4AGDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sunitinib (su11248) (n-2-diethylaminoethyl)-5-((z)-(5- fluoro-2-oxo-1h-indol-3-ylidene)methyl)-2,4-dimethyl-1h-pyrrole-3- carboxamide)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
317
structure length
303
Chain Sequence
LSIVMDPDELPLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 303
sequence length 317
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4agdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4agdA01
4QMMA 3K3IA 2YDJA 4E20A 1OPLA 3P5KA 4I92A 5LCJA 2VTRA 4DGNA 3G33A 4X3FC 1ZZ2A 3UQFA 3UZRA 1MQBA 4HZRA 4UEUA 3OUKA 3QLGA 4PF4A 3UMWA 2WMXA 5KCVA 4RJ3A 3C13A 3VRZA 3KXHA 4E5WA 4EH4A 5IUIA 4BWXA 5CVFA 2EXCX 3H0YA 4NCTC 3ZH8A 5EHLA 4PMMA 5CS6A 1NVSA 3QA0A 4AN3A 2JDVA 5AV3A 4NW6A 1P14A 2OGVA 3L8SA 5I5ZA 2WTJA 2ACXA 4X3FA 2PULA 4CTBA 3F9NA 3LFBA 2UUEA 2XZSA 4U8ZA 3FEGA 3BHHA 5IG1A 5FTOA 5CAOA 4FV0A 3R2YA 4IAZA 4KIQA 4ANQA 2PPQA 4LOPA 5D1JA 2QCSA 3BHVA 3II5A 4EOMA 3FXZA 3F2NA 1MRYA 3I7CA 4LMNA 1E1VA 4XRLA 4APPA 1FGIA 4FKWA 4RLKA 5E1EA 3W2RA 2RG5A 4XNEA 3BCEA 4RZWA 3UVQA 5E91A 3U6JA 3QTIA 4D1XA 4HOKA 3AMBA 3WE4A 4CTCA 5BUIA 1G8AA 3NYVA 1Q24A 3D7TA 4N4SA 4JNWA 1R39A 2J5EA 3LM0A 3M11A 5DOSA 3S0OA 4HZSA 5K5NA 3AXWA 1T46A 1E9HA 2F57A 2BRMA 3QYWA 4E1ZA 3GU6A 5DPVA 5LVNA 3PLAE 1UU3A 5ANKA 1PKGA 2J0JA 2XKCA 2QR7A 4QMSA 3ZM4A 1XBBA 4WBBB 3R8LA 3O0GA 4MXOA 2A4LA 4E5AX 5CTPA 1LP4A 1H25A 2RF9A 4GJ3A 5HG9A 5BYZA 4H58A 4WNKA 4A4LA 4ANNA 5CALA 3QD4A 2C68A 5K3YA 4CSVA 2IVUA 3PXYA 4RX7A 3F61A 5C27A 2W99B 3DNDA 3HRFA 2GQSA 5FXSA 3I5NA 5I3OA 4FVRA 3NAYA 4JG8A 4M0ZA 1ZZLA 4G3DA 2WU6A 2QO9A 3FAAA 3NNXA 3Q9ZA 4I3ZA 2FGIA 2VTPA 3UIBA 2C6OA 4FKVA 2VUWA 1H1RA 2ZOQA 4FZFB 3QYZA 5FTQA 3T3UA 3E63A 3B2WA 2JDTA 4ZJVA 4QTBA 3BEGA 4HCUA 3DK6A 5G1XA 3GENA 4FV5A 5IH6A 3OCSA 5L8LA 3GT8A 1GIJA 2QHNA 4YZNA 3CS9A 4C4JA 1M2QA 3FI3A 4NH1A 2GNFA 3O23A 2PYWA 4RJ5A 3TG1A 4FODA 3PE2A 4WNOA 3EOCA 3VUIA 1YWRA 2BZIB 3BU6A 3IS5A 4YLLA 3PLSA 5IA0A 2OO8X 4RBLA 1ATPE 4O21A 4I5CA 3R9NA 4F7LA 3RAHA 3EN6A 1SVEA 1P4FA 3R01A 4KBAA 3D5VA 1H07A 4FL1A 4H1MA 4A9SA 4FA2A 4E6DA 4QQTA 3A62A 3GU7A 3L9PA 5E90A 1M2PA 3FLWA 4F09A 3I6UA 4NL0A 4QTCA 4YO6A 4B0GA 4EH8A 4C35A 4ZTMA 2IZTA 4HNIA 4YJQA 5LQFA 3QCQA 4EBVA 4AT5A 2ITPA 2I1MA 4B8MA 2W1CA 3Q60A 3CTQA 4C7TA 2YM7A 1UNLA 2OJJA 4M7IA 5H2UA 5BVNA 1Y6BA 2I0EA 4ZSAA 4FKJA 2GS2A 3QKLA 2XBJA 1YQJA 2X8EA 4HYUA 4O6EA 3FMJA 5E8WA 4O96A 4Y5QA 4XG3A 4YC3A 3C0GA 3UOHA 3CP9A 4BBFA 3AC1A 3CJGA 4BN1A 3K54A 5AP2A 4MKCA 1CKIA 4IAKA 2F2UA 3MJ2A 3NYNA 4QYGA 3SC1A 2W96B 4ACMA 1P5EA 1AD5A 4BKJA 4Z55A 4UWBA 3JXWA 5AP3A 3R8UA 1LUFA 5HLWA 1QPJA 2Y6MA 3NLBA 3MFUA 2W4JA 5DT0A 2P33A 3ZLSA 4ZLOA 5EFQA 4IB0A 4IZ5A 3VC4A 3MB6A 4EOJA 4FYNA 3NSZA 5FXRA 4XBUA 3VUDA 3BU3A 4R3RA 4S2ZA 2C5VA 1H0VA 3Q96A 2R3IA 1BLXA 5M51A 3QC4A 3TKHA 4F65A 2OK1A 4MD8E 2ETRA 3ODYX 4B4LA 4BF2A 3FYKX 5BVWA 4EH6A 3FQSA 5BYLA 4RVKA 1OL2A 2A2AA 2QVSE 2WMTA 3P0MA 4FKPA 5DT4A 5AUYA 3E8DA 2NP8A 3BU5A 3PY1A 4FTRA 2P3GX 4Q9SA 4CT1A 3NEWA 3QD3A 3ROYA 2B1PA 3ZFXA 3QD2B 3R7GA 3BHYA 5CSHA 3ZTXA 4FEVA 3FZTA 2WMWA 4ZK5A 2DS1A 1JKSA 2FSOX 3W2PA 2J0IA 4WG4A 2W1EA 4QMYA 4M12A 5AIRA 3UIXA 3IW8A 3R8MA 3LFEA 4F08A 5M08A 5AR2A 1SYKA 3FPMA 3BWFA 4LQMA 5HE2A 4L8MA 4EK4A 3QZHA 5FEEA 3VHEA 2HZ0A 4P90A 3F2RA 1UU7A 5EH0A 2E9VA 3K5UA 3IOPA 4FNWA 4GW8A 2NNWB 3BWJA 3KK8A 3FQHA 4BDHA 4D9UA 2OZOA 5JH6A 4ANLA 3C5UA 4IM2A 3H0ZA 1WZYA 2VGPA 3REPA 5HX6A 3ZEPA 4QP6A 1WBTA 3AC4A 2J0LA 4N6YA 5TF9A 4IQ6A 4QPAA 2ZM4A 2CKEA 1YXVA 2WZJA 4IAIA 5IQCA 3H10A 3QQFA 5G6VA 4FBXA 4EHZA 4Y83A 2OH4A 2C3LA 2PUIA 3I81A 5M53A 1YOJA 4C36A 1UKHA 4FI1A 3T9TA 4CV8A 4XHKB 3V5PA 4AFJA 5I9WA 4YBKA 4N70A 4BBMA 3ALOA 1OKZA 3GGFA 1ZARA 4FV9A 3GB2A 3DLSA 5BVEA 1UWHA 3OXZA 3P23A 1CKJA 3BYMA 4CFNA 4H36A 4IFGA 1WVXA 3EFJA 2HZIA 4KS8A 4EZ3A 4GUBA 4YHFA 2PZIA 4RVTA 2ETKA 4IC7A 5ACBC 2UW5A 1KV1A 3COIA 5C8NA 5KMJA 5GZ8A 3AC8A 3QX2A 3ORZA 2WMQA 2WQMA 3BLHA 3IOKA 3O8UA 2W1GA 2PWLA 4CFXA 1YVJA 3C7QA 4TPTA 4OBPA 3PE1A 3LQ3A 3LLAA 3RWQA 5EQEA 4YTHA 2VN9A 5AUWA 3SV0A 2J0KA 1IAHA 4NM0A 4IAAA 1GAGA 3FL5A 4KSPA 3QBNA 4UWYA 3LFDA 3TUDA 4U6RA 1GIHA 3QTRA 4DITA 2ETMA 3KN6A 3S95A 3VRYA 1JOWB 3BGQA 4OGRA 4O0XA 4TNBA 4FEUA 4EK5A 3HX4A 3TXOA 3U6IA 2G9XA 5HVJA 3FY2A 1I44A 3LXKA 3FWQA 5EG3A 4CYIA 2F7ZE 4X3FB 2QOIA 4II5A 4TYGA 4MX9A 3U4WA 5HZNA 2VNWA 1QPEA 4RVLA 2HWPA 4DGMA 1UVRA 5HIEA 3U6HA 1O9UA 2Z8CA 2EU9A 2PVMA 2WIHA 4C38A 1R1WA 3FHRA 4C4EA 3BIZA 4YLJA 4BB4A 4KKEA 5ANDA 5HNIX 3UOLA 5LJJA 4ZXTA 3VS1A 3F2AA 4E6CA 2X1NA 3Q52A 3RP9A 5IUGA 5JT2A 3BX5A 3PFQA 2YABA 4NUSA 5GJFA 5HTIA 5I9ZA 5IISA 4YNOA 4R3CA 4IMYA 1DAWA 4U3ZA 3SGCA 4DG2E 4LI5A 3BELA 2QOLA 2YN8A 4BR3A 2GNGA 3VS6A 2BZKB 5CSVA 2PZ5A 4FTOA 5IEXA 3OOMA 2YA9A 1FOTA 3CKXA 3HV5A 4AP7A 4DH1A 4QMTA 2CLQA 2UZDA 2YIWA 3AC5A 4FKRA 4KKGA 3QALE 4CV9A 2X8IA 4NYEA 3OHTA 4OAVB 4R7BA 1KE6A 3KMWA 4NM7A 3VUGA 4U81A 4DGGA 3BHTA 4JBPA 3CQUA 4BFMA 3DZOA 1OGUA 4YJPA 4AOTA 2C1BA 2R5TA 2QOKA 3RPVA 1PHKA 2JFMA 2PVLA 3PVBA 4L3LA 4JL9A 4O0RA 3W32A 2WOUA 2XIYA 5HNGA 3TNIA 3WZEA 4OTFA 