1TQIA

Crystal structure of a. fulgidus rio2 serine protein kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 91
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqiA02
4AFJA 3CLYA 4D2SA 4QMLA 3EQFA 3P23A 3LFKA 5TJJA 5EW9A 3LKMA 3I59A 2Z5UA 4QNYA 4KBAA 4PMTA 1ZMUA 1ULYA 3BRBA 3A8WA 4FTTA 2Z60A 4GKHA 4ZTQA 5M4CA 2AC5A 3GLXA 3GYHX 5GIOE 2PZYA 3E8CA 3KRRA 3DKWA 4LFUA 3GU6A 4FL2A 4NJDA 2X6DA 4NU1A 3A7JA 4L5IA 5D4SA 4MXXA 2WTJA 4FE2A 3F88A 3AC5A 4IZ5A 3OCTA 3TL8A 2NP8A 4C2WA 4E5AX 4FV2A 4FK6A 4FV4A 2BTSA 4XV3A 2V9VA 3JY9A 4QOXA 3RAKA 2EB3A 4BC6A 2C68A 2VN2A 4WRSA 2Y6MA 4WNKA 4RMZA 4LK1F 4F0GA 4ETSA 3RJPA 2W1FA 4XV2A 4I6BA 3FMHA 2BTRA 3B2TA 3Q60A 4DEHA 4D4YA 5CF8A 5HU3A 1J7IA 5FGMA 4XG4A 4M6XA 2REIA 4FODA 5HVQC 3GU8A 3UNKA 4XG2A 3NX8A 4KD1A 3SW4A 2P4IA 4KABA 4UMPA 3A60A 4HV5A 2YITA 2QR7A 4U3YA 2IP2A 4GYIA 3R30A 3WG9A 4D2RA 5E91A 5L2TA 2QZ8A 3EL7A 5KO1A 2LSOA 2QURA 4FEWA 2QOOA 4V04A 1G3NA 2FBIA 3BZ6A 3LWFA 3K1NA 4J1RA 5E1WA 4F9AA 3EFLA 4WCGA 1STZA 2MC3A 4YJQA 4EC8A 4I6QA 4IRIA 2OBJA 3SAYA 4O7SA 3JXWA 5LEKA 5DYMA 2ZV8A 2VE8A 4W4YA 4IDVA 4BY9E 1BL7A 4WOVA 4C7TA 3HOTA 4H3BA 4X3JA 3NEUA 4B7TA 3WZDA 1YG2A 4FV3A 2C5YA 1NVSA 2I0VA 4JX7A 2IA1A 2PWLA 3LCOA 2NYXA 1XR1A 4ASDA 4UHTA 3H9OA 4LL0A 2OQGA 5HG9A 4ZMEA 3N4TA 3BJ6A 1ZWSA 4G3GA 4UN0C 3D5LA 1OUYA 2VGOA 4IAAA 3PP1A 4YURA 5D8KB 2LF7A 4E6DA 2OJGA 3VUMA 3JY0A 2GNLA 5F1RA 3R9DA 4HZRA 2A1AB 1J59A 5HZNA 3AG9A 3I5UA 4PX6A 3OBGA 5HGIA 2BROA 3QUPA 2VTTA 4RJ8A 5A14A 5DWRA 1HQCA 1DS5A 2E9UA 4AUAA 2Q0OA 4QTBA 1I6XA 5C1QB 4YTIA 4ZTSA 2BRNA 2OG8A 1UU7A 3VS3A 3BHYA 4EOIA 4DH5A 2V5QA 3DQWA 1XB4A 2Z7LA 5AP2A 3F69A 2VD5A 3I4PA 4E3CA 4PGGA 4IB5A 2YIWA 4U0VA 4G3EA 3R9HA 2FSWA 4FUXA 5IQBA 3PRFA 4FSWA 2XAQA 1TKIA 3VUTA 4UMQA 2JGZA 1IN4A 2Z3YA 2ACXA 1SZMA 5AJQA 5DD8A 3R1NA 4F99A 3SXYA 4UUVA 4MKCA 3KRLA 2CPKE 4ASZA 5LMAA 2BKKA 1YOLA 2XNMA 4C38A 1LJ9A 1QL6A 4BCMA 4K2RA 4I01A 4EUTA 3OF0A 1WCCA 3R60A 3EFJA 3J81K 4MWIA 2WTVA 5D11A 1IW7F 3V5JA 1ZLKA 4D4VA 1M7QA 2VTJA 2VO6A 3PA4A 3U54A 2H6CA 5D6EA 2WQMA 2YERA 3UVQA 4FKIA 3TNWA 4Q5SF 1RJBA 4BNCA 1Z1DA 1T46A 4EQMA 1ZG1A 3ZLYA 3MY1A 4MXOA 1FMKA 3LFSA 5HS8A 4UV9A 2HY81 1KYZA 1B4AA 1M7NA 3PYYA 3PVUA 3U4WA 4L43A 2OZOA 3QL8A 4YG2F 1IXCA 4FTCA 4ENYA 5JZNA 4QWQA 4A9TA 3COIA 4XV1A 1SYKA 5FEQA 1R5HA 2HW7A 5KMIA 4QTDA 4RC3A 5AP4A 2G9WA 5K0XA 1RUOA 2STWA 3RI1A 3EN4A 3O96A 5HNBA 4JR7A 2WMSA 3UOJA 4EJVA 3JYAA 2EXMA 5ANJA 3CP9A 3SXFA 5IQEA 4JQFA 2COMA 2QM3A 3DZQA 4DINA 2VWZA 2MA3A 3Q4CA 3W18A 3BWGA 3FMLA 3E5QA 2EFWA 4QQCA 4DFBA 3PA3A 2ADUA 5ICGA 5AA8A 1V4RA 3KK8A 2PUUA 2BDJA 5L8LA 4WXHA 3VS7A 1S7AA 4MXAA 1QPEA 3FHIA 3QQGA 5K0KA 2R3KA 4BR3A 1O57A 3BLRA 4D0WA 5HVJA 4YZMA 1O7LA 4GK3A 5LCJA 4YC3A 2VBYA 2OFVA 2WMAA 5CEQA 1SVGA 1PKDA 4YLKA 5M09A 5D4RA 5HE0A 3UO5A 2PZRA 4IB1A 2YIRA 5DPVA 4JOAA 4WKQA 3ABUA 1R0PA 2ZDUA 3LLTA 2C3JA 5TR6A 3B73A 1NVQA 2O5KA 3E8DA 5F95A 2IA0A 1PXKA 2HKOA 2UW8A 4CT1A 3LXKA 3G15A 3WIGA 4M0ZA 3R63A 4U3ZA 5HTCA 5D7VA 4FIIA 3D15A 3ZXTA 4EJUA 4YHJA 3W2QA 3RZBA 2EXCX 3BIZA 2BMCA 4E8AA 3FMJA 2NRAC 3PLSA 1XMKA 5AIRA 4LL5A 4MTEA 3CQUA 4RVLA 4XLIA 3Q2JA 4EWHA 3KF7A 5CYIA 3VULA 3CPBA 5B2MA 4HQMA 4YPDA 1F1ZA 2UW3A 3WZJA 2DK5A 4WXDA 2CMWA 3QQJA 3TUBA 2OI4X 4DT9A 2FO0A 5I9UA 3G51A 4UZHA 3CGFA 4HOKA 3TACA 3C4FA 1WKMA 1F9NA 1LP4A 4CLIA 4JAJA 5F1ZA 1OKRA 3LFDA 4BCFA 1W98A 3R8LA 1B6CB 1FNNA 4Y17A 2HQRA 1R5GA 2ZM1A 1H1PA 4CFXA 4BDBA 3D7TA 3EUHA 4JG8A 1Y8YA 2YIQA 4HZFA 5HLWA 4C34A 5HS9A 4M84A 4O6LA 4NKAA 4F6UA 3I79A 4OAUC 2XRNA 2JDOA 3D2KA 2A27A 5L6OA 2G9XA 4KIKA 3OHTA 4G3FA 3HRTA 5CALA 1U3EM 4E73A 5E90A 2X4ZA 2RGPA 4EJWA 4IIRA 4ZMFA 3TI1A 1Z7UA 1KOAA 2A6HF 4BDEA 2WQBA 1UKHA 3F6OA 2OWBA 3BQRA 5TRDA 3FC2A 3SC1A 3U4UA 2F57A 4BICA 2QOFA 3AC3A 1P6RA 4TTHB 5CZIA 1YXSA 3RPSA 4WG5A 3F22A 2FMYA 5ETFA 4TYEA 2QO7A 3GC0A 4FZ7A 3G3ZA 4ASEA 5AV0A 5IDPA 3PG3A 3F6VA 1WAKA 1RZ4A 2X8EA 2KJCA 3ZC6A 1ATPE 2DBBA 2PN6A 3GCVA 5FG8A 1J0RA 2YN8A 3QXPA 4Y85A 3RBWA 2M5WA 1GVJA 1REPC 1U5TB 3QOPA 3GO5A 2V22A 4XP3A 4TYIA 2RFDA 3UIXA 3FI3A 5TO8A 1PRYA 4GK4A 3I0TA 5BYZA 3R00A 3VF8A 2VWUA 3I64A 3HV5A 3BHVA 3OY1A 3MFSA 4O0YA 4IHPA 1I5ZA 2QLQA 4BBFA 1B9NA 4I2OA 4FC0A 1LDJA 2RKUA 1QMZA 2JBPA 5FGKA 2EU9A 1XH9A 4U0IA 4X3FA 4CXAA 2GXBA 3QQLA 3PXRA 5ERIA 3EHAA 4KMUX 2H34A 4CNHA 1P4OA 1F5QA 3RYPA 3PSDA 5M51A 2K4BA 3UOLA 2XROA 4J96A 5BPYA 3LW0A 3LAJA 4JBQA 4ENJA 4K2EA 4HF1A 2Q8KA 3HRBA 4E6QA 2BBYA 2GNIA 1BOAA 4LOOA 4IAZA 4NYEA 4YU2A 4D1SA 3WTVC 4O7RA 4NM0A 5AV1A 2GSFA 4I4EA 3VW6A 2ZO4A 5ETIA 4Y83A 5M4UA 2WTDA 3E88A 3HA6A 5D5UB 5F64A 4P90A 3FM3A 2OZAB 1U54A 1R00A 2Y4IC 3UP7A 2HYFA 4XX9A 4ENXA 5HO8A 3QTIA 3RCDA 3KXZA 3I71A 1FLIA 4WNPA 3FM5A 4NM3A 5M44A 3Q3BA 2UZVA 3OCBA 2ISZA 1GY3A 2C6LA 3G33A 2IZUA 3OOGA 3OFMA 4IX6A 4RS8A 5KMJA 1CKPA 1W83A 3QALE 2A07F 4FVPA 4M9SA 3ZMTA 4DBXA 2R3JA 3P5KA 4JBOA 4OTQA 3Q32A 5AR5A 1UNLA 3FEGA 3ET7A 4Y46A 4AE9A 3TWJA 2EWNA 3ZS5A 2X8IA 4NQWA 2VX0A 2JKMA 3M1EA 4RIWB 4A4XA 4D2WA 3ACJA 3QYWA 3VF9A 5HG8A 5G6VA 3QPHA 5EYDA 5JGAA 4O27B 4XNEA 3ORZA 