4AGDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sunitinib (su11248) (n-2-diethylaminoethyl)-5-((z)-(5- fluoro-2-oxo-1h-indol-3-ylidene)methyl)-2,4-dimethyl-1h-pyrrole-3- carboxamide)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
317
structure length
303
Chain Sequence
b'LSIVMDPDELPLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 303
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4agdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4agdA01
4PWNA 4QMMA 3E5AA 3U51A 4FEWA 4TWOA 4GKIA 4XP0A 5I0BA 4OUCA 3HMOA 5L6OA 4EQMA 2ZB0A 4AUAA 3BV3A 5AWMA 2J51A 3D7TA 3NYNA 3V5WA 2W9FB 4QP2A 2HY0A 2PMIA 2CDZA 3FZOA 2GQGA 2JFLA 4V01A 3TJCA 2V0DA 1CKJA 3LM0A 3LXPA 2ZV9A 2VX3A 4Z16A 2XBAA 3F69A 3M2WA 3R8VA 2GNJA 4QQTA 4YC3A 3H0YA 2XIYA 2X8EA 2YLFA 4PL5A 3LPBA 4XG6A 4D9TA 4HVSA 3DXNA 3FI2A 2ITVA 3NUXA 3CR0A 5CSPA 3FHRA 4YJOA 4M84A 3ANQA 5JKGA 1KE5A 2G2HA 2WXVA 4FK6A 4BKYA 3KCKA 2FB8A 5CSWA 1FGIA 2QNJA 1NT2A 4S2ZA 4FV4A 3F88A 4UZHA 4N6ZA 3RAIA 2UW8A 3CJFA 4XV1A 3TV6A 2Z7LA 2QLUA 5FTGA 1IAJA 3TKHA 3NW7A 5D7AA 2VTMA 3NYVA 4MQ2A 3DK3A 5DR2A 3CSVA 3HUBA 4C36A 1SYKA 4QPAA 3T9TA 2IVSA 4XP2A 3I0OA 3VS7A 4AFEA 2VO7A 2OZAB 5BVFA 2OF4A 4I5MA 4UMPA 3D5UA 3EQPA 3MW1A 4NW6A 5JRQA 1FOTA 3MJ1A 4D2PA 4ANLA 1ZWSA 1GY3A 3QX4A 1O9UA 4ACCA 3ZU7A 2NP8A 5D7VA 4N0SA 4ORKA 1M2RA 3AT4A 4JI9A 3UIXA 4DC2A 5HTBA 3PY0A 4DG0E 4E73A 2Y9QA 2JIUA 4O7VA 3KB7A 3KK9A 4FV2A 5EHYA 3IK3A 3BU5A 2A19B 2J50A 4FTAA 2ZM4A 2UW3A 1P5EA 2OXYA 3LFQA 3Q6WA 4KNBA 5FXSA 4C34A 4ZTLA 3QZGA 4KKGA 4NWMA 5FBNC 1K2PA 3TEIA 4CKIA 4D5HA 3BLHA 3VN9A 4Y83A 2I1MA 3ZO3A 1H27A 2BZKB 3OCGA 1GZKA 3HP5A 1GOLA 3R04A 2XKCA 2EXMA 5EK7A 1OIQA 1CKIA 2YLEA 4ENYA 2UW6A 2ITQA 4FC0A 4FIHA 4G3DA 2BPMA 5K4IA 2XBJA 1G8AA 1R0EA 4C8BA 3NNVA 5EOLA 3QCSA 4Q2AA 4N4SA 4QD6A 1UNLA 3ZRMA 4DH7A 2JAVA 4N70A 5KKRC 3ZC5A 5AP4A 3RK9A 3DK7A 1PHKA 5BVDA 2O64A 2WQMA 3PRFA 5HU9A 3LFNA 2OH0E 2QG5A 2BZJA 4X6RA 4G9RA 1BKXA 3UC4A 3CJGA 3UP2A 3VUIA 4CZYB 4I4EA 2F2CB 4N57A 3ORLA 5LMKA 4AZWA 3PYYA 2W1CA 4IB1A 4NM7A 5LCKA 3VC4A 4BCNA 3OMVA 4RG0A 4CSVA 3IW4A 2Y8OA 3E3PA 3W18A 4BTMA 3U6JA 2GSFA 4LMNA 5HX8A 3OOMA 4IJ9A 4K77A 2CKEA 4YZDA 3ZRKA 3EN6A 3DFAA 2X2MA 4RIWA 2WTKB 4U6RA 1APME 5GJFA 3TJDA 2GS6A 4IZYA 1W82A 4CMOA 5EM5A 2UW7A 2R9SA 3BPRA 3LJ2A 5HOAA 3VBYA 3NW6A 1M2PA 3CQUA 4AWIA 1F5QA 4F9BA 2WOTA 4AW5A 4U43A 3TDWA 2YDKA 3Q52A 4GT5A 4BZOA 1Q3DA 5D41A 2YM4A 4G1WA 3AG9A 2JDRA 4FT0A 4EOJA 1H0VA 4FBXA 2FUMA 4MD7E 3BYVA 3UG1A 4Q9ZA 2XIZA 4BF2A 3GI3A 3R7UA 3U4WA 4D55A 3QQFA 3MFSA 2IZSA 4OT6A 5M57A 1U46A 4AZVA 3NMUF 3MGYA 3TV4A 4FKIA 4F1MA 3GOPA 4D1ZA 3C0GA 4FKVA 3ZBFA 4G3FA 4K11A 4FGRA 3BIZA 3JVSA 3AC5A 1JKLA 4CNHA 2R3OA 5TO8A 4ZAUA 2WIHA 5LXMA 3VUKA 4FTIA 3MBLA 4DT9A 4QP7A 2FSLX 4YBJA 5CU6A 1DAYA 4LL5A 4NU1A 5FLFA 2B9JA 1R39A 2C6IA 3R1YA 4QMYA 3V5PA 3ZSIA 3DK6A 5ACBC 2IVTA 1YXSA 3QZHA 4V04A 3RMFA 4DE4A 4YTHA 5CI7A 5JFXA 2ITXA 4DT8A 5A14A 4C37A 3DKCA 3LMIA 4AGUA 4FE2A 4EH8A 2RFSA 2WFYA 3PZEA 4IVAA 2VWXA 4JR7A 3FZRA 4XRLA 3HRBA 3ETAA 3OG7A 4BIBA 3QLFA 4O7WA 2QURA 3HUCA 2XIXA 4MWHA 1YXXA 3RPSA 2W1HA 2ITUA 4W4WA 3VVHA 3PLAE 1A9UA 4AQCA 5AMNA 4C3FA 4F1TA 1OBDA 3HRCA 4BRXA 4DCAA 3L9MA 5CSVA 3LFFA 1J1BA 3QRIA 4IDVA 4AA0A 4W4YA 2BTRA 4B0GA 5FUTA 4AZFA 4UMQA 3R7IA 4F99A 4JQ8A 4IW0A 4GKHA 2XK7A 5GHVA 4LUEA 3WILA 4X2GA 4BWKA 3D94A 3TXOA 4ERWA 4ZJVA 4IZAA 2G01A 1WBSA 3CTQA 3IW5A 4IC7A 4GUEA 3DAEA 5FWKK 4EK6A 5IA0A 2ZM1A 4XHKB 3NNUA 3BYSA 2Y7JA 3CY3A 4E26A 2NO3A 4YR8A 5IKWA 1BI8A 1REKA 2WELA 2R3JA 4PL4A 1SNXA 4WRGA 2V5QA 2YM8A 5BUJA 4WA9A 4FSYA 1OBGA 3AC1A 3Q4UA 4MEDA 5K5NA 2BKKA 3BWFA 5DRBA 3LMHA 2WO6A 3S95A 3WYYA 2PE2A 2VWBA 2PVHA 5CU2A 3OEFX 3FKOA 3G6HA 4C4IA 3N4TA 3P79A 3G0FA 2C68A 4F4PA 2EXEA 4H3QA 4HYSA 2JAMA 3R9DA 4ZLYA 2A4LA 1UU9A 1ZY5A 5CQUA 4I22A 4CQGA 4RWLA 4AOIA 1O6LA 3LQ8A 4EZ7A 4A4XA 3H9RA 5EW3A 4IHPA 4JS8A 5E4HA 3ORPA 3O0GA 5E8SA 4FIGA 4KRCA 3K3JA 1FGKA 4HGTA 3QTQA 3QQJA 5DNRA 3P0MA 5KHWA 4EKKA 5IQGA 1YW2A 4LV5A 3UPXA 4MNEB 4FSQA 2F7ZE 1URWA 3G51A 4RIXA 4BCMA 1J1CA 3ACKA 4F7SA 4UWBA 4WKQA 5FBOA 3TNWA 4F09A 4JBVA 5IDPA 4QP9A 1Y6BA 2B54A 3TNPC 1QMZA 4C62A 2A27A 1HCLA 1SVGA 1OKZA 1Y8GA 4ENXA 3VUTA 4C61A 4PP7A 4DLJA 4O0YA 1KE9A 4OTDA 3UNZA 3DDPA 4WSYA 2PVLA 2QHMA 4WRSA 3ET7A 3TZ8A 3V8WA 4GK4A 1BMKA 4I5HA 1CDKA 1RDQE 3MY1A 4LGHA 4O6EA 5F20A 4YHTA 2BZHB 2G15A 3LCOA 4M12A 1GIIA 3SLSA 5A4EA 3D15A 3N4VA 3PG3A 4TWCA 3FXWA 2HWPA 2CGXA 3CD3A 2WD1A 3Q96A 4R6VA 4C33A 4F70A 5HU3A 1NVQA 2JDOA 4AZSA 3GU5A 4A9RA 5T68A 4BWXA 3ENHA 2R3FA 3A7HA 3E7VA 2WTKC 3CY2A 5C01A 3DV3A 5IA3A 3ZXZA 3FZ1A 5IH5A 1BLXA 3BELA 3R9NA 5CT7A 3A8WA 3HP2A 1XO2B 1U5QA 3C7QA 4HZSA 4M69A 1GNGA 1XH7A 2YM3A 3W2OA 3R30A 5E8ZA 2G9XA 4QPMA 3KMUA 3MA3A 2ITTA 4ZTRA 2QOKA 4CTBA 4P5ZA 3HMPA 2XKFA 3NGAA 3A62A 2BIKB 2F57A 4U41A 3MS9A 3OC1A 4Y95A 5CT0A 4AN2A 2UW9A 3V51A 4K1BA 4DG2E 5M53A 4BKJA 5DEYA 5EYMA 3UJGA 4UY9A 4GS6A 4FSNA 1T45A 4D5KA 3VF9A 4UMUA 2XZSA 4YJQA 4O86A 4EL9A 4A9UA 4QMVA 3RBWA 4IDTA 2C6OA 5IDNA 2X7GA 4QTEA 3HAVA 2HZNA 4ALVA 5D1JA 4BBMA 3UO5A 3G9NA 3AC2A 4GG5A 