2BRHA 3NUXA 4BCNA 4W9XA 1PXNA 2XIZA 1NVQA 2VNYA 3OY1A 1FVVA 3VJOA 4CG9A 4IJPA 1Q8YA 4G17A 4ERWA 4FC0A 1W84A 3Q5ZA 2H6DA 3F7ZA 2BAQA 4KS7A 4XP3A 3R7UA 1SVHA 2BHHA 2WMRA 4NKAA 4O81A 4QMVA 1LPUA 5M57A 3HNGA 3PYYA 1BKXA 4FL3A 3GC7A 3U87A 4AOIA 2GS7A 3ELJA 4J8NA 5CVGA 3ZFMA 3N4TA 2Z7RA 3LFFA 2FYSA 3IG7A 4FZAB 4OBQA 4PDPA 3LFSA 4H1JA 4OTGA 3NGAA 3VUHA 4MQ1A 4JDKA 4YJSA 3EQBA 2RL5A 4RIWB 3O2MA 5IMXA 2OFUA 2OJGA 2XEZA 3GCUA 4K2RA 1T45A 4IACA 4FSQA 1R0PA 3NMUF 5H8BA 2FSMX 2UW0A 4AG8A 1NT2A 3PJ1A 5L6PA 2EXMA 3WZKA 3RHXA 4YZDA 5GNKA 3UMXA 4ZZNA 4O84A 2GNLA 3MTLA 3UC3A 2XM8A 4BHNA 2HAKA 1H08A 3E7VA 4MH7A 2ITVA 3GQLA 3OWJA 4NFNA 5EW9A 4CFUA 3KGAA 2UZLA 1OL5A 3NIZA 4MQ2A 3KRRA 5JKGA 5DVRA 2X9FA 5D7AA 4FKUA 1JNKA 1JKKA 2J5FA 3EJ1A 3IQ7A 3OXTA 4BZDA 4FEWA 4AA5A 4CFVA 3HGKA 4RPVA 3VO3A 3MPAA 4HGTA 3TWJA 2QO2A 5LVMA 2E9PA 3Q6UA 4JX7A 3WZDA 1XH5A 4EBWA 4DEIA 5DWRA 4D5HA 5JFVA 2GMXA 3O7LD 2R3PA 4FT5A 3NUAA 4ENYA 1V0BA 3DKGA 1A06A 3ZDIA 2GPHA 3TIZA 4CMUA 5CF5A 1H24A 4HVIA 5L2SA 3MPMA 3HDMA 2HK5A 1W0XC 3LPBA 3H30A 5AAEA 2BHEA 2NRYA 4RIYB 2XYUA 4EC8A 1W7HA 3TUCA 3RWPA 3S1HA 2Y9QA 3DS6A 4Y85A 3VBQA 2W1DA 1KV2A 3W8QA 4E4LA 4F7SA 4EHGA 4L68A 4YJUA 4DEBA 1ZOHA 3DKFA 2GCDA 4MWHA 2R3QA 4BDBA 5GZ9A 3DXQA 1NXKA 3W18A 5C4KA 4ZEGA 4RX8A 4D0WA 3MDYA 3UNJA 4O7TA 4TXCA 1LR4A 2WTKB 2HXQA 3MV5A 3PXQA 4ALWA 4IAYA 4L7SA 3PXZA 1WVYA 2X4FA 3GI3A 3EZVA 1KSWA 2GHGA 2YM5A 3IK3A 1MRVA 2GHLA 4JX3A 3ORMA 4ANSA 2VAGA 4I5HA 3UVRA 2F2CB 2OXXA 1GJOA 3LXNA 1GZ8A 3VS3A 4CRLA 2P4IA 3EQDA 5DN3A 3TIYA 2PVHA 4JG7A 3VJNA 3WE8A 1S9IA 3N9XA 3HMIA 5TO8A 3ANQA 4GFGA 2GS6A 2W1HA 4GL9A 4XUFA 3WZJA 5LMKA 1MP8A 4IWDA 4TT7A 4S30A 5I9XA 4XEYA 1QPCA 4TNDA 3ZXTA 5K5XA 4I24A 4X0MA 5AUTA 2I7QA 2QG7A 3BQCA 4X2NA 2X2LA 3RVGA 4IXPA 3ZOSA 4BHZA 5FDPA 2E9UA 5IH4A 1NY3A 4MF1A 5TE0A 1ZLTA 5HTCA 1Y8GA 2XNBA 3MFTA 4YJVA 1Z9XA 2VO7A 4I6QA 4WHZA 5JFSA 4RFZA 2H8HA 2PSQA 3QRUA 2UZOA 2BMCA 4FG8A 4GYGA 3KULB 4H3QA 4L67A 4EI4A 4ZY4A 3DAKA 5J9LA 4BDKA 3P86A 3HUBA 3R63A 4KRDA 4QMOA 2VTNA 4XG7A 4PTCA 3C4FA 3IW7A 5DHJA 2B0QA 2YDKA 5AAFA 4WOVA 4RVMA 2G1TA 1CTPE 3HECA 3QKKA 2GTMA 4TY1A 4USFA 3IONA 4FVQA 4M13A 4Y73A 2G2FA 3VS2A 3ZONA 2WMVA 5KUPA 5LOHA 1KUTA 3T9IA 3VIDA 4EHVA 3SG9A 4PWNA 2OF4A 4P2KA 3FLZA 3OTUA 4PL5A 3DNEA 1BX6A 2QU5A 3G90X 4K9YA 4OT6A 5DMZA 4HGLA 3MW1A 1JKTA 4D28A 4D1ZA 4IIRA 3I79A 4UMQA 3EQGA 4IANA 5CENA 3ZMMA 3DB8A 1J1BA 4JS8A 4CMOA 2YHVA 3EMGA 3A7FA 4ZTLA 2R64A 2RFNA 2JAVA 4V05A 3C5IA 2I40A 5J7HA 4F9CA 3QRTA 3LCKA 2IW9A 2PVKA 2IN6A 4YGAA 3U4UA 5LARA 3W55A 1U5QA 2CKQA 4D58A 4W4VA 4JDJA 3IKAA 1Q97A 5CEQA 4BRXA 4FT7A 2QOHA 4JIAA 3N4VA 2QO7A 3RK9A 4M66A 2ITTA 4CZYB 2OIDA 4ONAA 3RNIA 4D0XA 4ZAUA 3F3UA 2ZV2A 3LOKA 2JDSA 2B7AA 4O38A 1VZOA 3W2OA 5HG5A 4F99A 2C47A 2JKOA 4PMSA 5DI1A 1WCCA 5DR9A 3OVVA 3R83A 2RSVA 5HORA 3OW3A 5E8TA 3R8ZA 4M3QA 4WNMA 3Q9WA 5AUVA 3TACA 3EQCA 4GEOA 3ORKA 4I41A 4YNEA 5CU3A 4GK2A 3RK7A 3T3VA 3VN9A 4LRKA 5CZIA 3TV4A 3ERKA 3MPTA 3Q6WA 3TZ9A 4AXAA 5A54A 2FVDA 4BDIA 3ZZEA 5EQYA 4DE4A 1ZMUA 3L9NA 4AZTA 2IG7A 3HDNA 2PVRA 3KA0A 3ORPA 4TYHB 2BIYA 2IZRA 4RJ6A 4JBVA 4RQKA 1WBOA 4JJRA 4O6LA 2R3GA 3UP2A 3TEIA 5KHXA 2CKOA 5HIDA 4IX5A 3MY0A 2QOBA 4PUZA 2OJIA 2DWBA 2IW8A 3RHKA 4A07A 2JAMA 2YWVA 4DEDA 4TN6A 5DEWA 1R78A 2EUFB 1IASA 3FBVA 3MVLA 3QCXA 4XH6A 3HAVA 2YZAA 3LJ0A 1YWNA 2R3MA 2YM8A 5C03A 2BDJA 4ZTSA 3UQGA 4MHAA 4GH2A 3F3ZA 3KXNA 4EKKA 2YIYA 4F1MA 1O6LA 2CN8A 5CSXA 5EM6A 5IKWA 2F7EE 3OEZA 4RX5A 1UU8A 5JQ8A 4O1OA 4H3BA 4GT5A 4M84A 1YI3A 2G2IA 3UGCA 2ZB1A 4U97A 3W2CA 4DEEA 3UC4A 3FSFA 3A7JA 4QMUA 3P7BA 4ZTRA 5A4CA 5LVOA 4RWKA 4AWIA 4BCIA 3BPRA 4JR3A 2YLFA 1H4LA 2R3FA 4PNIA 2XRWA 1ZAOA 1ZYDA 2UW7A 3F5GA 3AT2A 4I4EA 2HZNA 5C8KA 2YM4A 5J95A 5L3AA 5IQEA 2BR1A 5KZIA 2WIPA 4BTKA 5ETFA 2PE2A 3POZA 4E26A 1PY5A 4R7IA 3HUCA 5CF8A 3GOKA 5K4JA 2XK3A 1OUKA 3JY0A 2XVDA 3HMOA 3KRLA 2KULA 2QNJA 5CX9A 3H9RA 4G16A 2WMAA 2REIA 4YURA 5JGDA 4DBXA 3G9LX 3NUYA 3PUPA 4OTPA 1YDSE 4HW7A 4CQGA 5A4QA 4CD0A 3GOPA 3CSVA 3FMHA 4UYNA 4AZVA 2C1AA 2XJ2A 4UXQA 2P2IA 4I93A 5CASA 5L6OA 1M14A 2Z7QA 5BVKA 2C3IB 2PVFA 1XR1A 4BCFA 3P08A 2C30A 4GG5A 4FTKA 3CKWA 3COMA 3E92A 4U5JA 2Z2WA 3FSKA 3IGGA 4PTEA 1Q3WA 3VS5A 4HYIA 4YLKA 4A9RA 4A9UA 4XG6A 3W10A 3OZ6A 4BI1A 4M67A 5IA4A 4LM5A 3C0IA 4QNYA 2QHMA 4IB5A 4ALUA 5EKNA 4NM5A 1OBDA 1RQQA 4AZSA 5KMNA 5CSWA 2CCIA 4MXAA 4KINA 4BI0A 3R1QA 1RW8A 5IDPA 1JBPE 4FGRA 1SNXA 4ALVA 3EFKA 3B8RA 5DGZA 4BYIA 3GFEA 4FV4A 5EM8A 3GCVA 2IWIA 2YITA 3M42A 4PL4A 4G3CA 2X7OA 3DCVA 3IW6A 4FGBA 4KIKB 3KEXA 4E3CA 3ZUTA 1IR3A 4ZMFA 1HCLA 2WTDA 5CXZA 2CMWA 1F0QA 4B6LA 2PMLX 1FINA 4G6NA 2IZSA 2GNIA 4IZAA 4OTIA 3MBLA 4ZTHA 3ULIA 3V5JA 4CKRA 2NPQA 2VRXA 4GU9A 2RKUA 2UW9A 4NCTA 3F5PA 5I4NA 1KE9A 2X0GA 2PMNX 3V5WA 2J6MA 3FI4A 3EN4A 2HY81 4FYOA 3BQRA 3BHUA 4FSZA 4MWIA 5FLFA 3QCYA 4XLIA 2GNHA 1JVPP 4O7RA 1F3MC 3RTPA 3KN5A 3L1SA 4GFMA 3FMLA 4DGOA 5HOAA 1ZYCA 2J7TA 3UIMA 3ORNA 3NWWA 4JDHA 5ANJA 3QQKA 3H4JA 3VHKA 3G5DA 5JZJA 3MSSA 4WKQA 2BZJA 4AZEA 3C51A 3JVRA 4L3JA 3OXIA 3V8TA 1Q8UA 3NNVA 1YOLA 2V62A 4EH2A 4NIFB 2BFYA 4FSWA 4BTMA 