4GIIA 3OWKA 3WGGA 4YJVA 3KRXA 3Q2MA 2EFPA 4YIFA 1R58A 1E1XA 3ZFXA 4CYDA 2OICA 4K1BA 3C51A 3FLWA 3ZO1A 4BCKA 3EN7A 2ZNZA 3Q9YA 1RDQE 4QP9A 1JLUE 3ISPA 1ZRDA 1WBPA 3ZFYA 2GDOA 4B8XA 1MDMB 2ITTA 4ZZOA 4FKPA 4AN9A 1BC8C 5BUEA 4IAYA 3D7TB 5J5TA 4EZ7A 2P3GX 1MP8A 4BAYA 4WG3A 4D2PA 5CEMA 4EJTA 1S9JA 4MEDA 5JFSA 4ALVA 4BF2A 4ACDA 2LAVA 1O6KA 5LHIA 4JVGA 4IF4A 5CT7A 3V01A 2WEIA 1DP7P 4ORKA 3TNPC 5KKRC 3LSTA 4YC8A 4LMUA 4FG7A 3F72A 2VTLA 4Y13A 3BLQA 3PJ2A 3B8RA 2PUNA 3KXHA 4IBMA 3JAMZ 3PQKA 2GQRA 3KFAA 1IXSB 3BU3A 1W7HA 3RPYA 3BU6A 3NGAA 2PK9A 3RNIA 3FLZA 2W5AA 1JSUA 3ZC5A 5HDKA 1M2QA 2PL0A 3TGNA 5I9VA 4XJ0A 4ANLA 5IT9K 2CFXA 5AUZA 4AAAA 4DA5A 3BX5A 2HR3A 4B0GA 4RJ4A 2BPMA 3UYSA 2YZLA 4MBLA 3RHXA 2XKCA 5E1XA 3E8NA 5AV2A 3D5UA 3I81A 5I9ZA 2IN6A 4A0ZA 1F0QA 1OUKA 4L3PA 2UW7A 3BI6A 5JK3A 1XO2B 4NCTC 4R1YA 4M9ZA 4C3RA 3KVXA 5IUGA 2B9HA 3PWYA 2C0OA 4TYHB 3QD2B 4U7ZA 3FKOA 3E3PA 2J5EA 5BVDA 3QRUA 3RAHA 4XLNF 4IVCA 4WD5A 3GW2A 4GW8A 2WO6A 2QOBA 1ZG5A 2PULA 4UVAA 2ETRA 3ZO4A 4AZTA 4JRNA 2F9GA 2J5FA 3QTZA 3FZSA 4D5HA 3ID6C 3U51A 4BHPA 2JTVA 5KVRA 4AZSA 3KY2A 2OJFE 4O0XA 4JDIA 4QNAA 4Q47A 3HAVA 2B9FA 3RYRA 5LCKA 4KKGA 3MW1A 3MV5A 2VT2A 5BPDA 4ACCA 4H58A 1FVVA 4H39A 2W17A 5IA3A 3KMMA 4DFXE 4OR5A 5IQIA 1PXOA 3T9IA 3OG7A 2P6SA 2A61A 3CY3A 4RLKA 4HVDA 1OKZA 1M14A 1BLXA 4BI2A 1T39A 2PVRA 3RKYA 2YDKA 2YJSA 1Q99A 2WB8A 4V0GB 3H3ZA 1FYMA 4EKLA 4RJ7A 2BR1A 3SD0A 3FYKX 3NIZA 2RDPA 4O38A 1NXKA 4LB5A 3O50A 4JK1X 3UIUA 1S7OA 1SFXA 3EN6A 2FA5A 1L0OC 2YACA 1FBNA 3E62A 3QCSA 1GIHA 1T38A 3RM7A 1J7LA 1ZZ2A 2NS0A 3QUEA 1GOLA 2WXVA 5LHHA 4A0YA 1ZYSA 4EHGA 2B0LA 4FVRA 1T98A 4D0PA 4O81A 2GU8A 3R0TA 1A48A 4CFFA 1HKSA 4Q5HA 5AUVA 3O7LD 4LOQA 2F7ZE 2WQOA 4UMTA 1OIUA 4EM2A 4MH7A 3E7VA 5ANEA 5LVMA 2W1IA 3KGAA 3DU8A 3QA8A 2CLXA 5CU3A 2DTRA 4M3QA 1FYLA 5DH3A 2A0CX 1FOTA 1XGMA 4QMZA 1P14A 4PTGA 4O5VA 3KU2A 2WIHA 3PUPA 4H36A 3UQCA 3TXOA 3RKWA 2X8DA 4PWNA 2I0EA 4I4FA 3GT8A 1SMYF 3B02A 4X0MA 3L9FA 4FIGA 3D5VA 1Z9XA 2P5KA 1ZMWA 5L3CA 1ON2A 3CJFA 4EK6A 2X0LA 2XKOA 4OINF 2NO3A 3D5XA 2QI8A 2W4OA 4QP3A 3PJ1A 3KULB 3D9VA 3EYYA 1Y6AA 3MAJA 4N0BA 5D7AA 4KIKB 5EHYA 4QQTA 2XUUA 4GL9A 1SM2A 3SHFA 4R3RA 2G7HA 3S1HA 2ITUA 4HNFA 3UMWA 3G9NA 3QKLA 3ORKA 3QAME 1R1UA 4ESJA 5LLQA 5TE0A 3CS9A 3PFIA 3EQLF 4FV7A 2BILB 3ORMA 2A19B 2VTIA 5D41A 3A62A 5CENA 2VX3A 4FKOA 4F70A 5CU0A 5GZ8A 4DEGA 5HCYA 1T6SA 2UXXA 3ROYA 4K9YA 4GV1A 3UOKA 5ICEA 2ESNA 4U7BA 3PIZA 4C4HA 4Q2AA 5EYKA 4EHEA 4RRVA 1O3SA 4O2PA 5B2KA 4DITA 5L3EA 4WK8F 4ONAA 3OMVA 1KQ9A 5DCMA 3GXLA 4OIOF 4LRJA 5BNJA 4QTCA 4FTLA 5FUTA 1UU9A 3QRFF 4M97A 3DKCA 1Q24A 1WRJA 5CSPA 4Q9ZA 2PJPA 5FXSA 4IXAA 2P7VB 4EBVA 3A61A 4UALA 2XK4A 3HTSB 1OPKA 2BZHB 2QO9A 2B9JA 1P92A 3MJ1A 2PVNA 5FXQA 1Q61A 2XHKA 4BI1A 1R78A 3FMQA 4P5QA 3TKUA 2UW6A 5GJGA 2ZCWA 2OZ6A 2J4ZA 3KN6A 2G01A 2J9MA 5FDPA 2ZMEA 1QCFA 1FX7A 1TBXA 3TZ7A 5AIPA 4AOIA 1UA2A 5AUWA 4ZY6A 1UU3A 4CYIA 1KYWA 2LNBA 3VBTA 3V4GA 4IVNA 4A7CA 3SOAA 2Z99A 2ZOQA 4O96A 4XG9A 4U6RA 3KN5A 2XYUA 3QD0A 2R3OA 4BVUA 3PVGA 2PMHA 1F3MC 4F6SA 1BX6A 2WOUA 4PPBA 1TQPA 5LVNA 3VS6A 4EV0A 3ZN0A 1ONVA 3KETA 2X7OA 3ZFMA 1P2AA 1CF7A 2SRCA 5HBHA 3EYGA 3ETAA 3P9CA 3GU4A 5LGTA 5CF5A 3TIZA 5ILVA 4NTTA 2W57A 2OBPA 3MVJA 2C0IA 5AR3A 4FV0A 4C36A 5FBNC 2HWVA 5A46A 3GC7A 5FLFA 2A2AA 5BYYA 4APCA 5KK1A 2RKHA 4V01A 1DM2A 4CXFA 3SRVB 3PE2A 4LGGA 3BQCA 2W1EA 1WBVA 3F66A 3BV3A 1LDKB 1BM9A 4IHTA 3ORIA 2GNFA 2IJLA 3PXKA 4FT0A 5HNIX 3GU7A 5FRIA 4FTJA 3F8CA 2HAKA 1HOWA 3NYXA 4YJRA 3ZN1A 2WIPA 4ZLOA 3VBXA 1FZPB 2WELA 3TNQB 2ERKA 5IU2A 5LVPA 4TYJA 4QYYA 3ZEWA 5C9CA 3HRFA 4YJNA 2GTMA 2PY3A 3BELA 4G34A 4JDHA 5HX6A 4IEBA 4O1PA 3N9XA 3E63A 4BDFA 2DLLA 5KCVA 1WWXA 3VS1A 4EI4A 4ZK5A 2BE5F 4RSSA 5JFWA 2X2MA 2VUWA 1P2FA 4JIAA 4R3PA 2XBJA 2R5TA 5DI1A 5BOXA 3DP7A 4QPSA 2W99B 2RSVA 4B8MA 1S3JA 4L9VA 3BHUA 5IA1A 2HGCA 3MQ0A 4RB1A 2CYYA 3AGMA 1HXDA 3NUUA 4D4SA 2WQEA 1Y8GA 2VWYA 5AFVA 3VS0A 3WGIA 1MD0A 2C1BA 3KL8A 2VNYA 3FSFA 4A0XA 3GFEA 2VTRA 4TWOA 4PMPA 5CY3A 3VQUA 2Z7RA 4AZWA 4BDIA 2A69F 5HG7A 4F6WA 2JIUA 4GYGA 2KIMA 3GVUA 2HZNA 1EH4A 4IXPA 3T5XA 4JT3A 3MH2A 4EH8A 2IA2A 3E8EA 3I59B 2W9ZB 2ITQA 2QOQA 4AIJA 1VR2A 1RIOH 5DR2A 3GGFA 4MNUA 4L5JA 4O3MA 1PXJA 4PP7A 4AZFA 4NKSA 4EOLA 1FBSA 4P5OA 4YSJA 4ZY5A 4FV9A 5D10A 5ETAA 1XBCA 2Q83A 4YZ9A 5JT2A 4LLGF 3DPLC 4F9WA 1U5QA 4XP0A 5DT4A 2R7FA 4FV6A 3WOWA 2VV9A 2BDFA 1H26A 3PDTA 2VTNA 1NY3A 1H25A 1ZN2A 1XH8A 4E26A 3P0MA 2R4BA 4CQEA 2PVFA 4Y95A 4IW0A 3WYYA 2OIQA 4I21A 5HOOA 1QZYA 2WMBA 4MTAA 3QTXA 3CC6A 1ZY4A 4R7IA 1IRKA 4RAYA 3IL2A 4M66A 4FEVA 3LJ2A 3T3UA 2UW5A 2EVAA 4PL3A 3ZZEA 2H6BA 2YLFA 3J7AO 2XCKA 4ANOA 2VOOA 4IX4A 4X21A 5K5RA 4I6HA 1YO5C 4L9JA 5LGUA 4AW2A 1BYGA 4AU8A 4F64A 3TQNA 4MVFA 5JRQA 1AQ1A 4J95A 2WC2A 2J51A 2C6EA 1KU7A 3CTQA 3W32A 1W7PD 3Q52A 4JI9A 2G2IA 4J8NA 4DGGA 3GX4X 4MNFA 2WMWA 4MNEB 4ZTRA 3EFWA 4EH9A 5AUXA 4TN6A 3WZUA 3JSOA 1R1TA 3EJ1A 4UB7A 2EV0A 3PG1A 2DQLA 2XM8A 4YHTA 3FL5A 5CQWA 4FSQA 3VQHA 1GXQA 3SXRA 1AOYA 1Y6BA 2XA4A 2L3DA 4KNYA 3MFUA 4E70A 4FSNA 