3CE3A 5JZNA 4OAUC 1UV5A 4DEBA 1XQZA 3TN8A 4KWPA 4YPSA 3KREA 5HVKA 4YP8A 5DE2A 2YAAA 4CFNA 2JLDA 4YLKA 4YJSA 4M15A 3KXNA 4RX5A 3ZM9A 2XKDA 4OTGA 3MPAA 5L3AA 3FL4A 2RG6A 4LV8A 4WO5A 1ATPE 3K2LA 3R1NA 1HCKA 2VGPA 1J7IA 1J3HA 5AP3A 1JAMA 3QTXA 1K3AA 3FDNA 3HGKA 3NAXA 3DKFA 3KY2A 3O71A 2VX1A 3Q9XA 4IM3A 1H8FA 4CZTA 1SNUA 3NZ0A 3PP1A 5DEWA 1H1RA 4G2FA 3KXZA 4FKLA 5C26A 3MPTA 4NT4A 2YDIA 3R9OA 4BYJA 1OL2A 2V62A 5EDRA 1MP8A 3C0IA 2OWBA 3OD6X 4RVKA 4EI4A 5K0KA 4LI5A 1M2QA 2KULA 4XX9A 4YSMA 5ICPA 1U5RA 5IPJA 3I6WA 4EYMA 4BDAA 4U3YA 2VTSA 3D9VA 3P4KA 4YZMA 5JGDA 3QCQA 4L3PA 5DPVA 3HNGA 4UN0C 3DKGA 4FKGA 5HHWA 4EHVA 1FVRA 3FI3A 4HVGA 1YOLA 2R5TA 4M67A 2YISA 2QG7A 3DU8A 5J9LA 2R0IA 1XHAA 3H9FA 1YDTE 4FKQA 2R3NA 3QU0A 3VO3A 5M4CA 4ONAA 1PXPA 5B2MA 3WZDA 5CAPA 2VTPA 4RBLA 2HZIA 4Z3VA 4H1JA 5E1SA 3S1HA 1WBNA 4CG8A 3MWUA 1UNHA 3NIEA 3NIZA 3QAME 5B0XA 2W0JA 2BUJA 4OTRA 4TN6A 2GDOA 5HD7A 1JSUA 4IQ6A 4FV1A 4BDBA 3KMMA 3NEWA 3OTUA 4CZUA 1FINA 1PY5A 3OTVA 2J6MA 3EN5A 3I6UA 2XCHA 4YZNA 4DITA 1RQQA 3I7BA 5AM6A 4F7LA 2VTOA 4RIYB 3G0EA 4H1MA 5TR6A 1QL6A 4QRCA 2F9GA 2OJIA 3NWWA 3KC3A 5CLPA 1H4LA 3F82A 4ZY5A 5KBRA 2ONLC 4PTCA 3ZCLA 3ENMA 4TXCA 5K9IA 3ZEPA 3IDPA 1TKIA 5EYDA 3UYSA 5HIBA 4D2TA 4FTLA 3QXPA 3QD4A 4XG9A 4RJ3A 4D0WA 2BROA 4EORA 5G6VA 5CF8A 1J7UA 3VS2A 2HENA 4JIAA 4LOQA 4RFZA 4EK8A 1FMKA 2HW6A 5DHJA 4ASEA 3PPKA 1B38A 2RFNA 2J9MA 3EIDA 1H1WA 3KXGA 5JFSA 4AT5A 4FYNA 5C4KA 5IQAA 3TACA 4O7NA 4HGLA 4QP6A 2X6DA 2JITA 4IAFA 5CEIA 5FEQA 3D14A 2BAQA 4IZ5A 5DFPA 4JDIA 2DWBA 2YIRA 2PVKA 3MB6A 4PTGA 4RA4A 4L7FA 3PA3A 4EYJA 4DBXA 2Y4IC 3NUPA 3QRTA 5DOSA 4FKWA 4BGGA 4FV5A 5F9EA 4IACA 1OUKA 1QPDA 3WOWA 4RVMA 5AUTA 3AC8A 1WFCA 3R00A 3IW7A 4G6NA 4JJRA 3ZOSA 1YOJA 3CLYA 3MTLA 2JIIA 3QUDA 4N6YA 4WG4A 5CNNA 3ALNA 3QTUA 5AX9A 5J95A 4ZIMA 4AU8A 4TYJA 3VHEA 3LAUA 3KULA 4R1YA 3E3BX 4ZS0A 1WAKA 3AGLA 5ETCA 5LQFA 2XJ0A 3FL5A 1W0XC 3TV7A 3R02A 4E6AA 3R9RA 3F7ZA 3FLWA 1M7NA 2YZLA 2G2FA 2BRNA 2QR8A 3LCKA 4FKSA 5AP6A 4J52A 5DLSA 3KRWA 3LW0A 3VUDA 3QZFA 2R64A 4O6LA 5AUYA 4LMUA 3F5UA 3MDYA 2IZRA 1YWVA 1ZYJA 2WEVA 4ZMEA 3QL8A 3ZO4A 4D4SA 4NJDA 3HZTA 3R7GA 4BVUA 5BNJA 4CVAA 1UU8A 4U3ZA 2JKOA 5FEDA 2VAGA 3W2CA 4Y5QA 4ZSAA 4KB8A 2WHBA 3IW6A 4BDCA 3UO4A 2VV9A 2O5KA 2Q0NA 2PWLA 3C51A 4ZSJA 4TYEA 3NUAA 1CMKE 1H25A 5CF6A 4AW0A 1TVOA 1R1WA 5AA8A 1ZYCA 2HZ4A 3FWQA 3KF7A 3RPYA 4CFVA 3KL8A 4X2KA 2R3RA 3ZEWA 2WQBA 4X21A 5LVOA 4U44A 2YEXA 5J7BA 4UYAA 4FEUA 5C27A 3DBEA 4MD9E 4MK0A 2O63A 3BX5A 4KD1A 4ZOGA 3BLQA 3UOKA 4OBPA 4AN9A 3Q4CA 4BL1A 3LMGA 4U97A 4HVDA 2Z2WA 4IC8A 4E6CA 5H3QA 2JKQA 4U0IA 2B7AA 2R3HA 1CKPA 3HECA 4RRVA 2VTLA 2XEYA 2GHGA 4RIWB 4Z55A 3W10A 4ERKA 4Q5EA 4ALWA 2VO3A 2WOUA 3AD4A 4I0TA 2UW4A 4FTJA 4PY1A 5FP5A 4CKRA 2IPXA 5AR4A 3PJ1A 3RVGA 2GHLA 3SG8A 5BVKA 3GC7A 3H10A 2ZM3A 4ZTNA 4O27B 3MPMA 3QX2A 3Q2JA 1JSTA 2WMTA 3PWYA 3HEGA 2OIQA 3BGPA 4DINA 2R3IA 3TNIA 4LGDA 5EHOA 1R78A 2EB2A 4DFXE 3P08A 2W17A 4TZRA 3KMWA 4I0SA 4K0YA 2PE1A 4FKUA 3UNJA 4CV9A 4CXAA 4TL0A 3KXMA 3SW7A 4AP7A 3ZDIA 3Q9ZA 4WNMA 4FT9A 4RT7A 2WMBA 2NRYA 4R8QA 3Q60A 4ZY6A 5T6KA 2GNHA 4WHZA 3O23A 2PMOX 2J4ZA 1F0QA 2XK8A 3D0EA 4MTAA 4QMWA 4D58A 4CQEA 1YRPA 4ANMA 1Q8WA 1H1QA 3NSZA 3S2PA 4C4GA 5HO8A 3C50A 3RALA 5HO7A 2OBJA 2JBPA 3VS3A 4YGAA 2GQRA 5TF9A 2X39A 4RQKA 3ZLWA 5AUVA 2WTVA 3BGZA 3UZRA 4U42A 3PIXA 4IAZA 5ANKA 4O0VA 2O0UA 4C7TA 2E9UA 3LXLA 1OGUA 5JN2A 3AQVA 3HMMA 2W7XA 4OBOA 4MHAA 2UZDA 4RFMA 3PUPA 4C4EA 5HE0A 1UVRA 3UQGA 3V6SA 3EN9A 5KX8A 3FQHA 1AQ1A 2XS0A 3FE3A 4U80A 4U40A 2W9ZB 4EUUA 4WNOA 3G9LX 3E8DA 4FTUA 2B55A 4GU6A 3RWQA 4GT4A 2C6MA 2YN8A 4OBQA 4DG3E 4D4RA 3GGFA 3NVKI 3EQFA 5HNIX 4E4LA 2ZMCA 3QGWA 4EH5A 2ZMDA 3UIMA 1YI4A 4PTEA 3SD0A 4AE6A 3R8PA 3W33A 3UNKA 3MIAA 5FRIA 2OXXA 1OPKA 2IVUA 3D5XA 2W1FA 3MJ2A 4FTRA 2OJGA 3NVMB 3EOCA 3TDVA 1O6YA 3P1AA 5F95A 3TKUA 4P90A 1DI8A 2XIKA 3LQ5A 2ETRA 4V05A 2OW3A 4Y85A 4J97A 3RTPA 4FTQA 5B2LA 3C1XA 2P4IA 1H08A 1CTPE 1XH6A 3GXLA 4R3RA 4BYIA 4EH6A 3ORKA 4GL9A 4FV6A 4IX5A 5HZNA 5E92A 1OIUA 3EFWA 4IAKA 4C35A 1E1XA 5C4LA 2A0CX 2GHMA 4ITIA 4O0SA 4AX8A 5ETIA 4EH2A 2XJ2A 3FY2A 5CVGA 4F0IA 5IQCA 3RNYA 2R2PA 2JD5A 3SRVB 4BCKA 4EK5A 3PIZA 4XLIA 1ZRZA 3F5GA 4PMTA 2C1AA 3WIGA 3EYGA 1JVPP 4JRNA 5DI1A 2HCKA 2O3PA 2XK6A 2F7XE 2X6EA 2E9VA 3EN4A 3MIYA 4G5JA 1YXUA 3OBJA 3ORMA 4FTTA 2VZ6A 5AIKA 1PF8A 1GJOA 4CCUA 1TQIA 1DI9A 2HWOA 3BCEA 4NUSA 4F6WA 4ALUA 2VD5A 5A4CA 2VTRA 2UZUE 3O2MA 3EYHA 3FKLA 3Q6UA 4ANNA 4MBLA 3QRJA 3OROA 3FEGA 4OR5A 3EFJA 1I44A 2VGOA 5HE2A 3ZMMA 3NUSA 3FYJX 5HIDA 2RL5A 2PVRA 4II5A 5HLPA 2HAKA 3EQRA 3NNWA 2XNPA 1ZARA 4RIXB 3OS3A 5E90A 1JWHA 3DNEA 2UVXA 4QQCA 4IAAA 3OXTA 3U8WA 3O8UA 4X6QC 4IB0A 4FIIA 5CEKA 4KIPA 1PRYA 4RMZA 3EQCA 2PZPA 3HV4A 4CG9A 2EB3A 3KCFA 4MXOA 5EFQA 5FTOA 3MA6A 5J79A 3L9PA 5TE0A 5A9UA 2R3QA 2UW0A 2C6DA 5AV1A 2GTMA 4M0ZA 3CQWA 5F4NA 2FGIA 5HG5A 2QONA 3QQUA 2J0KA 4XJ0A 3NDMA 4XBRA 2YFXA 1TQPA 5JZJA 4FV8A 4D2RA 3VBWA 2J5FA 3ULIA 4NL0A 5FDXA 5FGKA 4LRMA 3O7LB 3IPHA 1M14A 4ZLOA 4QOXA 4W8DA 1R3CA 2R3PA 3F9NA 3MN3A 3E87A 3GU4A 3HV5A 5LMKC 3SXFA 2EXCX 2E9PA 4FYOA 