4K33A 4FZDB 4FSMA 2E2BA 4JRVA 4GV1A 1IAJA 2VU3A 3OT3A 3LFAA 4NK9A 4DFLA 5HX8A 3D5XA 4DEGA 5CAQA 3BLRA 1XKKA 4YO4A 2WQNA 2YEXA 3A7HA 5LMAA 4Y46A 5HNBA 3UNZA 1OB3A 3OT8A 4L43A 4PPCA 4QP2A 2JDOA 3MH2A 3Q9XA 4BDCA 4F9YA 3RAIA 3ZU7A 5A6NA 4JBQA 5I9VA 1STCE 4RWLA 1PKDA 5CT7A 5FDXA 2W4KA 5KBRA 3LKMA 4FIFA 4UZDA 1WBVA 3R7EA 3O17A 3LAUA 3QRKA 4I21A 3BYUA 1FVRA 4IADA 4O0UA 4AX8A 5DIAA 2WEIA 4NZWB 2RIOA 4EOKA 1NW1A 5EM5A 4FTLA 5JZNA 4AU8A 3PIZA 4ZY6A 2GU8A 3R28A 3MH1A 3L8XA 3R21A 4AAAA 4BL1A 4QTEA 3AGMA 5A3XA 1XH8A 5IPJA 2QLQA 3AMAA 3IW5A 3TUBA 4FTIA 2YZLA 3PXFA 4IX3A 3FZ1A 4BTJA 2OG8A 2XK8A 3D15A 3FUPA 4H39A 3LW0A 2C3KA 4RIWA 4W4XA 3OWKA 4BICA 4YZCA 5CAUA 1OIUA 4BCHA 4RC3A 3HV3A 3VULA 4IE9A 4OT5A 3PA4A 2WPAA 3FLQA 4GMYA 3RPYA 3KK9A 5GINE 1XO2B 4EK3A 4WRSA 3CD3A 3KY2A 3MI9A 4ACHA 3Q4CA 4AGDA 2VV9A 3NUUA 5FXQA 4MD7E 5IH5A 1GZNA 2PHKA 2R9SA 3E93A 5L6WL 5LVPA 4NM3A 5GHVA 4EH7A 5JGAA 3E8NA 1P4OA 4HPUE 1ZYLA 2J2IB 4NT4A 4USDA 3KVXA 5J9YA 4BY9E 1S9JA 3SXFA 4EQMA 5M09A 1BYGA 4AZFA 5CZHA 3QZIA 3UZTA 4J8MA 3QWKA 5AX9A 4PQNA 4U44A 2LAVA 2WMSA 3QQLA 3QUEA 4CCBA 3EFLA 3PPZA 3K3JA 3A4PA 1Q8TA 4PDYA 1K2PA 2W1IA 5FM3A 4RSSA 4ZIMA 5JRSA 2F49A 5CNOA 4LUDA 4N57A 5F20A 3PWDA 1PXJA 1Z57A 3FC2A 2R3NA 3RM7A 5HO7A 2WTKC 3HYHA 4JR7A 2H96A 4KBCA 4BDFA 4RIYA 4S32A 4J96A 2WNTA 4W4WA 4BCPA 5AAGA 2WFYA 2YIXA 3QRIA 5JSMA 3QTZA 5AR3A 3CLYA 3MGYA 2X81A 4M15A 4U7ZA 1ERKA 2VWXA 3MA3A 5KKRB 4ZLZA 4MBJA 2JLDA 1OIRA 3AT4A 3EFWA 3HP2A 4IWPA 1CDKA 4GT4A 4FK3A 4YP8A 1OVEA 4E6QA 2XBAA 4E4MA 4BGHA 5ETCA 2XNEA 3LVPA 3KL8A 4I6FA 5IQAA 5AV1A 1XHAA 5JN2A 2OU7A 1V1KA 3MVJA 4M68A 5A14A 3TDWA 3ODZX 3CIKA 3HA6A 4IC8A 2R3HA 1YXTA 4APCA 3FLYA 4YTIA 4DTBA 3DKOA 3NNUA 4E93A 1YXSA 3HV4A 4K77A 4ZJJA 4EZ7A 2E9NA 4L45A 4M69B 2W7XA 4C57A 2XKEA 3F88A 3PPKA 2R7BA 2YDIA 2XKDA 3C1XA 4LRJA 4QQCA 4UZHA 4N6ZA 5L2IA 2XMYA 4PY1A 2W5BA 1WVWA 4CKJA 1YDTE 4ITIA 2OICA 3RZFA 2CNQA 4O83A 4U41A 2ONLC 4IZYA 3R9DA 3OBGA 3PXKA 5CWZA 4ANOA 3Q2JA 3HZTA 4NU1A 3C4CA 4C37A 4CEGA 5BVOA 5H8EA 4QP3A 4O7WA 4G5JA 4O86A 4QTAA 4EOPA 1YXXA 3MVMA 5M07A 3CR0A 3TZ8A 4RJ4A 3KULA 5JQ5A 2VTQA 4DFYA 4O7NA 5AV4A 3PJ2A 5BQ0A 2ZDUA 1FQ1B 2ZMCA 3O96A 4XMOA 5IEYA 5J5SA 4WG3A 3H9OA 3JUHA 2XK7A 5BUEA 1XWSA 4EH3A 1OKYA 2XNMA 4X6QC 1I09A 3NRMA 3P4KA 2C0TA 3KCKA 4P7EA 4DH8A 4GKIA 5FG8A 1PRYA 4FTJA 2GDOA 3I6WA 5AX3A 5EW3A 4DCAA 4AGUA 2PZRA 5LWMA 1V0OA 1PXOA 2GFSA 3P7AA 4FTQA 4AGWA 3V5LA 1U46A 2X7GA 4RJ8A 5KX8A 3DZQA 3OCGA 2KTYA 2OKRA 3P78A 1LEZA 2ITZA 3OWLA 2VWVA 4EOIA 3I7BA 2C5OA 1XH4A 5E92A 2LGCA 5ANEA 5D11A 2VX3A 4GSBA 3SG8A 1RDQE 1MUOA 5EK7A 1HOWA 4G3GA 5DYJA 4AN9A 1M7QA 2BZHB 3A7IA 4WUAA 5EI2A 4BC6A 2YCRA 4MNFA 4AF3A 1W8CA 4Z3VA 4ZZOA 5A9UA 3QZFA 4K6ZA 4EOOA 5IQIA 5H3QA 4HCVA 3WIGA 4PP7A 2C6LA 3BE2A 2OH0E 3NCZA 4WSQA 2O63A 1X8BA 2HCKA 3UNKA 4U3YA 1ZYSA 4D2PA 4RGJA 4QP8A 2VWBA 3ZUVA 4UMRA 4FE2A 2C6MA 4RA4A 2VWWA 3UPZA 4XYFA 3BKBA 3D14A 4I5PA 3CQEA 3LE6A 2F4JA 1J1CA 4OLIA 4D4YA 3SAYA 2SRCA 4KIOA 5HCZA 5TT7A 2I0VA 3P7CA 1FVTA 1PW2A 2ZM3A 4J52A 4YHJA 5HCYA 4ENXA 5AMNA 3OCBA 1K3AA 5HCXA 4TYHA 2V7AA 3MIAA 2DUVA 3ATTA 3D2IA 2X6EA 4QOXA 3TL8A 2CLXA 3LMGA 4TW9A 3Q32A 4QP1A 5IU2A 3BBWA 4YC8A 4XG9A 3VUMA 4J97A 1W82A 4BCQA 4XG8A 3DFCB 3WF6A 3FY0A 2C3JA 2CJMA 3DKCA 4TYEA 3UZPA 3FPQA 4QT1A 2G01A 2OWBA 2W9ZB 4TWNA 4K18A 4QMZA 5I9UA 3WBLA 5J87A 2HOGA 3CD8A 2BKZA 3DV3A 2V5QA 3HLLA 4RLLA 4TWPA 3W33A 1PXPA 1W83A 4ZLYA 1OI9A 4R7HA 4HVGA 5HO8A 2ITXA 3ZUUA 1JSUA 4AW2A 3WF5A 2WGJA 3MB7A 4CNHA 3LQ8A 4GFOA 4DH3A 2B9IA 3EZRA 4FSNA 5DEYA 3VBWA 2YERA 4M14A 2B9HA 4F70A 4B8LA 4FK6A 5DH3A 5EDRA 3KCFA 1P2AA 3KQ7A 4I0RA 3ATSA 2VTJA 5LXMA 3VWAA 4W8EA 1B6CB 4LOQA 4KSQA 1YW2A 2ZYBA 1Q99A 1Y57A 2OSCA 4MXXA 5CYIA 1ZXEA 2ZB0A 4FOCA 3PRFA 4WSYA 4J98A 3QFVA 4PV0A 5FEQA 2OW3A 4ZS0A 2Q83A 2W5HA 5AIKA 5HU3A 1PJKA 1WMKA 4EH5A 5M4CA 3JR1A 4YTFA 2CNVA 2HIWA 3CGOA 3HRCA 3QTSA 3UJGA 2A27A 2PTKA 5ETAA 5J9ZA 4EYJA 5KE0A 4QNAA 3E8EA 1PXIA 3RCDA 4B7TA 1G3NA 4RC2A 2CGUA 2VTOA 3SQQA 4XBRA 4WT6A 1QCFA 3DDPA 3UE4A 4C4HA 4FNYA 3PWYA 2QONA 4L44A 3EL7A 3ZBXA 1KWPA 4FL2A 4TZRA 5LMBA 1URCA 3G6HA 4GU6A 2B53A 1Q8WA 1ZYJA 2ZV7A 3MFRA 3OEFX 4O0SA 4U80A 3RJCA 3UIUA 2YJRA 3HP5A 4TYIA 4BDGA 5DR6A 4BZOA 2IVTA 4C3FA 1GZKA 4QYYA 1MRUA 1XH7A 4XV2A 4DT8A 5GZAA 2PVJA 3BZ3A 2C6DA 1ZRZA 3PP0A 4QYFA 4C3PA 4M8TA 2W1FA 4JIKA 4YZ9A 4FNXA 4BKYA 4D2WA 3GC0A 4EQUA 2ZJWA 4YMJA 2BDFA 2HW6A 4Z9LA 3FKOA 1MQ4A 3UOKA 4NJ3A 4YC6A 2XNNA 4EHEA 2UVYA 3OUNB 3QL8A 3TM0A 3AD6A 3QUDA 3NCGA 4RFYA 1H1PA 5J1VA 5HE0A 4FEQA 4I20A 1M17A 5GJDA 4DFXE 3MN3A 4MBIA 3R7OA 2BPMA 4KIKA 4YZMA 1PMUA 3KMUA 4NEUA 5DLSA 3VUTA 4FKTA 4DT9A 3ANRA 3RPRA 5A4EA 2IJMA 3ZCLA 3G0FA 2PUNA 2BTSA 3LFCA 3NW5A 3BI6A 4IJ9A 5ANIA 5M55A 4TWOA 2B55A 3DFAA 4FT3A 4TWCA 3RALA 3G9NA 3ZLXA 2WELA 4L3PA 4BCGA 5KHWA 4FTMA 4BIEA 2ERKA 3Q3BA 4V01A 4ZOGA 4EKLA 4U79A 1TQIA 3SKCA 4HVDA 2B52A 2RFEA 5HE3A 3PVWA 2YLEA 3NDMA 2UVXA 2PL0A 4M97A 1KE7A 2I0YA 3F7WA 3OD6X 2C4GA 2R3RA 3LXLA 3KFAA 3PSBA 2J90A 4FV7A 1JPAA 2G15A 4JG6A 4MF0A 4QMXA 2W05A 4D1SA 3SXSA 5JK3A 2O0UA 4DFBA 3FZSA 5IQDA 5C26A 