4AGDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sunitinib (su11248) (n-2-diethylaminoethyl)-5-((z)-(5- fluoro-2-oxo-1h-indol-3-ylidene)methyl)-2,4-dimethyl-1h-pyrrole-3- carboxamide)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
317
structure length
303
Chain Sequence
LSIVMDPDELPLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 303
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4agdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4agdA01
1PF8A 2XK6A 2C5OA 1U4DA 2YCQA 3BYMA 5HESA 2FSOX 4WA9A 3C13A 1UU9A 4YZDA 2JKKA 3CTHA 4YTCA 3I7BA 3E63A 5A6NA 3MFUA 2NRUA 4QRCA 4O7YA 1H1QA 3ZLXA 3L9NA 4UALA 4MWHA 3LXNA 2YCFA 3DPKA 3E8NA 2PZRA 4RC3A 4RC4A 1OECA 3RK7A 3T9IA 4BDCA 2XUUA 3QCXA 4BWXA 2KULA 3GCUA 4D2PA 4QT1A 3AC2A 5FBOA 4AA4A 2H96A 5A14A 3TV7A 4UN0C 4RT7A 5LMAA 4M97A 3QRIA 5K4JA 4JBQA 4NCTA 5C4KA 4GL9A 5DLSA 5H8BA 2CJMA 2YM6A 3CS9A 2CSNA 1OBDA 4C58A 1YHVA 3R9DA 4RJ4A 3U87A 4BCFA 3CP9A 1Z57A 2WTDA 3QU0A 4PUZA 1Z5MA 3B8RA 3PA5A 3EJ1A 1OL2A 1I44A 4WSQA 3RAWA 4BKJA 2PUPA 3KXNA 2BZIB 4ZZOA 2RKUA 4H3QA 2ZB0A 1YOLA 4CFUA 2VU3A 4LI5A 1ZAOA 2ONLC 1Y91A 1JLUE 4ZSEA 3FQHA 1BI7A 2JKOA 5AV1A 4J95A 1SYKA 4YJOA 4JG8A 4RQKA 3Q2MA 5JGBA 3NNXA 5BYYA 1IR3A 3R30A 2XIZA 4MQ2A 2NO3A 5B2KA 5M57A 1STCE 2OJJA 3TUBA 4G3DA 4PMMA 3P7BA 4MF0A 4B8MA 4DTBA 4OTDA 5KZ0A 3AC8A 3C51A 2OXXA 5E9EA 3LFBA 2YCSA 4F70A 2XF0A 4IB0A 3LQ3A 4K6ZA 4IAYA 4LOOA 4EUUA 3HV7A 3PIYA 3KQ7A 2Y0AA 4IM2A 3OD6X 2YM7A 2OFVA 3KVWA 4ZTNA 4DH7A 2PPQA 4ASDA 3OZ6A 2GNJA 2Q0BA 2R3MA 3MVJA 3QF9A 2BKKA 5L3AA 3LKMA 5CXZA 2ACXA 3H9RA 5IDPA 3EMGA 3ZC6A 4ZZNA 1W98A 3OXIA 4U0IA 4FT5A 3OF0A 1BX6A 4E6QA 4FSMA 3MI9A 1WMKA 4XMOA 1GJOA 4ZS0A 3ALOA 4P2KA 3JXWA 4ACDA 1YDRE 5FWKK 3BU6A 1V0OA 4CQEA 2IN6A 2F7XE 4OAUC 1YHWA 1H8FA 4FKVA 3UO6A 4GKIA 3A7JA 2Z8CA 3C9WA 2IWIA 4DFUA 3VRYA 2WMSA 2OZAA 2UW0A 4G5PA 4JVGA 1YXSA 4IAKA 5DA3A 4J8NA 2ETRA 1WBSA 5FTQA 1Y6BA 2VWWA 2B9FA 4FOBA 2QOBA 1OBGA 2Z60A 2PZ5A 4E4XA 2YIXA 4JJRA 4NM0A 4CZYB 4U8ZA 4GK2A 3Q9XA 4WHZA 3JR1A 2UW7A 3R8UA 3W10A 3NNWA 2W1IA 3R1YA 4FTQA 4DGNA 4QP7A 3DB6A 2GNFA 4BDDA 4I0SA 4MBLA 4O2ZA 5CF6A 5J79A 1YXVA 4FSUA 5KE0A 3DTCA 3O71A 1EH4A 2QOOA 4BBFA 3H9FA 3PLAE 5LARA 3BYOA 4QYFA 1J7UA 3FSKA 1P5EA 3B8QA 4M8TA 5CZIA 1Y57A 2X6EA 2XK4A 5I0BA 5J9LA 4TTHB 3ATTA 3SG9A 2VTIA 2AC3A 3AT3A 4FV4A 4YJVA 3R9RA 3DFCB 2JC6A 3IW6A 4NW6A 4BTMA 3NUYA 4QMYA 5HG9A 1XBAA 2C6TA 1XO2B 4O1OA 4M69A 3DXPA 5A46A 2DWBA 4O0XA 5HU3A 3NYOA 4MAOA 5EFQA 3QAME 3I5NA 5EYDA 1U46A 4FEXA 4WT6A 3EQIA 3PG1A 5HLPA 3H4JA 3LFQA 1OL6A 3O2MA 1MRUA 5FP5A 3QX2A 5E1EA 4FEUA 1E1XA 4KBAA 1ND4A 3QWJA 4TL0A 1AQ1A 3HX4A 4CFFA 4BDFA 4BCIA 1ERKA 3HAVA 3PE2A 5CT7A 4WOVA 5AX3A 1ZMWA 3ZXZA 1QL6A 4QQCA 3EFWA 1REJA 5CQUA 2Y4IB 3A60A 5EG3A 2WTJA 3E8CA 3BHTA 4BI2A 1CKPA 3ORNA 2FGIA 4G1WA 3DB8A 4O7RA 1ZY5A 4IBMA 3RKBA 5E92A 4NFNA 4PDYA 4B4LA 3A62A 1UWJA 3F7WA 3FMHA 2OGVA 4L01A 3UGCA 5M09A 3D15A 3QRJA 2J6MA 1DAYA 5E8YA 4TYHB 3G15A 3F2NA 2PWLA 2E9OA 1H07A 4RC2A 4CFMA 2Y6MA 4GFGA 5AJQA 3HNGA 2XM8A 4L53A 1GZ8A 2Y7JA 3Q9WA 5ANDA 2R0IA 3IONA 4FIGA 4BB4A 3A7GA 1SVEA 2PVMA 3TDWA 5FG8A 5DVRA 4TWPA 1RQQA 5CAOA 4AOIA 1WBNA 4RRVA 4FNYA 3O0GA 5IA2A 4ZLOA 4MCVA 1LUFA 3GU8A 4RX9A 1YI4A 3AT4A 1PRYA 3FI2A 4I20A 3LFFA 4TT7A 5HTBA 5ICPA 3FSFA 4HVIA 4FOCA 3ZU7A 2BZHB 1T45A 3A61A 3NNUA 4I92A 1GIIA 2VTJA 3FYJX 4GT5A 3RM6A 3NAXA 3PP0A 1DM2A 4RJ3A 4C4JA 3HL7A 3QRUA 4X6RA 1KUTA 1AGWA 3BU3A 3IG7A 3CQWA 4K8AA 2NP8A 3CD8A 2XS0A 3VIDA 4H39A 4WNKA 1PXIA 3PXFA 4FNXA 2GQRA 1SNUA 3ELJA 3ZFMA 2WOUA 4JR7A 4CV9A 5AAEA 3KB7A 4E4MA 4PDOA 2EUFB 5HLWA 3KFAA 5L2TA 3GFWA 2VTMA 2B53A 3ZO3A 1LP4A 5HNIX 4PL3A 4YJRA 2C1BA 4GU6A 4EH7A 5KBRA 3ORTA 2J0LA 2VAGA 4N70A 4ASZA 1YXUA 3NDMA 5CSWA 4BCHA 5JFSA 4CMTA 3MH2A 3I5ZA 5EH0A 3DZOA 4L6QA 4OGRA 3TL8A 2F57A 5H3QA 2FSTX 5F1ZA 3D7TB 4N57A 2YN8A 3NIZA 3Q4ZA 4G17A 4Q2AA 3O8TA 5GHVA 5B2MA 4UX9A 4O83A 3MH3A 5B0XA 5HX8A 4O6LA 1JVPP 3VAPA 3ORXA 4GU9A 3UVRA 4WUNA 3CBLA 3QLFA 2QG7A 3W2OA 1MRYA 2DYLA 4IB3A 4H3PA 5HORA 4AFJA 2B4SB 3MY1A 4P5ZA 4FV7A 5HO7A 4E6AA 5M07A 3PWDA 3D7TA 3MVMA 4EQUA 3UNJA 5I9XA 2WPAA 4IJ9A 1IAJA 5FGKA 3BRBA 5D41A 5J1WA 2E9VA 4W4XA 3PIXA 5CYIA 3UOLA 4NUSA 3RPOA 5J7HA 1H01A 4HYSA 4Y46A 4Y83A 4ZSLA 4DBNA 1REKA 1P14A 3BHHA 4I5MA 1UA2A 4FKGA 3T3UA 2UZVA 1SVHA 3CE3A 3R1QA 4EOLA 3ZEPA 4TWOA 4HGTA 3TJCA 3SLSA 3TN8A 3FZSA 4QYHA 5I4NA 3LOKA 1WVYA 1TVOA 4A9TA 2ITVA 3DNEA 3REPA 1H26A 1R78A 3PPJA 4FUXA 3WE4A 2R0UA 2JD5A 4AWIA 3RPRA 5A3XA 4HGSA 4IADA 4F1OA 4XV1A 2W96B 4MD7E 2VWVA 3LQ5A 4G3FA 2ZM3A 3UIUA 3RNIA 3R8MA 4JQEA 4EZ7A 5KMLA 4DFBA 4ALVA 3F2AA 1WBTA 1Y8GA 3II5A 3V5PA 4EHVA 4R3PA 5CAVA 2PUIA 4L43A 4E5AX 3UNKA 4IVCA 3T3VA 3L9PA 5AAGA 4X3FA 4XV3A 3BHYA 3KXXA 3GU5A 1PMUA 5E8ZA 4RFZA 4JI9A 1WBPA 2R5TA 2G9XA 3MJ2A 4L45A 4JG6A 5HTCA 3MVHA 3EYHA 2W1DA 3VWAA 1WZYA 4IAFA 2R4BA 2ETKA 3SW4A 4D5KA 2BR1A 2HZ0A 2C30A 2YAKA 3LCTA 3ORLA 4B7TA 5EQYA 3QKLA 2EU9A 2P4IA 2QLQA 5CEPA 3DNDA 5H8EA 2QOIA 4O0VA 3R7OA 2BHEA 4F6SA 3NUSA 4TWNA 4QP1A 2HZIA 4JRNA 1PMVA 3O96A 4KBKA 5EYCA 3TWJA 5DT4A 1OI9A 4F63A 4Y73A 