3IW8A 2C5VA 3H3CA 4WSQA 5AP5A 2IZUA 4B99A 1XH9A 5AR5A 5BVNA 1ZZLA 2VNWA 4WG5A 5DN3A 3R8ZA 2VTAA 2PVMA 3ROCA 4E8AA 3QRKA 4ZMFA 3UDBA 4G17A 5HLNA 2OGVA 5I3RA 4Y46A 3OEZA 4ZJIA 3EJ1A 4MF0A 4TPTA 2RFEA 3QRUA 4FSUA 3CC6A 4NZWB 2GNIA 5EG3A 5EW8A 4DTKA 1BUHA 1Q97A 3MSSA 5EM6A 2C6LA 4BY9E 2QOLA 4M69B 5IEYA 1Z9XA 2I7QA 3HA6A 5IH4A 1ZYDA 5AUWA 4Y5HA 3ZS5A 2XA4A 4PDYA 4O2PA 5J5TA 3Q04A 5E9EA 4PDSA 4LRJA 2WAJA 3W16A 2R4BA 1B39A 3BYOA 4J7BA 3HLLA 3RI1A 4DEGA 1XH4A 3ZZWA 1CM8A 5JRSA 4RA5A 1YHVA 2X8DA 1KE6A 3QC9A 3WE4A 4E6QA 4O1OA 3QKLA 4ZP5A 2XNBA 3RAHA 2ZJWA 3QKMA 3UIBA 4MXXA 3VBTA 4BIEA 4ZSEA 2PSQA 4O0WA 3ZUUA 1WVWA 3BQCA 2GTNA 2H96A 4DH8A 1DAWA 5EQPA 2GFSA 4UXQA 2VU3A 5HVYA 5CAOA 5AP7A 2W5AA 3NS9A 2CHLA 3SXSA 3L8PA 4DH1A 1OPJA 4IB3A 5CVHA 3HMIA 3O8TA 3OUKA 4G6LA 4L68A 1PXLA 3TNQB 3DQXA 3UVQA 3NPCA 2I0HA 2O8YA 4FIEA 3BEGA 5H2UA 4CFUA 2LGCA 3WF6A 2HXQA 3ORIA 2F49A 4GK3A 5BYLA 4DH5A 1AGWA 4ZZMA 3WZKA 5DGZA 3DB8A 2WB8A 3M11A 4EH3A 4FL2A 1L3RE 2QU5A 2WMSA 2B9FA 3NCGA 4XEYA 2QQ7A 2NNWB 3R2YA 4BR3A 4GJ2A 2H34A 2GFCA 3EL7A 3RPVA 2G1TA 3BKBA 3MY0A 1UA2A 1SVHA 4O7LA 4TY1A 1A48A 2FVDA 5D12A 2OLCA 1STCE 2R3MA 4M68A 4YBKA 2QKRA 3MTFA 3POOA 4B8LA 4O1PA 2X4FA 3IDBA 3UQFA 1JSVA 2CGUA 5J87A 3WZEA 3UO6A 5H8BA 3Q53A 4JBOA 4CFXA 5AV4A 3GUBA 4UWYA 4E93A 5F94A 2YACA 3K54A 3SXRA 1H07A 3PJ8A 1OKWA 5LJJA 3VS0A 4F08A 4BDGA 4PMPA 2BAJA 4JX7A 5FQDC 4ANSA 2ZDUA 3TNHA 1NW1A 2P3GX 3EFKA 1YHSA 3FSKA 4BI1A 3FV8A 3LLTA 2PMNX 4HGSA 4B9DA 3M1SA 3VS5A 3KQ7A 4NIFA 5LARA 5EYKA 5DVRA 2XP2A 4AGCA 4X3FA 4J99A 4DGNA 2J0JA 2FSOX 2BDFA 3C5UA 4K2RA 4QYYA 4A07A 1OM1A 3JXWA 3FMNA 4EONA 4JOAA 3PE1A 1KE7A 3A7FA 3R28A 2IO6A 2X4ZA 3ZFXA 4ANQA 5TKDA 2ZDTA 3FLNC 2GQSA 3RJCA 3ZONA 4C2WA 3GBZA 4F65A 2I40A 1IA9A 2OIBA 5JEBA 4FT5A 4L53A 3RM6A 1URCA 1JPAA 5I9UA 2PVJA 1SZMA 4PNKA 3QTRA 3I60A 4V0GA 2XIRA 3QQGA 4I6BA 4I93A 4QP4A 1OECA 3V01A 2CN5A 4BTKA 3C13A 2HXLA 4P4CA 5JK3A 4L6QA 3EHAA 2CNVA 4FKTA 5E8YA 1H1SA 3R1SA 4BWPA 4BBFA 1VYZA 4IVCA 4J1RA 4B4LA 2B52A 1B6CB 2EVAA 4MD8E 4FZFB 3UMXA 2WMQA 3E8EA 3OY3A 4ITHA 1V1KA 1NY3A 1JOWB 4USDA 2Q0BA 4USFA 4FTOA 1GIJA 5KMLA 5L8LA 2B0QA 3AT3A 4G31A 1Q62A 2GNFA 4TWPA 4W8EA 2RKUA 3OWLA 1S9IA 1U59A 3LJ1A 3B8RA 5EW9A 1LR4A 4UALA 2C3LA 4I6HA 3O50A 4IJPA 5FXQA 4UBAA 3KGAA 4LL0A 3T3VA 3UG2A 2CSNA 5H8EA 4B7TA 3BWJA 3F61A 4EHZA 4ZS4A 3CKWA 5J9ZA 3EQGA 3EQBA 5IUIA 5ANOA 1JBPE 2YJRA 3D83A 3BRBA 3DTWA 4O0UA 4EBWA 4YJTA 2X9EA 2PUUA 5CVFA 4BC6A 3QUEA 2BFYA 2UV2A 1ZY4A 3BYUA 4GJ3A 4IADA 2WTDA 4YO4A 5HI2A 2O65A 5H8GA 3EN7A 3QYWA 5A6OA 3OP5A 5AUZA 2X1NA 4MCVA 4RLLA 3FMLA 3UZPA 2WU6A 4FTKA 4BCQA 4NFMA 5A4QA 3CPBA 1WBWA 3KULB 4NM0A 2JGZA 4KSQA 5C1QB 5KBQA 1JKSA 1F3MC 3FQEA 2QC6A 3GCUA 3R1QA 3BZ3A 5HORA 4HYHA 3DGKA 3DJ7A 3MVJA 4WD5A 5E8XA 3I1AA 1YWNA 4YO6A 3RK5A 3GQLA 5G1XA 4EOLA 4RJ5A 5B7VA 3ZO1A 3LFSA 4CT1A 5FD2A 3BE2A 2E2BA 2HELA 2YAKA 3FAAA 4OTHA 3GC0A 3BLRA 4OTPA 4UXLA 4FZDB 3F3WA 3A7IA 3QTZA 4RJ7A 5LCJA 4IEBA 4JBQA 4E6DA 3AMAA 4I3ZA 2BRBA 2OI4X 4QMPA 1LEWA 2ZYBA 3MB7A 4I0RA 5ETAA 3ERKA 4BHNA 5L8KA 3TTIA 1SM2A 5GJDA 2Y4IB 2OICA 4G3CA 3B2TA 4YZ9A 3R0TA 3OWKA 1JNKA 3AC3A 3CGOA 4XV3A 4QPSA 4AW2A 2BRMA 1EH4A 2WTWA 4C4FA 1VJYA 2ZV7A 3C4CA 5ANIA 4CMUA 3C4FA 3AD6A 4GSBA 1OL7A 3F5XA 1KWPA 2WTIA 4IAIA 2PZYA 1FMOE 2C3JA 5FXRA 3DLZA 3QHRA 3QBNA 3LQ3A 2FSMX 4DGGA 4L42A 4XG4A 4HNIA 4I94A 5GJGA 3GCSA 2OXDA 1P14A 5KMMA 2DUVA 5ITAA 5FDPA 1R0PA 3IO7A 4D2WA 4RVTA 2W06A 2WGJA 3AOXA 3P5KA 3DZQA 5FG8A 4QMLA 5HX6A 5L2TA 3FSFA 5JQ5A 5CS6A 3L9LA 4KIKA 4XS2A 2UUEA 3MI9A 5A6NA 2BILB 1YXVA 5L2WA 5EKNA 4IWOA 2CCIA 3LZBA 4K8AA 5LVMA 3OUNB 2QOFA 4J98A 2QKWB 5IUGA 3VJNA 3NUUA 4R3CA 4GU9A 3ATSA 3BYMA 3LCTA 4XYFA 4O81A 2BALA 3LVPA 4LG4A 2VWUA 4U9AA 1PXMA 3I0QA 4L7SA 3ZDUA 4BHZA 2UZOA 3ZC6A 3DNDA 1X8BA 3AGMA 4MBIA 4WIHA 2B1PA 4QYHA 3W2PA 4FL1A 2ZAZA 4G16A 5C8KA 2HIWA 2VTQA 4IIRA 4TYIA 5CNOA 3G33A 4KINA 5L2QA 4AAAA 4W9XA 5GIPE 3NLBA 4GIIA 4HCUA 5JT2A 3QGYA 4FODA 2VWWA 4Q9SA 2V55A 5E8UA 3FMJA 2I0YA 1Z5MA 4YTIA 4HCTA 4DFUA 1ZOGA 1RJBA 2A2AA 4XCUA 4YSJA 4HCVA 5IA2A 3ANRA 4G9CA 3RNIA 2XVDA 3ZUTA 1M17A 5KHXA 5AJQA 2C30A 4BZDA 3FZPA 1IR3A 3KFAA 3HX4A 4FI1A 4UMTA 2C3KA 5CF4A 4GW8A 4O0RA 3MVLA 4EZ3A 4G34A 4PDPA 2ITZA 3PSDA 1YKRA 2YCFA 3DBCA 4F63A 4QMSA 5EI2A 4MXAA 4X2FA 3MFTA 2OFVA 4YNEA 5AP2A 5J7HA 2OFUA 4M97A 5CAUA 1Q8ZA 3JS2A 4O7RA 3G6GA 4LUDA 2XK9A 4FTCA 3OF0A 3IG7A 5AV0A 5I3OA 3UODA 4AACA 4PUZA 4EQUA 5CEOA 3PSBA 5M55A 1O6KA 2IVVA 4KIOA 4A06A 2ESMA 2W1GA 3ATTA 5A4TA 5DIAA 3ZFMA 1H26A 2C47A 4XMOA 3BEAA 2WZJA 2YABA 5CZHA 4RIOA 4BFMA 4Z7GA 2CGVA 4YZCA 2GMXA 4QMUA 4CRLA 3WF9A 4NTSA 3OT8A 4MYGA 4TKSA 2QVSE 5BYYA 5K0XA 4ZZNA 4KBCA 5LWMA 2ETMA 3QF9A 4RWKA 3UGCA 4UYNA 3FLQA 2BHEA 1OKYA 1IG1A 3BHTA 3SC1A 2QO2A 5BVWA 1WBVA 3DBQA 2CKOA 3F2AA 4IVDA 5L2SA 4FEVA 3OWPA 3PRIA 5FM2A 5FM3A 3LLAA 1GAGA 3LFBA 3E8NA 3U54A 3PJCA 4HJOA 3EL8A 3PSCA 2R3LA 5BUEA 2C6EA 4O2ZA 3FMMA 2C0OA 5IA5A 3D7TB 5TOZA 2H9VA 4RX9A 4GVAA 2WEIA 3CS9A 2OJFE 4JXFA 3GT8A 4QMXA 5HKMA 3V5TA 3PA5A 3C9WA 4MF1A 4XV9A 2RG5A 3SA0A 2RF9A 1XJDA 5IZFA 3KXXA 5IH6A 4ARKA 