3WTSC 2C0TA 3AC4A 2E9VA 3SKCA 2PHKA 5DBXA 2MLGA 4I7HA 4NW6A 3G0FA 3ORTA 4R8HA 5DUKA 5CXHA 2WU6A 2QHMA 4WRGA 3NLBA 3RAIA 2VO3A 4I24A 1XGSA 2ESHA 1B1BA 4EYMA 4AX8A 3RAWA 2G2FA 5K1YA 4ZAUA 5E8ZA 2M30A 2OLCA 4W8DA 2GS7A 3P7NA 2JIIA 5H2UA 3A2CA 4IACA 5HD4A 4E1ZA 3ZHPC 3LM0A 3MB6A 1FPQA 3DV8A 2UVZA 2VTMA 2R7DA 4P5ZA 2QOIA 2YAKA 1YYVA 1RUNA 2VTOA 3WODF 1YXVA 2X6EA 2P33A 4FTAA 5CLSA 1OZ1A 1JAMA 2P6TA 2J6MA 4B8LA 1FBQA 3PE1A 4BHNA 4I22A 1PMVA 4FSMA 2KIUA 1HSJA 1MRYA 4BYYA 2DI3A 1U6GA 4BTMA 2NRUA 5KBRA 3U9CA 2F4JA 3SA0A 3DKFA 2VN9A 2HENA 1IUYA 2IPQX 3VB2A 3LMIA 3DXQA 1OPCA 4AW0A 1P4WA 5EM6A 2HOEA 3FLYA 4WBBB 1G6NA 4RGXA 1GHCA 4Z7GA 1IF1A 1PMEA 2FUMA 5C8KA 1KGSA 4NFNA 4FSYA 4LGDA 3CQEA 3CJGA 3MH1A 5HBJA 3FZRA 4IC8A 3QRIA 3PXZA 4GIHA 2EJRA 1HCKA 1SD4A 5HI2A 3FZOA 3QCQA 2YIYA 5EK7A 4YJTA 2AXLA 3VJOA 4LG0B 4BYJA 2XK3A 3BHHA 2XK9A 3KP2A 2V1DA 3OBJA 3IHUA 2ZVAA 3UODA 4L46A 3S4QA 3POZA 3VUIA 3E6DA 2XJ0A 3K1PA 1ZYCA 4FYNA 4IAFA 5DR9A 5DV5A 4EOPA 2DPUA 4WSYA 5CI7A 3W8QA 2UZWE 3V51A 4RVKA 2RNJA 4G2FA 4I0BA 2FBHA 2A6EF 1IAHA 3QGWA 5G1XA 2W84A 2P7CB 3MH3A 4X2FA 4XHKB 4O7TA 4XOZA 4ZTHA 4G5PA 3KLOA 3AC1A 2VO7A 3FLSA 3COHA 3O8TA 3LA3A 1JKTA 1XDUA 3MVMA 4QMOA 4FZFB 4L9NA 2OO8X 4FOBA 1L3LA 4Y5QA 4ACHA 4GMYA 3OWPA 4NCTA 4FICA 3P79A 1Q8WA 1CKJA 3MIYA 4ZJJA 2W4KA 3DPKA 5ACBC 5HLGA 4G3CA 3S2WA 4L68A 2M8EA 3H3CA 4WXCA 2YM8A 2GCDA 2GS2A 2GHGA 2O0UA 4F0FA 2CG4A 4FKSA 5IQFA 4IE9A 3DCVA 4LRKA 5TOZA 2ITYA 3SXSA 1BI1A 5J9YA 2J5OA 4FIEA 3KP7A 4CZUA 4JBVA 2K02A 5FTOA 4FZ6A 4RG0A 3HMOA 2VWVA 5HBEA 5LOHA 1F4KA 1P4FA 4MX9A 1YVJA 4RIXA 3IQ7A 2QOKA 2G15A 1ZREA 2UZUE 1IXRC 4GU6A 2HYGD 4ANSA 2W9FB 4UYNA 4YIIA 3C3WA 5D9HA 3V3VA 3RKXA 3UVRA 3NIEA 4QMQA 1ZY5A 3ECHA 1ZLJA 4P55A 3N97A 4L00A 4EORA 3E6CC 3UC3A 3Q5IA 5K5OA 3QCXA 1FSHA 4IFGA 4YBKA 4EEVA 2DAOA 4QMXA 3P9JA 4WUAA 3HSEA 3J80K 3C5IA 3ALNA 5ILUA 2VTHA 2HK5A 4JQEA 1YWRA 3VAPA 4KS7A 4J99A 3MA3A 3R04A 1JGSA 3FBVA 3F6XA 2YA9A 5FEEA 4G6DA 4RFYA 3UDBA 4CFWA 3HHHA 5TF9A 2XAFA 5L4QA 3QUDA 3KLNA 2CGVA 2R7BA 1ZH5A 4FV8A 3OOMA 4FEUA 3BE2A 5CANA 1YDRE 5CAOA 4J71A 3F8MA 5GZ9A 4FMQA 4FT8A 5IT9Z 4PL4A 3TDVA 3GFJA 1GZOA 2JFLA 4OMYA 3R6SA 1D8KA 4ZOGA 2CLQA 2JSCA 4WO5A 4LUEA 4N57A 4DH1A 4FKJA 5HLPA 2DT5A 4FSRA 2YLEA 2F7XE 4U42A 2BZJA 1TW2A 3ROCA 4AN2A 4H0EA 1O7FA 4O7LA 3QZFA 3EQIA 4PPCA 3Q5FA 4MAOA 2W1CA 3BLHA 2GTNA 3IW5A 2W06A 3RWPA 3GOKA 5L3AA 1OYWA 3QTRA 3TEIA 4L44A 4P9UA 2CGXA 1B59A 3F5PA 2QHNA 3T9TA 5HG5A 2OK1A 2EB2A 5EEHA 3E92A 3EYHA 3W6JB 5IZFA 2QG7A 4Z55A 1FT9A 2YWVA 3KP4A 3FMSA 4OBPA 5H3QA 2ZBKA 3CY2A 5IA4A 4ZSGA 2FH9A 2WHBA 3SZTA 5JQ5A 5L6PA 5IDNA 2QKWB 4J98A 1KWPA 5A6OA 3DKOA 2XJ2A 3QZIA 4DCEA 5TKDA 4JG6A 3DTWA 4KSPA 3U2RA 4Q48A 4I41A 4NT4A 1ZGAA 1QZZA 1SNUA 1XSDA 1NA7A 4HGSA 3DAEA 3MGYA 4HZSA 2ETKA 4RQKA 5AR2A 2V79A 3MPMA 4L6QA 5HO7A 2IZSA 5AR8A 2ZMDA 2DYLA 3BEAA 5HICA 3PFQA 3U6JA 4BYIA 1XQZA 1YHVA 2FXAA 5CZHA 4FL1A 5LWMA 3J81Z 4X2KA 3LZBA 1U4DA 4O84A 4DGNA 4FIFA 4UYAA 2BIKB 1I44A 3V8TA 4EOKA 3QQFA 2WZJA 2TDXA 2W7XA 4FKVA 4N9IA 4OTPA 2PVYA 5HLHA 3FYJX 3C4WA 5I3OA 4G17A 3I6WA 1K78B 5D5XB 4DNCA 3I7BA 4AE6A 3KCFA 5I0BA 2Y7JA 4UX9A 5FP6A 5KMLA 4LMYA 4Z9LA 4ANNA 1TQMA 1XBBA 4JNWA 1ZMVA 1W7PA 3OZ6A 4LM5A 3VEPA 3TOAA 3KFWX 5A2QK 5L2WA 5D6FA 3A7GA 5DNRA 2FF4A 2OA4A 5DGZA 2VT3A 5J9ZA 5CSVA 4FKUA 1G3YA 5ANOA 4CO8A 4AWXB 5AAFA 2WTCA 5JRSA 1PDNC 4BCGA 3DDQA 1XGNA 1YI3A 4M6YA 2P5LC 1DPUA 3MY5A 3AQVA 5TT7A 4PMSA 5GJDA 4QMSA 2R2PA 3IKTA 3CPCA 3H9RA 4EVIA 4IRHA 4QMTA 1OM1A 4BQAA 3G90X 3EDPA 1H0WA 4QP2A 5KZIA 4ZSEA 2JITA 4DH3A 4NM7A 2R3PA 3RI4A 4X3FB 3L1SA 4MEXF 3E87A 2IO6A 1I1GA 5JEBA 4F9BA 3TO7A 3QD4A 5AWMA 5E8XA 4ZEGA 5C4KA 3DQVC 2QU6A 4KRCA 4BL1A 1SAXA 4EK8A 2CN8A 4EONA 1H1SA 5AONA 1K79A 1PKGA 5FM3A 4Y5HA 5FD6A 2CCIA 3TUCA 4JL9A 2C6DA 3K2LA 5HHWA 5CVFA 5ICFA 4TZRA 3F9NA 4OBOA 2QD9A 3V6RA 1R23A 1YXXA 3A4PA 3BYMA 4Z16A 2C5OA 3TJCA 1WSUA 1SMHA 3TN8A 4YTHA 3R7UA 5A4EA 4E5BA 4BHCA 4I0AA 3P7AA 2ZJ2A 4JS8A 2VC0A 4EZ5A 1GAGA 2HELA 5DT0A 1Q4LA 4HYIA 2XKDA 3V5PA 2FMLA 2J0MB 3NNWA 2GWRA 4Z3VA 2AUHA 5CVVA 3R8PA 2CKEA 4XBUA 3NYNA 2BIYA 3A99A 2HOGA 3NVKI 4RIOA 4R79A 1D3YA 3CDHA 4E6AA 1H07A 4O2ZA 4KS8A 3SQNA 3COKA 2JZYA 1LEZA 4IJPA 5E20A 3R21A 3Q9XA 3Q9WA 4EK3A 3KP6A 3VBWA 3LA7A 3V6SA 5J87A 1FBUA 3HRUA 3CR0A 4GSBA 3QX2A 2I40A 3ENHA 4S32A 3TOBA 3VS4A 5HLNA 3RGFA 4KDPA 4M69B 4YO4A 4K8AA 3I5NA 4KIOA 4OTWA 5KNJA 4EHVA 4DEAA 2R3RA 3Q4ZA 2JD5A 1KU2A 4A4OA 2Y4IB 5L8JA 1YLFA 3IPHA 3PXYA 3TDZC 5HS7A 4BCOA 3NW7A 3LFQA 3BYVA 5IA2A 3REOA 3ABTA 3ZMMA 4LI5A 4YZBA 1WFCA 4HLXA 3GP0A 2QKRA 5CYVA 1H1QA 1U78A 4C33A 1TLHB 3F3UA 3R61A 5FDXA 2BEOA 3NW5A 5CVGA 2M45A 4L52A 3VHKA 4A12A 3PY3A 3OVVA 3UMXA 4FIJA 3IG7A 4HGEA 2XVCA 4I09A 3AT4A 1E17A 4GFMA 3TTJA 2L02A 5HEZA 5DFPA 3EKNA 3K3JA 3BYSA 2OFUA 2GFSA 2C6OA 3DLSA 3FHZA 3GUDA 3D5WA 2ONLC 5EI8A 3HEGA 2H6DA 2C5NA 3CUQB 2J5PA 4J53A 1R22A 4PTCA 4BWXA 3WTUC 1OL5A 3WYXA 4O7WA 3DF8A 3MN3A 4LLLA 3OROA 3IKAA 1FYKA 4HV6A 4JX3A 2FA2A 2XIRA 3EOCA 1J91A 3FUPA 2OZAA 2PE1A 3I54A 5DDGA 1XJDA 