5ETCA 4FNWA 3LFCA 3DXNA 3TT0A 3UIMA 2BUJA 4E5WA 1ZZ2A 4F9YA 4IZAA 1YVJA 3AD5A 4EL9A 4CSVA 4ERKA 4YMJA 4USEA 2XNGA 2OI4X 5IEYA 5LCKA 3VS5A 3RPYA 3U54A 3MIAA 2QD9A 3W16A 3WBLA 2X8IA 2CLQA 3VC4A 2VX3A 4C37A 3EHAA 3ZZEA 3EQRA 3M1SA 2ITZA 4I24A 4I6FA 2I6LA 5EDQA 5HE2A 5DR6A 3CXWA 4G6LA 1KOBA 3VHEA 4FV0A 3OG7A 4GJ2A 1RE8A 4L3LA 5ANGA 2B1PA 3D7ZA 5C27A 4BTFA 5CAUA 4O96A 3QD4A 5BYLA 4RFYA 4ANOA 3V5WA 5EHLA 4R7BA 1DS5A 3ODYX 4G3GA 4I4FA 1XWSA 4LL5A 5AV0A 4BI1A 3R8LA 4MXCA 4IAIA 4N4SA 4JAJA 4FK6A 1FINA 4M14A 4TZRA 4EBVA 5L6OA 4G9RA 4U81A 2BVAA 2O65A 3TJDA 3W2PA 1VYZA 4YU2A 2RFSA 4NU1A 3BGZA 2R3RA 1VZOA 4LOQA 4EC9A 1MQ4A 3GGFA 3LHJA 4IIRA 2BROA 4OBQA 2QU5A 4NKAA 3ZEWA 4R1VA 1XJDA 3SRVB 3WIKA 3N51A 4IM0A 4YC8A 4PPBA 3HUBA 4FG7A 2WTCA 4CLIA 2RIOA 1ZMVA 3RAIA 3ZFYA 2W5BA 3N4VA 1H28A 2GNIA 2J4ZA 3LPBA 4C4IA 3ZC5A 4XG9A 1H1SA 5IQCA 2V7AA 3TI1A 2WQMA 2BZKB 5BX0A 4A4LA 4O0WA 1JKTA 4IX6A 4AZTA 5IKWA 2HWPA 4PY1A 5EW8A 4C33A 4CCBA 4HVHA 1QPCA 3HMIA 2R3QA 3G6GA 4IDVA 2RL5A 3UYTA 1IAHA 2GHGA 3EFJA 4A9SA 4HZRA 5HI2A 4RIWB 3FKLA 4YZCA 4AFEA 1IEPA 4DEDA 3PJ2A 2W05A 4EONA 1OGUA 1YI3A 3NUXA 2ZV9A 4QP4A 4DCAA 4ZSJA 4G3EA 2V55A 4YTHA 4OTWA 2HXQA 4AT4A 4CRLA 2CCHA 4MX9A 4HVDA 5C9CA 3BEGA 4KAOA 3LCSA 2B54A 5KBQA 4BY9E 1PW2A 3QFVA 2SRCA 3F66A 3QZGA 4H58A 5CENA 3Q6UA 2BIYA 2O3PA 4M66A 3SC1A 3VHKA 3P08A 3F61A 1Q8YA 3U9CA 3UOHA 1F3MC 4FYNA 5LVMA 4DFXE 2VWUA 3OWJA 4J53A 4IHPA 1V0BA 2HY81 3MDYA 4MHAA 4QTDA 3PA3A 4PWNA 4AA5A 2OJGA 5L6PA 5HIBA 1NT2A 1DAWA 3BYVA 3DXQA 3SGCA 4FIHA 4DE4A 2XBJA 4P5QA 3D4QA 3VS3A 4BL1A 3DK6A 5C01A 3DY7A 4MYGA 3POZA 1V1KA 2WKMA 3GC0A 3HP5A 4ZTRA 4FI1A 2YLFA 2CN8A 5KMNA 4EH4A 3V5JA 4FKSA 5FM2A 4QMVA 3FLNC 2VO7A 4NIFB 4MBJA 4O0RA 3ZRKA 2CLXA 4FTTA 5L8LA 1VEBA 3F2RA 5F20A 2YERA 3BLRA 4FTNA 1DI9A 3W2QA 2XVDA 5HVKA 2BDJA 3GC9A 5TO8A 4L3PA 5BQ0A 4U45A 5KO1A 4EKLA 3ETAA 5IMEA 3GUBA 3GOPA 4H05A 4IACA 3CKWA 5IA1A 4EHEA 4UYNA 2WOTA 1BL7A 2VTLA 3Q04A 2ZDUA 4FZ7A 4UV0A 2WQOA 3EB0A 5KNJA 1OL5A 3ENMA 3TNPC 3NEWA 4XEYA 5HG7A 4RWIA 3TZ9A 3MY5A 4FV1A 3FY0A 1PXLA 2BTSA 2QHMA 1T46A 2YIYA 3EZRA 3S00A 3K3IA 2QO9A 1S9JA 2CN5A 1H0WA 3PIZA 5BVWA 1WBVA 3ORMA 3U9NA 3VQUA 3UQCA 2C0IA 4S34A 5K3YA 3JUHA 3MA6A 3HRBA 2XH5A 1JAMA 2CNUA 3NW6A 4NTSA 3PJ8A 5FP6A 5BMMA 3OOMA 5EM7A 4BCJA 3RMFA 2O8YA 1W82A 4AUAA 4EH5A 2VWIA 4IVBA 3CQEA 4XJ0A 4O2PA 3VBXA 4P90A 5E90A 2JEDA 5I5ZA 4WO5A 1IG1A 2J9MA 4V01A 1X8BA 2VO3A 1TQMA 3WIGA 3SOCA 4X6QC 4D1ZA 4BIDA 3AD6A 3QHRA 4DYMA 3QTRA 2JIUA 3NZ0A 3BEAA 4I3ZA 2FO0A 2QR7A 4I0RA 2R2PA 3EZVA 4C02A 3NWWA 1OKYA 3LJ1A 3BU5A 4PQNA 1YW2A 3EN5A 3W33A 3B2TA 3G51A 4EWQA 2ERZE 5E8WA 3DJ5A 4J52A 4QPMA 5C8NA 3ATSA 3VS6A 3OCBA 2YIWA 3PVUA 4V0GB 4OTGA 5GZ8A 4I4EA 2W5HA 2WO6A 3CTQA 2F9GA 2C0TA 3I1AA 4IWOA 3L8PA 4IC7A 3TZMA 4E4LA 5JKGA 4AGWA 5KMIA 4ACGA 1WAKA 1LR4A 1UNLA 5J9YA 1OUYA 2WZJA 4GW8A 4KRCA 4FX3A 1KE5A 4TW9A 2GTMA 3UTOA 4FVPA 5IA5A 1GZOA 3NYXA 3HDNA 2BDFA 1R1WA 3DZQA 3KXGA 4UMPA 3NUNA 4I5CA 1JSTA 1KE8A 4IZYA 4NCTC 1W83A 4CFVA 4AGUA 3BBTB 4DGLC 2CGVA 3ZFXA 3R2BA 5L2WA 4BWPA 1UV5A 4GFOA 4ZTSA 2Y9QA 1PXNA 3BELA 4FMQA 4LGHA 4RA5A 5FM3A 4E1ZA 3GU7A 4FBXA 4DFNA 4GYIA 4ZXTA 5E8VA 4QMZA 4BDAA 3UOKA 3CGOA 4NFMA 2ITQA 3G9NA 4PNKA 3PE1A 3GP0A 4DGGA 2I0YA 4AT3A 1UKHA 3FHRA 4QMXA 2HW7A 3MIYA 1P4FA 3WILA 3IO7A 4GEOA 3NVKI 4MD8E 4GG5A 4KINA 4EI4A 4RIXA 3WZDA 2BALA 1QPJA 3FMDA 4LGDA 3OWPA 4U40A 4F0GA 3NS9A 4U3YA 3AT2A 3EQBA 4YHTA 1UNGA 2BILB 3E7OA 4IXPA 4QO9A 5KZIA 4ENXA 4B0GA 3FC2A 3P78A 2UZLA 2I0EA 3WOWA 3S2PA 3FV8A 3CPBA 5AR8A 2CCIA 4LRKA 1M7QA 2WU7A 5HO6A 1OPLA 1JSUA 3KKVA 3QYWA 4G2FA 4XX9A 2X7GA 2G01A 3JVSA 4EHGA 3FI8A 5EDRA 4GJ3A 4K18A 2PK9A 5CALA 2O64A 4JX3A 4M0YA 1O6YA 4BC6A 4USFA 4QPSA 2J0MB 4EK4A 1B6CB 3R00A 5HOAA 4DG0E 2J5FA 3ALNA 1PYEA 4QMOA 4DFZE 3ROYA 1MP8A 2ZJWA 5M06A 4LMUA 3DK7A 3ZDIA 2IW6A 4FL1A 3NUUA 5E1SA 3L8VA 2YA9A 5HU9A 2YLEA 3SV0A 4FV2A 3GCQA 4HYHA 3W2SA 4XCUA 5AEPA 2Z2WA 4FT9A 4FZDB 3FZOA 3ZM4A 3C5IA 2VRXA 4LRMA 3RJCA 3FQSA 1FMKA 2WQEA 3QZIA 4O6EA 4F4PA 5K9IA 5LMKA 4D4SA 5DIAA 4EOOA 4FUYA 5CVGA 3P9JA 3OT8A 1PMEA 3V5LA 4QTEA 1CSNA 5J1VA 5AP2A 3Q3BA 5L4QA 1NA7A 4JBVA 4BCKA 4C59A 2W7XA 3Q6WA 5DPVA 1PXKA 3VW6A 2JKMA 3QKMA 3R9NA 4ENYA 4HW7A 4RSSA 3F3UA 4CT1A 4RJ8A 2G2HA 2WFYA 4GVJA 2CKQA 2WXVA 5TE0A 1SVGA 1PYXA 4QMNA 3U6JA 4UWCA 2PE1A 5D1JA 4YJNA 4HYIA 4I41A 2G1TA 2XK9A 4HNIA 3VUKA 1XBCA 3VQHA 2HZ4A 3PJCA 4E73A 3P0MA 4QPAA 3VS1A 2PMNX 3EQGA 5BNJA 3NUAA 4QP3A 2WAJA 2PVHA 1Y6AA 4QD6A 4EOMA 4EQMA 2YDJA 2XJ1A 4FSZA 4XBRA 5AFVA 3D5VA 1UNHA 2GQGA 3EWHA 4J99A 3ORZA 3DKOA 1KSWA 3MFRA 3IECA 5EHYA 2KTYA 2HCKA 5J87A 4ALWA 2AUHA 4OTPA 2EB2A 2QLUA 4C4HA 5CEMA 2R3KA 3R9HA 3T8OA 2XKDA 3KXMA 4MEDA 5HG8A 1M2PA 1OB3A 4CFXA 2A0CX 3TG1A 2VO6A 4JQ8A 3QQUA 3C50A 4AZSA 2WMWA 1KV2A 4O91A 4C35A 3ZRLA 4FTCA 4C3PA 5JN2A 2PZPA 1K9AA 3DBQA 5JGDA 1LEZA 3KULB 3KN6A 3BLHA 4APPA 3MW1A 3OCTA 4U41A 4BFMA 5EM6A 4EKKA 5KKRC 3OHTA 4L42A 5EI2A 2ZVAA 4FL2A 3BGQA 1BUHA 2LAVA 2A19B 3WYXA 4FA2A 4YLKA 3AMBA 2WMTA 3V8SA 4Z7GA 3PXKA 1J91A 5M08A 2FYSA 5EYMA 3IDCA 1GAGA 2PTKA 1WBWA 3KULA 