2ACXA 4H3BA 2EU9A 2BIYA 3PXZA 3IQ7A 1ZXEA 4CFFA 4NTTA 4KA3A 2F2UA 2Z7SA 4O7ZA 5D9HA 3O51A 5B2KA 4FSWA 4NCTA 4MVFA 3DXQA 1JQHA 1KOAA 3D5VA 4GEOA 3SOAA 4BDDA 3TUDA 3QA0A 4AA4A 4X0MA 3QXOA 4QMZA 3ZBXA 5L4QA 2CNQA 5AR3A 1FPUA 2C6TA 3QD3A 5IMXA 4IFCA 4O7TA 3B2WA 2WKMA 4AE9A 4AZTA 3B8QA 2W4KA 2DYLA 3Q32A 4FSTA 3EH9A 5AAFA 3UPZA 2XCKA 1RW8A 4WT6A 2OH4A 4K33A 4ACMA 2YCQA 4EH7A 4FF8A 4I1ZA 1W84A 2B4SB 5EQEA 3L8SA 5IUHA 3FLYA 2YIXA 5CU3A 3HA8A 3FMEA 4OTQA 4QMTA 3PXYA 3PIYA 5CSXA 4DFLA 5KMIA 1OL6A 4EOQA 1ERKA 2ERKA 2X2LA 1WMKA 2PHKA 3ZFYA 1IRKA 3JUHA 4E20A 2BKZA 4P2KA 4EHGA 4QO9A 1L8TA 4ASDA 1YWRA 2QI8A 5LVLA 3ZLYA 4FV3A 4OGRA 4KUJA 3VJOA 2BHHA 1PKDA 4DCEA 4DFBA 3EQIA 4U5JA 4Q5HA 1PW2A 5HG7A 3IS5A 3H9OA 3AMBA 1PJKA 4OTWA 5DT3A 2BTSA 2RFDA 4L52A 2XNOA 3RGFA 2ZOQA 3LOKA 4F7NA 5I9YA 1S9JA 2ZV8A 3R83A 5EM7A 4ZSGA 4FNXA 2YITA 2BDJA 4YHFA 1ZMVA 4JT3A 4BDIA 4JNWA 1H0WA 3Q5ZA 3HYHA 3U9NA 1XBAA 1Y91A 1OL5A 4HNFA 4KSPA 1JKTA 1UWHA 4DAWA 3FMHA 3O96A 4EOKA 3FBVA 4GYIA 2BDWA 2HOGA 5GZ8A 5KZ0A 5DBXA 3R7YA 5IQIA 2P33A 2JKMA 3DCVA 3QWJA 4FR4A 2OKRA 4L3JA 4AS0A 5M09A 2Z8CA 4GIHA 3IKAA 4RZVA 3CQEA 3SVVA 2C0IA 3EQDA 3OXIA 4LYNA 4CT2A 3PZHA 1KV1A 3BU6A 4L9IA 4HPUE 3VS4A 3GU8A 3JYAA 5HLWA 2XNMA 4DLIA 3TUCA 1TQMA 1MQ4A 5ACKA 5BPYA 3D4QA 3A60A 3W55A 3FY0A 5HICA 4G3GA 2YCRA 3PVGA 3UOLA 2JFMA 4LOPA 3WE8A 5JMSA 4FEXA 2HK5A 3K3IA 4EK4A 4RX7A 4YNOA 5D10A 4FSMA 3TZ9A 4F9AA 1MRVA 3SHEA 2UVYA 2QU6A 5HNGA 1BL7A 2PVFA 4M8TA 5JFVA 1PXIA 3DS6A 3ELJA 3TCPA 3DOGA 4XG2A 3OHTA 3PXFA 4IAYA 4LQMA 3U87A 2XNGA 3KRLA 2PL0A 3FPQA 4M66A 2HW7A 3OXZA 5J1VA 4ZTSA 4FSRA 3FHIA 4L67A 1MQBA 4D1XA 3DTCA 1NXKA 4D4YA 4X7QA 3D2IA 3IGOA 1P4OA 2R7BA 3F3ZA 3PVWA 4NJ3A 3SQQA 4DGLC 4K18A 5AR7A 5HG8A 3C5IA 4BN1A 3P9JA 3VUHA 4O7SA 5AUUA 1UKHA 4DYMA 2VN9A 1K9AA 2C1BA 5M06A 4UEUA 3V8TA 1ZLTA 1QPJA 4MX9A 3FI4A 4JL9A 5EOBA 5HBHA 3VWAA 4WBBB 4AG8A 2CCHA 1BYGA 3UBDA 3F7WA 2C4GA 4YC6A 2WPAA 3LFCA 2UW5A 4GK2A 3F3TA 3QA8A 4NYEA 3Q4TA 2JDSA 3NR9A 4YZBA 5IF1A 4CCBA 3NYXA 2ZV2A 3CBLA 4G6OA 1AD5A 4PX6A 1ZOEA 4FIJA 3V3VA 5HE1A 4EBVA 4I92A 3ZLXA 4EOMA 4FX3A 4RWJA 2VWIA 4XG7A 3P23A 4JX3A 1WZYA 2VWVA 4NIFB 4OAVB 4JDJA 5IEXA 3COKA 3HRFA 4YJRA 2QODA 2P55A 2PK9A 3CEKA 4L44A 4X3FB 5KUPA 3L1SA 3R63A 3A8XA 3BHUA 5I9XA 4F1OA 1U4DA 5CEQA 2CKPA 3MYGA 4DGMA 4Y8DA 5M07A 4NK9A 4NSTA 3TZ7A 1PYEA 1UU7A 3TT0A 1NVRA 3CCNA 2VTHA 4RJ4A 4L00A 2B9HA 4QMNA 1FBNA 4G5PA 4TYHA 4PPBA 5BMSA 3VF8A 2V22A 4M0YA 4YJVA 3EB0A 4IWPA 4QTCA 2AYPA 3PPZA 3NAYA 4V0GB 4S32A 4D9UA 4PPCA 5CAQA 3R71A 1UKIA 2IN6A 2GCDA 4DF3A 1T46A 4KKEA 3PJ3A 1H01A 4BIDA 2XNEA 4FNZA 4I5CA 3LCSA 4O0XA 2BVAA 4EZ5A 3S0OA 2P2IA 1IEPA 3T3UA 2OU7A 2QHNA 2IJMA 2QO9A 4RC4A 3TG1A 3FJQE 2YDJA 5LVPA 4MKCA 4CMTA 4UWCA 5DT4A 4QTDA 5AEPA 1IAHA 3ODZX 3CD8A 4AT4A 4XG8A 5ANDA 5KNJA 3ZTXA 3PLSA 4DFZE 5CEMA 4QYEA 3DFCB 4WOVA 4XRJA 3D5WA 2IWIA 3O17A 3IGGA 3T9IA 4KBAA 5LWNA 2PPQA 4FV0A 4FT3A 1ZYSA 4W9WA 2EUFB 3OFMA 3CTJA 4IX4A 4UB7A 3VULA 3FXXA 4AF3A 4DN5A 4PDOA 2XYUA 5AIRA 4DEAA 3FC1X 2QOIA 2PUNA 4EOIA 4JQEA 5CXHA 3GVUA 3K5VA 3GNIB 4GUBA 2Y4PA 4ITJA 4JAJA 4W4VA 4XUFA 4JG8A 5E91A 3V5QA 1WVXA 4FVRA 5HTCA 4TTHB 5H9BA 5IQBA 2X9FA 3PJ2A 4PV0A 5DR6A 4ACHA 3F2RA 3CPCA 1PKGA 4YU2A 2KTYA 3QCYA 1ND4A 4KKHA 4M14A 3UYTA 5I5ZA 3TIYA 2UVZA 1OITA 4O0TA 4MQ1A 4JG6A 4X2JA 5HNBA 4IB5A 2BZIB 4PQNA 5CYIA 3R9HA 4K6ZA 2YA9A 3KF4A 2W5BA 3W2RA 4UV0A 2J90A 3VS1A 3CIKA 3CP9A 5BVOA 3JVRA 2Z02A 2QR7A 1Z57A 4Y73A 5DRDA 4FV9A 2GU8A 2WTJA 3A7GA 4BCFA 4BTFA 3QQKA 2J0MB 5F1ZA 4RC2A 3PG1A 3QZIA 5DMZA 1FQ1B 2J0LA 2JEDA 5FTQA 2W4OA 3OCTA 2J7TA 3FZSA 3R21A 3N51A 4M7IA 1P4FA 2R3GA 2XMYA 3DT1A 3BHHA 4F9WA 2VRXA 3EMGA 3Q4ZA 5CI6A 3HAMA 4BGHA 4NKAA 2VX0A 1P2AA 4ZEGA 3RCJA 5E8TA 1VR2A 3W8LA 4BDKA 3DB6A 3KRXA 4L8MA 3JY9A 5CALA 2IG7A 2RSVA 1Q8YA 3QKKA 3QTSA 1E1VA 2FA2A 2YERA 4P5QA 3SDJA 4UZDA 4C4JA 4NKSA 3COHA 3LM5A 5DT0A 4PP9A 3VBVA 5I9VA 3O8PA 2YIQA 5CWZA 4RC3A 1XBCA 3KKVA 3LCDA 4ACDA 4EOSA 2FO0A 4RJ6A 4C2VA 4I24A 4PMMA 4QT1A 3C4XA 5M4UA 4B6LA 4BZNA 5KMNA 4RGJA 3ORTA 5HBEA 4H36A 5HE3A 1WBPA 1U54A 4FKPA 5DG5A 5EDPA 2YIYA 3CXWA 3FI8A 1Q5KA 1YI6A 3GCPA 4DFNA 4I4FA 4FOBA 2FSTX 4JAIA 3BHVA 3S00A 3E63A 5CASA 4UMRA 2HZ0A 3D7ZA 4S30A 3I81A 3ZM4A 5I9WA 3U6HA 4PL3A 2VTIA 1OB3A 4CV8A 2BRGA 4H58A 3UMWA 1KV2A 4KIKB 4QTBA 4ANBA 1XH5A 3D2KA 4BDJA 3W2QA 3QLGA 4FNWA 3R73A 3QFVA 4ANOA 5M56A 4QQJA 4ZY4A 2VO6A 4UX9A 1Y8YA 3KK8A 1OL1A 4USEA 3F3UA 4EOPA 2H6DA 5KMOA 3BI6A 4AFJA 2ITYA 1M7QA 2XYNA 3PY1A 2PVYA 3F3VA 4X3FC 4IWQA 2FH9A 4W4XA 4A4LA 4BDFA 3RZBA 3UZTA 2UZEA 4QQ5A 3ODYX 4FA2A 2W1DA 4I23A 1GZ8A 4HYIA 4GV1A 2CPKE 3QTWA 5CX9A 5EDQA 2C3IB 3Q9WA 4AOTA 4I6FA 4U45A 2QOCA 4AXAA 3FXZA 2YCSA 3RK7A 4GMYA 3UTOA 5HD4A 2NRUA 3POZA 4XNEA 1KE8A 4D1SA 5L2IA 2ZB1A 3HL7A 3IOPA 4JVGA 3O7LD 2CJMA 4IM2A 4JQ7A 2W4JA 4WNKA 5JGAA 5AV2A 1XH8A 3GCQA 3HVCA 3I5ZA 2GS2A 4FG7A 4DGOA 3PPJA 4AGDA 3THBA 3NX8A 5C8MA 1Y57A 3E93A 3S4QA 5M4IA 1G8SA 1OIRA 1BI7A 4YLLA 3QALE 2XM9A 3DZOA 4NM3A 2YWPA 3TIZA 4B8MA 4E5WA 3OWJA 2UZVA 3C4WA 2BRHA 4RLKA 3I5NA 1YVJA 4L45A 4HZRA 5DWRA 5IQHA 5J5SA 