1MJBA 1V0OA 2XIKA 4ZXTA 3QP5A 4N6ZA 4MBJA 5CAQA 1Z6RA 2XRWA 4RBLA 4YNOA 2UUEA 4WSQA 1KE6A 2OH4A 4UXLA 3F8NA 2M1BA 2Y0AA 2QODA 3NCGA 3UO6A 3UZTA 3A8XA 3EQCA 4O7NA 3IWZA 3WGHA 3MCZA 3VC4A 3ZRLA 2RFEA 3U8WA 3O2PE 3GNIB 4AP7A 4O7VA 1WVWA 3OWLA 3FXXA 3TTIA 1AGWA 3SG8A 4AT5A 2HTJA 4CGZA 3C0HA 2XIGA 3UPXA 4AIKA 5DG5A 2PTKA 4I5MA 2Z02A 5M06A 4GGGA 4FKLA 3DBFA 2BFXA 3R2YA 5FM2A 3DK6A 4UWYA 4DEEA 3UE4A 4PMMA 2ZB1A 4YPSA 2PMUA 3TT0A 3KREA 1TQIA 2B55A 4OMZA 5L3FA 4AXAA 4RQVA 4HF2A 2Z7QA 3EB0A 4LV8A 3K9TA 3LFAA 1P5EA 1O6YA 2H8HA 1GZ8A 3CUQC 2DPDA 4H1MA 4XP2A 3HYHA 2VBWA 2WV0A 2PMNX 3QA0A 1M17A 2XCHA 2JFMA 2BRBA 2XZSA 1IAJA 3UIMA 4EJOA 3OUNB 3ZZWA 3OP5A 4LGWA 3V7CA 3G73A 2QOLA 3ATTA 5BQTA 4RIWA 4TRLA 2ZM4A 3BPVA 5FEDA 2IWIA 3NWWA 4ZZDA 2HZ0A 4FT7A 1R7JA 3H30A 5HTIA 3WBLA 3W2SA 1OKWA 5AR7A 3V8LA 3GFLA 4NZWB 4RX7A 3R9RA 4C35A 1OI9A 3KEXA 2VBZA 2VGPA 4D4RA 2HXLA 3UZRA 5F20A 4D5KA 5J8FA 3UPZA 3H9FA 4XEYA 1S8NA 5BMSA 2ZAZA 2F5FA 4FV5A 3MWUA 5FP5A 4PGHA 4RAZA 2DQ7X 4AGWA 2QVOA 2VZ6A 3QYZA 3H4JA 2D1HA 4FKGA 5L3BA 4DGMA 1WBOA 3P9KA 2GZWA 3TV7A 5HOAA 4EHZA 4C4EA 5GIPE 3BWJA 3SOCA 2YM6A 5T6KA 2FVDA 4W9WA 1RI7A 4USDA 5C4LA 2RVCA 4NL0A 2BVAA 3N4VA 4FSTA 2JBOA 5KMMA 4IPAA 5FFZA 4C4IA 1STCE 2FSLX 3AC8A 4EOSA 5J1VA 4BDHA 2XEYA 4FZAB 2D1VA 5FXRA 5A3XA 2UZTA 1OL6A 3VBVA 4L45A 3O71A 3UQGA 2HZ4A 1UFMA 2ITPA 3UGCA 3WF9A 4M69A 3PY1A 3D83A 3P08A 4BH9A 1QQIA 3KQ7A 3T3VA 3NVMB 2ITNA 4YLLA 3ZONA 1VJYA 5CTPA 5EW8A 4WHZA 4GXOA 3HV7A 4EGZA 3ITZA 3O17A 4TY1A 4N9HA 1UU8A 4NUSA 3EWHA 4RGJA 5BVKA 4EMSA 4XUFA 1W8CA 4IH8A 3GBZA 3H3UA 2OXXA 4RIYB 1KV1A 4U44A 2PBIA 4GEOA 1GZKA 1OKYA 5I9XA 2PVLA 3MPAA 4A07A 3MZHA 4AF3A 1MQBA 2VWXA 4N70A 3WE8A 4U41A 4TYGA 3MIAA 1MUOA 5K5QA 3DBDA 4MQVA 3ECOA 4C37A 1U8RA 3BEGA 1H0VA 5LWNA 3IRQA 3T8TA 2RFSA 3QLGA 2RN7A 3NNVA 3BY6A 3E3BX 1JPAA 2IVTA 3CO6C 2CKOA 4YC6A 3UP2A 5LMKA 3K2ZA 1B9MA 1GIIA 4DN5A 5HKMA 3UNZA 3C1DA 5L2QA 2XK8A 2PFBA 2C69A 2GQQA 3FY2A 1BI0A 1R1WA 3W2CA 4I98B 3RALA 4HYHA 5ANGA 2OXYA 1OKVA 2QOCA 3I6UA 2QG5A 4RFZA 1YXTA 4CSVA 5EG3A 2ISYA 4L8MA 3B2WA 3KULA 1PMNA 5J7HA 4XG7A 4M9XA 4BDGA 3RPUA 1K9AA 1ZRFA 4YTCA 3R4KA 3V5WA 4IJAA 3U6HA 5BVEA 3L8XA 3RM6A 3CSVA 4WX9A 5BX0A 5H8BA 5J6XA 4O82A 3M9AA 2YR2A 2WEVA 3P1AA 3MPTA 3VW8A 1PW2A 4HNIA 5JKGA 2DUVA 3F8FA 1TVOA 4UV8A 3RTPA 1XGOA 4FT9A 3HL7A 5EQEA 4QRCA 4L9TA 4L7FA 1RQQA 3L8SA 3JTGA 3COAC 3AXWA 3C13A 1IEPA 3IOKA 3R6XA 3R7IA 4WG4A 3PY0A 2OSCA 3OUKA 5DVRA 2P55A 4AS0A 5C27A 1U54B 1KA8A 2JT1A 3DB6A 2XV4S 1GIJA 2QQBA 3G9LX 5IH6A 3HSRA 4ZZNA 2KULA 3HUBA 5I5ZA 2GNHA 4GU9A 3ROUA 2RC4A 2QQAA 3ZBFA 4HOBA 4O6JA 3Q9SA 1YHWA 3MFTA 4DAWA 4BB4A 4CV8A 3ZBXA 3RINA 4A5NA 2PMOX 4OTIA 2STTA 2ZJWA 4GVAA 2Q0NA 2X81A 3FI2A 4FT3A 4BZDA 2BRHA 1B6AA 3WTWC 3M7GA 3ZMDA 4C3FA 3F5XA 3KC3A 3SQQA 4QYHA 2Q2EA 2B52A 3AGLA 5T3QA 2A3SA 4P9FA 2VRXA 3VOEA 3NSZA 4CYJA 3QD3A 4KIPA 4IVBA 5AA9A 3R22A 3PIXA 4YMJA 4BDJA 5JR3A 1H1WA 5E1SA 2DW4A 4FK3A 3PJ8A 5M56A 1CKIA 4WWCA 2OJIA 5GZAA 3W2OA 2EA2A 5AMNA 4AGCA 3NW6A 3VUKA 3VO3A 4H05A 3O8UA 1HBXG 1D5VA 3FDNA 2WKMA 2JIVA 4HCTA 1YWVA 4EUUA 3R28A 3GQLA 1H4LA 1MJ9A 3DAKA 5FB2A 1MQ4A 4U0YA 3LXPA 1P4AA 1ZOEA 3F3WA 4H3QA 4CV9A 4WNOA 5KHXA 3DAJA 3TG1A 2GMXA 3E64A 4MK0A 4KBCA 4ASNA 4BHBA 4NM5A 1SD6A 5H6QA 4F7LA 2BCJA 1OMWA 3ZQ7A 3KVWA 4K18A 2EV6A 1YW2A 3O7LB 2VTQA 4I23A 3GUBA 5CEPA 3GFMA 4TWNA 1PHKA 4R5SA 3IRRA 2IVSA 4BCQA 4G5JA 4ZP5A 3WTZA 2J0JA 4DT8A 3M8FA 3IO7A 3ZUUA 3KP5A 1Z91A 1M2PA 1KE5A 3GC8A 4MWHA 2QBYB 1BL6A 5H8GA 3NPCA 4JXFA 4ANQA 2QCSA 2PMIA 1B38A 1K7AA 4I1ZA 1SFEA 4ERKA 3LE6A 2CSNA 3VBYA 1GNGA 3OTVA 3QCYA 3I7CA 3R7VA 4I0SA 2YX7A 1D8JA 1K2PA 3MZYA 3H10A 4XOYA 2VOPA 4D55A 1WMKA 4OTRA 3HKOA 3TO9A 2FNPA 2XF0A 3FQHA 3CGOA 1IAWA 5HQ0A 2BAKA 4GFGA 4QD6A 2PZPA 2FSTX 5LVLA 3V8JA 1OYYA 3R7OA 4YR8A 3QF9A 2OGVA 4IC7A 3FY0A 4ZLZA 3FX3A 3V8WA 2OZUA 1OYIA 3A7HA 5AP7A 3DXPA 4IWDA 3UG1A 5E17F 2XM9A 3J80Z 3BGZA 3UJGA 1BKXA 3R7YA 1RW8A 1G5SA 3IW8A 4U9AA 1CSNA 1PYXA 3QKMA 4BDKA 3LCSA 3QRTA 3ZO3A 4CG8A 4CMTA 5A6NA 2PG4A 3Q9VA 3DNDA 4GCVA 3CUOA 1WBSA 3HP2A 4F7JA 1JE8A 5IQHA 5CAVA 1E9HA 2QOHA 2XASA 1OBGA 2IVMA 4U0WA 2EA4A 3GC9A 3DT1A 2O63A 2I1MA 2B53A 5CNNA 5K4JA 4O86A 3RPRA 1K6OA 5J95A 2DQRA 1LR4A 4P4CA 3HVCA 3EQBA 4PF4A 3L00A 3GCSA 4YUQA 3TO6A 5AUTA 4RWKA 3BROA 2EK5A 3HV6A 4G6LA 5ETCA 1MDMA 1J3HA 2UVYA 3HA8A 3TIYA 4IWOA 3ZM9A 4I6FA 3OOPA 4DTAA 1KE8A 4MQ2A 4K77A 2X2KA 4O0WA 2X4HA 2XNEA 4KBKA 3R1SA 2K4JA 4KN4X 3GENA 1Z57A 4NSTA 2CWEA 2R3IA 3ODZX 4QQJA 4RGUA 2PMLX 4NHJA 3T8RA 2EFQA 5H20A 1CMKE 3R1YA 3BBTB 2W1GA 3KEQA 2XNNA 2JEDA 1EH7A 2IW8A 4R1VA 2UW9A 5BVWA 3V7SA 1JKSA 2ZNYA 4JBAA 4FEQA 4FHTA 3DFGA 2BV6A 3LIJA 4U79A 1C0WA 5B7VA 1J7UA 2O03A 4EGYA 2ZFWA 1YW9A 2IZTA 3CTAA 4CLJA 4DE4A 2C3KA 2UZDA 4BFMA 3CEKA 3R8MA 2J50A 3EQGA 4EH4A 3VN9A 2UW4A 5EI6A 5EM8A 4XLVA 2VWWA 2NRYA 3DBCA 5EM7A 5E8SA 4UBAA 3PSBA 1T0FA 2WFYA 4PP9A 1EH8A 4BTKA 2VBXA 2Y75A 3A4OX 5EDQA 4BCIA 3W2PA 3E5AA 4A9RA 4GG7A 3F3TA 4OIQF 2AC3A 1J2XA 3ERED 4NB5A 4WBOA 4AGUA 1YOJA 4CRSA 4V05A 4KINA 