4BCMA 1Q4LA 3F3WA 4GK3A 2HYYA 3BZ3A 3UOJA 1M52A 1OIYA 4IM3A 5C03A 4P7EA 4A9RA 3C7QA 3LCOA 3O17A 1QPEA 2VN9A 3OW4A 3A4PA 4XBUA 2A2AA 3D2IA 3FMLA 3Q9ZA 3PVGA 2IVTA 3OBGA 5AP6A 5JRQA 4DFYA 2PMLX 1G8SA 3E93A 4ID7A 3LFSA 4NH1A 3RI1A 3LVPA 5KHWA 3ORIA 3LFEA 1SZMA 2XKEA 3ZO2A 1ZOGA 5BVNA 4BIBA 3HLLA 3IGOA 4EUTA 2BMCA 3VS7A 4XG6A 5IA0A 3N4UA 3NAYA 4XNEA 2ZV8A 5HCYA 3F3TA 5CEOA 5DNRA 2F7ZE 3TM0A 4MTAA 4E8AA 2ITOA 4X3JA 4D9TA 3A99A 4RIYB 2GNGA 4K77A 1CDKA 1XH6A 3DCVA 3UE4A 3FWQA 4JXFA 5BPYA 4R77A 4PL4A 4AGDA 4CMOA 4XV2A 4FK3A 4QQJA 2PULA 3CY2A 3E5AA 3M11A 2R7BA 4TYEA 2IO6A 4ANSA 4L9IA 2W06A 5AA9A 3BYUA 3C4CA 3A7HA 3Q9YA 2VTRA 3EQCA 4JL9A 3LFDA 3QQLA 3E8DA 3FMEA 5HBEA 3KCKA 4LQMA 5M53A 1P4OA 2VUWA 4Y8DA 2F4JA 4QYGA 3VF9A 3WZUA 4QQ5A 3Q5IA 4YPDA 2PY3A 4IFGA 4R1YA 3OS3A 4RJ6A 5BMSA 5EK7A 5FRIA 3DFAA 3HA6A 3V51A 1XH7A 5L6WL 4N6YA 3R7UA 5F9EA 1YXXA 2HELA 2X7OA 2QOLA 3UO4A 2F2UA 5AV3A 4GMYA 5CS6A 4D9UA 2I0VA 2XK7A 4UMQA 4ZTMA 2YITA 2X9EA 3NYVA 3VUDA 2G2FA 2ITTA 3DKGA 4QNAA 5JT2A 3QUDA 5CX9A 3ZDUA 2BHHA 2XNMA 2QC6A 4H36A 2RGPA 4G6OA 4OTRA 4GFMA 3R01A 2PUNA 4YZMA 5CY3A 1CTPE 2YISA 4LGGA 2I1MA 4L46A 4QYEA 3R7IA 4X2FA 4WBBB 3RPVA 4C3FA 5BVDA 5KMOA 3NLBA 1GY3A 1FGKA 1OMWA 3CC6A 1FOTA 3R7VA 3EKNA 4DT9A 4ZP5A 2EXMA 4D0XA 1F5QA 3LZBA 2JFMA 5EKOA 4R5YA 4S2ZA 3SXRA 3H0YA 3TNQB 2P55A 4YHFA 1OPJA 3ORKA 4FV5A 5CLPA 4TYJA 3IOKA 2X1NA 4E4NA 2UZWE 3H3CA 3MS9A 3MB6A 4O7NA 4ZY5A 4FVRA 4PMSA 4L52A 4UZDA 1UU7A 3HGKA 4K33A 4RIOA 3EH9A 1J7IA 3GCSA 3T9TA 4C4EA 3PXYA 5L8KA 4F99A 3R83A 2RG6A 5J95A 3NX8A 3FLYA 5DMZA 5M4CA 3LJ0A 4C7TA 5JFXA 1WFCA 2PE2A 3OW3A 4QMWA 3W2RA 5GNKA 3FJQE 3GXLA 1ZLTA 3COIA 3VRZA 1W0XC 3EL7A 4JIAA 2BAQA 3O50A 4D4YA 2QURA 1ZZLA 3MYGA 3VBWA 4Y5QA 4RG0A 3C0HA 3QRKA 2QCSA 4GK4A 4X3FC 2ONLA 3AG9A 2UZTA 1BKXA 3K2LA 3C5UA 4XRJA 4W9XA 3SHEA 3DQXA 1KOAA 3KMWA 1S9IA 2RFDA 4PL5A 4TYHA 3TZ8A 2UZEA 3BQCA 2JITA 5A4QA 2XKFA 3C1XA 2OJIA 3ZXTA 1SMHA 4BDJA 4FG8A 4II5A 2JGZA 3DKCA 3ACJA 4PP7A 1ZYCA 3HRFA 2YM4A 1UU8A 4IJPA 2UZBA 3H30A 5M4IA 4FIEA 2FUMA 3MB7A 4HJOA 2GMXA 1AD5A 2W5AA 4IH8A 3L9LA 4GSBA 4XUFA 5ETFA 4AZFA 4CEGA 4D28A 4LUEA 2WNTA 1JOWB 3PVBA 4AE9A 1L8TA 2JIVA 2UZDA 2Q0NA 1ATPE 1YDTE 5CI7A 4CYJA 3PZEA 1JSVA 3QUPA 2JBPA 3DJ7A 4ZSAA 4D0WA 2J2IB 4MXAA 3SA0A 1PY5A 1OIRA 3BBWA 3GQLA 4OLIA 5I3OA 3IW5A 3IW4A 2X0GA 1URWA 1ZYJA 3NRMA 4I5PA 5CEQA 1OIUA 3DAJA 5JSMA 2OF2A 5JGAA 2R3HA 4C8BA 5AR3A 4G34A 4FIIA 4FV8A 4E6DA 5IQFA 3JY9A 2JDSA 4GUBA 4RZVA 3UZRA 3QA0A 5DHJA 4IB1A 4YUQA 5FXSA 3I0OA 3SG8A 4F9AA 4YTIA 4Q5HA 1VJYA 4MKCA 3FHIA 3P7AA 5C8MA 2WU6A 1NVQA 4QQTA 4XP3A 2YJRA 4CQGA 2CMWA 3M2WA 3QRTA 4KIKB 4BHZA 1VYWA 4IEBA 4F09A 4PNIA 5GJGA 4ZY6A 5T68A 3KVXA 3BWFA 2R3NA 4C2WA 5FXQA 5K0XA 3U55A 3NPCA 4A06A 4EH6A 2VWZA 2EXCX 3ZUVA 4RX8A 1KE6A 3UO5A 4RZWA 5EM8A 2J50A 2V5QA 3OVVA 2IW9A 4RQVA 4TN6A 3CGFA 3EN6A 3MPMA 4IE9A 5HE1A 3TNIA 5KMJA 3ZO1A 1K2PA 1O6KA 3AQVA 4ZEGA 4OT5A 2IZRA 2OSCA 2VV9A 4LV8A 4S32A 3V5QA 4O82A 1GIJA 1JQHA 4XLIA 2BAJA 2R3FA 3DS6A 3MH1A 5IPJA 4HNFA 2F49A 4O1PA 3C4ZA 3F3VA 4DN5A 5ANIA 2X4ZA 5HEZA 3ZONA 4F0FA 3DQWA 4FKOA 3UVQA 3KK8A 3LFAA 3R7GA 3NCZA 4GVAA 4EBWA 2ITYA 3Q53A 5F94A 4HGLA 1K3AA 2V7OA 1GOLA 3HVCA 4YP8A 1H1RA 3CKXA 3W1FA 1BL6A 3KXZA 4O27B 4D2TA 2C6IA 4Q5EA 4R7IA 2R64A 2RSVA 4KUJA 5EOLA 3R7EA 3HMMA 2XA4A 3ZMMA 3QYZA 3R71A 2XBAA 3FL5A 4YO6A 4BCNA 3OMVA 4CV8A 1XQZA 3NSZA 4HOKA 5GZAA 5IISA 4XS2A 2QG5A 3UIBA 4C62A 4GUEA 2R9SA 1F0QA 4FT0A 5K4IA 3LMIA 5DN3A 4F08A 4DH5A 4HVSA 4DEIA 3TXOA 3GOKA 3KRXA 3C0GA 2J0JA 4UMRA 2IW8A 4Z7HA 1WVXA 3ACKA 1YDSE 3V5TA 5TF9A 2B55A 3QHWA 2WTVA 3IW7A 4FEQA 3KCFA 2XIKA 3L1SA 3LCKA 3ZO4A 4ANQA 4AX8A 5M56A 4BKYA 4W8EA 2G15A 4HCUA 5AV2A 1FVVA 5J5SA 2EVAA 3NIEA 4KBCA 2WEIA 3KL8A 5EYKA 2ZDTA 4JDHA 4NM5A 1I09A 5IH4A 5IUHA 4ANNA 3I79A 3KK9A 3KRWA 3COHA 3PY1A 4YSJA 4R78A 1TQIA 1GIHA 1H1WA 4EZ5A 4ZS4A 4O86A 4RBLA 4C34A 4J96A 5M55A 4R3RA 3CIKA 3V01A 3C0IA 1PKDA 4DBXA 2QNJA 1QCFA 5LCJA 2B9IA 4F6WA 3U6HA 3FUPA 4QOXA 1U5QA 5IF1A 4WIHA 3UBDA 2QQ7A 2R3LA 5FEQA 2GFCA 3ZRMA 1ZYSA 4AW5A 3RPSA 5K5NA 2Z7RA 4O0SA 2ZMCA 2FB8A 4FKTA 4AW2A 4NM3A 2ITUA 4XH6A 4BRXA 4ZJVA 2BZJA 1JWHA 3MH0A 3UZPA 4WG4A 1RW8A 4GV1A 4G3CA 4HGEA 4OTIA 4YC3A 4HVGA 4IAZA 4J7BA 3IDPA 2UVYA 5TT7A 4M67A 3TUCA 1A06A 3D5WA 5AP3A 4HCVA 1BYGA 2BRNA 4NYEA 1JKKA 3JPVA 4X2NA 4CT2A 4JS8A 3SVVA 3UIXA 4C57A 4FNZA 5ACBC 1HOWA 3FLZA 5FEDA 2GFSA 5LMBA 4LUDA 1Q99A 4ACCA 2XK8A 3SRVA 5JQ8A 1YOMA 5DRDA 3TKIA 2VX1A 1H27A 3PSCA 3QALE 5FTGA 2PMOX 5AUYA 4EK5A 3QZHA 3EN4A 3LMHA 5D12A 3UP7A 4U44A 3FLWA 2XYUA 2GHLA 3K3JA 4X7QA 5AR2A 3VBYA 4IB5A 3ZH8A 3GCPA 1J1BA 3FZPA 3TNWA 2LGCA 5CASA 4ZLZA 2W17A 4BN1A 2EXEA 3SD0A 2BRHA 5EW3A 2CKOA 3OEFX 4KNBA 5L8JA 4QMLA 3AGMA 5AWMA 2XCHA 4IFCA 4U79A 3U4UA 4ALUA 5IEXA 1SM2A 4RWLA 4EOKA 4RIWA 4J8MA 3UMXA 4PP9A 4PTCA 1OL1A 5AM7A 4EOPA 2J0IA 2WTKC 3CSVA 1OKWA 4IZ7A 2XMYA 5AIKA 3CPCA 4GRBA 3KMUA 4WRGA 3CJFA 1PXMA 5T3QA 2B0QA 3AGLA 4ANBA 5C8KA 5KUPA 3ZOSA 4NTTA 3R28A 4FTMA 2IVSA 3A8XA 3PJ1A 5CU4A 1OZ1A 3QTZA 2YJSA 4WUAA 4ANLA 2OICA 2JFLA 2WQBA 3QGWA 3K54A 2WQNA 4Q9SA 