2V7OA 4KAOA 2UZWE 5JGBA 3EZRA 4L3LA 4XV2A 4L46A 3MVMA 3PVBA 3PXRA 3V6RA 4XH6A 4EQCA 1H28A 4LGGA 5HBJA 2WMXA 2BFXA 4BCOA 4HW7A 4JR3A 3PFQA 3A4OX 4IXPA 4FSZA 3P78A 4YPDA 2OJJA 3ALOA 5BYZA 3ZZEA 3PWDA 1OIYA 2ZVAA 4R7IA 3C4ZA 4KRDA 5HIEA 3ID6C 4HOKA 4FKRA 3RINA 4ASXA 4C58A 3OVVA 4CFMA 4DHFA 5ETFA 4P7EA 5AR8A 5D11A 2QOHA 4R78A 5CU4A 4GFOA 3R8MA 3DBFA 3R7OA 2ETKA 3ZXTA 2PULA 3KA0A 4M3QA 1NA7A 2VWYA 4X3JA 2CNUA 1G5SA 2BR1A 4ZTMA 4EC8A 3JPVA 5LVNA 3FMDA 1YOMA 3UVPA 3KVWA 2Y6MA 1ZYLA 3GFEA 2OJ9A 2REIA 2E9OA 5EH0A 5IISA 4A9TA 3JY0A 4PMSA 2A1AB 3R8UA 3FKNA 3REPA 1WBTA 2XK3A 3VUGA 3V8SA 1SMHA 3BE9A 2R7IA 5IQEA 4S34A 5J9YA 4BCHA 3KN6A 3MV5A 2QOBA 3I79A 3L8VA 1ZOHA 5HGIA 2B9IA 3F66A 4PRJA 4O83A 4FICA 3FC2A 5GIOE 5KMKA 3EWHA 3TL8A 3SRVA 3GC9A 3R6XA 2C5OA 5A4LA 3E7OA 1Q61A 4R7HA 4FG9A 4E5AX 1H1PA 3DAKA 5HQ0A 4RVLA 3E62A 3VS6A 4CGAA 2RGPA 4FKOA 3WARA 4E1ZA 2XM8A 5AP0A 3UQCA 2VTTA 2WQEA 4O84A 2Z60A 2SRCA 5KZIA 5CTPA 2E9NA 1PXKA 3UE4A 4EOOA 1YHWA 3QQHA 4JBPA 4YTCA 4YHJA 5JFWA 4RSSA 2UZTA 1WBOA 3DBDA 4GCJA 3EKKA 3QC4A 3KRRA 1G3NA 3RAKA 4A7CA 3SGCA 4WBOA 2AC3A 2ITPA 4GFMA 1PYXA 3FMKA 4IFGA 3AXWA 2PU8A 5CAVA 1WCCA 3ZO2A 2W5HA 1V0PA 2JKKA 3ORXA 2PUIA 4O82A 3DA6A 3RM7A 3PY3A 4ZZOA 3ZUVA 3GC8A 2P2HA 2OG8A 3KN5A 4H39A 3LJ0A 1UU3A 5CY3A 2B53A 3SG9A 2OZAA 2PE0A 4QNAA 3CKXA 1M52A 3KRJA 5CQWA 5LMAA 5EI6A 2C5XA 2W1IA 4U7ZA 3TUBA 4D28A 3FZTA 2QCSA 3PTGA 5E1EA 3NYOA 4BGQA 4EWHA 1MUOA 3RPRA 4EJNA 3SW4A 1Q4LA 3ZSHA 3KU2A 2ITWA 4AW1A 2XUUA 4U8ZA 4Z9LA 1HOWA 4CKJA 4BKZA 4FV7A 2PY3A 4RZWA 3F6XA 4C38A 4F6UA 4PF4A 3KXHA 5EKOA 3SKCA 5HCXA 1H24A 4I5PA 4XBUA 4TW9A 2QOOA 3AD5A 2F7EE 4FIFA 3RCDA 3VBXA 3U55A 5K3YA 4GH2A 5IQFA 4I6QA 2HYYA 4RX8A 4TRLA 4ZXTA 3UVRA 2XKEA 3Q3BA 4BCJA 3HKOA 3MH0A 4IH8A 2PTKA 2QD9A 4IX3A 4DEIA 1OPLA 2W96B 4YC8A 1WVYA 4HYUA 3QWKA 3E92A 4LOOA 5CF5A 4CLJA 4PPAA 4Z7HA 4FZAB 2PUPA 4LFIA 3OT3A 3NUYA 4WG3A 2Q83A 2IW6A 2VUWA 5AUXA 4C4HA 5DA3A 1Q99A 1Q41A 5BUIA 3SV0A 4MXZA 1XKKA 4QMQA 3Q2MA 1QPEA 2WU7A 3IECA 4DFYA 3RWPA 2PMLX 2JC6A 3OZ6A 4NW5A 5A54A 5IQDA 3AC4A 3UOHA 5HCZA 3L8XA 3E64A 4FGBA 3GU6A 2JBOA 4JDHA 3UP7A 3F2NA 4XOYA 4XOZA 2UZLA 4CLIA 2GS7A 4ZK5A 4E5BA 4JLCA 4J96A 4J8NA 4ACGA 1E9HA 4GT3A 2C5YA 1GZOA 4ID7A 4D2SA 1ZMUA 3SOCA 4F0FA 4O22A 5TT7A 4C57A 5AX3A 3ZRLA 4CYIA 4I20A 2ITNA 5HCYA 3TWJA 3PA4A 4OT5A 4RWIA 4LRKA 2CLQA 4R77A 4YUQA 2J2IB 4KS8A 4K9YA 2W05A 4GVJA 4QP1A 1REJA 3U6IA 1PXOA 3LFDA 3II5A 1Q8TA 4AN3A 3ZSGA 4G3EA 5CZIA 4RJ8A 3HV6A 4KS7A 1GIHA 3UIUA 1J7LA 5AAGA 3WF8A 4BCIA 5KMJA 2CKQA 3GFWA 1BL6A 3BBWA 3FLZA 3BU3A 3MVHA 2I0VA 1ZMWA 3GOKA 4FZ7A 3VQHA 4OW8A 4APCA 3EFLA 1JLUE 3OCBA 1PMVA 5IG1A 4IZ7A 4C3PA 5EI8A 2I0EA 4I41A 3GU7A 1RE8A 3GP0A 1ZAOA 2O2UA 4BTJA 3TM0A 2W1ZA 2JDTA 1YQJA 3A7JA 3NW5A 5C9CA 3W8QA 2OIDA 2R3KA 3GQIA 3HV7A 4QYGA 1YDSE 4U79A 4XG3A 4GRBA 5AFVA 5HEZA 5L6WL 3DPKA 4NCTC 4TYHB 5GZ9A 3Q9YA 5A3XA 4NH1A 2WMVA 4JRVA 4TT7A 2G2IA 4OTIA 3WF5A 5CXZA 3NCZA 3I7CA 4U81A 3WF7A 1UWJA 5JSMA 2YM6A 3LXNA 3H0ZA 2C6KA 4WUAA 1H00A 3FLSA 4ZTHA 3HDNA 3VQUA 4JDKA 4CRSA 1CSNA 4H3PA 3G2FA 4FTNA 4MBJA 3LE6A 3VRYA 1YXTA 4AA5A 4FMQA 4S31A 1XR1A 2X2KA 4C02A 3RP9A 4F9CA 4QNYA 3GCVA 3MH3A 2YIWA 5IMEA 4CYJA 5L6PA 5KE0A 1LEZA 3RPOA 3W2SA 3WYXA 3ZLSA 3BBTB 4IWDA 3U4UA 4XLVA 1Y6AA 2PZIA 1JKKA 4AZEA 4YURA 3RAWA 1J91A 3I4BA 3KEXA 2ERZE 2VNYA 3NRMA 2VWZA 2GPHA 2WMAA 5E8WA 3ZH8A 1DS5A 4PNIA 5C8NA 5AM7A 5DR9A 5AP1A 5M44A 1W83A 3N4UA 5FEEA 3CTHA 3MFRA 5EHLA 2F4JA 4RFYA 4BDEA 4C3RA 5J8IA 4E7WA 1LPUA 5CU0A 4HPTE 4CEGA 5LMBA 3QUPA 4A9YA 4EC9A 2PVNA 3IDCA 2GNLA 2CMWA 3AT2A 4NM5A 3Q5IA 2QOQA 2OK1A 4MXYA 3LHJA 2BMCA 4MWIA 4XP3A 4D2VA 4J71A 5M4FA 4IANA 3TTJA 2WNTA 4C0TA 4EHEA 4MAOA 4DEHA 5AR2A 4RQVA 1MRUA 2WTCA 5HESA 2HY81 3VNTA 2W99B 3K5UA 3QD0A 2WIPA 2IW9A 5M51A 5AA9A 1PMEA 2AC5A 3R7EA 4BCPA 4BI0A 2JDVA 5I4NA 5GNKA 3QD2B 1FVVA 3TI1A 5BQ0A 4YJPA 5CENA 4YTFA 5GZAA 2C69A 5AADA 3R01A 3LFAA 3MH1A 4MNEA 3QQLA 1KUTA 2BCJA 5KO1A 3SAYA 2X7FA 1LUFA 2R0UA 3QHWA 5E8VA 4CD0A 1XWSA 3PVUA 3FQSA 3ITZA 3WBLA 3COIA 3BV2A 1IASA 5AV3A 3MY5A 3QCXA 4DH3A 3CGFA 4S33A 4FUXA 3U9CA 3VW6A 4FTMA 4LM5A 4Y72A 2OF2A 2ONLA 2EWAA 4QTAA 5E7RA 2NPQA 2RIOA 3UC3A 1OUYA 3RZFA 4EEVA 3M42A 3T8OA 2J5EA 2YHVA 3OBGA 3R8LA 3GB2A 1VYWA 2WMUA 3TKIA 3RKBA 3VHKA 3W1FA 1IA8A 3E8CA 4YMJA 3H4JA 5GINE 4MXCA 4O7YA 2X8IA 3VRZA 4R3PA 1MRYA 5ANGA 4FL3A 5AAEA 3FYKX 3ZYAA 5K5XA 5ANJA 1ZZ2A 2V7AA 2Y6OA 5FP6A 4X2NA 5CANA 4DTBA 1W7HA 2YJSA 3E88A 3NUNA 4RPVA 4TYGA 4WUNA 3SX9A 4F64A 1U54B 5HVJA 4HVIA 3G5DA 5EYCA 4R7BA 4ZSLA 1LP4A 3R22A 4J95A 3PDTA 3R7VA 4GG7A 2Y0AA 3R2BA 5IU2A 3ULZA 2GNGA 3C4EA 3P7CA 4ZTQA 3C0HA 4ZJJA 4BDHA 4BICA 3BGQA 4F6SA 5L8JA 3BHYA 4L43A 3WIKA 3LKMA 2XK4A 1PMNA 5BVEA 4C59A 2Z7QA 1V0OA 3G90X 3P7AA 4KBKA 4NFNA 3WI6A 4FZ6A 1VEBA 2PYWA 3MFUA 3ACJA 4IX6A 2XEZA 4EWQA 4FKJA 4QP3A 2XF0A 4E4NA 4O91A 3VW8A 1A06A 4EKLA 5JH6A 4FT7A 1OI9A 5HTIA 3VUMA 4YLJA 1W98A 4FK3A 4IMYA 4F0GA 2AUHA 5IEVA 4IBMA 4QP8A 4HVHA 3H30A 3PXQA 4E3CA 1V0BA 3AMYA 4AT3A 3HMNA 4QYFA 2YWVA 4ASZA 4CFWA 1Q3WA 1W8CA 3RHKA 4A4OA 4AOJA 3OCSA 1Q24A 2FYSA 1DM2A 