1TQIA

Crystal structure of a. fulgidus rio2 serine protein kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
269
Chain Sequence
b'MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
total genus 91
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqiA02
4CHUA 4FSNA 3FI3A 2GNHA 1KQ0A 2DUVA 3W18A 2XAHA 4MK0A 5HG7A 5J95A 3LZBA 4I3ZA 3Q2JA 3DXJF 2HYGD 2QOLA 3CSVA 4XBUA 1CM8A 3R2BA 4AZVA 4GV1A 3GW2A 2VN2A 3ABUA 4BF2A 5JFVA 4WOVA 3ORNA 3E8DA 4MD7E 1XMAA 4KNYA 5DH3A 2XNPA 5L2WA 2C6OA 3RPUA 1XSDA 2VAGA 4EH7A 3ERED 2R3HA 3C51A 1GNGA 3L8PA 3WZJA 5CU0A 3ID6C 4ON0A 2UZEA 2DQ7X 3NSZA 5FO5A 3WTSC 1WRJA 3QQKA 2C3KA 1SYKA 1Y6BA 1M17A 3OF0A 3QTUA 3RK5A 5CSPA 3PPKA 5M55A 4DN5A 5HU3A 5E7RA 4EOJA 1QNTA 4MD9E 4S33A 2D2WA 2Q0BA 4RJ3A 3FI8A 3QQJA 5HDGA 1Z6RA 4WXCA 3U4WA 3A7HA 3RPSA 1Q4LA 4BVUA 3FXQA 4CT2A 1ULYA 3F5GA 5KNJA 4NTSA 5ICPA 1BI8A 3HP5A 4I6BA 2CKEA 5ICFA 4QPSA 1GZNA 4O22A 5B7VA 4P5QA 1FY7A 3E7VA 5AUXA 3ZBFA 3ZN1A 1DAWA 3HLLA 3ERKA 3OV8A 4ZH4F 1Q41A 2WMVA 3I59A 2BFXA 1HCKA 5L3DA 3GO5A 4DLJA 4EH8A 1OIRA 3R63A 2CG4A 1WVYA 3P7AA 1KU9A 5LRSA 2UZOA 2X7GA 3DTWA 1QZYA 5HKMA 3ZDUA 2OI4X 3L9NA 4J95A 3DB6A 3VWAA 4FTLA 1Y57A 3K5UA 3OMVA 1P4FA 3MAJA 1JSTA 1H27A 3JY0A 5KMLA 5IA2A 2DBBA 1WBPA 2IW6A 4D4YA 4C57A 3V5JA 3AMAA 1REJA 2ZB1A 3O50A 4PDPA 1W98A 4F9AA 2WFYA 4YTIA 5TO8A 3BGPA 3UYTA 5T6KA 5EI6A 3RDIA 4NB5A 3GVUA 2ZOQA 5FTQA 2Y6MA 3VS6A 3RPRA 1F0QA 4IEBA 2B55A 4BHNA 4F08A 5HU9A 3ULZA 4LL0A 4GIIA 1T2KA 4CZTA 3NIZA 1OZ1A 3BU3A 3DJ7A 4G31A 4EK8A 5CYVA 3VUKA 2FBIA 3KEXA 4ZIMA 3HNGA 3POOA 5IH5A 4ASDA 3EYHA 3QU3A 4AF3A 4U40A 1M2RA 3GU5A 1IRKA 4XYFA 2HWOA 3R21A 5FGKA 2PZRA 3FMHA 5HBEA 5T3QA 3HMOA 3Q60A 3MQ0A 2NYXA 3L8XA 3JTHA 4BDKA 3R9OA 2FSWA 3ZZWA 4ZSGA 5BQTA 2XMYA 2R3NA 3DNDA 4OW8A 4HCUA 3WTVC 3ACKA 1M14A 2H8HA 4XBRA 1M7NA 4V0GB 4E3CA 