H9FA 2PVYA 3FMLA 5EI6A 4IANA 4CV8A 3FEGA 5BYZA 2J0IA 3P4KA 4IVBA 5IDNA 4ZXTA 4FICA 4Z7HA 1CSNA 3ATSA 3GI3A 3MVJA 1V1KA 3E3PA 4MNEA 5AUYA 3OXZA 1UA2A 1OI9A 2AC3A 3EQFA 4FIEA 4MXCA 5B2MA 3TI1A 4B7TA 1GOLA 1NVSA 3IDCA 2OXXA 4FEUA 4BICA 4ZTQA 3HDMA 2X1NA 2C0IA 4QP1A 5DPVA 5HE1A 3NYOA 3UNJA 1WBWA 4JDIA 3KGAA 4K2RA 2PUUA 3C4XA 1OIQA 3EQGA 4IDTA 4K8AA 1Q8UA 5IU2A 2J7TA 5EOLA 3KRLA 1PY5A 3KVXA 1Q4LA 3PE1A 5JSMA 3LVPA 4FKUA 3SAYA 5M07A 4FTOA 3KRRA 4M8TA 5HNBA 4BI0A 1R1WA 5C27A 2HIWA 2C6EA 2LGCA 5JK3A 5CVHA 4WIHA 5L2IA 5CU6A 3E63A 2XKFA 4YBKA 4CQEA 2NRUA 2QD9A 2QHNA 4CT1A 3TUDA 2DWBA 2WO6A 3EZVA 5CNOA 3ML1A 2XIYA 4YJVA 2QO2A 4LRJA 5EG3A 4IM3A 3NZ0A 5HD4A 4O91A 3DBFA 3L9NA 2VD5A 3PSCA 5L8KA 2B9FA 3FMKA 3LJ2A 3MFTA 3IW7A 3CE3A 4DFLA 4PNIA 4QMXA 4HVIA 5DVRA 3ID6C 4NUSA 3NGAA 4H3QA 4ANBA 2WOUA 2JKOA 3KKVA 1WVWA 4QRCA 3P5JC 3U51A 3QD0A 5FLFA 2JDRA 3QA8A 4NFNA 1DI9A 2XKDA 4M66A 3R9DA 4I4EA 3U9NA 4UN0C 3I0OA 4DGMA 2ACXA 3KF7A 4RZVA 2WTDA 1K9AA 3ZHPC 3F5PA 4R6VA 1UKHA 5J79A 2C5VA 2UVXA 4RJ7A 2J0LA 4Q5HA 3AT3A 2W05A 2WEVA 3DKOA 2R0UA 1F3MC 4H39A 3MIAA 4G6LA 5J9LA 5I3OA 2JIUA 3FQEA 1QPEA 3LAUA 3CD3A 4FT7A 4FTNA 5HICA 1XMMA 3OOGA 5D41A 5TE0A 2VTIA 2ITWA 3P9JA 4BCGA 2E9UA 1T46A 3TKIA 4AZTA 2UZNA 2GS7A 2B53A 3H30A 3DKCA 3WE4A 4ZTHA 3TCPA 4XRJA 2A2AA 5CVFA 5DFPA 5DG5A 4R77A 2OKRA 4YGAA 3EN5A 1IA9A 4HYUA 4F7LA 4X21A 4BDGA 3OXIA 4C7TA 3I81A 3R2YA 2XAMA 4YU2A 5F9EA 3HLLA 2EXMA 3PY1A 3HV7A 4MD8E 4C4EA 2RSVA 2C3LA 3NFFB 5FTOA 1TKIA 3MSSA 4V0GA 3ZRMA 4QQTA 5ANOA 5KKRB 3QRIA 4USFA 4F0GA 2OO8X 4L46A 5DIAA 4DAWA 4RWIA 1QL6A 5EI8A 2AEGA 2BCJA 4FZ6A 2RFSA 4TKSA 4U3YA 5HO6A 2YWPA 3PJ1A 3AXWA 3E62A 4DEDA 3QC9A 2BILB 2G2FA 3E8NA 2UZBA 4F1OA 5CSVA 4TWPA 1MQBA 4X2GA 4DF3A 4CFFA 3UQCA 4YO6A 1YI3A 4Z7GA 4FTJA 5DRDA 2X7FA 3LJ0A 2HZ0A 1ZOEA 4AXDA 3DPKA 4S2ZA 4CYIA 1DS5A 3DDPA 4C35A 3FXXA 5AP6A 3PFYA 5FQDC 4FBXA 3NFGB 2H9VA 2YM6A 4BCMA 1L8TA 3DU8A 5LCKA 2WMUA 3PSBA 4AUAA 4BDHA 5ANJA 2B55A 3MH1A 4BL1A 1HCLA 5HX6A 2BVAA 2IJMA 3ZO4A 4MQ2A 1XMLA 4FV5A 3F7WA 4ZEGA 4BBFA 4G3EA 1YI4A 4KD1A 3GB2A 1A06A 4XG6A 4J97A 1PXIA 3B8RA 3R8PA 3GC7A 3N9XA 1WBPA 4BDCA 4BRXA 4DGGA 4AXEA 3HV4A 1YXTA 2PVHA 4AT3A 1G3NA 3PXKA 3W32A 1JAMA 1YHSA 2HYYA 2P55A 4AGDA 4M14A 2JFLA 2BRGA 1AGWA 1JSUA 2HAKA 4RWLA 2O2UA 5AIRA 5B0XA 4OTPA 3RPVA 3POOA 2I0VA 4FIHA 4G3GA 4MF0A 5AMNA 5I9UA 3A7HA 2ZDUA 5M4FA 1UV5A 3GU5A 3OD6X 3P86A 3QZFA 5CAPA 3UJGA 4PQNA 4D2VA 4RMZA 1M17A 3OXTA 2C6MA 5D1JA 2C69A 2C5XA 4G3DA 4MTAA 4OT5A 4FT5A 3OVVA 2QR8A 5EYDA 2VGPA 4GSBA 3TKHA 3TL8A 1WMKA 4K0YA 5KMKA 4J96A 2VWIA 3FY0A 3ACJA 5T68A 4I3ZA 3UPXA 3NYVA 4IC7A 3FE3A 2ZV7A 4JT3A 3UG2A 4MD9E 3SOAA 4BCKA 1TVOA 2ZV8A 4YP8A 3ZDUA 4BHNA 3LFDA