2H8HA 2X0GA 3GENA 2C0TA 2LAVA 2DS1A 2IZTA 1Q8UA 3A61A 3FPMA 4FUYA 4GFGA 3L9NA 3KVXA 3OY1A 5JQ8A 4D4VA 3COMA 4OLIA 3MESA 1YI3A 3DLSA 2XJ1A 5BX0A 3OW3A 5I9ZA 5HG9A 4FVQA 4ZLZA 2Z7RA 4I21A 5BMMA 2BAKA 3RHXA 4FVPA 2VTNA 2JIVA 5M08A 1KSWA 1I09A 2CGWA 3DQWA 3LIJA 3PXKA 4QMOA 4F9YA 3PE2A 4FOCA 2IW8A 2XH5A 3GEQA 4TNDA 4A9SA 4JG7A 3WZJA 2ITOA 3ZHPC 2DQ7X 2YZAA 4TNBA 3S3IA 3EQHA 4R1VA 3W32A 5KCVA 4EK3A 5EQYA 3DAJA 2WQNA 4DBNA 1UNGA 2XRUA 4KABA 4BBEA 4DEEA 4BB4A 2WMRA 3DJ5A 4BI2A 4D0XA 4IVBA 5EM8A 1PXNA 3OW4A 3QTIA 4AGWA 3VBQA 4APPA 3EKNA 5KKRB 4R5SA 3DXPA 4YJNA 2VTJA 2PZ5A 2P0CA 1PMUA 3EZVA 2OZOA 2X7OA 3A4PA 3HV3A 3FUPA 3JR1A 5T3QA 4DA5A 4EJ7A 3N9XA 4DEDA 5J1WA 3V5LA 4E4XA 3BQRA 4L01A 3UOJA 3NNXA 3ORZA 2WMWA 2XNNA 3DY7A 2CLXA 4NEUA 3V5JA 4CTCA 5DYJA 1YDRE 4GYGA 3DJ6A 2UZNA 2OSCA 3LFEA 4WNPA 3ORNA 5IA4A 2UZBA 1QPCA 2WQOA 1OZ1A 2W1EA 1OKVA 3IOKA 4YJUA 4BCGA 3A99A 3LXKA 3MH2A 3VAPA 4E4MA 5ANEA 1GZNA 4FG8A 1XBBA 4OTFA 2I6LA 3VIDA 4HGEA 3PP0A 4FNYA 4O21A 2OO8X 5CSHA 4EH4A 4M13A 4J53A 3A2CA 3V04A 1QCFA 1SVEA 3F5PA 5C03A 5HO6A 5A46A 4IM0A 1VZOA 3OOGA 4EUTA 4J8MA 2PZRA 3DKOA 2CN8A 2J0IA 3P7BA 1PXJA 4O38A 3QYZA 4R5YA 2YM7A 2QLQA 2YM5A 4EH9A 3ROYA 2C5NA 4FEQA 2XB7A 4JIKA 4KIQA 1NVSA 1OVEA 4IE9A 1FVTA 4TWNA 2QO7A 4MH7A 5IA1A 4DTAA 2VO0A 1KOBA 3P86A 5DH3A 4RIYA 4MNFA 3WZUA 3G15A 2X81A 3HDMA 2XRWA 5LOHA 4O96A 1BX6A 3DDQA 3TZMA 4F7JA 5CEPA 5K4JA 1OMWA 3IONA 4H05A
chains in the Genus database with same CATH superfamily
4PWNA 4QMMA 3E5AA 3U51A 4FEWA 4TWOA 4GKIA 4XP0A 5I0BA 4OUCA 3HMOA 5L6OA 4EQMA 2ZB0A 4AUAA 3BV3A 5AWMA 2J51A 3D7TA 3NYNA 3V5WA 2W9FB 4QP2A 2HY0A 2PMIA 2CDZA 3FZOA 2GQGA 2JFLA 4V01A 3TJCA 2V0DA 4O4CA 1CKJA 3LM0A 3LXPA 2ZV9A 2VX3A 4Z16A 2XBAA 3F69A 3M2WA 3R8VA 2GNJA 4QQTA 4YC3A 3H0YA 2XIYA 2X8EA 2YLFA 4PL5A 3LPBA 4XG6A 4D9TA 4HVSA 3AKLA 3DXNA 3FI2A 2ITVA 3NUXA 3CR0A 5CSPA 3FHRA 4YJOA 4M84A 3ANQA 5JKGA 4DHZA 1KE5A 2G2HA 2WXVA 4FK6A 4BKYA 3KCKA 2FB8A 5CSWA 1FGIA 2QNJA 1NT2A 4S2ZA 4FV4A 3F88A 4UZHA 4N6ZA 3RAIA 2UW8A 3CJFA 4XV1A 3TV6A 2Z7LA 2QLUA 5FTGA 1IAJA 3TKHA 3NW7A 5D7AA 2VTMA 3NYVA 4MQ2A 3DK3A 5DR2A 3CSVA 3HUBA 4C36A 1SYKA 4QPAA 3T9TA 2IVSA 4XP2A 3I0OA 3VS7A 4AFEA 2VO7A 2OZAB 5BVFA 2OF4A 4I5MA 4UMPA 3D5UA 3EQPA 3MW1A 4NW6A 5JRQA 1FOTA 3MJ1A 4D2PA 4ANLA 1ZWSA 1GY3A 3QX4A 1O9UA 4ACCA 3ZU7A 2NP8A 5D7VA 4N0SA 4ORKA 1M2RA 3AT4A 4JI9A 3UIXA 4DC2A 5HTBA 3PY0A 4DG0E 4E73A 2Y9QA 2JIUA 4O7VA 3KB7A 3KK9A 4FV2A 5EHYA 3IK3A 3BU5A 2A19B 2J50A 4FTAA 2ZM4A 2UW3A 1P5EA 2OXYA 3LFQA 3Q6WA 4KNBA 5FXSA 4C34A 4ZTLA 3QZGA 4KKGA 4NWMA 5FBNC 1K2PA 3TEIA 4CKIA 4D5HA 3BLHA 3VN9A 3AKJA 4Y83A 2I1MA 3ZO3A 1H27A 2BZKB 3OCGA 1GZKA 3HP5A 1GOLA 3R04A 2XKCA 2EXMA 5EK7A 1OIQA 1CKIA 2YLEA 4ENYA 2UW6A 2ITQA 4FC0A 4FIHA 4G3DA 2BPMA 5K4IA 2XBJA 1G8AA 1R0EA 4C8BA 3NNVA 5EOLA 3QCSA 4Q2AA 4N4SA 4QD6A 1UNLA 3ZRMA 4DH7A 2JAVA 4N70A 5KKRC 3ZC5A 5AP4A 3RK9A 3DK7A 1PHKA 5BVDA 2O64A 2WQMA 3PRFA 5HU9A 3LFNA 2OH0E 2QG5A 2BZJA 4X6RA 4G9RA 2XAOA 1BKXA 3UC4A 3CJGA 3UP2A 3VUIA 4CZYB 4I4EA 2F2CB 4N57A 3ORLA 5LMKA 4AZWA 3PYYA 2W1CA 4IB1A 4NM7A 5LCKA 3VC4A 4BCNA 3OMVA 4RG0A 4CSVA 3IW4A 2Y8OA 3E3PA 3W18A 4BTMA 3U6JA 2GSFA 4LMNA 5HX8A 3BL9A 3OOMA 4IJ9A 4K77A 2CKEA 4YZDA 3ZRKA 3EN6A 3DFAA 2X2MA 4RIWA 2WTKB 4U6RA 1APME 5GJFA 3TJDA 2GS6A 4IZYA 1W82A 4CMOA 5EM5A 2UW7A 2R9SA 3BPRA 3LJ2A 5HOAA 3VBYA 4FJVA 3NW6A 1M2PA 3CQUA 4AWIA 1F5QA 4F9BA 2WOTA 4AW5A 4U43A 3TDWA 2YDKA 3Q52A 4GT5A 4BZOA 1Q3DA 5D41A 2YM4A 4G1WA 3AG9A 2JDRA 4FT0A 4EOJA 1H0VA 4FBXA 2FUMA 4MD7E 3BYVA 3UG1A 4Q9ZA 2XIZA 4BF2A 3GI3A 3R7UA 3U4WA 4D55A 3QQFA 3MFSA 2IZSA 4OT6A 5M57A 1U46A 4AZVA 3NMUF 3MGYA 3TV4A 4FKIA 4F1MA 3GOPA 4D1ZA 3C0GA 4FKVA 3ZBFA 4G3FA 4K11A 4FGRA 3BIZA 3JVSA 3AC5A 1JKLA 4CNHA 2R3OA 5TO8A 4ZAUA 2WIHA 5LXMA 3VUKA 4FTIA 3MBLA 4DT9A 4QP7A 2FSLX 4YBJA 5CU6A 1DAYA 4LL5A 4NU1A 5FLFA 2B9JA 1R39A 2C6IA 3R1YA 4QMYA 3V5PA 3ZSIA 3DK6A 5ACBC 2IVTA 1YXSA 3QZHA 4V04A 3RMFA 4DE4A 4YTHA 5CI7A 5JFXA 2ITXA 4DT8A 5A14A 4C37A 3DKCA 3LMIA 4AGUA 4FE2A 4EH8A 2RFSA 2WFYA 3PZEA 4IVAA 2VWXA 4JR7A 3FZRA 4XRLA 1W2CA 3HRBA 3ETAA 3OG7A 4BIBA 3QLFA 4O7WA 2QURA 3HUCA 2XIXA 4MWHA 1YXXA 3RPSA 2W1HA 2ITUA 4W4WA 3VVHA 3PLAE 1A9UA 4AQCA 5AMNA 4C3FA 4F1TA 1OBDA 3O5AA 3HRCA 4BRXA 4DCAA 3L9MA 5CSVA 3LFFA 1J1BA 3QRIA 4IDVA 4AA0A 4W4YA 2BTRA 4B0GA 5FUTA 4AZFA 4UMQA 3R7IA 4F99A 4JQ8A 4IW0A 4GKHA 2XK7A 5GHVA 4LUEA 3WILA 4X2GA 4BWKA 3D94A 3TXOA 4ERWA 4ZJVA 4IZAA 2ZFYA 2G01A 1WBSA 3CTQA 3IW5A 4IC7A 4GUEA 3DAEA 5FWKK 4EK6A 5IA0A 2ZM1A 4XHKB 3NNUA 3BYSA 2Y7JA 4AXEA 3CY3A 4E26A 2NO3A 4YR8A 5IKWA 1BI8A 1REKA 2WELA 2R3JA 4PL4A 1SNXA 4WRGA 2V5QA 2YM8A 5BUJA 4WA9A 4FSYA 1OBGA 3AC1A 3Q4UA 4MEDA 5K5NA 2BKKA 3BWFA 5DRBA 3LMHA 2WO6A 3S95A 3WYYA 2PE2A 2VWBA 2PVHA 5CU2A 3OEFX 3FKOA 3G6HA 4C4IA 3UDTA 3BL7A 3N4TA 3P79A 3G0FA 2C68A 4F4PA 2EXEA 4H3QA 4HYSA 2JAMA 3R9DA 4ZLYA 2A4LA 1UU9A 1ZY5A 3W0RA 5CQUA 4I22A 4CQGA 4RWLA 4AOIA 1O6LA 3LQ8A 4EZ7A 4A4XA 3H9RA 5EW3A 4IHPA 4JS8A 5E4HA 3ORPA 3O0GA 5E8SA 4FIGA 4KRCA 3K3JA 1FGKA 4HGTA 3QTQA 3QQJA 5DNRA 3P0MA 5KHWA 4EKKA 5IQGA 1YW2A 4LV5A 