4JQ7A 3GFEA 2XZSA 3OBJA 2UUEA 2HAKA 4QMUA 2XIRA 4GH2A 3BV3A 3SXSA 4AN9A 4C4GA 2YHVA 3EL8A 4L7FA 3CJGA 1VR2A 4EYJA 2E2BA 3FAAA 4WRSA 2XKCA 1O9UA 4NIFA 5BYZA 4FKWA 4CKIA 4O38A 3RAHA 4IWPA 1W84A 3PTGA 2PU8A 1LEWA 3EQHA 5ITAA 3HMNA 4KS7A 4L8MA 3MPAA 4AG8A 5IEVA 3KEXA 2B9JA 3ENHA 4B99A 4DINA 5ANEA 4LG4A 3QL8A 5C1QB 4B9DA 4DEBA 3CR0A 4NEUA 2GS6A 2VTQA 3Q4TA 1XR1A 3LCDA 5TR6A 5A4TA 5CAQA 3Q5ZA 3HV4A 4KSQA 4L00A 4O0UA 1XHAA 3D5UA 4KRDA 3PY0A 2VNYA 3EQDA 3ORPA 3KRLA 5GJFA 5EKNA 3SX9A 4BBMA 5JFVA 2C5YA 3F5PA 4I93A 4D2WA 3SW7A 3VS4A 3F5GA 3OTVA 3MWUA 1Q62A 2FH9A 4O7LA 4AW0A 4CVAA 4ONAA 5LMKC 1IASA 3FBVA 2JDVA 2BIKB 4FTLA 3KMMA 5M4FA 3L9MA 3ZCLA 3NR9A 3C4WA 2X8EA 4O81A 4TNBA 4P4CA 3W18A 3GI3A 3FKNA 4K9YA 3QQKA 3QCYA 3R02A 5IDNA 3G0EA 3BE9A 5FQDC 2XEZA 5HHWA 4PMPA 4JLCA 3EKKA 2ZV2A 2YM5A 3C4EA 3AOXA 1M7NA 3GB2A 5H9BA 5HE0A 4UEUA 1JBPE 4K11A 3CCNA 5IQEA 2WTIA 2ERKA 4PV0A 1BI8A 2WIHA 2C68A 3FPMA 3G2FA 4FKUA 5ETIA 2C3KA 2I0HA 4C3RA 2BRGA 5AP4A 3TIYA 4H3BA 3D2KA 1Y8YA 4YLLA 2XNBA 4JOAA 2BTRA 5CEKA 5LWMA 5L2SA 2BKZA 5J7BA 2HZNA 3QQGA 3U8WA 3DA6A 2O0UA 3OXTA 3DJ6A 1WBOA 3MA3A 4V0GA 3R8ZA 4BZNA 4DH3A 3ET7A 3FXXA 3U6IA 3EOCA 4QYYA 3MBLA 5BVFA 4OAVB 2HY0A 3SOAA 2YFXA 4S30A 5JZNA 3D83A 4DF3A 3G0FA 1OKZA 5EOBA 2O63A 3V8WA 3ZYAA 3DBEA 3B2WA 3W2CA 4GT4A 4CFNA 5KMKA 1PXPA 4FTAA 3GEQA 3RCDA 4JBPA 4Z9LA 2CKPA 3MESA 5DOSA 4O84A 3VUGA 4Y95A 3IS5A 5A9UA 4FC0A 2WMUA 4UXLA 2C3IB 5E4HA 2C5NA 5I9WA 3R0TA 4FIJA 1M14A 3UQFA 5HIEA 2NRYA 4UWYA 4S33A 2WMRA 3BYSA 5BVEA 4MQ1A 3TACA 4ASEA 4RLKA 3AD4A 3UPZA 4ZTLA 3OTUA 3QTXA 2PZYA 2OJ9A 3MPTA 3HECA 2PVJA 3UPXA 4DEAA 4R5SA 3ULZA 2QHNA 1P2AA 1YWRA 5FUTA 3LXPA 4FODA 2VTNA 4LM5A 2CGXA 3WI6A 1ZRZA 1PXJA 2PVLA 4MXXA 1ZARA 3SAYA 4QMMA 3H0ZA 4W4WA 5E8SA 4KABA 2A1AB 3HV6A 3R73A 4FL3A 4D1SA 3DTWA 2VTOA 4AN2A 3R7YA 2X2LA 1J3HA 3IQ7A 4XHKB 4QNYA 2J7TA 2QOQA 3ZBFA 5IQGA 2G2IA 4QTAA 3A4OX 5DWRA 3DAEA 4OBPA 2GDOA 3DK3A 1U54B 3UC3A 5AAFA 3OXZA 5I9VA 3I81A 5CI6A 4Z3VA 4PRJA 3QX4A 2F2CB 1BMKA 3D14A 3Q96A 4RLLA 2YZLA 2XP2A 4TPTA 4DA5A 2AYPA 3RZFA 4CKRA 4TWCA 4D4RA 4ORKA 4YR8A 1UKIA 2VWXA 4H1JA 3TV4A 1GNGA 5C26A 3R63A 2P2HA 1U54A 3FZTA 2OK1A 3ZSGA 3D5XA 4JNWA 1Q8TA 2E9UA 3GVUA 4ARKA 4WSYA 4WG5A 3TIZA 4E5BA 4C36A 4FSYA 4J71A 5HIDA 3R22A 3GT8A 4AZVA 2HW6A 4TKSA 4EH3A 3AMYA 2CGUA 4GS6A 2X2MA 1OITA 2W1HA 4TYIA 4BCQA 3E87A 4I94A 5CT0A 3WE8A 3S95A 2VTAA 3ERKA 4EWHA 2OG8A 2QO2A 3MFSA 4OTFA 5IA3A 3UZTA 1XH9A 3GNIB 3HP2A 4FGRA 4A9UA 3TCPA 4E3CA 1JKSA 4O7TA 2HIWA 3QCSA 4G16A 4W8DA 5H2UA 3TKHA 4AT5A 1CKIA 2WIPA 1ZOHA 4AXAA 4D2VA 5HTIA 3AMAA 5DR9A 5HGIA 2PHKA 5JEBA 4BCGA 1FGIA 5EI8A 3QC9A 3CLYA 1MUOA 4OW8A 3HA8A 3EYGA 3FXWA 3PSDA 4A07A 3E3BX 2GS2A 2QKRA 5AR5A 5DG5A 1WVWA 3QD3A 4DTAA 2I40A 4FTKA 3FXZA 1IRKA 2IZUA 4AOTA 2UVZA 4CLJA 5GIPE 4ERWA 2OIDA 4M7IA 3AC5A 4ITHA 3LJ2A 4BI0A 2W1GA 3VBTA 1FQ1B 3FMJA 4IAAA 5ANJA 3RALA 4OTQA 4O7WA 4JG7A 4OTHA 4QP2A 2B7AA 2WGJA 3BHVA 3CTJA 2JDOA 5DH3A 3VF8A 1R39A 4CYIA 4FZ6A 4KWPA 1IA8A 1JNKA 1G5SA 4APCA 3S0OA 4MNEB 1YWVA 4F6UA 2QKWB 2GS7A 2R3JA 3UG2A 2Y4IC 1A48A 5AP5A 3WZJA 4G9CA 4LFIA 5BUEA 4YBJA 4AU8A 3PPKA 3PWYA 5DGZA 1FMOE 5CU0A 2JKQA 3KF4A 3QQHA 4ASXA 4DITA 2PSQA 3NW5A 4QMSA 4D2SA 3NYNA 5A4LA 3QTWA 1O6LA 4UWBA 2E9PA 2WB8A 4AOJA 3VS0A 5L2IA 3VS2A 2UW3A 4IANA 4MNEA 2GCDA 4UB7A 4C61A 5H8GA 4CGAA 3RAKA 4EHZA 3JVRA 4C0TA 4CXAA 4EH9A 2YIQA 4L3JA 1H25A 3O23A 3GC8A 3UMWA 2XNPA 1L3RE 1OPKA 3F6XA 5EI6A 3WYYA 5K0KA 5HCZA 5BUJA 2C6KA 4RX7A 4JIKA 4IMYA 4ITIA 2QU6A 3H10A 5HD7A 3PA4A 5FBNC 4Z16A 3SKCA 5CSVA 2C1AA 1NXKA 2OFUA 2WELA 2XRUA 5L2QA 3FC1X 4RMZA 3W8LA 2C5VA 4MXZA 4GIIA 4FV9A 4M84A 5HBJA 1QMZA 3WF8A 4PTEA 3JS2A 3QBNA 4MK0A 2XJ2A 4ZAUA 3ZM9A 2W0JA 4DLJA 4F65A 3G33A 5LVOA 5CWZA 3BV2A 5IUIA 4ZY4A 3ODZX 5F4NA 2OZAB 2UVXA 5JFWA 4TNDA 3DAKA 2XRWA 4PPAA 4EOJA 3R21A 3U51A 4RIYA 1Q61A 3NGAA 4W9WA 3OWKA 3PZHA 5IMXA 4YZNA 2W4OA 3ULIA 3LE6A 3JYAA 4EJNA 4DHFA 4CTBA 3FI4A 2JIIA 4IW0A 1BLXA 2X7FA 4EK6A 4RVTA 3UNZA 3IPHA 4ZMEA 5G6VA 3ANQA 4IVDA 4TYGA 4W4VA 2X39A 3CY3A 3S4QA 4AZWA 4YO4A 2UV2A 1YHSA 5F95A 3BX5A 3K5UA 4FTJA 1OIQA 3QUEA 4I6HA 4GG7A 4YLJA 4AN3A 4ZK5A 4DFLA 5M51A 4BKZA 2PVNA 3IDBA 2JDTA 4KSPA 2WMAA 5FDPA 3FDNA 3V8TA 2V62A 5IQAA 5FTOA 4AQCA 5CAPA 1R3CA 3COKA 2A4LA 2GTNA 3OROA 5DRBA 5CQWA 4XG4A 3KF7A 4IC8A 5AP1A 3H9OA 4ZIMA 4M69B 2HENA 5CF5A 3FQEA 3TTJA 4DAWA 2BRMA 4BBEA 3S1HA 1NVSA 1G8AA 2W9FB 3O51A 5CF8A 4D58A 4M15A 1V0PA 5A4CA 5GIOE 3O7LD 2J0KA 4CZTA 2ITXA 5DYJA 2VGOA 4M13A 3DLSA 2IVUA 5CNOA 5E7RA 5ANOA 3VJNA 3R6XA 2Z7LA 3TKUA 4BIEA 3FMNA 3QA8A 1FPUA 3OY3A 3HRCA 1YOJA 1PMNA 4E26A 3GCVA 3AC1A 2WMBA 4YZBA 2YWVA 1RDQE 2VTSA 3O8UA 3V6SA 3F7ZA 5AX9A 2YZAA 1Q8UA 4RJ5A 2IG7A 3D94A 4FSTA 4XRLA 3F69A 4FIFA 4AS0A 5TOZA 4JX7A 2V22A 4FTUA 4X2JA 4EC8A 4BGQA 4FGBA 2YACA 5KKRB 3MTFA 3RNYA 2GQSA 3LXLA 3E88A 4MH7A 4N0SA 3FYKX 4BTKA 2BPMA 2WHBA 2B9HA 4GCJA 5DT3A 4FZAB 4DCEA 4BVUA 3EN9A 4JDJA 3EQPA 3HYHA 4O0TA 5IZFA 3N4TA 3RGFA 5E8UA 2R3IA 3O7LB 5CU2A 3ID6C 5AADA 3WF7A 4DGOA 5EQPA 2GNLA 4EH8A 2OH4A 2ZM4A 3LM0A 2AC5A 2OF4A 3E64A 3FZ1A 3N9XA 3WF9A 