1XSXA 3KXGA 1ZLTA 5E1ZB 4LK0F 4QMNA 2VXZA 1Q8TA 2F2CB 5JGBA 4GJ2A 1NHAA 3LFEA 3F82A 4KNBA 3QBNA 4NH1A 4G31A 2C5XA 1ODDA 4GT3A 2JPCA 4ALWA 3SFZA 5BMMA 4FGRA 4N6YA 2PZIA 2Z7SA 4MHAA 3F2NA 3AMBA 4D0XA 3IW6A 3IONA 1FQ1B 1YS7A 3Q96A 3CTJA 4GVJA 4DG3E 3CTHA 3SRVA 3ZUVA 3E6MA 3BV2A 4BHZA 2HDCA 3D0EA 2XNOA 3KXMA 3DOGA 4DH7A 2C5VA 2R3NA 4HYUA 2VODA 3GOPA 2XAJA 2NNYA 6PAXA 4WNMA 1O3QA 4KYWA 2YM7A 1I27A 3SDJA 5IQCA 2QBYA 3I1AA 4PRJA 1TTYA 4EYJA 2F7EE 3HDNA 3QQUA 4DG0E 3FZVA 4AOTA 5KE0A 2X4FA 1OIQA 5AEPA 2EUFB 5DEYA 4EKKA 4QMMA 3L9PA 2BKZA 4TNDA 4FEXA 5EEGA 2ITXA 3O0GA 3QX4A 2R7IA 3PWDA 4E20A 2KKOA 4UMRA 3RP9A 3ZLXA 3RIRA 2XGXA 2UVXA 4TT7A 3ZO2A 5J79A 4O7ZA 1UHWA 4HPTE 4G6NA 4CFVA 2BAQA 5B0XA 3EQRA 4II5A 2VAGA 4EH7A 4FNWA 5DIAA 3E7OA 4IFCA 3AC2A 5IKWA 3HOSA 2QR8A 4PDSA 4DTBA 2WMRA 3Q6WA 4ZSLA 4B9DA 2H94A 3RPOA 2Q0BA 2XKPA 2YPRA 3WILA 5CAUA 2CQKA 2RIOA 3ALOA 3IGGA 4QMUA 3FWEA 1CM8A 3C1XA 3ZRMA 2WMQA 5DLSA 3IC7A 4PDOA 5CI6A 3R1QA 1OIYA 3G0EA 3DJ7A 3SW7A 3HUCA 1QPDA 4FSZA 4RGRA 3NQOA 2YABA 1PP8F 1G3WA 3ZTXA 2C6MA 3Q53A 4PDYA 3VBQA 3RNYA 1YW8A 1OPLA 4R1HA 2WTWA 4EZ3A 1SVEA 3VJNA 1UCRA 4NEUA 2HWOA 1ZXEA 2WTKB 4K0YA 4Y15A 1J1CA 1Y91A 3WZKA 1JHFA 5AP1A 3MY0A 1KE9A 5CS6A 5E1EA 4FA2A 4XSZF 2X9EA 3MI9A 5KBQA 2W25A 5HVYA 1OIRA 4L67A 5D12A 3JW4A 2K27A 4EQUA 5DE2A 2YJRA 2HWPA 3QGYA 4L0YB 2E9OA 2BYVE 3NUSA 4HGLA 1AD5A 4BZOA 3ELJA 3KZYA 1OECA 5DRDA 4IADA 5AP3A 4PL5A 5GJFA 3RJCA 2FE3A 4FV1A 2HYYA 5GNKA 1M2RA 3EQDA 4I93A 3M8EA 1XCVA 5AV3A 3TZ8A 1ZZLA 2YCFA 3V8SA 4KA4A 1UNGA 4TWPA 2HZIA 1W4MA 1BI3A 4H1JA 4U80A 4NWMA 3MEXA 4C62A 2PUIA 3BZ3A 3UO4A 5CXZA 3TDUC 4UVCA 2EWAA 3T8OA 4A6EA 1U5RA 5LMKC 4Z7HA 3DEUA 3OXTA 4JDJA 3F7WA 4X2JA 4GKIA 1ZYDA 1DUXC 4M68A 3HAMA 3HMPA 3EZRA 1UWJA 2GHMA 4R7HA 5HESA 2MBFA 3HYIA 4RPVA 5EQYA 4PDKA 3GCUA 1OVEA 2QC6A 1Q3WA 1J7KA 2ZKZA 5LHGA 4LYNA 2W1HA 2ZV9A 5H8EA 1JSTA 3PLAE 1XCBA 5LMBA 2GAUA 2YX4A 2BZKB 3PPJA 5AIKA 1G3SA 3FF5A 2R3SA 4HVSA 2P2HA 2Z33A 5E8TA 1UHMA 1NVRA 3REPA 3ML6A 5AM6A 1WVYA 2VWIA 4KWPA 4ZYEA 1CDKA 2JDVA 5FO5A 2LF8A 5KMKA 4NIFA 4PNKA 5IUIA 5JSMA 2ZV2A 4C4JA 3FL4A 3NUAA 2D45A 5HCZA 5IG1A 4XBFA 3HV4A 2GFCA 4OT6A 4KMFA 3AD5A 3FMKA 3BGQA 4OU0A 1DI9A 2R9SA 5JN2A 2RFNA 1J1BA 1H27A 4KB8A 5CT0A 2JC6A 3C0GA 4TWCA 1XDSA 2CO5A 4OIPF 4U97A 1FVTA 2E7XA 3DY7A 4N4SA 3AAFA 4F1OA 3CQWA 2YWPA 4FF8A 5IISA 4UWBA 3SVVA 3GVAA 2RG6A 3R01A 4ENKA 4ZYDA 4B6LA 4K6ZA 4IX5A 3F61A 2IW5A 2W1ZA 5K5XA 3GFWA 2PVKA 2K7LA 3MYGA 5A4LA 3HP5A 4LD5A 4FIHA 4PUZA 3HX4A 1HW5A 1KV2A 2IT0A 5KUPA 4WT6A 3MJ2A 4F08A 3RVGA 3SG9A 2UZKA 2GS6A 3DLZA 1PXPA 4KSQA 4E4XA 1PJKA 4ENNA 4LFIA 5IQAA 5CU6A 2WPAA 4E4LA 4AW5A 3CLOA 3ZSHA 4IAKA 4WIHA 4DEIA 1ZG3A 2XP2A 5DYJA 3RMFA 4C8BA 3GU5A 3JPVA 1KQ8A 4QMPA 5CVUA 2VO0A 3ZLWA 2QNJA 3KRJA 1H01A 5A54A 4FZDB 3LCTA 3U6IA 1OR7A 4HA8A 3BYUA 1FOKA 5IQDA 1YDSE 3EH9A 3N51A 1SFUA 1Q8ZA 5M4FA 4RZWA 4B09A 3AMYA 3QLFA 1Q8UA 4M71A 3N4UA 3ERKA 4ZTNA 3EQHA 4QPMA 4Y8DA 3FMMA 4GG5A 3D7ZA 4RC2A 5CVHA 2CW0F 3U87A 3FI4A 3ENMA 2O2UA 4FX0A 1REKA 4RGSA 3TV4A 3LJ1A 4BCHA 4ZJVA 5EQPA 1HSTA 2AYPA 4KFCA 4EK4A 5LVOA 1HKTA 3ZUTA 2VTAA 3R9OA 4DFUA 5C8MA 3DNEA 1H9TA 4CVAA 3JVRA 5E18F 3Q5ZA 4EL9A 1HKQA 3QWKA 1YXUA 3UQFA 1SD5A 1JKLA 5CF4A 3FJQE 3CKWA 5CVRA 4PZJA 4EM1A 3GEQA 2VONA 3VVHA 4S33A 2MLKA 5EM5A 5M57A 4L7SA 3NZ0A 4FSUA 4AW1A 3PZHA 2UZLA 5DEWA 1J9IA 4E4NA 4MCVA 5F6FA 2DU9A 3NDMA 1URCA 3ZOSA 2YFXA 3ANQA 2EV5A 4F65A 5DCFA 4CRLA 4U43A 3VUDA 4C58A 4TV7A 4OUCA 4C4FA 3FKLA 4L3LA 5HO6A 3TUDA 5BUJA 4S30A 4M8TA 4I5CA 4OLIA 1FWZA 4GUEA 4TNBA 4XMOA 1RE8A 3GFIA 2RGVA 1Q3DA 4EH6A 5DMZA 4BKJA 3IOPA 2P5VA 1Q8YA 3DJ5A 1JVPP 3G6HA 1ERKA 4YNEA 1PP7U 5BPIA 4S34A 4BXUA 4AACA 2QVSE 1XH7A 4PDPA 2R0UA 5EOLA 4E6CA 3CD3A 5C8NA 3MFKA 5CJ9A 2HXQA 2C6YA 3G2FA 3POOA 5E8YA 5K5NA 4DHFA 5E9EA 2CKPA 4DLJA 5EFQA 4G8XA 4I5PA 4HW7A 4IB0A 3L7WA 2F2EA 2CGUA 4L9IA 3ZEPA 2QLZA 1Q5KA 4KUJA 2KTYA 2O65A 1YDTE 3K3IA 1TNTA 1XHAA 2UV2A 1B39A 3ZLSA 3KMUA 4G7OF 2BRGA 4GK2A 2Y6OA 4G16A 2MH2A 1IR3A 3QRJA 2UZOA 4Q9SA 4MXZA 4R5YA 3NUXA 2V7OA 4HGTA 2KRFA 4BI0A 3PZEA 2IW9A 4HQEA 4YP8A 3VIDA 3F8BA 5EDRA 1Z9CA 3PQJA 4OTHA 3KEOA 5L8KA 2QENA 3GZ5A 2WTKC 4O0RA 3OW3A 2JDRA 4GT5A 5HDNA 2L54A 3KF4A 3QU3A 1EV7A 3WU1B 1ZOGA 1T2KA 4PNIA 2V0DA 2YSRA 3LHJA 2BZIB 1U5TA 3OC1A 5JGDA 1APME 3HMNA 2OF4A 5AIQA 4JJRA 4DQ2A 4A9SA 3HNGA 3JVSA 4W8EA 1BC7C 2EFNA 2OQRA 4BWPA 2JKQA 3R7EA 3KCCA 4MNEA 1IRGA 1BI8A 4NIFB 4I0TA 3HMIA 2HFHA 4IVDA 3LFBA 3NRMA 2PUPA 4FI1A 2EXEA 1VTNC 3JTHA 3E5UA 1MJAA 4YLJA 4QYFA 2X0GA 1MGTA 4R78A 4OAVB 3GCQA 3NEWA 2VC1A 1FP1D 3LAUA 1JWHA 1ZARA 2G7UA 3R71A 1U59A 3O2MA 4BBMA 3C18A 3IDPA 3GEZA 3G5DA 2A5YB 4KIGA 4ITIA 4XYFA 5CU4A 4YO6A 4I02A 4IVAA 3GB2A 2XNGA 1BIAA 4GJ3A 2VU3A 2O8YA 4DGOA 4IM3A 2IJMA 3TJDA 1G8SA 2QQ9A 2LDUA 2XJ1A 5HIEA 2GQSA 3L8PA 2HW6A 4C0TA 5E7RA 1TW3A 3FXQA 3V8KA 2FGIA 2X7GA 2OIBA 1O9UA 3VRZA 4DLIA 3V5QA 4MF0A 1U5TC 3D2IA 2J0LA 1XSVA 3W1FA 3CD8A 3NYVA 4S04A 1H9GA 2WQNA 5IH5A 4HBLA 1FMOE 1LEAA 3MTLA 1YRPA 2H27A 3NAYA 5CASA 3LPBA 3F5UA 5HD7A 2XIZA 