3T9TA 4BDDA 4O0RA 4I22A 1H4LA 3PWDA 5HE2A 1XGOA 4U0IA 4ORKA 2O6GE 3PJ3A 5IA5A 3ZYAA 4JBAA 1J1CA 4OMYA 3QRTA 1VYWA 2Y9QA 3EQPA 5BVOA 4O0VA 4I5PA 3TDZC 2W84A 3GC8A 4ITIA 2IVTA 4USEA 2ZAZA 4RWJA 2FU4A 5CLPA 4YZ9A 4A4OA 3BHVA 1ZLJA 3MA6A 3PRIA 4PDYA 3PPZA 2GFSA 3NIEA 5DOSA 4BICA 3PJ1A 3CLYA 4UV9A 3U54A 2WIHA 3QRFF 2YWPA 5CF8A 4USFA 1W84A 3QD2B 3R73A 1MJAA 4H58A 3HSRA 2E9PA 4FG7A 5ERIA 4KB8A 4MHAA 4GFMA 3QUDA 4KA3A 5AUZA 4BIBA 5DVRA 3MJ2A 1BL6A 3HV3A 4NTTA 2VONA 2X4FA 3TUBA 1RE8A 3P7CA 5CJ9A 4KA4A 5J9YA 2HWPA 4S30A 2A5YB 4Q2AA 4IDVA 5BS6A 1UVRA 2EWNA 4DGMA 2HYYA 2JBOA 3N9XA 3ZLYA 4EK6A 5A2QK 4EHGA 2FNAA 5C8NA 3F7WA 2VXZA 4B8LA 4E20A 3HDNA 4U43A 2H27A 1XO2B 3FY0A 1D5VA 5HLNA 4FMQA 3B2WA 2BRHA 4MXAA 2DAOA 2RFEA 1LQ1A 4ACDA 4Y8DA 3ECHA 5K0KA 3KXGA 4IFGA 5FD6A 2VNWA 3QD4A 2BRBA 4PGGA 3DF8A 4X3FA 2ZKZA 5DIAA 5HIBA 4DBXA 1F3MC 2O65A 1J1BA 1LDKB 3D9VA 1U6GA 2ZV2A 3AMBA 3VUDA 4BYJA 4BR3A 3LXLA 5C26A 3O0GA 4C4FA 5LMBA 4IVDA 4FSRA 1SM2A 1TNTA 4L53A 2BDJA 1Q5KA 2A2AA 3ANQA 2XK8A 4L5IA 4OU0A 4KDPA 4LV5A 4Q5HA 2IRFG 3GFEA 4R78A 4F9YA 2VO0A 4RIXA 3FAAA 4GYGA 2UZTA 1E9HA 1FT9A 5CLSA 3WZUA 2BYVE 2PVKA 3BI6A 1T98A 4LK1F 3I6WA 4I7HA 2OH4A 3NCGA 3FYJX 2P8TA 5KHXA 3SXYA 3MI9A 5IQBA 1P4AA 4K9YA 3U9CA 4OR5A 4ASEA 2PSQA 3LFAA 1O9UA 3C50A 1OL2A 4A4LA 2R3LA 3HHGA 1DP7P 3MZYA 4EYJA 5FGMA 5AA9A 5IA4A 4BIDA 4BDHA 4O2ZA 2L4AA 2XM8A 2BMCA 2JKKA 2EFWA 5AM6A 2VWIA 3OXTA 5CVFA 4DFNA 4D1SA 2W7XA 3M7GA 2BIKB 1WSUA 4QP1A 2JITA 3VJNA 5B2KA 1SMYF 3O17A 4P5ZA 2FMLA 1U3EM 4FKPA 5BUEA 4PPCA 4HCTA 3VFZA 3R8VA 1KV2A 1O3QA 3SZPA 4AWXB 3SC1A 4G5PA 4ZLOA 3RINA 1V0OA 3OP5A 1WKMA 4LFUA 5LLQA 1U4DA 5FEEA 2UZKA 5IT9K 1FWZA 3QCQA 3LQQA 4C7TA 4PGHA 3D94A 5HHWA 4F0GA 4IC8A 3OW3A 2A1AB 3I60A 3KP6A 2WQOA 4K1BA 2VWVA 1K79A 2C0IA 4NEUA 1S8NA 2QG7A 1S6LA 1ZHFA 4HZFA 5CVRA 3G5DA 