3EIDA 4E6CA 3LM5A 4NW5A 5IU2A 4FSRA 3RVGA 2JAMA 2UZUE 1G3NA 3GU4A 3QTIA 4YJPA 3A7FA 4DGMA 4CKJA 3F3ZA 4FICA 4MF1A 2OO8X 3LLTA 4RWKA 5IG1A 2BFYA 2QO7A 3PXQA 4NWMA 4YSMA 2C4GA 4DG3E 1IA9A 4NL0A 4QMTA 5HICA 4NT4A 4ITJA 4RGJA 4BR3A 3ZSHA 5JH6A 2WTWA 3EFKA 3ITZA 3Q2JA 3DDQA 3VUMA 2ZV7A 4Y72A 2YAAA 4CMUA 4E93A 5LOHA 2GHMA 4X0MA 2Q83A 2GPHA 1PXOA 4M3QA 3TNHA 3ZSIA 5I3RA 3R1NA 4XP2A 4FKLA 1ZMUA 2IJMA 2YABA 4BCOA 5KCVA 3TV6A 3FMKA 3MVLA 4NZWB 2R7IA 4YGAA 5IA4A 2OH0E 3BI6A 3TZ7A 4AAAA 1R0EA 4AA0A 5EQEA 5D7VA 2JLDA 2UW4A 2C3LA 3JY0A 1J1CA 4KD1A 4GT3A 5LVNA 2O2UA 3DBDA 4FF8A 2JBOA 3F9NA 1PJKA 2C6OA 5AIRA 3MN3A 3BWJA 4XP0A 2W4JA 2EWAA 3VBVA 2HWOA 2IVVA 3RK5A 4BCPA 4XG8A 4YJQA 3QD2B 4C38A 3IGGA 4KB8A 3ZBXA 4U5JA 2OWBA 3Q32A 5D10A 4USDA 4MBIA 5I9UA 2XB7A 4JDKA 1HCLA 5HO8A 4NSTA 3LFNA 2RFEA 2P2IA 4FE2A 2QOFA 4IQ6A 2OJFE 4G6NA 2UW9A 5D9HA 2PE0A 1CKJA 2P0CA 1Q24A 3HV3A 3MFTA 4QTCA 5DEYA 4RVLA 1CMKE 4KKEA 3E62A 3PFQA 5DE2A 5ETAA 5GJDA 3Q4UA 5AV4A 4MD9E 3SXFA 2DS1A 4EOSA 2QOCA 3AC3A 3DOGA 4UMUA 4AACA 3CEKA 2FSMX 4I5HA 2Y6OA 2X8DA 4D4VA 2XM9A 5TKDA 5CVFA 4KIKA 3VULA 2NPQA 4JT3A 3VUTA 1M2RA 4M12A 4M68A 2RG5A 2ESMA 5J9ZA 3QTSA 4IWDA 5AM6A 3DU8A 4FTRA 4HCTA 3UJGA 3A7IA 4XG7A 4J1RA 1YRPA 3PLSA 4FEVA 5AUTA 4K2RA 5KX8A 1KE9A 2C6EA 4AE6A 3FPQA 3F5UA 3ZLSA 3ZTXA 5IQHA 4MXYA 2C47A 3RZBA 4ZJIA 3UQGA 5EW9A 4ACHA 3I6UA 3GQIA 1NVRA 4H1MA 1B39A 1Q41A 1ZWSA 2OIQA 3E3PA 4C4FA 5BUIA 4FVQA 3QWKA 1RJBA 3AXWA 2HXLA 2QODA 1YI6A 1OM1A 3ANRA 3PVWA 5AR4A 3C4FA 3RTPA 1XH5A 2ITPA 2A27A 2ZOQA 3Q52A 4FYOA 5JRSA 3RM7A 5I9YA 4R7HA 2WEVA 4TRLA 3LIJA 5LVPA 5CF4A 3POOA 5JZJA 4BYJA 5AR7A 2PVKA 2J5EA 3KRJA 3DV3A 3S3IA 4X3FB 3I0QA 4X2KA 3KY2A 3GC7A 3TEIA 4I6BA 5CZHA 4UZHA 2FVDA 3R1SA 5FXRA 1PHKA 4QP8A 5IH6A 5G1XA 5HVYA 5BVOA 3ZUUA 3MY0A 1H1PA 4XOZA 3FL4A 4LL0A 3SQQA 5D7AA 4CCUA 1J7LA 4O7VA 3VUHA 4L44A 3W55A 2QONA 5DT0A 4AW1A 5CSPA 3UP2A 5IUGA 2OW3A 4EOIA 2W9ZB 3VBQA 4CG9A 2YDIA 5IQIA 2ITNA 3G9LX 4I6QA 3P7CA 2XNNA 4AP7A 2R3OA 2QI8A 4EK3A 5HQ0A 3NMUF 4BHNA 3O8PA 2PZIA 1M17A 5CU3A 2JDRA 5FD2A 3DKFA 4F9CA 5LWNA 3EQFA 3KA0A 4DEGA 3F88A 2PVRA 2RF9A 2CNVA 2P3GX 1R0PA 5AA8A 1OVEA 2ZB1A 4YNOA 2XEYA 3I6WA 2UZNA 2H8HA 2PYWA 4CNHA 4CZUA 5ACKA 5AP7A 4DT8A 4FKQA 5KHXA 2VX0A 3EFLA 2C0OA 4K1BA 1ZY4A 3MGYA 3GBZA 3BQRA 5HVJA 4Y85A 4DEEA 4RWJA 3PUPA 3ROCA 3RWQA 4DC2A 4GKHA 3OT3A 4RVMA 5CXHA 3OUNB 3Q60A 4EQCA 5A6OA 3R2YA 3BHUA 5CSHA 2YM3A 2OLCA 1OL7A 1Q8ZA 2QR8A 5HBHA 1YKRA 1WCCA 5M44A 4ZSGA 3M42A 3IKAA 3KXHA 1TQPA 3WF6A 2W1FA 4RVKA 4I22A 2NNWB 3P23A 1FVTA 4QP9A 1MRVA 2B52A 3FLQA 3G6HA 1ZOEA 3BGPA 4I0TA 3KRRA 4KS8A 2OKRA 4UY9A 4IX5A 1W7HA 2H6DA 2UW5A 3E92A 3OY1A 3TUDA 4F7NA 4KKGA 4LYNA 5B2LA 4PTGA 3V6RA 1Q3WA 2UZOA 4FKJA 1H08A 4DG2E 3NVMB 1YWNA 2FSLX 3F82A 3BLQA 4BDIA 4EORA 2YDKA 4ZTHA 3QC4A 4JDIA 5HZNA 4FTIA 3R8PA 3PXRA 4F1TA 3C4XA 3COMA 4UYAA 4U6RA 4UXQA 2JAVA 2ZMDA 1H00A 3RK9A 3P79A 5HCXA 3FLSA 4IX3A 4WBOA 1Q8WA 2E9NA 2YWPA 2ITWA 3IK3A 4PDSA 4EJ7A 3QXOA 3OFMA 2GU8A 3PJ3A 3QZFA 1OUKA 4IZ5A 5D11A 5HD4A 4ZMFA 4RJ7A 1APME 1HCKA 2XJ0A 3OUKA 4WNPA 4ACMA 4D2RA 4EOQA 3OOGA 1KE7A 1KWPA 3IOPA 2C6LA 2OU7A 2R3GA 5CEIA 4C2VA 5HX6A 3HEGA 1NW1A 3FEGA 3P86A 4ZOGA 5FEEA 1DI8A 4AGCA 3LMGA 3OEZA 5ANKA 3I7CA 4JRVA 2VO0A 4R3CA 5GZ9A 3UVPA 3OP5A 4QTBA 3QQFA 5IQDA 2CHLA 2O5KA 2BFXA 2VWYA 4WNMA 4EH2A 5M4UA 5AMNA 2VWBA 5HG5A 3FI3A 2Y4PA 4F9WA 4ANMA 5JK3A 3D0EA 3KC3A 4QMPA 2Z7SA 2CDZA 4NK9A 3KU2A 5AUVA 5CSXA 2ZAZA 4HPTE 3RHKA 4IDTA 4FEWA 3G5DA 4EZ3A 4RFMA 4XG3A 4RA4A 3LW0A 4F7JA 3ZLYA 2RFNA 3DGKA 3A2CA 4V04A 2OXDA 4WD5A 2ZM1A 2W4KA 3LXKA 4W4YA 3LLAA 2XYNA 3FKOA 2BAKA 4TXCA 3TTIA 1Q5KA 1A9UA 4L68A 4LV5A 3E7VA 5K5XA 4D5HA 3P5KA 3ZLWA 4XLVA 4YPSA 3ZHPC 4EEVA 4U9AA 3UYSA 2Z02A 4PMTA 2XNOA 2Y8OA 3FZRA 3QCQA 5LJJA 2EB3A 4WG3A 3DT1A 3DBFA 4IVAA 5FLFA 4V05A 2HK5A 4DEHA 4BDEA 2BDWA 3OCGA 4UBAA 4Q9ZA 3PPZA 3HMPA 4I21A 5J5TA 4YHJA 4QMQA 4B8LA 4NM7A 3QLGA 4BDKA 2OIBA 2PL0A 3DBCA 4O21A 2DUVA 4J98A 5DR2A 5E91A 1UVRA 3PP1A 4O22A 4PF4A 4ZLYA 2QOKA 2VD5A 4BZOA 4WNOA 4BGGA 3BKBA 2GSFA 4L7SA 3W8QA 3PRFA 1LPUA 1JKLA 2C6DA 2XCKA 1UWHA 3PRIA 4U3ZA 3P4KA 4EK8A 1JPAA 5B7VA 2XK3A 5AUWA 2OZOA 2OBJA 4CFWA 4KKHA 3E8EA 4IX4A 4MWIA 1E1VA 1MQBA 3ZS5A 3PXZA 3WARA 4R6VA 4ZZMA 5KMMA 4BTJA 2VNWA 4I23A 1OKVA 3HMOA 3L8XA 4MVFA 1URCA 4D55A 4FR4A 3QD0A 4YC6A 1FVRA 5EM5A 4A9YA 2PVYA 3CQUA 3QKKA 1Z9XA 4L67A 5C4LA 2V0DA 3UODA 4CRSA 2BRBA 4FTOA 3W32A 4YZ9A 5A54A 3RWPA 1UU3A 4DH1A 1PKGA 2X4FA 4JBOA 3SDJA 3VJOA 2I7QA 1H24A 2C6MA 4LRJA 3HZTA 5CNNA 4E7WA 2UW6A 1H0VA 2GNHA 4FKRA 3MV5A 5I9ZA 3OCSA 2BCJA 3QQJA 4NJ3A 2X2KA 2WMVA 2C3JA 3GENA 4ZTQA 4JAIA 3MJ1A 4A4XA 3BCEA 4FV3A 4LMNA 4A7CA 4KIQA 4HPUE 3MTLA 3D9VA 4NKSA 1XH4A 4F7LA 4FT7A 4U42A 3DLZA 1U59A 3KGAA 1QPDA 3VVHA 4YJTA 2PUUA 3F5XA 4LOPA 5LVLA 2Z7QA 3V04A 2WD1A 3QXPA 4KIPA 4OBOA 2CGWA 2YM8A 5HNGA 4JR3A 2ZYBA 4YJUA 3QGYA 3L8SA 5DI1A 3RINA 4FG9A 5E8TA 3QTUA 4FV6A 3BPRA 4BGHA 2J51A 4BWKA 1M2QA 5DBXA 4DLIA 4ZJJA 5T6KA 4O7ZA 1YQJA 1XKKA 4XOYA 2H9VA 4R8QA 4FSWA 4PPCA 2YIRA 4YJSA 3R8VA 3AC4A 4K0YA 5HNBA 2WTKB 4X21A 3WF5A 