3HEGA 3EQHA 2WHBA 3FZOA 3OWPA 2Y8OA 1ZWSA 3CPCA 4IM3A 5AUXA 3TZ7A 3WF9A 1U59A 4D2TA 4FIGA 3BBTB 5JGBA 4J99A 3VW6A 4EC9A 4C2WA 2X2MA 4IVBA 3ZBFA 4KKHA 4IWQA 4NIFA 5T6KA 5EKOA 2FSLX 4UX9A 4NW5A 4IWOA 5GIOE 1UNGA 4HGSA 3LQ5A 4LOOA 3VQUA 5ITAA 5M4UA 3FLNC 5IQHA 3GFWA 2WKMA 2OFVA 3SX9A 2BFXA 3MH0A 4DTAA 5ANGA 4QMQA 4L7FA 4A4OA 2Y4IB 3GVUA 2FB8A 4Q2AA 4FTAA 1BL6A 3N4UA 1OKVA 2PE1A 3QQHA 5FQDC 2O2UA 1KOAA 4X2GA 3V51A 4XP2A 4XCUA 3WIKA 1U5RA 5J79A 2GNJA 3R0TA 2Z02A 4EONA 3OY3A 3CGFA 4XV1A 1PYEA 4BCKA 5IF1A 4FG9A 3W8LA 3ZRKA 5C8MA 5B0XA 1EH4A 3Q4ZA 1DAYA 2XJ1A 1KE5A 3VVHA 1QMZA 2G2HA 3QZGA 3VBYA 1WBSA 3WF8A 3QX4A 2C5NA 3GXLA 4BWPA 3A99A 2ITYA 3DQXA 4OAUC 5AJQA 1XBCA 2C6EA 2F9GA 2JIVA 4O27B 4LUEA 3QQGA 3LM5A 3TNPC 3DK3A 1SMHA 2W9FB 3KRWA 4GVJA 4J7BA 5EI6A 4PP9A 4DEAA 4F9BA 2W06A 2ZAZA 4OBOA 3DB6A 3DXPA 5CVHA 4YTCA 1OIQA 1OL7A 2BAKA 2OF2A 3AOXA 4IDTA 2J50A 4HYHA 3C4EA 4GK4A 3QLFA 5AV0A 2XUUA 3I5ZA 3S4QA 5CXHA 3JPVA 3RM6A 4IVAA 4GCJA 4DEHA 5KMLA 2YISA 4EOQA 3WARA 4C58A 5CEOA 5AFVA 1G8SA 4AT3A 3E88A 1SNUA 2YIRA 3BGZA 5HLPA 4TRLA 2XS0A 4UMTA 4EWHA 3GCQA 5H9BA 2CHLA 3ZS5A 4GKHA 2QOFA 3A2CA 4C8BA 1YI4A 3D83A 1PXMA 3BE9A 5CAVA 3WYXA 2BAJA 3RI1A 4F0IA 2XNGA 2BUJA 3EIDA 3V3VA 2ZM1A 3VBXA 4NFMA 4IB3A 4X6RA 1YHVA 1O6KA 1UV5A 3HKOA 4PDSA 3QGYA 5AUUA 4CFWA 4CLIA 4CMTA 3FMNA 3RPSA 5L8JA 2GHMA 4OUCA 4CT2A 3FQEA 4ZSLA 5KKRC 3M2WA 3C4ZA 1CM8A 3R04A 3COHA 4IAFA 5L4QA 5L2TA 2O64A 1IEPA 1GY3A 5LVLA 2FSTX 1H1QA 3VBVA 4E8AA 1U54B 3WOWA 4YJNA 3R7IA 4FF8A 3Q9YA 3PDTA 4I6HA 3MY5A 2YCFA 2B4SB 3E62A 3FLSA 3FZRA 3I1AA 4EJNA 4MVFA 5E8SA 2QC6A 2VTLA 4F7JA 4G9RA 1PYXA 1YKRA 2IZUA 1M2RA 2FH9A 4ZSGA 5EW8A 4QO9A 1FGKA 1FBNA 3HMPA 3EB0A 2WQOA 2X7FA 4FKSA 4S33A 5C4LA 5IEVA 4L42A 2X6DA 4GS6A 4ERKA 2XEYA 4O0YA 3F6XA 2CCHA 2BCJA 1OMWA 2Q0BA 4DLIA 1WAKA 4XV3A 4O7LA 2W0JA 3PY3A 2QU6A 2C5YA 2XB7A 1Y6AA 3ACKA 4TKSA 4XOZA 4NKSA 3ZXZA 4DA5A 2CN5A 3KXMA 3GC9A 4ZSEA 4AOJA 3UO5A 3ITZA 3JY9A 3QHWA 5A6OA 3NVKI 2QI8A 4O7YA 1Q41A 4R1VA 4IZ7A 5HHWA 3FMKA 3HMNA 4C4FA 5FD2A 4M69A 2RFSA 3V8SA 3SW7A 1UWJA 4BWKA 4B99A 2F7XE 4I5MA 1GOLA 2VTMA 2XP2A 1JQHA 3EQRA 5B2LA 4OTRA 4U43A 5IDNA 4C02A 3W16A 5KZ0A 3QWJA 3NYOA 4FR4A 3QXOA 4DCEA 1YHSA 4JI9A 3BGPA 3NX8A 2JKKA 3EN7A 2JGZA 4MEDA 4OTQA 4RWJA 3NNWA 5AP5A 1OPJA 3KF7A 2W5AA 2X8DA 3UP7A 5BVFA 5EYCA 3G2FA 3W1FA 5FP5A 3MFSA 2QURA 4BYJA 3UPXA 3F5UA 2JBOA 5CU4A 4GIIA 5T3QA 2YIQA 4PNKA 3DGKA 2ITOA 4U42A 4C0TA 3WF7A 4BGQA 4W8DA 5DA3A 2I0HA 4QMNA 3D9VA 2XNOA 4KIPA 1KE8A 3KXXA 3LCSA 4YHTA 2QOCA 3PA3A 4GUEA 5EHOA 5FUTA 5E8UA 4A4XA 5BPYA 1Q61A 4IB1A 2WTIA 4K11A 3IDPA 5IQFA 4KABA 5JEBA 3DJ6A 5HVKA 4U9AA 3O71A 3QRJA 1H00A 3B8QA 1NA7A 3PIXA 4CYJA 3TNQB 1ZMVA 3DJ7A 5K4IA 4KUJA 5JMSA 5M4FA 2UZUE 4OTWA 4DF3A 3IPHA 4OW8A 4E5BA 3QTQA 1APME 2OXDA 2OJFE 3PRIA 4Z16A 2ITWA 1PMVA 4CXAA 3GU5A 3MJ1A 5BMSA 4AUAA 4EUTA 3V01A 1FMOE 4XG4A 3LCDA 1YDRE 4BCJA 3FHIA 3F3VA 4CVAA 2VZ6A 3B2TA 1H26A 1URWA 3E87A 4IFCA 3ZO2A 1OITA 4D2SA 2C0OA 4W9WA 1LEWA 1YRPA 3Q4TA 4E6AA 2CPKE 2B54A 3DAEA 4WBOA 4EH9A 4DFZE 3FKLA 2IVVA 4EK8A 2QR8A 3ENMA 4MXZA 3C0HA 4O7VA 1BL7A 4FOBA 4R5SA 3BLQA 3AGLA 1OBGA 3KF4A 5CQWA 4BIDA 4D2VA 4OTDA 4A7CA 2HWOA 3CY2A 5HQ0A 1Q5KA 3VAPA 4YR8A 5J5TA 4ZMEA 5K0KA 5FM2A 3D5UA 5GJGA 4C3RA 3H3CA 4UMUA 2QODA 5HO6A 3HVCA 3TN8A 3AD5A 5AM6A 4XV9A 3LJ2A 3DBCA 5CI6A 5ICPA 2WB8A 1SZMA 3QQJA 4D5KA 5M44A 3FI2A 4CFMA 4RMZA 3UQCA 2JFLA 4MBLA 4LL5A 2CGVA 4QTDA 3BYSA 2PE0A 4FV8A 5E8VA 5BMMA 5IQGA 3TNWA 2PZYA 2QG5A 4RG0A 2FA2A 3KXGA 1OECA 4EYMA 4UV0A 2OLCA 4PX6A 2X4ZA 5ACKA 3D0EA 4EORA 1REJA 2RGPA 2NO3A 3S3IA 5B7VA 4DFUA 5HESA 2OZAB 3QTUA 3COKA 2XCHA 2UZBA 3RBWA 4IH8A 3ALNA 4V0GB 5DG5A 3JS2A 4U45A 3KVWA 4XOYA 5E1SA 4JDIA 3MWUA 3R7VA 4ASEA 1IA8A 4RRVA 3RZBA 4BBEA 4L6QA 3R30A 2BRNA 1IA9A 3LLTA 2CNUA 3TJCA 4XRJA 4IVDA 4QD6A 4J53A 3MIYA 4CG8A 4YPDA 4G1WA 5HBHA 4ITJA 4FKOA 3IDBA 3CXWA 3PZEA 1NVRA 3BV2A 3K5VA 4CZTA 1B39A 2GFCA 3GU8A 3K2LA 4I6BA 3IECA 4RFMA 1WBPA 3A8WA 3SRVB 3V8WA 4AW1A 3RCJA 1JKLA 4ZJIA 4BDAA 5CU6A 1L8TA 2ZV9A 2YCQA 4BGGA 1ND4A 4B9DA 4FIHA 2YCSA 5L2QA 2XK4A 3ZC5A 5EYMA 1Y91A 3UTOA 2XF0A 3LCTA 1BMKA 3E64A 4ZSJA 4I4FA 2VTTA 3POOA 2PZPA 3LZBA 4CCUA 2YFXA 1YWVA 3ORIA 4RX9A 5AP4A 2PVYA 2Z7LA 4QP9A 3OCTA 4IBMA 4BCMA 2IO6A 3PPJA 4D4VA 2R7IA 3DLZA 4YBJA 2UV2A 4F6UA 3OG7A 4ARKA 2FUMA 4PMPA 2ERZE 2JIUA 3FYJX 1J7IA 5F94A 4UBAA 5F9EA 2YM6A 5HE1A 4ZTQA 5CY3A 3FZPA 3VS0A 3BEAA 2AYPA 4IX6A 2BIKB 3RK5A 4NJDA 5E7RA 3AC3A 5HGIA 2YAAA 4G5PA 3ZDUA 4HVHA 4UYAA 1RE8A 4L9IA 4MD9E 3KB7A 3UYTA 4FV2A 2HW7A 5CNNA 4EK6A 3LJ1A 4L00A 5IA3A 2QOOA 3HV7A 1Q62A 5BNJA 3U54A 4F63A 3IO7A 4DG3E 3TNHA 5DRBA 5BUJA 3FE3A 4XP0A 1XH9A 3DTWA 2O5KA 1OM1A 3UOJA 4ZP5A 4AW5A 3SD0A 3EL8A 3MTFA 4UALA 5E8YA 5HVYA 5T68A 3TZMA 4AGCA 2ZV8A 5CEIA 4RIXB 2O3PA 4CZUA 4HCTA 5BX0A 1GNGA 3V04A 4P5ZA 2WQBA 3QC9A 3QXPA 4S31A 4F1OA 3AC2A 2XRUA 1E1XA 4JQEA 3FKNA 3PG3A 2VTHA 2R0UA 4I1ZA 2IW6A 2XK9A 4Y72A 3ZEWA 4FTCA 1M52A 1TQMA 5A4LA 4BVUA 5AADA 5EI8A 1UNHA 4X7QA 5ETIA 3RINA 5I9YA 1VEBA 4AE6A 3WZUA 4G6LA 5HD7A 3D5WA 4G31A 2Q0NA 4MNEB 2JKQA 1CKPA 