3UPXA 4MNEB 4FSQA 2F7ZE 1URWA 3G51A 4RIXA 4BCMA 1J1CA 3ACKA 4F7SA 4UWBA 4WKQA 5FBOA 3TNWA 4F09A 4JBVA 5IDPA 4QP9A 1Y6BA 2B54A 3TNPC 1QMZA 4C62A 2A27A 1HCLA 1SVGA 1OKZA 1Y8GA 4ENXA 3VUTA 4C61A 4PP7A 4DLJA 4O0YA 1KE9A 4OTDA 3UNZA 3DDPA 4WSYA 2PVLA 2QHMA 4WRSA 3ET7A 3TZ8A 3V8WA 4GK4A 1BMKA 4I5HA 1CDKA 1RDQE 3MY1A 4LGHA 4O6EA 5F20A 4YHTA 2BZHB 2G15A 3LCOA 4M12A 1GIIA 3SLSA 5A4EA 3D15A 3N4VA 3PG3A 4TWCA 3FXWA 2HWPA 2CGXA 3CD3A 2WD1A 3Q96A 4R6VA 4C33A 4F70A 5HU3A 1NVQA 2JDOA 4AZSA 3GU5A 4A9RA 5T68A 4BWXA 3ENHA 2R3FA 3A7HA 3E7VA 2WTKC 3CY2A 5C01A 3DV3A 5IA3A 3ZXZA 3FZ1A 5IH5A 1BLXA 3BELA 3R9NA 5CT7A 3A8WA 3HP2A 1XO2B 1U5QA 3C7QA 4HZSA 4M69A 1GNGA 1XH7A 2YM3A 3W2OA 3R30A 5E8ZA 2G9XA 4QPMA 3KMUA 3MA3A 2ITTA 4ZTRA 2QOKA 4CTBA 4P5ZA 3HMPA 2XKFA 3NGAA 3A62A 2BIKB 2F57A 4U41A 3MS9A 3OC1A 4Y95A 5CT0A 4AN2A 2UW9A 3V51A 4K1BA 4DG2E 5M53A 4BKJA 5DEYA 5EYMA 3UJGA 4UY9A 4GS6A 4FSNA 4BJJB 1T45A 4D5KA 3VF9A 4UMUA 2XZSA 4YJQA 4O86A 4EL9A 4A9UA 4QMVA 3RBWA 4IDTA 2C6OA 5IDNA 2X7GA 4QTEA 3HAVA 2HZNA 4ALVA 1XMMA 5D1JA 4BBMA 3UO5A 3G9NA 3AC2A 4GG5A 3CE3A 5JZNA 4OAUC 1UV5A 4DEBA 1XQZA 3TN8A 4KWPA 4YPSA 3KREA 5HVKA 4YP8A 5DE2A 2YAAA 4CFNA 2JLDA 4YLKA 4YJSA 4M15A 3KXNA 4RX5A 3ZM9A 2XKDA 4OTGA 3MPAA 5L3AA 3FL4A 2RG6A 4LV8A 4WO5A 1ATPE 3K2LA 3R1NA 1HCKA 2VGPA 1J7IA 1J3HA 5AP3A 1JAMA 3QTXA 1K3AA 3FDNA 3HGKA 3NAXA 3DKFA 3KY2A 3O71A 2VX1A 3Q9XA 4IM3A 1H8FA 4CZTA 1SNUA 4AXFA 3NZ0A 3PP1A 5DEWA 1H1RA 4G2FA 3KXZA 4FKLA 5C26A 3MPTA 4NT4A 2YDIA 3R9OA 4BYJA 1OL2A 2V62A 5EDRA 1MP8A 3C0IA 2OWBA 3OD6X 4RVKA 4EI4A 5K0KA 4LI5A 1M2QA 2KULA 4XX9A 4YSMA 5ICPA 1U5RA 5IPJA 3I6WA 4EYMA 4BDAA 4U3YA 2VTSA 3D9VA 3P4KA 4YZMA 5JGDA 3QCQA 4L3PA 1OGYA 5DPVA 3HNGA 4UN0C 3DKGA 4FKGA 5HHWA 4EHVA 1FVRA 3FI3A 4HVGA 1YOLA 2R5TA 4M67A 2YISA 2QG7A 3DU8A 5J9LA 1W2DA 5BV3A 2R0IA 1XHAA 3H9FA 1YDTE 4FKQA 2R3NA 3QU0A 3VO3A 5M4CA 4ONAA 1PXPA 5B2MA 3WZDA 5CAPA 2VTPA 4RBLA 2HZIA 4Z3VA 4H1JA 5E1SA 3S1HA 1WBNA 4CG8A 3MWUA 1UNHA 3NIEA 3NIZA 3QAME 5B0XA 2W0JA 2BUJA 4OTRA 4TN6A 2GDOA 5HD7A 1JSUA 4IQ6A 4FV1A 4BDBA 3KMMA 3NEWA 3OTUA 4CZUA 1FINA 1PY5A 3OTVA 2J6MA 3EN5A 3I6UA 2XCHA 4YZNA 4DITA 1RQQA 3I7BA 5AM6A 4F7LA 3AKKA 2VTOA 4RIYB 3G0EA 4H1MA 5TR6A 1QL6A 4QRCA 2F9GA 2OJIA 3NWWA 3KC3A 5CLPA 1H4LA 3F82A 4ZY5A 5KBRA 2ONLC 4PTCA 3ZCLA 3ENMA 4TXCA 5K9IA 3ZEPA 3IDPA 1TKIA 5EYDA 3UYSA 5HIBA 4D2TA 4FTLA 3QXPA 3QD4A 4XG9A 4RJ3A 4D0WA 2BROA 4EORA 5G6VA 5CF8A 1J7UA 3VS2A 2HENA 4JIAA 4LOQA 4RFZA 3NFFB 4EK8A 1FMKA 2HW6A 5DHJA 4ASEA 3PPKA 1B38A 2RFNA 2J9MA 3EIDA 1H1WA 3KXGA 5JFSA 4AT5A 4FYNA 5C4KA 5IQAA 3TACA 4O7NA 4HGLA 4QP6A 2X6DA 2JITA 4IAFA 5CEIA 5FEQA 3D14A 2BAQA 4IZ5A 5DFPA 4JDIA 2DWBA 2YIRA 2PVKA 3MB6A 4PTGA 4RA4A 4L7FA 3PA3A 4EYJA 4DBXA 2Y4IC 3NUPA 3QRTA 5DOSA 4FKWA 4BGGA 4FV5A 5F9EA 4IACA 1OUKA 1QPDA 3WOWA 4RVMA 5AUTA 3AC8A 1WFCA 3R00A 3IW7A 4G6NA 4JJRA 3ZOSA 1YOJA 3CLYA 3MTLA 2JIIA 3QUDA 4N6YA 4WG4A 5CNNA 3ALNA 3QTUA 5AX9A 5J95A 4ZIMA 4AU8A 4TYJA 3VHEA 3LAUA 3KULA 4R1YA 3E3BX 4ZS0A 1WAKA 3AGLA 5ETCA 5LQFA 2XJ0A 3FL5A 1W0XC 4AXDA 3TV7A 3R02A 4E6AA 3R9RA 3F7ZA 3FLWA 1M7NA 2YZLA 2G2FA 2BRNA 2QR8A 4DHJA 3LCKA 4FKSA 5AP6A 4J52A 5DLSA 3KRWA 4QDVA 3LW0A 3VUDA 3QZFA 2R64A 4O6LA 2IEWA 5AUYA 4LMUA 3F5UA 3MDYA 2IZRA 1YWVA 1ZYJA 2WEVA 4ZMEA 3QL8A 3ZO4A 4D4SA 4NJDA 3HZTA 3R7GA 4BVUA 5BNJA 4CVAA 1UU8A 4U3ZA 2JKOA 5FEDA 2VAGA 3W2CA 4Y5QA 4ZSAA 3UDSA 4KB8A 2WHBA 4JMQA 3IW6A 4BDCA 3UO4A 2VV9A 2O5KA 2Q0NA 2PWLA 3C51A 4ZSJA 4TYEA 3NUAA 1CMKE 1H25A 5CF6A 4AW0A 1TVOA 1R1WA 5AA8A 1ZYCA 2HZ4A 3FWQA 3KF7A 3RPYA 4CFVA 3KL8A 4X2KA 2R3RA 3ZEWA 2WQBA 4X21A 5LVOA 4U44A 2YEXA 5J7BA 4DDGA 4UYAA 4FEUA 5C27A 3DBEA 4MD9E 4MK0A 2O63A 3BX5A 4KD1A 4ZOGA 3BLQA 3UOKA 4OBPA 4AN9A 3Q4CA 4BL1A 3LMGA 4U97A 4HVDA 2Z2WA 4IC8A 4E6CA 5H3QA 2JKQA 4U0IA 2B7AA 2R3HA 1CKPA 3HECA 4RRVA 2VTLA 2XEYA 2GHGA 4RIWB 4Z55A 3W10A 4ERKA 4Q5EA 4ALWA 2VO3A 2WOUA 3AD4A 4I0TA 2UW4A 4FTJA 4PY1A 5FP5A 4CKRA 2IPXA 5AR4A 3PJ1A 3RVGA 2GHLA 3SG8A 5BVKA 3GC7A 3H10A 2ZM3A 4ZTNA 4O27B 3MPMA 3QX2A 3Q2JA 1JSTA 2WMTA 3PWYA 3HEGA 2OIQA 3BGPA 4DINA 2R3IA 3TNIA 4LGDA 5EHOA 1R78A 2EB2A 4DFXE 3P08A 2W17A 4TZRA 3KMWA 4I0SA 4K0YA 2PE1A 4FKUA 3UNJA 4CV9A 4CXAA 4TL0A 3KXMA 3SW7A 4AP7A 3ZDIA 3Q9ZA 4WNMA 4FT9A 4RT7A 2WMBA 2NRYA 4R8QA 3Q60A 4ZY6A 5T6KA 2GNHA 4O4DA 4WHZA 3O23A 2PMOX 2J4ZA 1F0QA 2XK8A 3D0EA 4MTAA 4QMWA 4D58A 4CQEA 1YRPA 4ANMA 1Q8WA 1H1QA 3NSZA 3S2PA 4C4GA 5HO8A 3C50A 3RALA 5HO7A 2OBJA 2JBPA 3VS3A 4YGAA 2GQRA 5TF9A 2X39A 4RQKA 3ZLWA 5AUVA 2WTVA 3BGZA 3UZRA 4U42A 3PIXA 4IAZA 5ANKA 4O0VA 2O0UA 4C7TA 2E9UA 3NFGB 3LXLA 1OGUA 5JN2A 3AQVA 3HMMA 2W7XA 4OBOA 4MHAA 2UZDA 4RFMA 3PUPA 4C4EA 5HE0A 1UVRA 3UQGA 3V6SA 3EN9A 5KX8A 2XANA 3FQHA 1AQ1A 2XS0A 3FE3A 4U80A 4U40A 2W9ZB 4EUUA 4WNOA 3G9LX 3E8DA 4FTUA 2B55A 4GU6A 3RWQA 1VLRA 4GT4A 2C6MA 2YN8A 4OBQA 4DG3E 4D4RA 3GGFA 3NVKI 3EQFA 5HNIX 4E4LA 2ZMCA 3QGWA 4EH5A 2ZMDA 3UIMA 1YI4A 4PTEA 3SD0A 4AE6A 3R8PA 3W33A 3UNKA 3MIAA 5FRIA 2OXXA 1OPKA 2IVUA 3D5XA 2W1FA 3MJ2A 4FTRA 2OJGA 3NVMB 3EOCA 3TDVA 1O6YA 3P1AA 5F95A 3TKUA 4P90A 1DI8A 2XIKA 3LQ5A 2ETRA 4V05A 