5AP0A 5HE3A 3OWLA 4OUCA 4TY1A 4DTKA 4U43A 5HKMA 2R3PA 4U80A 5DFPA 2IPXA 2ETMA 4F1MA 3VW8A 4S31A 3PY3A 4YNEA 5AUZA 3Q4CA 3IW8A 4BDBA 4D1XA 3FMMA 3UDBA 4AZEA 3PG3A 4GIHA 2XNEA 3K5VA 3PSBA 2QVSE 5EHOA 2QOHA 4Y5HA 2J90A 5CTPA 4FKPA 4O7SA 4U97A 2REIA 3BE2A 3G90X 4FSQA 3CD3A 4RIXB 4YBKA 5AUXA 3VN9A 4BDHA 3VO3A 2YEXA 4OT6A 4F9BA 4O0YA 3RBWA 3GU6A 1U5RA 4BICA 2VTPA 3HV5A 3ZZWA 4E20A 2F7EE 3A8WA 5E8XA 2XIYA 3V3VA 2WMQA 2WMXA 5IQBA 3UC4A 1CM8A 1ZYDA 3PYYA 5JMSA 3PDTA 4XG2A 3LQ8A 4UMTA 1FBNA 4CG8A 3NNVA 2DQ7X 3ZUTA 2VTTA 2P33A 2W1CA 4F64A 3TDVA 2CPKE 3KN5A 3HUCA 4BYIA 2VTHA 5CANA 2X6DA 4QP6A 1GZNA 1Q3DA 3KREA 3NCGA 2CKEA 2UW8A 5AUUA 2VZ6A 4B6LA 3P1AA 4OR5A 4XYFA 2H34A 4IWQA 4RX5A 2CNQA 4X2GA 5JQ5A 1H4LA 4BZDA 3R9OA 5LXMA 2YCRA 3I60A 4FSNA 4NJDA 1TKIA 3EN7A 4U7ZA 5CU6A 5DEWA 5EDPA 3RHXA 3I4BA 4MXOA 3VNTA 4AF3A 2PMIA 3NUPA 5BVKA 3RP9A 4FT3A 2W1EA 3WZEA 4F7SA 4WKQA 3R04A 5FDXA 3MSSA 4A4OA 3LAUA 2OXYA 2C5XA 4PDPA 2FA2A 4RPVA 2C69A 3THBA 2IZTA 2X9FA 1ZXEA 1KV1A 4YTFA 4GYGA 1W8CA 1XH8A 5HLNA 3WZKA 4KA3A 4CD0A 4EYMA 5IH5A 1YXTA 3NW7A 4KIOA 4XV9A 3OC1A 4YURA 2HOGA 4G31A 1B38A 1ZYLA 1Q97A 2W1ZA 5CVHA 1NY3A 3QTQA 4I1ZA 3FY2A 5LQFA 4HYUA 2W99B 3HDMA 2XIXA 3VUIA 4G5JA 3UG1A 5GINE 4DH8A 1GZKA 3DDPA 4N6ZA 4J97A 4M0ZA 4Z55A 4PX6A 4F0IA 2IZSA 5A4EA 4FKIA 1SNXA 4BF2A 3FE3A 1E9HA 3HKOA 4HZSA 3U4WA 4BDGA 3HAMA 2PVFA 2X81A 4MNFA 1XBBA 3BIZA 4FZFB 5J8IA 4CTCA 3RCJA 2VGPA
chains in the Genus database with same CATH superfamily
1PF8A 2XK6A 2C5OA 1U4DA 2YCQA 3BYMA 5HESA 2FSOX 4WA9A 3C13A 1UU9A 4YZDA 2JKKA 3CTHA 4YTCA 3I7BA 3E63A 5A6NA 3MFUA 2NRUA 4QRCA 4O7YA 1H1QA 3ZLXA 3L9NA 4UALA 4MWHA 3LXNA 2YCFA 3DPKA 3E8NA 2PZRA 4RC3A 4RC4A 1OECA 3RK7A 3T9IA 4BDCA 2XUUA 3QCXA 4BWXA 2KULA 3GCUA 4D2PA 4QT1A 3AC2A 5FBOA 4AA4A 2H96A 5A14A 3TV7A 4UN0C 4RT7A 5LMAA 4M97A 3QRIA 5K4JA 4JBQA 4NCTA 5C4KA 4GL9A 5DLSA 5H8BA 2CJMA 2YM6A 3CS9A 2CSNA 1OBDA 4C58A 1YHVA 3R9DA 4RJ4A 3U87A 4BCFA 3CP9A 1Z57A 2WTDA 3QU0A 4PUZA 1Z5MA 3B8RA 3PA5A 3EJ1A 1OL2A 1I44A 4WSQA 3RAWA 4BKJA 2PUPA 3KXNA 2BZIB 4ZZOA 2RKUA 4H3QA 2ZB0A 1YOLA 4CFUA 2VU3A 4LI5A 3W0OA 1ZAOA 2ONLC 1Y91A 1JLUE 4ZSEA 3FQHA 1BI7A 2JKOA 5AV1A 4J95A 1SYKA 4YJOA 4JG8A 4RQKA 3Q2MA 5JGBA 3NNXA 5BYYA 1IR3A 3R30A 2XIZA 4MQ2A 2NO3A 5B2KA 2X0PA 1STCE 2OJJA 5M57A 4G3DA 3TUBA 4PMMA 3P7BA 4MF0A 4B8MA 4DTBA 4O4EA 4OTDA 5KZ0A 3AC8A 3C51A 2OXXA 5E9EA 3LFBA 2YCSA 4F70A 2XF0A 4IB0A 3LQ3A 4K6ZA 4IAYA 4LOOA 4EUUA 3HV7A 3PIYA 3KQ7A 2Y0AA 4IM2A 3OD6X 2YM7A 2OFVA 3KVWA 4ZTNA 4DH7A 2PPQA 4ASDA 3OZ6A 2GNJA 2Q0BA 2R3MA 3MVJA 3QF9A 2BKKA 5L3AA 3LKMA 5CXZA 2ACXA 3H9RA 5IDPA 3BL7A 3EMGA 3ZC6A 4ZZNA 1W98A 3OXIA 4U0IA 4FT5A 3OF0A 1BX6A 4E6QA 4FSMA 3MI9A 1WMKA 4XMOA 1GJOA 4ZS0A 3ALOA 4P2KA 3JXWA 4ACDA 1YDRE 5FWKK 3BU6A 1V0OA 4CQEA 2IN6A 2F7XE 4OAUC 1YHWA 1H8FA 4FKVA 3UO6A 4GKIA 3A7JA 2Z8CA 3C9WA 2IWIA 4DFUA 3VRYA 2WMSA 2OZAA 2UW0A 4G5PA 4JVGA 1YXSA 4IAKA 5DA3A 4DDIA 4J8NA 2ETRA 1WBSA 5FTQA 1Y6BA 2VWWA 2B9FA 4FOBA 2QOBA 1OBGA 2Z60A 2PZ5A 4E4XA 2YIXA 4JJRA 4NM0A 4CZYB 4U8ZA 4GK2A 3Q9XA 4WHZA 3NFFB 3JR1A 2UW7A 3R8UA 3W10A 3NNWA 2W1IA 3R1YA 4FTQA 4DGNA 4QP7A 3DB6A 2GNFA 4BDDA 4I0SA 4MBLA 4O2ZA 5CF6A 5J79A 1YXVA 4FSUA 5KE0A 3DTCA 3O71A 1EH4A 2QOOA 4BBFA 3H9FA 3PLAE 5LARA 3BYOA 4QYFA 1J7UA 3FSKA 1P5EA 3B8QA 4M8TA 5CZIA 1Y57A 2X6EA 2XK4A 5I0BA 5J9LA 4TTHB 3ATTA 3SG9A 2VTIA 2AC3A 3AT3A 4FV4A 4YJVA 3R9RA 3DFCB 3W0SA 2JC6A 3IW6A 4NW6A 4BTMA 3NUYA 4QMYA 5HG9A 1XBAA 2C6TA 1XO2B 4O1OA 4M69A 3DXPA 5A46A 2DWBA 4O0XA 5HU3A 3NYOA 4MAOA 5EFQA 3QAME 3I5NA 5EYDA 1U46A 4FEXA 4WT6A 3EQIA 3PG1A 5HLPA 3H4JA 3LFQA 1OL6A 3O2MA 1MRUA 5FP5A 3QX2A 5E1EA 4FEUA 1E1XA 4KBAA 1ND4A 3QWJA 4TL0A 1AQ1A 3HX4A 4CFFA 4BDFA 4BCIA 1OGYA 1ERKA 3HAVA 3PE2A 5CT7A 4WOVA 5AX3A 1ZMWA 3ZXZA 1QL6A 4QQCA 3EFWA 1REJA 5CQUA 2Y4IB 3A60A 5EG3A 2WTJA 3E8CA 3BHTA 4BI2A 1CKPA 3ORNA 2FGIA 4G1WA 3DB8A 4O7RA 1ZY5A 4IBMA 3RKBA 5E92A 4NFNA 4PDYA 4B4LA 3A62A 1UWJA 3F7WA 3FMHA 2OGVA 4L01A 3UGCA 5M09A 3D15A 3QRJA 2J6MA 1DAYA 5E8YA 4TYHB 3G15A 3F2NA 2PWLA 2E9OA 1H07A 4RC2A 4CFMA 2Y6MA 4GFGA 5AJQA 3HNGA 2XM8A 4L53A 1GZ8A 2Y7JA 3Q9WA 5ANDA 2R0IA 3IONA 4FIGA 4BB4A 3A7GA 1SVEA 2PVMA 3TDWA 5FG8A 5DVRA 4TWPA 1RQQA 5CAOA 4AOIA 1WBNA 4RRVA 4FNYA 3O0GA 5IA2A 4ZLOA 4MCVA 1LUFA 3GU8A 4RX9A 1YI4A 3AT4A 1PRYA 3FI2A 4I20A 3LFFA 4TT7A 5HTBA 5ICPA 3FSFA 4HVIA 4FOCA 3ZU7A 2BZHB 1T45A 3A61A 3NNUA 4I92A 1GIIA 2VTJA 3FYJX 4GT5A 3RM6A 3NAXA 3PP0A 1DM2A 4RJ3A 4C4JA 3HL7A 3QRUA 4X6RA 1KUTA 1AGWA 3BU3A 3IG7A 3CQWA 4K8AA 2NP8A 3CD8A 2XS0A 3VIDA 4H39A 4WNKA 1PXIA 3PXFA 4FNXA 2GQRA 1SNUA 3ELJA 3ZFMA 2WOUA 4JR7A 4CV9A 5AAEA 3KB7A 4E4MA 4PDOA 2EUFB 5HLWA 3KFAA 5L2TA 3GFWA 2VTMA 2B53A 3ZO3A 1LP4A 5HNIX 4PL3A 4YJRA 2C1BA 4GU6A 4EH7A 5KBRA 3ORTA 2J0LA 2VAGA 4N70A 4ASZA 1YXUA 3NDMA 5CSWA 4BCHA 5JFSA 4DDGA 4CMTA 2AEGA 3MH2A 3I5ZA 5EH0A 3DZOA 4L6QA 4OGRA 3TL8A 2F57A 5H3QA 2FSTX 5F1ZA 3D7TB 4N57A 2YN8A 3NIZA 3Q4ZA 4G17A 4Q2AA 3O8TA 5GHVA 5B2MA 4UX9A 4O83A 3MH3A 5B0XA 5HX8A 4O6LA 1JVPP 3VAPA 3ORXA 4GU9A 3UVRA 4WUNA 3CBLA 3QLFA 2QG7A 3W2OA 1MRYA 2DYLA 4IB3A 4H3PA 5HORA 