4BCOA 4X2JA 5EYKA 3A7GA 3ORTA 5TR6A 3NUPA 4DTKA 4BDJA 1CMKE 4QP4A 3TTJA 4AW0A 2HYYA 4ACDA 1UA2A 5HICA 4JLCA 2XA4A 3DT1A 3GNIB 3KU2A 1JAMA 2QLUA 4K8AA 5M06A 4WD5A 3LMIA 2CSNA 4GK3A 3I60A 4F9WA 2Y4IC 3LIJA 2A19B 1H27A 2PK9A 5AR8A 4YJTA 4AZWA 3W2SA 2WOTA 3CY3A 2BALA 3V5TA 2R4BA 3EQFA 3CCNA 4C59A 3Q4UA 3N51A 4FV3A 4YJRA 3PJ3A 3R1SA 4MYGA 5HBEA 4FNZA 4R5YA 4UWCA 3D7ZA 3EQPA 2DYLA 2A1AB 4QMPA 4TTHB 3U8WA 3VF8A 3QTWA 1ZOGA 4U0IA 3CTJA 5HG7A 4QMLA 5E8XA 4OR5A 1OIYA 4WO5A 2W17A 3UVPA 5IA1A 4L01A 4I0TA 4H05A 5C9CA 4A9TA 4AFEA 4QYEA 1PXKA 3SA0A 2UW3A 2C5XA 4YPSA 3AG9A 2ONLA 3RNYA 3SOAA 5IMEA 1DI8A 5DRDA 4E7WA 4YU2A 3C4XA 2W4OA 4BDDA 2R2PA 2XCKA 2ZMDA 4FEXA 4UN0C 3RKBA 2PUUA 1OL6A 4MK0A 2H9VA 5FTGA 3F66A 3QCSA 2JEDA 4IM0A 3L8VA 4DC2A 2JIIA 4AT4A 4UMPA 3FI8A 3ZC6A 5KMMA 1H0WA 5HEZA 5A46A 4A06A 1YHWA 4HJOA 4G9CA 2BRBA 3AMYA 3DBDA 3C9WA 2B9JA 4RWIA 4X21A 3G51A 4L52A 4BZNA 3FL4A 3DTCA 3JVSA 4D55A 3U51A 3NW6A 5CU2A 3F5XA 5AR7A 3SLSA 2XIRA 2WD1A 4RIOA 4ZTNA 3ROCA 1K9AA 2GQGA 3MY1A 3BV3A 4F9AA 2ITUA 3O50A 4YUQA 3ETAA 2WMBA 3FJQE 3P9JA 1VJYA 4JQ7A 5F4NA 1XH6A 2C0IA 4Q9ZA 2RFDA 2Z60A 3ZO3A 3GEQA 1IG1A 4DG0E 1SVGA 3KMMA 4GG7A 1YXUA 4C4IA 1TVOA 3MS9A 4WNPA 5JFWA 1JSTA 3E3PA 1J3HA 4KAOA 3ZLYA 4PRJA 3Q2MA 4IW0A 4EOLA 2E9OA 4ASXA 3DDQA 4F0GA 1VYWA 3DK7A 1ZOEA 5FP6A 5J1WA 4D9TA 1HCKA 4G34A 1WBNA 4JOAA 4QP7A 3EWHA 1PXLA 5LWNA 3LXPA 3AQVA 3U55A 2NRUA 3HL7A 1IRKA 1YI6A 1AQ1A 2WTVA 5D9HA 1BI7A 2UVZA 3TV7A 3VNTA 2PVNA 3A61A 3G6GA 3R73A 2QQ7A 4U40A 4GVAA 4LGHA 3VUKA 4IDVA 2WQEA 2JDRA 4IX4A 5D12A 3OF0A 3OW4A 3ENHA 4I0SA 4R8QA 2GQRA 3DU8A 4GT3A 3CTHA 3HV6A 2FO0A 3PSCA 3Q53A 4PL3A 3PXRA 4WA9A 5C1QB 5B2MA 4QQJA 5HI2A 3C4WA 3QKMA 5C01A 1U54A 1OUYA 1DI9A 4F0FA 4F64A 3KREA 4PPBA 5EQPA 3OMVA 2ZVAA 3QU0A 3SHEA 3EQIA 3F82A 3DXNA 1ZMWA 3E3BX 2JC6A 3PSDA 3DQWA 1L3RE 3R8VA 4FTNA 2I6LA 3ACJA 2A0CX 5L2WA 3O8PA 3CE3A 3R22A 4LFIA 5H8GA 2XK6A 5CEMA 2HY0A 2O8YA 3RAKA 4FT9A 1PF8A 3VQHA 3R9RA 3GCPA 4WG5A 2ITQA 3LMHA 2HXLA 3V6RA 5DT3A 1W98A 5AM7A 5JFXA 3GU4A 2UW6A 2Y6OA 4RC4A 3NVMB 5CANA 1O6YA 1QPDA 4O0WA 5CI7A 1BI8A 5EM7A 3RAWA 3D7TB 3GP0A 5CT0A 5TKDA 3MH3A 1Q8ZA 4BI2A 1B38A 3FMMA 4AA4A 5J8IA 2ESMA 2VTIA 4K0YA 3ET7A 4C61A 4EEVA 4EWQA 4HNFA 3UO6A 2W1ZA 4FTUA 4J1RA 5EOLA 3TT0A 3OBJA 4FZ7A 2WEVA 3ZM9A 5HKMA 4L53A 2UZNA 2HENA 2Y7JA 2V55A 4CFFA 1TQPA 3QGWA 5AA9A 2BILB 2JBPA 4DHFA 1Q3DA 1VR2A 4JVGA 2YJSA 2UZWE 4F1TA 3NUSA 2XJ0A 3CC6A 2UZTA 1BUHA 1KOBA 3KC3A 4S34A 5CEPA 4ORKA 3PVGA 4GJ2A 3SVVA 4G2FA 2IPXA 4KWPA 1JLUE 3VF9A 4YZBA 3NZ0A 5AP6A 5KMKA 2VX0A 3P1AA 4DBNA 4EOSA 2CDZA 5AA8A 5CSPA 5DR2A 3MESA 3D94A 3I4BA 4FKGA 5KO1A 4FSTA 4FSUA 3IGOA 3OC1A 5B2KA 4C33A 5FBNC 4DYMA 2GTNA 5A4TA 1DM2A 2YACA 4KD1A 3PA5A 4GYIA 2WTCA 1YOMA 2WXVA 2BRGA 2QKWB 2BTRA 3LFNA 2R3OA 4DGLC 2PY3A 3A4OX 4PTGA 4UB7A 3U9CA 4JBOA 5TOZA 5DE2A 1OKWA 3TJDA 3ZO1A 2R3KA 4FZ6A 5HIBA 2Y0AA 3NR9A 2PMIA 2VX1A 4G6OA 1FMKA 2WMUA 2AUHA 3SDJA 4MAOA 5DNRA 4EZ5A 4FSYA 1REKA 4ASDA 2J4ZA 4PMTA 4UXLA 2OXYA 3ZSHA 4MCVA 4W4YA 2BVAA 3E8CA 5CF6A 3FMDA 2VO3A 3R8PA 3OFMA 4EQCA 3CBLA 4KNBA 2VD5A 1FPUA 2J0MB 3A60A 3R6XA 1V0PA 3D2KA 4R77A 4JT3A 2BKKA 3PVUA 1ZY4A 1Z5MA 2EB2A 3EHAA 4AE9A 4C34A 4HVSA 2R3JA 2VTSA 4ID7A 4O2PA 2Y4PA 1H1SA 3ZLWA 4BKZA 2EWAA 4LV8A 2XNPA 3NPCA 3L9MA 3QUPA 2VWUA 2CGXA 4IVCA 4J71A 4KBKA 5HU9A 1QL6A 3QHRA 2BDWA 3T8OA 4E4NA 5J7BA 5CLPA 4R78A 4CLJA 3MYGA 4QPSA 5HLNA 4FTTA 5E4HA 3UODA 2V22A 4QRCA 3ULZA 4ANBA 4D4RA 4YJOA 3WILA 5AEPA 3QTXA 4FKLA 1R0EA 4R3PA 2H34A 3ORXA 4ASZA 2OIBA 2X2KA 4IHPA 5ANOA 5I0BA 4HYSA 1J7LA 5D10A 3WI6A 4FUYA 3QA8A 2YAKA 4DLJA 2R0IA 3DBEA 3NAXA 2OI4X 2ZDTA 3AD4A 5EDQA 3DPKA 2VTAA 2XIXA 2BROA 4FKIA 4V04A 1ZY5A 2ITNA 3F69A 3G0EA 3O51A 4QYHA 1RJBA 5IUHA 3EKKA 4LL0A 4O0VA 4DH7A 5DBXA 3VBTA 1A48A 3PY0A 3DOGA 1PMEA 3BRBA 3GQIA 4CGAA 3OTVA 4TYJA 3NUNA 4EJ7A 3NW7A 4AACA 4FVPA 3R02A 3LFQA 2P2HA 3TKUA 3OS3A 5K9IA 5CAPA 5BYYA 4NSTA 2OZAA 3DJ5A 1GZOA 2WAJA 3BYVA 3GC8A 5LCKA 3VS7A 5LMKC 3MVHA 4V0GA 3MA6A 4FX3A 3OP5A 5HD4A 2CGWA 3V5QA 3TDVA 2QKRA 4WRGA 3PIYA 2UW4A 3EYHA 1OZ1A 4ITHA 5DFPA 3DA6A 3I0QA 5AP7A 3QF9A 3L8PA 4N0SA 3E5AA 1J7UA 4PDOA 4D2RA 2V7OA 3R71A 3ZRLA 4C62A 4DINA 5GIPE 4O1PA 3R9HA 3SXRA 1U4DA 4R1YA 3LCOA 4CQEA 2OJ9A 4J95A 2VO6A 5D41A 1SM2A 3NS9A 1WBWA 4UY9A 3CJFA 3HRBA 1AGWA 2X9EA 3TI1A 3SRVA 5E8ZA 5CEKA 4I23A 2PMOX 3KKVA 5L8KA 4F6SA 5HTBA 4IEBA 3UO4A 4EL9A 3HAMA 4YSMA 1J91A 2XM9A 5IZFA 3M1SA 4FMQA 4NWMA 4P4CA 5JRQA 3WYYA 3TKIA 2DQ7X 4LYNA 5FEDA 5AP0A 1G5SA 4QMWA 4CRSA 4LMUA 5I3RA 4FSRA 4JQ8A 1DS5A 3E7OA 3D4QA 3FXXA 3R00A 4FUXA 1A9UA 4QQ5A 2VWYA 4X2FA 5AP1A 3S2PA 2WO6A 4DH5A 4TL0A 2PU8A 3EKNA 3GCSA 2JD5A 4ACGA 3FC1X 4AQCA 4KRCA 2PUPA 5D7VA 1OPKA 4FKQA 5EHYA 4DN5A 2EB3A 4AN2A 4H3PA 2EVAA 4C4GA 2UZEA 4X2KA 4WIHA 3HA8A 5KBQA 5HG8A 4LG4A 3V6SA 4XS2A 3RPOA 4MXCA 2EXEA 4M0YA 1WFCA 3DAJA 4Y95A 3PZHA 3O7LB 3UYSA 4Z7GA 3FDNA 3RMFA 4KB8A 3RGFA 2VWIA 1TKIA 3UG2A 3EN9A 3Q04A 4X3JA 5IQBA 3PP1A 4O7SA 2R3LA 2XYNA 2C6KA 5KMOA 4O7ZA 3CPBA 3F3TA 4XG2A 4RJ7A 3BYOA 3NIEA 5EYDA 5AWMA 4XJ0A 4K1BA 4O82A 4HPTE 2Z7SA 3UBDA 3NYXA 