4CTBA 3KXNA 3W10A 2WTEA 4WUNA 3DA6A 3DXNA 1QO0D 3FXZA 2ITZA 2UZEA 3O23A 2QONA 4ITHA 1FPUA 1A06A 4ZTLA 4W9XA 3ZH8A 4C57A 2V55A 3WARA 1LNWA 3C50A 4XG8A 2I0YA 4YJOA 4O21A 5J9LA 1WBNA 4X2GA 2GXGA 3H0YA 3ATSA 2PYWA 1BI2A 3LQRA 4KA3A 4GUBA 2HCKA 2YM4A 2C1AA 2HTSA 4USEA 3LMHA 3BGPA 4X3FC 5HE2A 4IANA 5ILSA 5EOBA 4O1OA 3L9LA 3M42A 2YAAA 5JMSA 2DO7A 4MD7E 1L3RE 2RL5A 3ULZA 5FWKK 2NNWB 3DFCB 4Q5EA 2FEZA 1R3CA 2CN5A 4C3PA 5I9WA 3L09A 3VFZA 4YJUA 2W1DA 2C6KA 3HHGA 3FWQA 3C4EA 4AA0A 1WBTA 3HIFA 4F1MA 5AX3A 1VZOA 1K3AA 3FXWA 5K4IA 1BIBA 2UW0A 2XIYA 4ASXA 4FTNA 2DWBA 1OL2A 3II5A 3VHEA 2JLDA 1G4DA 2CCHA 1FY7A 2WGJA 3L9NA 4RB2C 4FG9A 4BTFA 2UZBA 4MYGA 3L2CA 4D2TA 2RG5A 3QHRA 5IF1A 4BIBA 4RX9A 5AP6A 3ZSGA 4HX4A 2ELHA 4UWCA 2PEXA 5A9UA 3DXJF 4D9TA 4XG6A 3RK5A 2ZXJA 1O6LA 3FC1X 5DEQA 5DD4A 4HW0A 2CDZA 3V5LA 3NUYA 5IH4A 3A7IA 2B4SB 2XNPA 1A04A 5J8IA 4NJ3A 5CX9A 3TCPA 5EHOA 4DFZE 4EOMA 2BGCA 5B2LA 5E8WA 5ITAA 4G9YA 4NW5A 3IK3A 2HS5A 3IECA 4HX8A 1WI9A 4FX3A 4L42A 1QNTA 2BAJA 2FSMX 4RJ3A 2WAJA 4C02A 5F4NA 3KZZA 3D14A 4CFNA 5LXMA 3F7ZA 2DS1A 5F94A 3QRKA 1OGUA 4LQMA 1REJA 3I60A 3ZPLA 2K86A 2H09A 1CF7B 4O7YA 4F9CA 1URWA 4FTIA 4RX8A 4O0UA 3UNJA 4W4VA 3QFVA 3MESA 2GNJA 4F9YA 1DI8A 2IPXA 2VE9A 4FKWA 4N0SA 4AZEA 4BKYA 3QKKA 2HEOA 4DFLA 3FPMA 3FV8A 3BPXA 3D94A 4IJ9A 4ARKA 3NNUA 3K5UA 3ZMZA 4S2ZA 2A4LA 4EH3A 1W82A 3LOKA 3JS2A 5FD5A 4RWJA 5JFRA 2Y4PA 4UXNA 2YCSA 3DQXA 1IN7A 4TL0A 4JDKA 4FNZA 4GS6A 2BRMA 1IN5A 1YI6A 5FLXK 5EH0A 3F3XA 1UB9A 3IS5A 1FVRA 4OBQA 3I0OA 4V0GA 3UYTA 5AUYA 2CGWA 2E2BA 3UIBA 4IHSA 2C6TA 3F3VA 4ZIMA 4DEDA 2WTIA 1FSEA 4EQCA 2FBKA 5M08A 3AD6A 1I1SA 2FNAA 3CKXA 3E93A 2PE2A 3FI8A 2F5EA 3GZ6A 3AT3A 2XUBA 4MHGA 4GRBA 1YS6A 5CNOA 3U55A 3PTGA 1WBWA 4LG0A 3OWJA 3R83A 3E6BA 3LMGA 1BBYA 1OPJA 1BUHA 5IUHA 3HTUA 3RK7A 3WE4A 3CIKA 1R36A 4MQ9F 5AUUA 3CBLA 2BHEA 4MD8E 2WWYA 4L3JA 5HE1A 1XD7A 3AOXA 4E93A 2XS0A 2W5BA 3LQ3A 3TKHA 3WF8A 3QWJA 3R8UA 2EB7A 1FGIA 3FKNA 5ANIA 4OTFA 2P2IA 1YIOA 5DUIA 1H00A 4TYHA 5JHUA 3RWQA 3SV0A 1KOBA 2OU7A 1M52A 1PXLA 3TNIA 4FTQA 5T68A 1EH6A 5K9IA 5AAGA 1QPMA 3HRCA 3PVBA 3PXFA 1KSWA 3OV8A 4XH6A 5BVOA 1JQHA 4EWQA 3IW7A 4FKTA 5H6RA 3QC4A 3SZPA 2O3FA 3Q9ZA 3MFRA 2BFYA 4F09A 3MWMA 4S05A 4CTCA 2YISA 3FZ1A 4FOCA 3FE3A 3OTUA 3E3VA 2ZM3A 2FU4A 3OEZA 3G6GA 3UC4A 1PXMA 1XMAA 4UXQA 3MDYA 1ZOHA 3ZCLA 3DTCA 4LG4A 4D9UA 2QUFA 4F4PA 4AZVA 2O0YA 3ZP5A 4FNYA 4KRDA 3HUGA 3FHRA 1CGPA 3EN9A 3MS9A 4M0YA 5A4QA 2R64A 4CICA 3NRVA 2WOTA 4BDDA 1LPUA 4ZSJA 4X6RA 3NS9A 4U45A 2E1NA 3ODYX 3QTUA 3C5UA 5EKOA 1XH6A 4UZDA 2ITOA 1XH4A 2R3MA 4ID7A 3UG2A 5LQFA 2G2HA 3HSFA 3HRSA 4A9UA 1IA8A 3EN5A 4F0IA 3PXQA 4XG3A 1USSA 4RX5A 5JFXA 1FP2A 4ALUA 2PVMA 3WF7A 2YDJA 1ZHFA 4FTMA 3P7CA 4RWIA 1PXIA 4HYSA 3V7RA 2L01A 5C03A 4ZJIA 3S00A 2E7WA 2DK8A 4G1WA 5HVKA 4IX3A 1IN8A 2ITVA 5HORA 2X9FA 5EDPA 2J90A 1QPJA 4ESBA 5EW3A 5AP0A 4ACMA 2YU3A 5HU9A 1XN7A 4A2UA 4BN1A 3WIKA 4IQ6A 4YFNF 4FBXA 2KJBA 5GHVA 2FOKA 3RDIA 2W5HA 4AOJA 4ZH4F 4D1XA 1KQ0A 2L4AA 4IZYA 5JH6A 4JIKA 2R3LA 3SX9A 3B8QA 3W16A 1ZYJA 3FPQA 3RPQA 3TNHA 2PU8A 4IZ7A 4EOJA 4Z2YA 1PY5A 2BDWA 3ELKA 3FQEA 5BMZA 3IWFA 3MVLA 2JRTA 3K5VA 4TKSA 5CU2A 5LJJA 4D1ZA 4U5JA 4HDVA 4YZCA 2GIVA 3FAAA 4AT4A 2W0JA 4M72A 5DT3A 2XMYA 4GT4A 4ANBA 3FMDA 4K11A 5D5VB 4IB3A 3FMEA 3Q4UA 4YFXF 2YCRA 4JAIA 4UY9A 5IMEA 2IW6A 4S31A 3F2RA 1JHHA 4L53A 5J5SA 4RT7A 1WVXA 5KKRB 3PJ3A 2H96A 2XB7A 4TPTA 2B1PA 2YHVA 3BDDA 2I7QA 3DZOA 4R3CA 3QZHA 3JUHA 4ITJA 4G6OA 1Z6TA 3I4BA 4ZYHA 4RC4A 2OJ9A 4GO1A 4QO9A 2XK7A 1HW2A 1ZRCA 4Y73A 2W05A 4DG2E 1LVAA 4M14A 4OW8A 4QYEA 1USTA 1MKMA 1WQ2A 1J5YA 3BOQA 2XIXA 3W6KB 4EK5A 3ORPA 3LLAA 2BUJA 3L9MA 1QPCA 4FL3A 1HCLA 1VEBA 3RZFA 4QMWA 1ND4A 3EMGA 2ZDTA 4A06A 3EIDA 4XS2A 2O8XA 2CNUA 3BJOA 4YBJA 2UXNA 3FQSA 2O64A 4YGAA 2FB8A 4KAOA 3EKKA 4C2VA 4O0VA 4EJ7A 4MBIA 5CF6A 1OBDA 4NFMA 5IA5A 1ZYLA 5JZJA 2CGPA 3R8ZA 4RWLA 2B7AA 4HCVA 1R1VA 5DRBA 5ANDA 2V6CA 2G1TA 1YKRA 4EH2A 4J52A 4RJ5A 3DPTA 4RA4A 3DBQA 2R0IA 2ZMCA 2LGCA 2OIDA 1ZAOA 3HGKA 4FTOA 3UOHA 4A6DA 4KKEA 4JQ7A 5JVTA 3WTTC 3LJ0A 1G3TA 1SVHA 4OIRF 3S3IA 2RF9A 3MB7A 4LOPA 2WU7A 3IKVA 5KMOA 5I3RA 5JI6A 3CXWA 1H1RA 3LAPA 3KE2A 2IVUA 2O6GE 4PV0A 1PUEE 4QTAA 5DOSA 2J2IB 2Y9QA 4M73A 2Z9OA 1GXPA 4O83A 4B99A 1OB3A 3PPKA 3WI6A 4O91A 3VWAA 3VODA 2VTSA 2ZMEB 2MD5A 2PVJA 4HPUE 3Q6UA 5J1WA 2HZTA 2JDTA 1YQJA 4ENMA 3IW4A 4DEBA 3SGCA 5IA0A 3K0LA 4M13A 3PVWA 1U2WA 3CE3A 4HLYA 3O51A 2OU2A 4I0RA 4E4MA 4DH8A 4BKZA 4AG8A 1CTPE 1P4XA 1LEWA 4K33A 5A4TA 1Q62A 3LXNA 2F5DA 3F21A 2Z2WA 5DCMB 2GPHA 2PI0A 4FT5A 3V5TA 4XLPF 3E97A 4HCUA 4F7SA 3GF2A 3ZMSA 3QTWA 1SNXA 4CMOA 4BWKA 4G3DA 4JLCA 2O61A 3GQIA 4AD9A 4H3PA 1QGPA 4M7IA 1A9UA 1UVRA 2J0IA 4ZZLA 5AM7A 1Z05A 1BMKA 4LRMA 3AD4A 4CFUA 3OS3A 4FUYA 3THBA 5DN3A 2QQ7A 3UBDA 2XH5A 4L18B 2JKOA 4G6QA 3OT8A 3S95A 3QXOA 2Z8CA 5KZ0A 4G9CA 5A2QZ 3U9NA 4CMUA 3LCDA 4C59A 4DBNA 5CEOA 3C7QA 1S29A 3R2BA 1RNLA 3RHKA 3TKYA 3CO7C 4F7NA 3OT3A 3NAXA 2AS5F 2OJJA 2ETMA 4BCPA 1DAWA 5HCXA 3FZTA 4BDAA 3M1SA 3VS2A 4CKIA 3JR1A 1Q41A 3PA5A 