4AFJA 2B4SB 3MY1A 4P5ZA 4FV7A 5HO7A 4E6AA 5M07A 3PWDA 3D7TA 3MVMA 4EQUA 3UNJA 5I9XA 2WPAA 4IJ9A 1IAJA 5FGKA 3BRBA 5D41A 5J1WA 2E9VA 4W4XA 3PIXA 5CYIA 3UOLA 4NUSA 3RPOA 5J7HA 1H01A 4HYSA 4Y46A 4Y83A 4ZSLA 4DBNA 1REKA 1P14A 3BHHA 4I5MA 1UA2A 4FKGA 3T3UA 2UZVA 1SVHA 3CE3A 3R1QA 4EOLA 3ZEPA 4TWOA 4HGTA 3TJCA 3SLSA 3TN8A 3FZSA 4QYHA 5I4NA 3LOKA 1WVYA 1TVOA 4A9TA 2ITVA 3DNEA 3REPA 1H26A 1R78A 3PPJA 4FUXA 3WE4A 2R0UA 2JD5A 4AWIA 3RPRA 5A3XA 4HGSA 4IADA 4F1OA 4XV1A 2W96B 4MD7E 2VWVA 3LQ5A 4G3FA 2ZM3A 3UIUA 3RNIA 3R8MA 4JQEA 4EZ7A 5KMLA 4DFBA 4ALVA 3F2AA 1WBTA 1Y8GA 3II5A 3V5PA 4EHVA 4R3PA 5CAVA 2PUIA 4L43A 4E5AX 3UNKA 4IVCA 3T3VA 3L9PA 5AAGA 4X3FA 4XV3A 3BHYA 3KXXA 3GU5A 1PMUA 5E8ZA 4RFZA 4JI9A 1WBPA 2R5TA 2G9XA 3MJ2A 4L45A 4JG6A 5HTCA 3MVHA 3EYHA 2W1DA 3VWAA 1WZYA 4IAFA 2R4BA 2ETKA 3SW4A 4D5KA 2BR1A 2HZ0A 2C30A 2YAKA 3LCTA 3ORLA 1VLRA 4B7TA 5EQYA 3QKLA 2EU9A 2P4IA 2QLQA 5CEPA 3DNDA 5H8EA 2QOIA 4O0VA 3R7OA 2BHEA 4F6SA 3NUSA 4TWNA 4QP1A 2HZIA 4JRNA 1PMVA 3O96A 4KBKA 5EYCA 3TWJA 5DT4A 1TZDA 1OI9A 4F63A 4Y73A 5ETCA 4FNWA 3LFCA 3DXNA 3TT0A 3UIMA 2BUJA 4E5WA 1ZZ2A 4F9YA 4IZAA 1YVJA 3AD5A 4EL9A 4CSVA 4ERKA 4YMJA 4USEA 2XNGA 2OI4X 5IEYA 5LCKA 3VS5A 3RPYA 3U54A 3MIAA 2QD9A 3W16A 3WBLA 2X8IA 2CLQA 3VC4A 2VX3A 4C37A 3EHAA 3ZZEA 3EQRA 3M1SA 2ITZA 4I24A 4I6FA 2I6LA 5EDQA 5HE2A 5DR6A 3CXWA 4G6LA 1KOBA 3VHEA 4FV0A 3OG7A 4GJ2A 1RE8A 4L3LA 5ANGA 2B1PA 3D7ZA 5C27A 4BTFA 5CAUA 4O96A 3QD4A 5BYLA 4RFYA 4ANOA 3V5WA 5EHLA 4R7BA 1DS5A 3ODYX 4G3GA 4I4FA 1XWSA 4LL5A 5AV0A 4BI1A 3R8LA 3W0RA 4MXCA 4IAIA 4N4SA 4JAJA 4FK6A 1FINA 4M14A 4TZRA 4EBVA 5L6OA 4G9RA 4U81A 2BVAA 2O65A 3TJDA 3W2PA 1VYZA 4YU2A 2RFSA 4NU1A 3BGZA 2R3RA 1VZOA 4LOQA 4EC9A 1MQ4A 3GGFA 3LHJA 4IIRA 2BROA 4OBQA 2QU5A 4NKAA 3ZEWA 4R1VA 1XJDA 3SRVB 3WIKA 3N51A 4IM0A 4YC8A 4PPBA 3HUBA 4FG7A 2WTCA 4CLIA 2RIOA 1ZMVA 3RAIA 3ZFYA 2W5BA 3N4VA 1H28A 2GNIA 2J4ZA 3LPBA 4C4IA 3ZC5A 4XG9A 1H1SA 5IQCA 2V7AA 3TI1A 2WQMA 2BZKB 5BX0A 4A4LA 4O0WA 1JKTA 4IX6A 4AZTA 5IKWA 2HWPA 4PY1A 5EW8A 4C33A 4CCBA 4HVHA 1TFFA 1QPCA 3HMIA 2R3QA 3G6GA 4IDVA 2RL5A 3UYTA 1IAHA 2GHGA 3EFJA 4A9SA 4HZRA 5HI2A 4RIWB 3FKLA 4YZCA 4AFEA 1IEPA 4DEDA 4LDTA 3PJ2A 2W05A 4EONA 1OGUA 1YI3A 3NUXA 2ZV9A 4QP4A 4DCAA 4ZSJA 4G3EA 4QDVA 2V55A 4YTHA 4OTWA 2HXQA 4AT4A 4CRLA 2CCHA 4MX9A 4HVDA 4AXCA 5C9CA 3BEGA 4KAOA 3LCSA 2B54A 5KBQA 4BY9E 1PW2A 3QFVA 2SRCA 3F66A 3QZGA 4H58A 5CENA 3Q6UA 2BIYA 2O3PA 4M66A 3SC1A 3VHKA 3P08A 3F61A 1Q8YA 3U9CA 3UOHA 1F3MC 4FYNA 5LVMA 4DFXE 2VWUA 3OWJA 4J53A 4IHPA 1V0BA 2HY81 3MDYA 4MHAA 4QTDA 3PA3A 4PWNA 4AA5A 2OJGA 5L6PA 5HIBA 1NT2A 1DAWA 3BYVA 3DXQA 3SGCA 4FIHA 4DE4A 2XBJA 4P5QA 3D4QA 3VS3A 4BL1A 3DK6A 5C01A 3DY7A 4MYGA 3POZA 1V1KA 2WKMA 3GC0A 3HP5A 4ZTRA 4FI1A 2YLFA 2CN8A 5KMNA 4EH4A 3V5JA 4FKSA 5FM2A 4QMVA 3FLNC 2VO7A 4NIFB 4MBJA 4O0RA 3ZRKA 2CLXA 4FTTA 5L8LA 1VEBA 3F2RA 5F20A 2YERA 3BLRA 4FTNA 1DI9A 3W2QA 2XVDA 5HVKA 2BDJA 3GC9A 5TO8A 4L3PA 5BQ0A 4U45A 5KO1A 4EKLA 3ETAA 5IMEA 3GUBA 3GOPA 4H05A 4IACA 3CKWA 5IA1A 4EHEA 4UYNA 4AAYA 2WOTA 1BL7A 2VTLA 3Q04A 2ZDUA 4FZ7A 4UV0A 2WQOA 3EB0A 5KNJA 1OL5A 3ENMA 3TNPC 3NEWA 4XEYA 5HG7A 4RWIA 3TZ9A 3MY5A 4FV1A 3FY0A 1PXLA 2BTSA 2QHMA 1T46A 2YIYA 3EZRA 3S00A 3K3IA 2QO9A 1S9JA 2CN5A 1H0WA 3PIZA 5BVWA 1WBVA 3ORMA 3U9NA 3VQUA 3UQCA 2C0IA 4S34A 5K3YA 2A98A 3JUHA 3MA6A 3HRBA 2XH5A 1JAMA 2CNUA 3NW6A 4NTSA 3PJ8A 5FP6A 5BMMA 3OOMA 5EM7A 4BCJA 3RMFA 2O8YA 1W82A 4AUAA 4EH5A 1G8KA 2VWIA 4IVBA 3CQEA 4XJ0A 4O2PA 3VBXA 4P90A 5E90A 2JEDA 5I5ZA 4WO5A 1IG1A 2J9MA 4V01A 1X8BA 2VO3A 1TQMA 3WIGA 3SOCA 4X6QC 4D1ZA 4BIDA 3W0QA 3AD6A 3QHRA 4DYMA 3QTRA 2JIUA 3NZ0A 3BEAA 4I3ZA 2FO0A 2QR7A 4I0RA 2R2PA 3EZVA 4C02A 3NWWA 1OKYA 3LJ1A 3BU5A 4PQNA 1YW2A 3EN5A 3W33A 3B2TA 3G51A 4EWQA 2ERZE 5E8WA 3DJ5A 3AKLA 4J52A 4QPMA 5C8NA 3ATSA 3VS6A 3OCBA 2YIWA 3PVUA 4V0GB 4OTGA 5GZ8A 4I4EA 2W5HA 4DHZA 2WO6A 3CTQA 2F9GA 2C0TA 3I1AA 4IWOA 2XALA 3L8PA 4IC7A 3TZMA 4E4LA 5JKGA 4AGWA 5KMIA 4ACGA 1WAKA 1LR4A 1UNLA 5J9YA 1OUYA 2WZJA 4GW8A 4KRCA 4FX3A 1KE5A 4TW9A 2GTMA 3UTOA 4FVPA 5IA5A 1GZOA 3NYXA 3TYKA 3HDNA 2BDFA 1R1WA 3DZQA 3KXGA 4UMPA 3NUNA 4I5CA 1JSTA 1KE8A 4IZYA 4NCTC 1W83A 4CFVA 3W0PA 4AGUA 3BBTB 4DGLC 2CGVA 3ZFXA 3R2BA 5L2WA 4BWPA 1UV5A 4GFOA 4ZTSA 2Y9QA 1PXNA 3BELA 4FMQA 4LGHA 4RA5A 5FM3A 4E1ZA 3GU7A 4FBXA 4DFNA 4GYIA 4ZXTA 5E8VA 4QMZA 4BDAA 3UOKA 3CGOA 4NFMA 2ITQA 3G9NA 4PNKA 3PE1A 3GP0A 4O4FA 4DGGA 2I0YA 4AT3A 1UKHA 3FHRA 4QMXA 2HW7A 3MIYA 1P4FA 3WILA 3IO7A 4GEOA 3NVKI 4MD8E 4GG5A 4KINA 4EI4A 4RIXA 3WZDA 2BALA 1QPJA 3FMDA 4LGDA 3OWPA 4U40A 4F0GA 3NS9A 4U3YA 3AT2A 3EQBA 4YHTA 1UNGA 2BILB 3E7OA 4IXPA 4QO9A 5KZIA 4ENXA 4B0GA 3FC2A 3P78A 2UZLA 2I0EA 3WOWA 3S2PA 3FV8A 3CPBA 5AR8A 2CCIA 4LRKA 1M7QA 2WU7A 5HO6A 1OPLA 1JSUA 3KKVA 3QYWA 4G2FA 4XX9A 2X7GA 2G01A 3JVSA 4EHGA 3FI8A 5EDRA 4GJ3A 4K18A 2PK9A 5CALA 2O64A 4JX3A 4M0YA 1O6YA 4BC6A 4USFA 4QPSA 2J0MB 4EK4A 1B6CB 3R00A 5HOAA 4DG0E 2J5FA 3ALNA 1PYEA 4QMOA 4DFZE 3ROYA 1MP8A 2ZJWA 5M06A 4LMUA 3DK7A 3ZDIA 2IW6A 4FL1A 3NUUA 5E1SA 3L8VA 2YA9A 5HU9A 2YLEA 3SV0A 4FV2A 3GCQA 4HYHA 5BV3A 