3FV8A 4I22A 4RIXA 4FG7A 4BDEA 4YSJA 4QPMA 1H28A 3JYAA 4FIIA 4HGEA 1Q4LA 1OL1A 4RA5A 5E9EA 3QAME 3TV6A 4JRNA 4XX9A 3KXZA 2IVSA 3UG1A 4PPAA 4Q5HA 2V0DA 2HELA 5BVDA 3EH9A 4MXYA 1XBAA 4NTTA 3O8TA 4F7NA 5CU0A 5EDPA 2O65A 1JWHA 3ORLA 4JAIA 4Z7HA 5EOBA 4FV1A 2XKFA 4MNEA 2UW8A 3QQUA 2UZVA 1H8FA 2JKMA 3ZHPC 4RT7A 2P0CA 3ZO4A 2RG6A 5CF4A 3R7YA 3IW4A 3THBA 2J51A 2WTWA 3DBQA 3CEKA 3PTGA 5AUZA 3UDBA 3ZRMA 3U9NA 2VWZA 3LHJA 4WUNA 3Q5IA 5FGKA 1UKIA 4ZZMA 3TCPA 3W2QA 3ZYAA 1VYZA 3IDCA 4BIBA 1UU9A 5KNJA 1H01A 4O22A 5FWKK 4DAWA 5F95A 4FT0A 2AC3A 4MTAA 3R9OA 4JAJA 5FRIA 5KMIA 4O2ZA 3I0OA 1R3CA 4LRMA 3PJCA 3CQWA 4LV5A 5IA5A 4E4XA 4FIJA 4ANMA 2B9FA 5M56A 4R6VA 2XIKA 1H1WA 4G3FA 3ZSIA 4ZY5A 4ZS4A 3VS4A 4KA3A 3PG1A 3FXWA 3S00A 4GIHA 4E73A 3DY7A 4FICA 4FIEA 4G3EA 4EUUA 5IA2A 4LGDA 3SW4A 2CKPA 4A9YA 3AT3A 4OTHA 2X39A 3ID6C 1Y8YA 3EN5A 4USEA 4FV6A 4CKIA 4F4PA 2YM3A 5FBOA 5HBJA 3KRJA 4DFNA 2C6TA 4JXFA 4P5QA 5AR5A 5AR4A 1XJDA 4GRBA 3SOCA 3R1YA 5F1ZA 4L46A 1GIIA 2AC5A 3L9LA 3OROA 2OIQA 4C2VA 3FMEA 4XLVA 3ZFYA 1M7NA 2C6IA 4O91A 3G15A 4I94A 2XH5A 3OOGA 3PJ8A 5M4IA 4LGGA 4ACCA 3KRXA 3DBFA 1PMNA 3R2BA 3TTIA 4D4SA 5CQUA 4RQVA 2C69A 4Y8DA 4Y5HA 3ZZWA 3GUBA 4O0TA 3H9FA 2VO0A 2P55A 2GSFA 3EYGA 3GBZA 2JITA 3VW8A 4AS0A 4F6WA 4RZVA 2QD9A 1CSNA 3ZSGA 5K0XA 5AV2A 2YWPA 2VGOA 2OBJA 2WU7A 3QD0A 1XQZA 3C50A 1JSVA 2QOQA 3A8XA 3R1NA 1F5QA 4AA0A 4Q5EA 4BTFA 3P79A 2HZ4A 2J9MA 4NTSA 3HMMA 3F3WA
chains in the Genus database with same CATH superfamily
4QMMA 3K3IA 2YDJA 4E20A 1OPLA 3P5KA 4I92A 5LCJA 2VTRA 4DGNA 3G33A 4X3FC 1ZZ2A 3UQFA 3UZRA 1MQBA 4HZRA 4UEUA 3OUKA 3QLGA 4PF4A 3UMWA 2WMXA 5KCVA 4RJ3A 3C13A 3VRZA 3KXHA 4E5WA 4EH4A 5IUIA 4BWXA 5CVFA 2EXCX 3H0YA 4NCTC 3ZH8A 5EHLA 4PMMA 5CS6A 1NVSA 3QA0A 4AN3A 2JDVA 5AV3A 4NW6A 1P14A 2OGVA 3L8SA 5I5ZA 2WTJA 2ACXA 4X3FA 2PULA 4CTBA 3F9NA 3LFBA 2UUEA 2XZSA 4U8ZA 3FEGA 3BHHA 5IG1A 5FTOA 4O4BB 4FV0A 5CAOA 3R2YA 4IAZA 4KIQA 1ST0A 4ANQA 2PPQA 4LOPA 5D1JA 2QCSA 3BHVA 3II5A 4EOMA 3FXZA 3F2NA 1MRYA 3I7CA 4LMNA 1E1VA 4XRLA 4APPA 1FGIA 4FKWA 4RLKA 5E1EA 3W2RA 2RG5A 4XNEA 3BCEA 4RZWA 3UVQA 5E91A 3U6JA 3QTIA 4D1XA 4HOKA 3AMBA 3WE4A 4CTCA 5BUIA 1G8AA 3NYVA 1Q24A 3D7TA 4N4SA 4JNWA 1R39A 2J5EA 3LM0A 3M11A 5DOSA 3S0OA 4HZSA 5K5NA 3AXWA 1T46A 1E9HA 2F57A 2BRMA 3QYWA 2IF8A 3GU6A 5DPVA 4E1ZA 5LVNA 1UU3A 3PLAE 5ANKA 1PKGA 2J0JA 2XKCA 2QR7A 4QMSA 3ZM4A 1XBBA 4WBBB 3R8LA 3O0GA 4MXOA 2A4LA 4E5AX 5CTPA 1LP4A 1H25A 2RF9A 4GJ3A 5HG9A 5BYZA 4H58A 4WNKA 4A4LA 4ANNA 5CALA 3QD4A 2C68A 5K3YA 4CSVA 2IVUA 3PXYA 4RX7A 3F61A 5C27A 2W99B 3DNDA 3HRFA 2GQSA 5FXSA 3I5NA 5I3OA 4FVRA 3NAYA 4JG8A 4M0ZA 1ZZLA 4O4DA 4G3DA 2WU6A 2QO9A 3FAAA 3NNXA 3Q9ZA 4I3ZA 2FGIA 2VTPA 3UIBA 2C6OA 4FKVA 2VUWA 1H1RA 2ZOQA 4FZFB 3QYZA 5FTQA 3T3UA 3E63A 3B2WA 2JDTA 4ZJVA 4QTBA 3BEGA 4HCUA 3DK6A 5G1XA 3GENA 4FV5A 5IH6A 3OCSA 5L8LA 3GT8A 1GIJA 2QHNA 4YZNA 3CS9A 4C4JA 1M2QA 3FI3A 4NH1A 2GNFA 3O23A 2PYWA 4RJ5A 3TG1A 4FODA 3PE2A 4WNOA 3EOCA 3VUIA 1YWRA 2BZIB 3BU6A 3IS5A 4YLLA 3PLSA 5IA0A 2OO8X 4RBLA 1ATPE 4O21A 4I5CA 3R9NA 4F7LA 3RAHA 3EN6A 1SVEA 1P4FA 3R01A 4KBAA 3D5VA 1H07A 4FL1A 4H1MA 4A9SA 4FA2A 4E6DA 4QQTA 2AEGA 3PFYA 3A62A 3GU7A 3L9PA 5E90A 1M2PA 3FLWA 4F09A 3I6UA 4NL0A 4QTCA 4YO6A 4B0GA 4EH8A 4C35A 4ZTMA 2IZTA 4HNIA 4YJQA 5LQFA 3QCQA 4EBVA 4AT5A 2ITPA 2I1MA 4B8MA 2W1CA 3Q60A 3CTQA 4C7TA 2YM7A 1UNLA 2OJJA 4M7IA 5H2UA 5BVNA 1Y6BA 2I0EA 4ZSAA 4FKJA 2GS2A 3QKLA 2XBJA 1YQJA 2X8EA 4HYUA 4O6EA 3FMJA 5E8WA 4O96A 4Y5QA 4XG3A 4YC3A 3C0GA 3UOHA 3CP9A 4BBFA 3AC1A 3CJGA 4BN1A 3K54A 5AP2A 4MKCA 1CKIA 4IAKA 2F2UA 3MJ2A 3NYNA 4QYGA 3SC1A 2W96B 4ACMA 1P5EA 1AD5A 4BKJA 4Z55A 4UWBA 3JXWA 5AP3A 3R8UA 1LUFA 5HLWA 1QPJA 2Y6MA 3NLBA 3MFUA 2W4JA 5DT0A 2P33A 3ZLSA 4ZLOA 5EFQA 4IB0A 4IZ5A 3VC4A 3MB6A 4EOJA 4FYNA 3NSZA 5FXRA 4XBUA 3VUDA 3BU3A 4R3RA 4S2ZA 2C5VA 1H0VA 3Q96A 2R3IA 1BLXA 5M51A 3QC4A 3TKHA 4F65A 2OK1A 4MD8E 2ETRA 3ODYX 4B4LA 4BF2A 3FYKX 5BVWA 4EH6A 3FQSA 5BYLA 4RVKA 1OL2A 2A2AA 2QVSE 2WMTA 3P0MA 4FKPA 5DT4A 5AUYA 3E8DA 2NP8A 3BU5A 3PY1A 4FTRA 2P3GX 4Q9SA 4CT1A 4AXDA 3NEWA 3QD3A 3ROYA 2B1PA 3ZFXA 3QD2B 3R7GA 3BHYA 5CSHA 3ZTXA 4FEVA 3FZTA 2WMWA 4ZK5A 2DS1A 1JKSA 2FSOX 3W2PA 2J0IA 4WG4A 2W1EA 4QMYA 4M12A 5AIRA 3UIXA 3IW8A 3R8MA 3LFEA 4F08A 5M08A 5AR2A 1SYKA 3FPMA 3BWFA 4LQMA 5HE2A 4L8MA 4EK4A 3QZHA 5FEEA 3VHEA 2HZ0A 4P90A 3F2RA 1UU7A 5EH0A 2E9VA 3K5UA 3IOPA 4FNWA 4GW8A 2NNWB 3BWJA 3KK8A 3FQHA 4BDHA 4D9UA 2OZOA 5JH6A 4ANLA 3C5UA 4IM2A 3H0ZA 1WZYA 2VGPA 3REPA 5HX6A 3ZEPA 4QP6A 1WBTA 3AC4A 2J0LA 4N6YA 5TF9A 4IQ6A 4QPAA 2ZM4A 2CKEA 1YXVA 2WZJA 4IAIA 5IQCA 3H10A 3QQFA 5G6VA 4FBXA 4EHZA 3BLAA 4Y83A 2OH4A 2C3LA 2PUIA 3I81A 5M53A 1YOJA 4C36A 1UKHA 4FI1A 3T9TA 4CV8A 4XHKB 3V5PA 4AFJA 5I9WA 4YBKA 4N70A 4BBMA 3ALOA 1OKZA 3GGFA 1ZARA 4FV9A 3GB2A 3DLSA 5BVEA 1UWHA 3OXZA 3P23A 1CKJA 3BYMA 4CFNA 4H36A 4IFGA 1WVXA 3EFJA 2HZIA 4KS8A 4EZ3A 4GUBA 4YHFA 2PZIA 4RVTA 2ETKA 4IC7A 5ACBC 2UW5A 4O4FA 1KV1A 3COIA 5C8NA 5KMJA 5GZ8A 3AC8A 3QX2A 3ORZA 2WMQA 2WQMA 3BLHA 3IOKA 3O8UA 3VONA 2W1GA 2PWLA 4CFXA 1YVJA 3C7QA 4TPTA 4OBPA 3PE1A 3LQ3A 3LLAA 