3OW4A 5IPJA 5CSWA 3MVHA 2OF2A 3QQKA 1SMTA 3LFNA 2A68F 3R0JA 2V62A 3DV3A 4KICA 5BS6A 3ULIA 3BBWA 2W4JA 5M53A 3QTQA 4OGRA 3A7FA 2PZ5A 4YTFA 5L2SA 3K1MA 4WA9A 4R7BA 2IVVA 3DK7A 3LQ5A 3OCGA 2ETHA 4HVHA 3I53A 3MBLA 2NPQA 3MA6A 1UWHA 5FFXA 3JSPA 5AADA 4YHFA 2QYOA 4EH5A 3W2RA 4E5WA 1ZRZA 4I92A 2C47A 1X3UA 1NW1A 4XRLA 4FNXA 5HIBA 3R02A 4AT3A 2VWBA 4UMUA 5LEJA 5M07A 4DF3A 3H92A 3P86A 4AWIA 2RQPA 4FYOA 4J7BA 4UEUA 4ZYGA 3HECA 2ZV7A 3D0SA 1MZBA 3HLLA 2HQNA 4NTSA 3DFAA 1H24A 2Y8OA 4ZS0A 2Y0MA 3QZGA 5J8CA 4LLNA 1BJAA 4TW9A 3DJ6A 4LUDA 2XNBA 4RB3C 3M2WA 2E9NA 1Y57A 3PIYA 3EQPA 4KKHA 2C6IA 3PJCA 1AWCA 4O22A 5HE3A 5GINE 1H28A 3I58A 1XWSA 4P7EA 1FGKA 1H8FA 4QMYA 4FTUA 5JFVA 4ZTMA 1T45A 2HY0A 3P78A 5D5WB 3QAHA 4MXYA 4RFMA 4YJPA 2CJMA 2GA2A 3DS6A 1FC3A 4W4WA 1OL1A 3WU0A 5FTQA 2J7TA 4ZSAA 2XBAA 3EYIA 4MF1A 5EI2A 3RPVA 4MEYF 5IEVA 2CHLA 1XKKA 4CKJA 4LB6B 1E1VA 4AIHA 4QP6A 4CG9A 5AR4A 1OMIA 3ZRKA 2H9VA 2PSQA 2W24A 3DK3A 5AP5A 2C30A 3R9NA 1GZNA 2DFIA 4BIDA 1S6LA 1IZ1A 4RIYA 2FQ3A 3E5XA 3UZPA 1JSVA 1JXSA 3FSKA 3TKIA 1LEBA 4RJ6A 4CCBA 1JNKA 2B54A 3R8VA 1W84A 2WD1A 4L01A 1ZGJA 3BKBA 3BU5A 4W4XA 1YOMA 2F2UA 2J0KA 4AQCA 1E2XA 4NK9A 4LGHA 1ZYRF 2PLYA 3OCSA 3W33A 4BZNA 2GHLA 3GWZA 4MD9E 5ICPA 5L3GA 4IWQA 4HDUA 2E1CA 4LV5A 2O3PA 4CDGA 2CNQA 3MH0A 4JQ8A 5CVJA 3MSSA 3BYOA 1KUTA 1JOWB 5CVIA 2ONLA 3ZDUA 3K54A 4C61A 4G9RA 4MXCA 2D2WA 3K69A 1TNSA 3OEFX 4FKRA 2X2LA 1DAYA 3HV3A 3VUHA 4M12A 3TZMA 1IN6A 3R73A 2VX1A 4QP7A 3BP8A 3WZEA 3QU6A 1HW1A 2V7AA 4CKRA 4BGQA 5C26A 3OXZA 4APPA 4X6QC 3LFCA 2WMXA 3BJAA 4UVBA 1BI7A 4J97A 2UZNA 3F2AA 3Q4TA 1IG1A 4HVGA 1FINA 2JAVA 4R6VA 5HIDA 3WTXC 4FTRA 2YM3A 1MRUA 5AAEA 4DYMA 1OITA 2I6LA 1L8TA 2F49A 1YQAA 2W85A 4U7DA 2JPBA 3IGOA 5ACKA 5CSXA 5IQGA 4BGHA 4XV9A 4F1TA 4B4LA 5D1JA 2X39A 2CNVA 2YDIA 3ZXZA 4YSMA 2YM5A 4O6EA 1DDNA 4QPAA 3LQQA 5CLPA 4G7ZF 3WF5A 3R0AA 5FTGA 2UWMA 3UTOA 2HKXA 1X8BA 1SD7A 4BGGA 2QU5A 1LB2A 4UV0A 1YTYA 5DR6A 4I94A 3ZYAA 4P96A 3VNTA 4I20A 3M11A 4JR3A 4A4LA 4DTKA 4EOQA 5H9BA 5J7BA 4XRFA 2R3QA 4OOIA 3ZMVA 4M67A 4QT1A 1V1KA 2R3FA 5ANKA 4EJNA 1UKIA 5EYMA 4BCNA 5A4CA 3QC9A 4IM0A 4G7HF 1H08A 3KXXA 4BBEA 3F23A 3ORLA 2F5CA 3C4XA 2FYSA 5M55A 4IAIA 5E8IA 4AN3A 3OD6X 4EQQA 5AX9A 1Y0UA 3H0ZA 3HRMA 2VTPA 3QQHA 4M15A 4F63A 4X7QA 2C3IB 4IZAA 2CKQA 1Q1HA 3QTSA 3FMNA 2ACJA 5AV4A 2B9IA 5ICCA 4ESFA 4ZLYA 5HTBA 3CUQA 5K3YA 1JBPE 3LCKA 2VNWA 2V1XA 5C01A 3L8VA 4OT5A 1J75A 5CEKA 3FXUA 4ZZMA 5HLIA 1LDDA 4CZYB 4GCJA 2OXDA 4U40A 4KIFA 3BCEA 4ERWA 2X1NA 3LM5A 4RLLA 1I09A 3U9GA 3ANRA 2GNGA 1JKKA 4QYGA 1IRFA 4U81A 3F5GA 1XBAA 4AA5A 4FKQA 3ZDIA 4RZVA 3FZPA 4USFA 4BDCA 1PXNA 4HYEA 1GJOA 2JDSA 4IM2A 4KUMA 1S9IA 5LRSA 4KIQA 4CGAA 4YZDA 5I4NA 2ZB0A 3I0QA 3KP3A 5BVFA 5HDGA 4ACGA 3QP6A 3EZVA 5KX8A 3SLSA 4R77A 2JKKA 4CQGA 3QPTA 3UVPA 1W5TA 3D4QA 3KK9A 2BHHA 3P9IA 3KMWA 4UNOA 5L3DA 4QLCU 4GFOA 4PY1A 3WE2A 3KKVA 4AA4A 3NYOA 3WE3A 5FD2A 3KA0A 5FLXZ 5LRRA 1V3FA 2XKEA 4Y72A 4IDTA 4JG7A 3MTFA 4RB0A 3VUGA 3KRWA 4HF0A 3BE9A 3N4MA 2I0HA 1F5TA 4OTDA 4ZS4A 4CHUA 3GCPA 3AMAA 3IDBA 4XCUA 5KHWA 4TXCA 4CD0A 1G8AA 3ACKA 4ANMA 2XEZA 1OL7A 4HAMA 3PPZA 3NR9A 2PQ8A 5M4IA 3LA2A 4AVPA 4D2VA 3TM0A 1YWNA 3DBEA 3FXRA 2XAHA 1H0MA 2XRUA 2QO2A 4IRGA 2FRHA 1VYZA 2QWWA 1YI4A 3Q04A 4YJSA 5HNGA 3O3KA 2RV8A 3DKGA 2YIXA 4JRVA 5E8UA 5D8LB 2NAZA 3RCJA 2C4GA 1R0EA 1V0BA 1ON1A 3ZMUA 2W96B 4KIBA 4D28A 1BN5A 2PPQA 3SHEA 4QP4A 1DPRA 2ITWA 2GQGA 2XYNA 3T1BA 3PSCA 4JBPA 4QP1A 5LARA 2IZRA 3BPRA 3GI3A 4XSXF 3AT2A 3DDPA 4FR4A 3I5ZA 3LQ8A 4YZNA 2LKPA 3NUPA 1K78A 5F9EA 3ORNA 3HDMA 4EOOA 3OY3A 4PTEA 5LGNA 5FBOA 1W0XC 4XBRA 2GA1A 4MQ1A 5LBQA 1UNHA 5FQDC 4EBWA 1LQ1A 2V1UA 4WF2A 3FMRA 1UV5A 4FTKA 5EHLA 2OH0E 5BUIA 2XK6A 4CZZA 4G94A 4IWPA 2PE0A 4IMYA 3JAMK 1QBJA 1IASA 4RIXB 4BCJA 4C4GA 3T0YA 2L4MA 5DA3A 2HIWA 4GH2A 5BQ0A 3U1DA 5DHJA 3LVPA 2OAZA 4ZY4A 3TDWA 1KU9A 4I3ZA 4DC2A 2XAGA 3RTRA 5BYLA 4F7ZA 4FVQA 2ESMA 2BALA 5IEXA 3COMA 1YW7A 4HJOA 3WTYC 1PMUA 3HMMA 4QQ5A 3NNXA 1U46A 1W7PB 4BTJA 3NMUF 3QHWA 5L6WL 3EL8A 3W55A 1O3RA 4A5MA 4O0TA 4LJZF 2ERZE 3BHTA 1LUFA 4R8QA 3O8PA 4RVMA 3NUNA 4QP8A 2OD5A 4U88A 3IDCA 4FG8A 3S2PA 3KCKA 2WMVA 3EFKA 4QTEA 2ZYBA 2QLUA 4EC9A 2WMTA 3TZ9A 5CEIA 4Q4ZF 5HX8A 3NCZA 5IT3A 4PPAA 4A9YA 2YEXA 4AGDA 2XKFA 5L2IA 2E9PA 2IRFG 4M74A 3LXLA 4BRXA 3BWFA 2C3LA 4O0SA 4QMVA 3ORXA 4CZTA 3CJNA 3V04A 3CCNA 4DCAA 3C4CA 4HVIA 2X7FA 1NT2A 2P8TA 5CQUA 5CSHA 1W5SA 1V0PA 3FLQA 2M87A 1YFHA 3OXIA 3P7BA 2KIFA 5IMXA 5EKNA 1YHSA 2Y48A 3GXOA 4MTDA 3C0IA 4ON0A 4CT2A 4MGRA 1PYEA 4I5HA 1O3TA 4DFYA 1PF8A 3PRIA 4L0ZB 1Q97A 4DFNA 4OTGA 4FGBA 4KT5C 3O6BB 2FSOX 3F3ZA 4P2KA 4PQNA 4YFKF 4CCUA 2OKRA 4DGLC 4X2NA 5CWZA 4HX7A 5E8VA 3VRYA 3ZSIA 3ZU7A 1XH5A 5JQ8A 5ED4A 2WMUA 3QU0A 2OW3A 3FLNC 1VYWA 3PP0A 3RKBA 3ZM4A 5KMNA 2P0CA 4LMNA 3EETA 1Z5MA 4RA5A 5E8GA 4EM0B 4U8ZA 5E4HA 1WZYA 2PVHA 3C4ZA 1MRVA 2JAMA 4PCQA 2YZAA 3WF6A 2EFOA 3DGKA 3ULQB 4CEGA 3RK9A 4E7WA 2IG7A 2R3GA 5BVNA 4D58A 4KN7X 4RVTA 3DB8A 2R3HA 5E92A 5EYCA 2NNNA 4FX4A 3S0OA 2P4WA 2MH9A 4XRJA 1KU3A 1KE7A 4BIEA 2CSOA 3HZTA 1IA9A 3R7GA 3C9WA 5IEYA 2B0QA 3TV6A 3W8LA 1R39A 3VS5A 3P4KA 4J8MA 5I9YA 4AFEA 3C7JA 3LFFA 2XVDA 2YCQA 4CFMA 3KB7A 5CAPA 2WNTA