3W2SA 4XCUA 5AEPA 2Z2WA 4FT9A 4FZDB 3FZOA 3ZM4A 3C5IA 2VRXA 4LRMA 3RJCA 3FQSA 1FMKA 2WQEA 3QZIA 4O6EA 4F4PA 5K9IA 5LMKA 4D4SA 5DIAA 4EOOA 4FUYA 5CVGA 3P9JA 3OT8A 1PMEA 3V5LA 1W2DA 1CSNA 4QTEA 5J1VA 5AP2A 3Q3BA 5L4QA 1NA7A 4JBVA 4BCKA 4C59A 2W7XA 3Q6WA 5DPVA 1PXKA 3VW6A 2JKMA 3QKMA 3R9NA 4ENYA 4HW7A 4RSSA 3F3UA 4CT1A 4RJ8A 2G2HA 2WFYA 4GVJA 2CKQA 2WXVA 5TE0A 1SVGA 1PYXA 4QMNA 3U6JA 4UWCA 2PE1A 5D1JA 4YJNA 4HYIA 4I41A 2G1TA 2XK9A 4HNIA 3VUKA 1XBCA 3VQHA 2HZ4A 3PJCA 4E73A 3P0MA 4QPAA 3VS1A 2PMNX 1ST0A 3EQGA 5BNJA 3NUAA 4QP3A 2WAJA 2PVHA 1Y6AA 4QD6A 4EOMA 4EQMA 2YDJA 2XJ1A 4FSZA 4XBRA 5AFVA 3D5VA 1UNHA 2GQGA 3EWHA 4J99A 3ORZA 3DKOA 1KSWA 3MFRA 3IECA 5EHYA 2KTYA 2HCKA 5J87A 4ALWA 2AUHA 4OTPA 2EB2A 2QLUA 4C4HA 5CEMA 2R3KA 3R9HA 3T8OA 2XKDA 3KXMA 4MEDA 5HG8A 1M2PA 1OB3A 4CFXA 2A0CX 3TG1A 2VO6A 4JQ8A 3QQUA 3C50A 4AZSA 2WMWA 1KV2A 4O91A 4C35A 3ZRLA 4FTCA 4C3PA 5JN2A 2PZPA 1K9AA 3DBQA 5JGDA 1LEZA 3KULB 3KN6A 3BLHA 4APPA 3MW1A 3OCTA 4U41A 4BFMA 5EM6A 1W2FA 4EKKA 5KKRC 3OHTA 4L42A 5EI2A 2ZVAA 4FL2A 3BGQA 1BUHA 2LAVA 2A19B 3WYXA 1ST4A 4FA2A 4YLKA 3AMBA 2WMTA 3V8SA 4Z7GA 3PXKA 1J91A 5M08A 2FYSA 5EYMA 3IDCA 1GAGA 2PTKA 1WBWA 3KULA 4BCMA 1Q4LA 3F3WA 4GK3A 2HYYA 3BZ3A 3UOJA 1M52A 1OIYA 4IM3A 5C03A 4P7EA 4A9RA 3C7QA 3LCOA 3O17A 1QPEA 2VN9A 3OW4A 3A4PA 4XBUA 2A2AA 3D2IA 3FMLA 3Q9ZA 3PVGA 2IVTA 3OBGA 5AP6A 5JRQA 4DFYA 2PMLX 1G8SA 3E93A 4ID7A 3LFSA 3P5JC 4NH1A 3RI1A 3LVPA 5KHWA 3ORIA 3LFEA 1SZMA 2XKEA 3ZO2A 1ZOGA 5BVNA 4BIBA 3HLLA 3IGOA 4EUTA 2BMCA 3VS7A 4XG6A 5IA0A 3N4UA 3NAYA 4XNEA 2ZV8A 5HCYA 3F3TA 5CEOA 5DNRA 2F7ZE 3TM0A 4MTAA 4E8AA 2ITOA 4X3JA 4D9TA 3A99A 4RIYB 2GNGA 4K77A 1CDKA 1XH6A 3DCVA 3UE4A 3FWQA 4JXFA 5BPYA 4R77A 4PL4A 4AGDA 4CMOA 4XV2A 4FK3A 4QQJA 2PULA 3PFYA 3CY2A 3E5AA 3M11A 2R7BA 4TYEA 2IO6A 4ANSA 4L9IA 2W06A 5AA9A 3BYUA 3C4CA 3A7HA 3Q9YA 2VTRA 4F78A 3EQCA 4WD5A 4JL9A 3LFDA 3QQLA 3E8DA 3FMEA 5HBEA 3KCKA 4LQMA 5M53A 1P4OA 2VUWA 4Y8DA 2F4JA 4QYGA 3VF9A 3WZUA 4O4CA 2IEWA 4QQ5A 3Q5IA 4YPDA 2PY3A 4IFGA 4R1YA 3OS3A 4RJ6A 5BMSA 5EK7A 5FRIA 3DFAA 3HA6A 3V51A 1XH7A 5L6WL 4N6YA 3R7UA 5F9EA 1YXXA 2HELA 2X7OA 2QOLA 3UO4A 2F2UA 5AV3A 4GMYA 5CS6A 4D9UA 2I0VA 2XK7A 4UMQA 4ZTMA 2YITA 2X9EA 3NYVA 3VUDA 2G2FA 2ITTA 3DKGA 4QNAA 5JT2A 4MUQA 3QUDA 4O4DA 5CX9A 3ZDUA 2BHHA 2XNMA 2QC6A 4H36A 2RGPA 4G6OA 4OTRA 4GFMA 3R01A 2PUNA 4YZMA 5CY3A 1CTPE 2YISA 4LGGA 2I1MA 4L46A 4QYEA 3R7IA 4X2FA 4WBBB 3RPVA 4C3FA 5BVDA 5KMOA 3NLBA 1GY3A 1FGKA 4LV7A 1OMWA 3CC6A 1FOTA 3R7VA 3EKNA 4DT9A 4ZP5A 2EXMA 4D0XA 1F5QA 3LZBA 2JFMA 5EKOA 4R5YA 4S2ZA 3SXRA 2ZFYA 3H0YA 3TNQB 2P55A 4YHFA 1OPJA 3ORKA 4FV5A 5CLPA 4TYJA 3IOKA 2X1NA 4E4NA 2UZWE 3H3CA 3MS9A 3MB6A 4O7NA 4ZY5A 4FVRA 4PMSA 4L52A 4UZDA 1UU7A 3HGKA 4K33A 4RIOA 3EH9A 1J7IA 3GCSA 3T9TA 4C4EA 3PXYA 5L8KA 4F99A 2X0QA 3R83A 2RG6A 5J95A 3NX8A 3FLYA 5DMZA 5M4CA 3LJ0A 4C7TA 5JFXA 1WFCA 2PE2A 3OW3A 4QMWA 3W2RA 5GNKA 3FJQE 3GXLA 1ZLTA 3COIA 3VRZA 1W0XC 3AKJA 3EL7A 4JIAA 2BAQA 3O50A 4D4YA 2QURA 1ZZLA 3MYGA 3VBWA 4Y5QA 4RG0A 3C0HA 3QRKA 2QCSA 4GK4A 4X3FC 2ONLA 3AG9A 2UZTA 1BKXA 3K2LA 3C5UA 4XRJA 4W9XA 3SHEA 3DQXA 1KOAA 3KMWA 1S9IA 2RFDA 4PL5A 4TYHA 3TZ8A 2UZEA 3BQCA 2JITA 5A4QA 2XKFA 3C1XA 2OJIA 3ZXTA 1SMHA 4BDJA 4FG8A 4II5A 2JGZA 3DKCA 3ACJA 4PP7A 1ZYCA 3HRFA 2YM4A 1UU8A 4IJPA 2UZBA 3H30A 5M4IA 4FIEA 2FUMA 3MB7A 4HJOA 2GMXA 1AD5A 2W5AA 4IH8A 3L9LA 4GSBA 4XUFA 5ETFA 4AZFA 4CEGA 4D28A 3KIOC 4LUEA 2WNTA 1JOWB 3PVBA 4AE9A 1L8TA 2JIVA 2UZDA 2Q0NA 1ATPE 1YDTE 5CI7A 4CYJA 3PZEA 1JSVA 3QUPA 2JBPA 3DJ7A 4ZSAA 4D0WA 2J2IB 4MXAA 3SA0A 1PY5A 1OIRA 3BBWA 3GQLA 4OLIA 5I3OA 3IW5A 3IW4A 2X0GA 1URWA 1ZYJA 3NRMA 4I5PA 5CEQA 1OIUA 3DAJA 5JSMA 2OF2A 5JGAA 2R3HA 4C8BA 5AR3A 4G34A 4FIIA 4FV8A 4E6DA 5IQFA 3JY9A 2JDSA 4GUBA 4RZVA 3UZRA 3QA0A 5DHJA 4IB1A 4YUQA 5FXSA 1W2CA 3I0OA 3SG8A 4F9AA 4YTIA 4Q5HA 1VJYA 4MKCA 3FHIA 3P7AA 5C8MA 2WU6A 1NVQA 4QQTA 4XP3A 2YJRA 4CQGA 2CMWA 3M2WA 3QRTA 4KIKB 4BHZA 1VYWA 4IEBA 4F09A 4PNIA 5GJGA 4ZY6A 5T68A 3KVXA 3BWFA 2R3NA 4C2WA 5FXQA 5K0XA 4QDEA 3U55A 3NPCA 4A06A 4EH6A 2VWZA 2EXCX 3ZUVA 4RX8A 3TMOA 1KE6A 3UO5A 4RZWA 5EM8A 2J50A 2V5QA 3OVVA 2IW9A 4RQVA 4TN6A 3CGFA 3EN6A 3MPMA 4IE9A 5HE1A 3TNIA 5KMJA 3ZO1A 1K2PA 1O6KA 3AQVA 4ZEGA 4OT5A 2IZRA 2OSCA 2VV9A 4LV8A 4S32A 3V5QA 4O82A 1GIJA 1JQHA 4XLIA 2BAJA 2R3FA 3DS6A 3MH1A 5IPJA 4HNFA 2F49A 3BL9A 4O1PA 3C4ZA 3F3VA 4DN5A 5ANIA 2X4ZA 5HEZA 3ZONA 4F0FA 3DQWA 4FKOA 3UVQA 3KK8A 3LFAA 3R7GA 3NCZA 4GVAA 4EBWA 2ITYA 3Q53A 5F94A 4HGLA 1K3AA 1G8JA 2V7OA 1GOLA 3HVCA 4YP8A 1H1RA 3CKXA 3W1FA 1BL6A 3KXZA 4O27B 4D2TA 2C6IA 4Q5EA 4R7IA 2R64A 2RSVA 4KUJA 5EOLA 3R7EA 3HMMA 2XA4A 3ZMMA 3QYZA 3R71A 2XBAA 3FL5A 4YO6A 4BCNA 3OMVA 4CV8A 1XQZA 3NSZA 4HOKA 5GZAA 5IISA 4XS2A 2QG5A 3UIBA 4C62A 4GUEA 2R9SA 1F0QA 4FT0A 5K4IA 3LMIA 5DN3A 4F08A 4DH5A 4HVSA 4DEIA 3TXOA 3GOKA 3KRXA 3C0GA 2J0JA 4UMRA 2IW8A 4Z7HA 1WVXA 3ACKA 1YDSE 3V5TA 5TF9A 2B55A 3QHWA 2WTVA 3IW7A 4FEQA 3KCFA 2XIKA 3L1SA 3LCKA 3ZO4A 4ANQA 4AX8A 5M56A 4BKYA 4W8EA 2G15A 4HCUA 5AV2A 1FVVA 5J5SA 2EVAA 3NIEA 4KBCA 2WEIA 3KL8A 5EYKA 2ZDTA 4JDHA 4NM5A 1I09A