3RWQA 5EQEA 4YTHA 2VN9A 5AUWA 3SV0A 2J0KA 1IAHA 4NM0A 4IAAA 1GAGA 3FL5A 4KSPA 3QBNA 4UWYA 3LFDA 3TUDA 4U6RA 1GIHA 3QTRA 4DITA 2ETMA 3KN6A 3S95A 3VRYA 1JOWB 3BGQA 4OGRA 4O0XA 4TNBA 4FEUA 3W0PA 4EK5A 3HX4A 3TXOA 3U6IA 2G9XA 5HVJA 3FY2A 1I44A 3LXKA 3FWQA 5EG3A 4CYIA 2F7ZE 4X3FB 2QOIA 4II5A 4TYGA 4MX9A 3U4WA 5HZNA 2VNWA 1QPEA 4RVLA 2HWPA 4DGMA 1UVRA 1W2FA 5HIEA 1O9UA 3U6HA 2Z8CA 2EU9A 2PVMA 2WIHA 4C38A 1R1WA 3FHRA 4C4EA 3BIZA 4YLJA 4BB4A 4KKEA 5ANDA 5HNIX 3UOLA 5LJJA 4ZXTA 3VS1A 3F2AA 4E6CA 2X1NA 3Q52A 3RP9A 5IUGA 5JT2A 3BX5A 3PFQA 2YABA 4NUSA 5GJFA 5HTIA 5I9ZA 5IISA 4YNOA 4R3CA 4IMYA 1DAWA 4U3ZA 3SGCA 4DG2E 4LI5A 3BELA 2QOLA 2YN8A 4BR3A 2GNGA 3VS6A 2BZKB 5CSVA 2PZ5A 4FTOA 5IEXA 3OOMA 2YA9A 1FOTA 3CKXA 3HV5A 4AP7A 4DH1A 4QMTA 2CLQA 2UZDA 2YIWA 3AC5A 4FKRA 4KKGA 3QALE 4CV9A 2X8IA 4NYEA 3OHTA 4OAVB 4R7BA 1KE6A 3KMWA 4NM7A 4DHIB 3VUGA 4U81A 4DGGA 3BHTA 4JBPA 3CQUA 4BFMA 3DZOA 1OGUA 4YJPA 4AOTA 2C1BA 2R5TA 2QOKA 3RPVA 1PHKA 2JFMA 2PVLA 3PVBA 4L3LA 4JL9A 4O0RA 3W32A 2WOUA 2XIYA 5HNGA 3TNIA 4AXFA 3WZEA 4OTFA 2BRHA 3NUXA 4BCNA 4W9XA 1PXNA 2XIZA 1NVQA 2VNYA 3OY1A 1FVVA 3VJOA 4CG9A 4IJPA 1Q8YA 4G17A 4ERWA 4FC0A 1W84A 3Q5ZA 2H6DA 3F7ZA 2A98A 2BAQA 4KS7A 4XP3A 3R7UA 1SVHA 2BHHA 2WMRA 4NKAA 4O81A 4QMVA 1LPUA 5M57A 3HNGA 3PYYA 1BKXA 4FL3A 3GC7A 3U87A 4AOIA 2GS7A 3ELJA 4J8NA 5CVGA 3ZFMA 3N4TA 2Z7RA 3LFFA 2FYSA 3IG7A 4FZAB 4OBQA 4PDPA 3LFSA 4H1JA 4OTGA 3NGAA 3VUHA 4MQ1A 4JDKA 4YJSA 3EQBA 2RL5A 3P5JC 4RIWB 3O2MA 5IMXA 2OFUA 2OJGA 2XEZA 3TMOA 3GCUA 4K2RA 1T45A 4IACA 4FSQA 1R0PA 3NMUF 5H8BA 2FSMX 2UW0A 4AG8A 1NT2A 3PJ1A 5L6PA 2EXMA 4O4CA 3WZKA 3RHXA 4YZDA 5GNKA 3UMXA 4ZZNA 4O84A 2GNLA 3MTLA 3UC3A 2XM8A 4BHNA 2HAKA 1H08A 3E7VA 4MH7A 2ITVA 3GQLA 3OWJA 4NFNA 5EW9A 4CFUA 4AAYA 3KGAA 2UZLA 1OL5A 3NIZA 4MQ2A 3KRRA 5JKGA 5DVRA 2X9FA 5D7AA 4FKUA 1JNKA 1JKKA 2J5FA 3EJ1A 3IQ7A 3OXTA 4BZDA 4FEWA 4AA5A 4CFVA 3HGKA 4RPVA 3VO3A 3MPAA 4HGTA 3TWJA 2QO2A 5LVMA 2E9PA 3Q6UA 4JX7A 3WZDA 1XH5A 4EBWA 4DEIA 5DWRA 4D5HA 5JFVA 2GMXA 3O7LD 2R3PA 4FT5A 3NUAA 4ENYA 1V0BA 3DKGA 3W0SA 1A06A 3ZDIA 2GPHA 3TIZA 4CMUA 5CF5A 1H24A 4HVIA 5L2SA 3MPMA 3HDMA 2HK5A 1W0XC 3LPBA 3H30A 5AAEA 2BHEA 2NRYA 4RIYB 2XYUA 4EC8A 1W7HA 3TUCA 3RWPA 3S1HA 2Y9QA 3DS6A 4Y85A 3VBQA 2W1DA 1KV2A 3W8QA 4E4LA 4F7SA 4EHGA 4L68A 4YJUA 4DEBA 1ZOHA 3DKFA 4AXEA 2GCDA 4MWHA 2R3QA 4BDBA 5GZ9A 3DXQA 1NXKA 3W18A 5C4KA 4ZEGA 4RX8A 4D0WA 3MDYA 3UNJA 4O7TA 4TXCA 1LR4A 2WTKB 2HXQA 3MV5A 3PXQA 4ALWA 4IAYA 4L7SA 3PXZA 1WVYA 2X4FA 3GI3A 3EZVA 1OGYA 1KSWA 2GHGA 2YM5A 3IK3A 1MRVA 2GHLA 4JX3A 3ORMA 4ANSA 2VAGA 4I5HA 3UVRA 2F2CB 2OXXA 1GJOA 3LXNA 1GZ8A 3VS3A 4CRLA 2P4IA 3EQDA 5DN3A 3TIYA 2PVHA 4JG7A 3VJNA 3WE8A 1S9IA 3N9XA 3HMIA 5TO8A 3ANQA 4GFGA 2GS6A 2W1HA 4GL9A 4XUFA 3WZJA 5LMKA 1MP8A 4IWDA 4TT7A 4S30A 5I9XA 4XEYA 1QPCA 4TNDA 3ZXTA 5K5XA 4I24A 4X0MA 5AUTA 2I7QA 2QG7A 3BQCA 4X2NA 2X2LA 3RVGA 4IXPA 3ZOSA 4BHZA 5FDPA 2E9UA 5IH4A 1NY3A 4MF1A 5TE0A 1ZLTA 5HTCA 1Y8GA 2XNBA 3MFTA 4YJVA 1Z9XA 2VO7A 4I6QA 4WHZA 5JFSA 4RFZA 2H8HA 2PSQA 3QRUA 2UZOA 2BMCA 4FG8A 4GYGA 3KULB 4H3QA 4L67A 4EI4A 4ZY4A 3DAKA 5J9LA 4BDKA 3P86A 3HUBA 3R63A 4KRDA 4QMOA 2VTNA 4XG7A 4PTCA 3C4FA 3IW7A 5DHJA 2B0QA 2YDKA 5AAFA 4WOVA 4RVMA 2G1TA 1CTPE 3HECA 3QKKA 2GTMA 4TY1A 4USFA 3IONA 4FVQA 4M13A 4Y73A 2G2FA 3VS2A 3ZONA 2WMVA 5KUPA 5LOHA 1KUTA 3T9IA 3VIDA 4EHVA 3SG9A 4PWNA 2OF4A 4P2KA 3FLZA 3OTUA 4PL5A 3DNEA 1BX6A 2QU5A 3G90X 4K9YA 4OT6A 5DMZA 4HGLA 3MW1A 1JKTA 4D28A 4D1ZA 4IIRA 3I79A 4UMQA 3EQGA 4IANA 5CENA 3ZMMA 3DB8A 1J1BA 4JS8A 4CMOA 2YHVA 3EMGA 3A7FA 4ZTLA 2R64A 2RFNA 2JAVA 4V05A 3C5IA 2I40A 5J7HA 4F9CA 5BV3A 3QRTA 3LCKA 2IW9A 2PVKA 2IN6A 4YGAA 3U4UA 5LARA 3W55A 1U5QA 2CKQA 3O5AA 4FJVA 4D58A 4W4VA 4JDJA 3IKAA 1Q97A 5CEQA 4BRXA 4FT7A 2QOHA 4JIAA 3N4VA 2QO7A 3RK9A 4M66A 2ITTA 4CZYB 2OIDA 4ONAA 3RNIA 4D0XA 4ZAUA 3F3UA 2ZV2A 3LOKA 2JDSA 2B7AA 4O38A 1VZOA 3W2OA 5HG5A 4F99A 2C47A 2JKOA 4PMSA 5DI1A 1WCCA 5DR9A 3OVVA 3R83A 2RSVA 5HORA 3OW3A 5E8TA 3R8ZA 4M3QA 4WNMA 3Q9WA 5AUVA 3TACA 3EQCA 4GEOA 2AQXA 3ORKA 4I41A 4YNEA 5CU3A 4GK2A 3RK7A 3T3VA 3VN9A 4LRKA 5CZIA 3TV4A 3ERKA 4AQKA 3MPTA 3Q6WA 3TZ9A 4AXAA 5A54A 3AKKA 2FVDA 4BDIA 3ZZEA 5EQYA 4DE4A 1ZMUA 3L9NA 4AZTA 2IG7A 3HDNA 2PVRA 3KA0A 3ORPA 4TYHB 2BIYA 2IZRA 4RJ6A 4JBVA 4RQKA 1WBOA 4JJRA 4O6LA 2R3GA 3UP2A 3TEIA 5KHXA 2CKOA 5HIDA 4IX5A 3MY0A 2QOBA 4PUZA 2OJIA 2DWBA 2IW8A 3RHKA 4A07A 2JAMA 2YWVA 3BL9A 3W0QA 4DEDA 4TN6A 5DEWA 1R78A 2EUFB 1IASA 3FBVA 3MVLA 3QCXA 4XH6A 3HAVA 2YZAA 3LJ0A 1YWNA 2R3MA 2YM8A 5C03A 2BDJA 4ZTSA 3UQGA 4MHAA 4GH2A 3F3ZA 3KXNA 4EKKA 2YIYA 4F1MA 1O6LA 2CN8A 5CSXA 5EM6A 5IKWA 2F7EE 3OEZA 4RX5A 1UU8A 5JQ8A 4O1OA 4H3BA 4GT5A 4M84A 1YI3A 2G2IA 1G8JA 3UGCA 2ZB1A 4U97A 3W2CA 4DEEA 3UC4A 3FSFA 3A7JA 4QMUA 3P7BA 4ZTRA 5A4CA 5LVOA 4RWKA 4AWIA 2X0OA 4BCIA 3BPRA 4JR3A 2YLFA 1H4LA 2R3FA 4PNIA 4QDVA 4QEBA 2XRWA 1ZAOA 1ZYDA 2UW7A 3F5GA 3AT2A 4I4EA 2HZNA 5C8KA 2YM4A 5J95A 5L3AA 5IQEA 2BR1A 5KZIA 2WIPA 4BTKA 5ETFA 2PE2A 3POZA 4E26A 1PY5A 4R7IA 3HUCA 5CF8A 3GOKA 5K4JA 2XK3A 1OUKA 3JY0A 2XVDA 3HMOA 3KRLA 2KULA 2QNJA 5CX9A 