chains in the Genus database with same CATH superfamily
2I5UA 4AFJA 3CLYA 4D2SA 1I3QJ 4QMLA 3EQFA 3P23A 3LFKA 5TJJA 5EW9A 3LKMA 3I59A 2Z5UA 4QNYA 4KBAA 4PMTA 1ZMUA 1ULYA 3BRBA 3A8WA 4FTTA 1SAUA 2Z60A 4GKHA 4ZTQA 5M4CA 2AC5A 3GLXA 3FIWA 3GYHX 5GIOE 2PZYA 3E8CA 3KRRA 3BG5A 3DKWA 2OCCH 4LFUA 3GU6A 4FL2A 4NJDA 2X6DA 4NU1A 3A7JA 2CH0A 1K83J 4L5IA 5D4SA 4MXXA 2WTJA 4FE2A 3F88A 1HF0A 3AC5A 4IZ5A 3OCTA 4CYCA 3TL8A 2NP8A 4C2WA 4XRSA 4E5AX 4FV2A 4FK6A 4FV4A 2BTSA 4XV3A 2O5RA 2GXAA 2V9VA 3JY9A 4QOXA 1VQ7I 3RAKA 2EB3A 2Y9ZA 4BC6A 3AKKA 2C68A 2GM4A 2VN2A 4WRSA 2Y6MA 4WNKA 4RMZA 4LK1F 4F0GA 4ETSA 3RJPA 2A6TA 2W1FA 4XV2A 4I6BA 3FMHA 3MKLA 2BTRA 3B2TA 3Q60A 4DEHA 4D4YA 5CF8A 5HU3A 1J7IA 5FGMA 4XG4A 4M6XA 5EG0A 2REIA 4FODA 5HVQC 2XGCA 3GU8A 3UNKA 4XG2A 3NX8A 4KD1A 3SW4A 2P4IA 4KABA 4UMPA 3A60A 4HV5A 2YITA 2QR7A 4U3YA 2IP2A 4GYIA 3R30A 2W82A 3WG9A 4D2RA 5E91A 5L2TA 2QZ8A 3EL7A 5KO1A 2LSOA 4BXXJ 2QURA 4FEWA 2QOOA 3HL2A 4V04A 1G3NA 2FBIA 3BZ6A 3LWFA 3K1NA 4J1RA 5E1WA 4F9AA 3EFLA 4WCGA 4FETA 1STZA 2MC3A 4YJQA 4EC8A 4I6QA 4IRIA 2OBJA 3G6EI 4AIDA 1NG6A 3SAYA 4O7SA 3JXWA 2GOMA 5F04A 5DYMA 5LEKA 2ZV8A 3HUGB 2VE8A 4W4YA 4IDVA 4BY9E 1BL7A 4WOVA 4C7TA 3HOTA 4H3BA 1GVDA 5IP7J 4D5FA 3OY9A 4X3JA 3NEUA 4B7TA 1EKEA 3WZDA 1YG2A 2B63J 4FV3A 2C5YA 1NVSA 2I0VA 2ELJA 1SFKA 4JX7A 2CQXA 2IA1A 1ZQ3P 2NYXA 2PWLA 3LCOA 3W0RA 1XR1A 4ASDA 4UHTA 3H9OA 4LL0A 3ZRGA 2OQGA 1Z67A 3LSMA 1X1PA 5HG9A 4Y3OA 4ZMEA 3N4TA 3BJ6A 1ZWSA 1XPXA 4G3GA 4UN0C 1B72B 3D5LA 1OUYA 2VGOA 4IAAA 3PP1A 2CW8A 5D8KB 4YURA 2LF7A 4E6DA 2OJGA 3VUMA 3JY0A 4BEHA 2ME0A 2GNLA 5F1RA 3R9DA 4HZRA 1LFPA 3BL9A 2A1AB 1J59A 5HZNA 3AG9A 3I5UA 4PX6A 3OBGA 3AG4H 5HGIA 2BROA 2V6EA 4ZYAA 3QUPA 2VTTA 5FKOA 4RJ8A 5A14A 3IV5A 5DWRA 1HQCA 4J01A 1TWFJ 1DS5A 5FKMA 2E9UA 4AUAA 2Q0OA 4QTBA 1I6XA 5C1QB 4YTIA 4ZTSA 2BRNA 2OG8A 1UU7A 3VS3A 3BHYA 4EOIA 4DH5A 2V5QA 3DQWA 1XB4A 1MBKA 2NVXJ 2N8GA 2GBYA 2Z7LA 5AP2A 3F69A 2VD5A 3I4PA 4E3CA 4PGGA 2QQ8A 4IB5A 2YIWA 4U0VA 4PJMA 4G3EA 3R9HA 2FSWA 4FUXA 2ECBA 5IQBA 3PRFA 4FSWA 2XAQA 3OYBA 1TKIA 3VUTA 4UMQA 2JGZA 1BA5A 1IN4A 2Z3YA 2ACXA 1SZMA 5AJQA 5DD8A 3R1NA 4F99A 3SXYA 4UUVA 4MKCA 3KRLA 2CPKE 4ASZA 2KRHA 3SZGA 3LL7A 5LMAA 4F91B 2BKKA 1YOLA 4ZTJA 3DU5A 4H4KC 2IS6A 2XNMA 4C38A 1LJ9A 3KIOA 4CUGA 1QL6A 4BCMA 4HPQA 4K2RA 4XICA 1I6HJ 4I01A 3W0PA 1MBJA 4EUTA 4CYCB 3OF0A 1WCCA 3R60A 3EFJA 3J81K 4MWIA 3CESA 3KYCB 2WTVA 5D11A 1IW7F 3V5JA 3HC7A 1ITYA 2FQ4A 1AKHB 1ZLKA 2RAEA 4D4VA 1M7QA 2VTJA 2Z2SB 2VO6A 3PA4A 2ME6A 3U54A 2H6CA 5D6EA 2WQMA 2YERA 3UVQA 3KIOC 4FKIA 3TNWA 1R6RA 1XMMA 4IQJA 4Q5SF 1RJBA 4BNCA 1Z1DA 1T46A 4EQMA 1ZG1A 4XOPA 3ZLYA 3MY1A 4MXOA 1FMKA 4KT6A 3LFSA 5HS8A 4UV9A 2HY81 1KYZA 1B4AA 5E3MA 1M7NA 3WHBA 3PYYA 3PVUA 3U4WA 4L43A 2OZOA 3QL8A 2XSJC 2LY9A 4YG2F 1IXCA 2WA0A 4FTCA 4ENYA 5JZNA 4QWQA 4A9TA 3COIA 4XV1A 1SYKA 5FEQA 1R5HA 2HW7A 5KMIA 1N75A 4QTDA 4RC3A 5AP4A 2G9WA 2IEWA 5K0XA 1RUOA 2STWA 3RI1A 3EN4A 1HOMA 3O96A 5HNBA 4JR7A 3TYKA 2WMSA 3UOJA 4EJVA 3JYAA 2EXMA 5ANJA 3CP9A 3SXFA 5IQEA 4JQFA 2COMA 2QM3A 1M1EB 3DZQA 4DINA 2VWZA 2MA3A 4DZJA 3Q4CA 3W18A 3BWGA 3FMLA 3E5QA 2EFWA 4QQCA 4DFBA 3PA3A 2ADUA 5ICGA 5AA8A 5GPCA 1V4RA 3KK8A 2PUUA 2BDJA 5L8LA 1UZCA 4WXHA 4BJTA 3VS7A 3NARA 1S7AA 4MXAA 1QPEA 1GUUA 3FXJA 3FHIA 3QQGA 3PFYA 2A05A 4UUTA 4B4CA 5K0KA 2R3KA 4BR3A 1O57A 3BLRA 4XMYA 4D0WA 5HVJA 4YZMA 1O7LA 4GK3A 1Y39A 5LCJA 4YC3A 2VBYA 2OFVA 2WMAA 5CEQA 1SVGA 1TWAJ 1PKDA 4YLKA 5M09A 2EZKA 5D4RA 1QHGA 5HE0A 3UO5A 2PZRA 4IB1A 2YIRA 5DPVA 4JOAA 4WKQA 1K4SA 3ABUA 1R0PA 2ZDUA 3LLTA 4XRSG 2C3JA 5TR6A 3B73A 4LG3A 1NVQA 2O5KA 1JGGA 1D1CA 3E8DA 5F95A 4W97A 2IA0A 1PXKA 2HKOA 2UW8A 4CT1A 3LXKA 3G15A 2LKSA 4O4BB 3QYBA 3WIGA 4M0ZA 3R63A 4U3ZA 5HTCA 5D7VA 3UKGA 2R7WA 4FIIA 3D15A 3ZXTA 4EJUA 4YHJA 3W2QA 3RZBA 2EXCX 3BIZA 1VQMI 2BMCA 1RKWA 4E8AA 3FMJA 2NRAC 1WJCA 3PLSA 4BJ5C 1XMKA 5AIRA 1APLC 4LL5A 4MTEA 3CQUA 4RVLA 4XLIA 4G6TB 4V2FA 3Q2JA 4EWHA 3KF7A 5CYIA 3VULA 3CPBA 5B2MA 2LK2A 4HQMA 4YPDA 1F1ZA 2UW3A 3WZJA 2DK5A 3ZR8X 4WXDA 2CMWA 2EIJH 2MG4A 3QQJA 3TUBA 2OI4X 1DP3A 4DT9A 2FO0A 4D9JA 3G51A 3GTJJ 5I9UA 4UZHA 3CGFA 3DEWA 2R7ZJ 2IEKA 4HOKA 4BE0A 3TACA 3C4FA 1WKMA 3CF2A 4P1WA 1F9NA 1LP4A 4CLIA 4JAJA 5F1ZA 4J00A 1OKRA 3LFDA 4BCFA 1W98A 3R8LA 3OR2C 3HDDA 1B6CB 1FNNA 4Y17A 4IKFA 2HQRA 1R5GA 2ZM1A 1H1PA 4CFXA 4BDBA 3D7TA 2X6YA 3EUHA 1JI8A 4JG8A 1Y8YA 2YIQA 4PJNA 4HZFA 5HLWA 2XALA 5GTHC 4C34A 5HS9A 4M84A 4O6LA 4NKAA 4F6UA 3BQYA 3K4LA 3I79A 4OAUC 2XRNA 3FKIJ 2JDOA 3D2KA 2A27A 5L6OA 2G9XA 4KIKA 1IJWC 3OHTA 4G3FA 3HRTA 1YITI 5CALA 1U3EM 4E73A 5E90A 2X4ZA 2RGPA 4EJWA 4IIRA 4ZMFA 3TI1A 1Z7UA 1KOAA 2X1DA 2A6HF 4BDEA 2DA7A 2WADA 2WQBA 1UKHA 2DA1A 2HVSA 1RKTA 1JKRC 3F6OA 2OWBA 3BQRA 5TRDA 3FC2A 3SC1A 3U4UA 2F57A 1N78A 4BICA 2QOFA 3AC3A 1AHDP 2HNHA 1P6RA 4TTHB 5CZIA 1X4PA 3LSIA 1YXSA 3RPSA 2ELKA 2R7QA 4WG5A 3F22A 2FMYA 5ETFA 2ZC2A 4NNJA 2NVYJ