2OW3A 4Y85A 4J97A 3RTPA 4FTQA 5B2LA 3C1XA 2P4IA 1H08A 1CTPE 1XH6A 3GXLA 4R3RA 4BYIA 4EH6A 3ORKA 4GL9A 4FV6A 4IX5A 5HZNA 5E92A 1OIUA 3EFWA 4IAKA 4C35A 1E1XA 5C4LA 2A0CX 2GHMA 4ITIA 4O0SA 4AX8A 5ETIA 4EH2A 2XJ2A 3FY2A 5CVGA 4F0IA 5IQCA 3RNYA 2R2PA 2JD5A 3SRVB 4BCKA 4EK5A 3PIZA 4XLIA 1ZRZA 3F5GA 4PMTA 4CCUA 2C1AA 3WIGA 3EYGA 1JVPP 4JRNA 5DI1A 2HCKA 2O3PA 2XK6A 2F7XE 2X6EA 2E9VA 3EN4A 3MIYA 4G5JA 1YXUA 3OBJA 3ORMA 4FTTA 2VZ6A 4O4BB 1PF8A 1GJOA 5AIKA 1TQIA 1DI9A 2HWOA 3BCEA 4NUSA 4F6WA 4ALUA 2VD5A 5A4CA 2VTRA 2UZUE 3O2MA 3EYHA 3FKLA 3Q6UA 4MUQA 4ANNA 4MBLA 3QRJA 3OROA 3FEGA 4OR5A 3EFJA 1I44A 2VGOA 5HE2A 3ZMMA 3NUSA 3FYJX 5HIDA 2RL5A 2PVRA 4II5A 5HLPA 2HAKA 3EQRA 3NNWA 2XNPA 1ZARA 4RIXB 3OS3A 5E90A 1JWHA 3DNEA 2UVXA 4QQCA 4IAAA 3OXTA 3U8WA 3O8UA 4X6QC 4IB0A 4FIIA 5CEKA 4KIPA 1PRYA 4RMZA 3EQCA 2PZPA 3HV4A 4CG9A 2EB3A 3KCFA 4MXOA 5EFQA 5FTOA 3MA6A 5J79A 3L9PA 5TE0A 5A9UA 2R3QA 2UW0A 2C6DA 2XAMA 5AV1A 2GTMA 4M0ZA 3CQWA 5F4NA 2FGIA 5HG5A 2QONA 3QQUA 2J0KA 4XJ0A 3NDMA 4XBRA 2YFXA 1TQPA 5JZJA 4FV8A 4D2RA 3VBWA 2J5FA 3ULIA 4NL0A 5FDXA 5FGKA 4LRMA 3O7LB 3IPHA 1M14A 4ZLOA 4QOXA 4W8DA 1R3CA 2R3PA 3F9NA 3MN3A 3E87A 3GU4A 3HV5A 5LMKC 3SXFA 2EXCX 4AQKA 2E9PA 4FYOA 3IW8A 2C5VA 3H3CA 4WSQA 5AP5A 2IZUA 4B99A 1XH9A 5AR5A 5BVNA 1ZZLA 2VNWA 4WG5A 5DN3A 3R8ZA 2VTAA 2PVMA 3ROCA 4E8AA 3QRKA 4ZMFA 3UDBA 4G17A 5HLNA 2OGVA 5I3RA 4Y46A 3OEZA 4ZJIA 3EJ1A 4MF0A 4TPTA 2RFEA 3QRUA 4FSUA 3CC6A 4NZWB 2GNIA 5EG3A 5EW8A 4DTKA 1BUHA 1Q97A 3MSSA 5EM6A 2C6LA 4BY9E 2QOLA 4M69B 5IEYA 1Z9XA 2I7QA 3HA6A 5IH4A 1ZYDA 5AUWA 4Y5HA 3ZS5A 2XA4A 4PDYA 4O2PA 5J5TA 3Q04A 5E9EA 4PDSA 4LRJA 2WAJA 3W16A 2R4BA 1B39A 3BYOA 4J7BA 3HLLA 3RI1A 4DEGA 1XH4A 3ZZWA 1CM8A 5JRSA 4RA5A 1YHVA 2X8DA 1KE6A 3QC9A 3WE4A 4E6QA 4O1OA 3QKLA 4ZP5A 2XNBA 3RAHA 2ZJWA 3QKMA 3UIBA 4MXXA 3VBTA 4BIEA 4ZSEA 2PSQA 4O0WA 3ZUUA 1WVWA 3BQCA 2GTNA 2H96A 4DH8A 1DAWA 5EQPA 2GFSA 4UXQA 2VU3A 5HVYA 5CAOA 3BLAA 5AP7A 4DDIA 2W5AA 3NS9A 2CHLA 3SXSA 3L8PA 4DH1A 1OPJA 4IB3A 5CVHA 3HMIA 3O8TA 3OUKA 4G6LA 4L68A 1PXLA 3TNQB 3DQXA 3UVQA 3NPCA 2I0HA 2O8YA 4FIEA 3BEGA 5H2UA 4CFUA 2LGCA 3WF6A 2HXQA 3ORIA 2F49A 4GK3A 5BYLA 4DH5A 1AGWA 4ZZMA 3WZKA 5DGZA 3DB8A 2WB8A 3M11A 4EH3A 4FL2A 1L3RE 2QU5A 2WMSA 2B9FA 3NCGA 4XEYA 2QQ7A 2NNWB 3R2YA 4BR3A 4GJ2A 2H34A 2GFCA 3EL7A 3RPVA 2G1TA 3BKBA 3MY0A 1UA2A 1SVHA 4O7LA 4TY1A 1A48A 2FVDA 5D12A 2OLCA 1STCE 2R3MA 4M68A 4YBKA 2QKRA 3MTFA 3POOA 4B8LA 4O1PA 2X4FA 3IDBA 3UQFA 1JSVA 2CGUA 5J87A 3WZEA 3UO6A 5H8BA 3Q53A 4JBOA 4CFXA 5AV4A 3GUBA 4UWYA 4E93A 5F94A 2YACA 3K54A 3SXRA 1H07A 3PJ8A 1OKWA 5LJJA 3VS0A 4F08A 4BDGA 4PMPA 2BAJA 4JX7A 5FQDC 3W0MA 4ANSA 2ZDUA 3TNHA 1NW1A 2P3GX 3EFKA 1YHSA 3FSKA 4BI1A 3FV8A 3LLTA 2PMNX 4HGSA 4B9DA 3M1SA 3VS5A 3KQ7A 4NIFA 2NYAA 5LARA 5EYKA 5DVRA 2XP2A 4AGCA 4X3FA 4J99A 4DGNA 2J0JA 2FSOX 2BDFA 3C5UA 4K2RA 4QYYA 4A07A 1OM1A 3JXWA 3FMNA 4EONA 4JOAA 3PE1A 1KE7A 3A7FA 3R28A 2IO6A 2X4ZA 3ZFXA 4ANQA 5TKDA 2ZDTA 3FLNC 2GQSA 3RJCA 3ZONA 4C2WA 3GBZA 4F65A 2I40A 1IA9A 2OIBA 4O4EA 5JEBA 4FT5A 4L53A 3RM6A 1URCA 1JPAA 5I9UA 2PVJA 1SZMA 4PNKA 3QTRA 3I60A 4V0GA 2XIRA 3QQGA 4I6BA 4I93A 4QP4A 1OECA 3V01A 2CN5A 4BTKA 3C13A 2HXLA 4P4CA 5JK3A 4L6QA 3KIOC 3EHAA 2CNVA 4FKTA 5E8YA 1H1SA 3R1SA 4BWPA 4BBFA 1VYZA 4IVCA 4J1RA 4B4LA 2B52A 1B6CB 2EVAA 4MD8E 4FZFB 3UMXA 2WMQA 3E8EA 3OY3A 4ITHA 1V1KA 1NY3A 1JOWB 4USDA 2Q0BA 4USFA 4FTOA 1GIJA 5KMLA 5L8LA 2B0QA 3AT3A 4G31A 1Q62A 2GNFA 4TWPA 4W8EA 2RKUA 3OWLA 1S9IA 1U59A 3LJ1A 3B8RA 5EW9A 1LR4A 4UALA 2C3LA 4I6HA 3O50A 4IJPA 5FXQA 4UBAA 3KGAA 4LL0A 3T3VA 3UG2A 2CSNA 5H8EA 4B7TA 3BWJA 3F61A 4EHZA 4ZS4A 3CKWA 5J9ZA 3EQGA 3EQBA 5IUIA 5ANOA 1JBPE 2YJRA 3D83A 3BRBA 3DTWA 4O0UA 4EBWA 4YJTA 2X9EA 2PUUA 5CVFA 4BC6A 3QUEA 2BFYA 2UV2A 1ZY4A 3BYUA 4GJ3A 4IADA 2WTDA 4YO4A 3W0SA 5HI2A 2O65A 5H8GA 3EN7A 3QYWA 5A6OA 3OP5A 5AUZA 2X1NA 4MCVA 4RLLA 3FMLA 3UZPA 2WU6A 4FTKA 4BCQA 4NFMA 5A4QA 3CPBA 1WBWA 3KULB 4NM0A 2JGZA 4KSQA 5C1QB 5KBQA 1JKSA 1F3MC 3FQEA 2QC6A 3GCUA 3R1QA 3BZ3A 5HORA 4HYHA 3DGKA 3DJ7A 3MVJA 4WD5A 5E8XA 3I1AA 1YWNA 4YO6A 3RK5A 3GQLA 5G1XA 4EOLA 4RJ5A 5B7VA 3ZO1A 3LFSA 4CT1A 5FD2A 3BE2A 2E2BA 2HELA 2YAKA 3FAAA 4OTHA 3GC0A 3BLRA 4OTPA 4UXLA 4FZDB 3F3WA 3A7IA 3QTZA 4RJ7A 5LCJA 4IEBA 4JBQA 4E6DA 3AMAA 4I3ZA 2BRBA 2OI4X 4QMPA 1LEWA 2ZYBA 3MB7A 4I0RA 5ETAA 3ERKA 4BHNA 5L8KA 3TTIA 1SM2A 5GJDA 2Y4IB 2OICA 4G3CA 3B2TA 4YZ9A 3R0TA 3OWKA 1JNKA 3AC3A 3CGOA 4XV3A 4QPSA 4AW2A 2BRMA 1EH4A 2WTWA 4C4FA 1VJYA 2ZV7A 3C4CA 5ANIA 4CMUA 3C4FA 3AD6A 4F78A 4GSBA 1OL7A 3F5XA 1KWPA 2WTIA 4IAIA 2PZYA 1FMOE 2C3JA 5FXRA 3DLZA 3QHRA 3QBNA 3LQ3A 2FSMX 4DGGA 4L42A 4XG4A 4HNIA 4I94A 5GJGA 3GCSA 2OXDA 1P14A 5KMMA 2DUVA 5ITAA 5FDPA 1R0PA 3IO7A 4D2WA 4RVTA 2W06A 2WGJA 3AOXA 3P5KA 3DZQA 5FG8A 4QMLA 5HX6A 5L2TA 3FSFA 5JQ5A 5CS6A 3L9LA 4KIKA 4XS2A 2UUEA 3MI9A 5A6NA 2BILB 1YXVA 5L2WA 5EKNA 4IWOA 2CCIA 3LZBA 4K8AA 5LVMA 3OUNB 2QOFA 4J98A 2QKWB 5IUGA 3VJNA 3NUUA 4R3CA 4GU9A 3ATSA 3BYMA 2IF8A 3LCTA 4XYFA 4O81A 2BALA 3LVPA 4LG4A 2VWUA 4AXCA 4U9AA 1PXMA 3I0QA 4L7SA 3ZDUA 4BHZA 2UZOA 3ZC6A 3DNDA 1X8BA 3AGMA