3H9RA 4G16A 2WMAA 2REIA 4YURA 5JGDA 4DBXA 3G9LX 3NUYA 3PUPA 4OTPA 1YDSE 4HW7A 4CQGA 5A4QA 4CD0A 3GOPA 3CSVA 4MUQA 3FMHA 4UYNA 4AZVA 2C1AA 2XJ2A 4UXQA 2P2IA 4I93A 5CASA 5L6OA 1M14A 3NFFB 2Z7QA 5BVKA 2C3IB 2PVFA 1XR1A 4BCFA 3P08A 2C30A 4GG5A 1TZDA 4FTKA 3CKWA 3COMA 3E92A 4U5JA 2Z2WA 3FSKA 3IGGA 4PTEA 1Q3WA 3VS5A 4HYIA 4YLKA 4A9RA 4A9UA 4XG6A 3W10A 3OZ6A 4BI1A 4M67A 5IA4A 4LM5A 3C0IA 4QNYA 2QHMA 4IB5A 4ALUA 5EKNA 4NM5A 1OBDA 1RQQA 4AZSA 5KMNA 5CSWA 2CCIA 4MXAA 4KINA 4BI0A 3R1QA 1RW8A 5IDPA 1JBPE 4FGRA 1SNXA 4ALVA 3EFKA 3B8RA 5DGZA 4BYIA 3GFEA 4FV4A 5EM8A 3GCVA 2IWIA 2YITA 3M42A 4PL4A 4G3CA 2X7OA 3DCVA 3IW6A 4FGBA 4KIKB 3KEXA 4E3CA 3ZUTA 1IR3A 4ZMFA 1HCLA 2WTDA 5CXZA 2CMWA 1F0QA 4B6LA 2PMLX 1FINA 4G6NA 2IZSA 2GNIA 4IZAA 4OTIA 3MBLA 4ZTHA 3ULIA 3V5JA 4CKRA 1G8KA 2NPQA 2VRXA 4GU9A 2RKUA 2UW9A 4NCTA 3F5PA 5I4NA 1KE9A 2X0GA 2PMNX 3V5WA 2J6MA 3FI4A 3EN4A 2HY81 4FYOA 3BQRA 3BHUA 4FSZA 4MWIA 5FLFA 3QCYA 4XLIA 2GNHA 1JVPP 4O7RA 1F3MC 3RTPA 3KN5A 3L1SA 4GFMA 3FMLA 4DGOA 5HOAA 1ZYCA 2J7TA 3UIMA 3ORNA 2NYAA 3NWWA 4JDHA 5ANJA 3QQKA 3H4JA 3VHKA 1XMLA 3G5DA 5JZJA 3MSSA 4WKQA 2BZJA 4AZEA 3C51A 3JVRA 4L3JA 3OXIA 3V8TA 1Q8UA 3NNVA 1YOLA 2V62A 4EH2A 4NIFB 2BFYA 4FSWA 4BTMA 3PUFC 4K33A 4FZDB 4FSMA 2E2BA 4JRVA 4GV1A 1IAJA 2VU3A 3OT3A 3LFAA 4NK9A 4DFLA 5HX8A 3D5XA 4DEGA 5CAQA 3BLRA 1XKKA 4YO4A 2WQNA 2YEXA 3A7HA 5LMAA 4Y46A 5HNBA 3UNZA 1OB3A 3OT8A 4L43A 4PPCA 4QP2A 2JDOA 3MH2A 3Q9XA 4BDCA 4F9YA 3RAIA 3ZU7A 5A6NA 4JBQA 5I9VA 1STCE 4RWLA 1PKDA 5CT7A 5FDXA 2W4KA 5KBRA 3LKMA 4FIFA 4UZDA 1WBVA 3R7EA 3O17A 3LAUA 3QRKA 4I21A 3BYUA 1FVRA 4IADA 4O0UA 4AX8A 5DIAA 2WEIA 4NZWB 2RIOA 4EOKA 1NW1A 5EM5A 4FTLA 5JZNA 4AU8A 3PIZA 4ZY6A 2GU8A 3R28A 3MH1A 3L8XA 3R21A 4AAAA 4BL1A 4QTEA 3AGMA 5A3XA 1XH8A 5IPJA 2QLQA 3AMAA 3IW5A 3TUBA 4FTIA 2YZLA 3PXFA 4IX3A 3FZ1A 4BTJA 2OG8A 2XK8A 3D15A 3FUPA 4H39A 3LW0A 2C3KA 4RIWA 4W4XA 3OWKA 4BICA 4YZCA 5CAUA 1OIUA 4BCHA 4RC3A 3HV3A 3VULA 4IE9A 4OT5A 3PA4A 2WPAA 3FLQA 4GMYA 3RPYA 3KK9A 5GINE 1XO2B 4EK3A 4WRSA 3CD3A 3KY2A 3MI9A 4ACHA 3Q4CA 4AGDA 2X0PA 2VV9A 3NUUA 5FXQA 4MD7E 2IEWA 1GZNA 2PHKA 2R9SA 3E93A 5L6WL 5IH5A 4NM3A 5LVPA 5GHVA 4EH7A 5JGAA 3E8NA 1P4OA 4HPUE 1ZYLA 2J2IB 4NT4A 4USDA 3KVXA 5J9YA 4BY9E 1S9JA 3SXFA 4EQMA 5M09A 1BYGA 4AZFA 5CZHA 3QZIA 3UZTA 4J8MA 3QWKA 5AX9A 3W0RA 4PQNA 4U44A 2LAVA 2WMSA 3QQLA 3QUEA 4CCBA 3EFLA 3PPZA 3K3JA 3A4PA 1Q8TA 4PDYA 1K2PA 2W1IA 5FM3A 4RSSA 4ZIMA 5JRSA 2F49A 5CNOA 4LUDA 4N57A 5F20A 3PWDA 1PXJA 1Z57A 3FC2A 2R3NA 3RM7A 5HO7A 2WTKC 3HYHA 4JR7A 2H96A 4KBCA 4BDFA 4RIYA 4S32A 4J96A 2WNTA 4W4WA 4BCPA 5AAGA 2WFYA 2YIXA 3QRIA 5JSMA 3QTZA 5AR3A 3CLYA 3MGYA 2X81A 4M15A 4U7ZA 1ERKA 2VWXA 3MA3A 5KKRB 4ZLZA 4MBJA 2JLDA 1OIRA 3AT4A 3EFWA 3HP2A 4IWPA 1CDKA 4GT4A 4FK3A 4YP8A 1OVEA 4E6QA 2XBAA 4E4MA 4BGHA 5ETCA 2XNEA 3LVPA 3KL8A 4I6FA 5IQAA 5AV1A 1XHAA 5JN2A 2OU7A 1V1KA 3MVJA 4M68A 5A14A 3TDWA 3ODZX 3CIKA 3HA6A 4IC8A 2R3HA 1YXTA 4APCA 3FLYA 4YTIA 4DTBA 3DKOA 3NNUA 4E93A 1YXSA 3HV4A 4K77A 4ZJJA 4EZ7A 2E9NA 4L45A 4M69B 2W7XA 4C57A 2XKEA 3F88A 3PPKA 2R7BA 2YDIA 2XKDA 3C1XA 4LRJA 4QQCA 4UZHA 4N6ZA 5L2IA 2XMYA 4PY1A 2W5BA 1WVWA 4CKJA 1YDTE 4ITIA 2OICA 3RZFA 2CNQA 4O83A 4U41A 2ONLC 4IZYA 3R9DA 3OBGA 3PXKA 5CWZA 4ANOA 3Q2JA 3HZTA 4NU1A 3C4CA 4C37A 4CEGA 5BVOA 5H8EA 4QP3A 4O7WA 4G5JA 4O86A 4QTAA 4EOPA 1YXXA 3MVMA 3W0NA 5M07A 3CR0A 3TZ8A 4RJ4A 3KULA 5JQ5A 2VTQA 4DFYA 4O7NA 5AV4A 3PJ2A 5BQ0A 2ZDUA 1FQ1B 2ZMCA 3O96A 4XMOA 5IEYA 5J5SA 4WG3A 3H9OA 3JUHA 2XK7A 5BUEA 1XWSA 4EH3A 1OKYA 2XNMA 4X6QC 1I09A 3NRMA 3P4KA 2C0TA 3KCKA 4P7EA 4DH8A 4GKIA 5FG8A 1PRYA 4FTJA 2GDOA 3I6WA 5AX3A 5EW3A 4DCAA 4AGUA 2PZRA 5LWMA 1V0OA 1PXOA 2GFSA 3P7AA 4FTQA 4AGWA 3V5LA 1U46A 2X7GA 4RJ8A 5KX8A 3DZQA 3OCGA 2KTYA 2OKRA 3P78A 1LEZA 2ITZA 3OWLA 2VWVA 4EOIA 3I7BA 2C5OA 1XH4A 5E92A 2LGCA 5ANEA 5D11A 2VX3A 4GSBA 3SG8A 1RDQE 1MUOA 5EK7A 1HOWA 4G3GA 5DYJA 4AN9A 1M7QA 2BZHB 3A7IA 4WUAA 5EI2A 4BC6A 2YCRA 4MNFA 4AF3A 1W8CA 4Z3VA 4ZZOA 5A9UA 3QZFA 4K6ZA 4EOOA 5IQIA 5H3QA 4HCVA 3WIGA 4PP7A 2C6LA 3BE2A 2OH0E 3NCZA 4WSQA 2O63A 1X8BA 2HCKA 3UNKA 4U3YA 1ZYSA 4D2PA 4RGJA 4QP8A 2VWBA 3ZUVA 4UMRA 4FE2A 2C6MA 4RA4A 2VWWA 3UPZA 4XYFA 3BKBA 1VLRA 3D14A 4I5PA 3CQEA 3LE6A 2F4JA 1J1CA 4OLIA 4D4YA 3SAYA 2SRCA 4KIOA 5HCZA 5TT7A 2I0VA 3P7CA 1FVTA 1PW2A 2ZM3A 4J52A 4YHJA 5HCYA 4ENXA 5AMNA 1TFFA 3OCBA 1K3AA 5HCXA 4TYHA 2V7AA 3MIAA 2DUVA 3ATTA 3D2IA 2X6EA 4QOXA 3TL8A 3ML1A 2CLXA 3LMGA 4TW9A 3Q32A 4QP1A 5IU2A 3BBWA 4YC8A 4XG9A 3VUMA 4J97A 1W82A 4BCQA 4XG8A 3DFCB 3WF6A 3FY0A 2C3JA 2CJMA 3DKCA 4TYEA 3UZPA 3FPQA 3AKJA 4QT1A 2G01A 2OWBA 2W9ZB 4TWNA 4K18A 4QMZA 5I9UA 3WBLA 5J87A 2HOGA 3CD8A 2BKZA 3DV3A 2V5QA 3HLLA 4RLLA 4TWPA 3W33A 1PXPA 1W83A 4ZLYA 1OI9A 4R7HA 4HVGA 5HO8A 2ITXA 3ZUUA 1JSUA 4AW2A 3WF5A 2WGJA 3MB7A 4CNHA 3LQ8A 4GFOA 4DH3A 2B9IA 3EZRA 4FSNA 5DEYA 3VBWA 2YERA 4M14A 4BJJA 2B9HA 4F70A 4B8LA 4FK6A 5DH3A 5EDRA 3KCFA 4LV7A 1P2AA 3KQ7A 4I0RA 3ATSA 2VTJA 5LXMA 3VWAA 4W8EA 1B6CB 4LOQA 4KSQA 1YW2A 2ZYBA 1Q99A 1Y57A 2OSCA 4MXXA 5CYIA 1ZXEA 2ZB0A 4FOCA 3PRFA 4WSYA 4J98A 3QFVA 4PV0A 5FEQA