3FQHA 3P1AA 4TWCA 4EQMA 3C4FA 4DFUA 4JX7A 4UZHA 3BKBA 1D8JA 4EQCA 4YURA 3GLXA 5M4CA 3F5PA 4YJVA 3KKVA 3OROA 2WU7A 4B6LA 2VBZA 3RKXA 4EHZA 2QLQA 3BHTA 3EN9A 3QZFA 1YOMA 3D83A 4ACGA 4ZTMA 3VJOA 5E9EA 2YLFA 5CAPA 3I5NA 2Z33A 2Z02A 3GU7A 5AUVA 4QQTA 3V5TA 1KUTA 2L3DA 2Y4PA 4IIRA 4MQ1A 4W9WA 1J5YA 4G3DA 4TT7A 4FHTA 1ZWSA 4BL1A 4RQVA 1PXKA 2VX0A 4ALUA 2IZRA 3GQIA 3VW8A 1ZOEA 1ZYDA 2GFCA 2EA2A 4ZYHA 2GZWA 2W0JA 2VTOA 3KRLA 3HOTA 3C4WA 1UNGA 2IA0A 3RAWA 5CAUA 4FT5A 2W1DA 4AN9A 3VW6A 3GUBA 2XNMA 5A4TA 4HGLA 4K11A 1IXCA 3R9NA 3FMLA 4FVRA 3LAJA 4ETSA 4FSZA 2GMXA 4BDGA 1BIBA 2YM3A 2WHBA 4EM0B 4CG9A 3JTGA 3R7OA 3ZBXA 3GENA 4ZXTA 3IWFA 1WVWA 4MBLA 3DCVA 3QAHA 3M42A 1Q61A 4QTBA 3VBTA 3FKOA 2HZNA 4MVFA 4S05A 3VS1A 4IFCA 5JQ8A 1FX7A 1KE5A 4F4PA 3TNQB 3COIA 4ZY4A 3QQGA 2Z7QA 1JGSA 4FG9A 4ASNA 3F9NA 2OIBA 3AC3A 4FKVA 1T46A 4RVKA 5EYMA 4RGJA 3P7BA 4D4VA 2D45A 1YHSA 5IEVA 3WI6A 3I7BA 3ZMUA 2QOCA 4CMTA 4FKUA 4EOQA 2ZMCA 1P14A 1PRYA 4IAIA 4HCVA 3RPOA 3CD8A 4WA9A 5FRIA 1Q3DA 3QTRA 3TTIA 2YIWA 3W16A 5LBQA 4LRJA 4I0RA 4J8NA 4I24A 3KY2A 1H25A 3IDBA 3MWMA 5M51A 4P96A 2DWBA 2NP8A 5DEWA 3H4JA 3JSOA 4XG3A 4BH9A 2DU9A 2W4OA 3F6XA 5CQUA 3DV3A 2FF4A 4ARKA 4FKQA 4O0SA 2AC5A 3UOJA 3IRRA 2JAVA 2PULA 5I9YA 3TV6A 4RB0A 2XM9A 1YTYA 2UZVA 1A06A 4ZSEA 1RUNA 4YC6A 5L8KA 1PW2A 4R7IA 5I5ZA 1FPUA 4J53A 4EORA 3CUQC 3F23A 4I5CA 4CFNA 4YZBA 4U3YA 5A3XA 3BYUA 4L52A 3RPYA 4P7EA 2XKCA 3SW7A 4RX5A 4RGSA 4G6DA 1NVRA 2Y7JA 3UVRA 2B54A 4MEXF 4YUQA 4U42A 4F6UA 3MB6A 4M74A 2OZUA 2QM3A 4AP7A 4PRJA 4I98B 3PVUA 2ZYBA 4DC2A 3QF9A 4YJTA 3DK3A 4X21A 4G3GA 1DUXC 3OTUA 3ZRMA 3EHAA 3KL8A 3KF7A 1FBQA 4GCJA 1WBNA 4ZS4A 2LGCA 2EV0A 3LSTA 3VUTA 4JR7A 1RNLA 3DJ5A 5F6FA 1WBOA 2R0UA 3R71A 4LJZF 5FUTA 4U9AA 2A3SA 2QG5A 4C3FA 5BMMA 4Z3VA 2FA5A 5CWZA 5C9CA 4FKTA 4R5SA 1FBUA 3FZRA 4FSYA 3RHXA 4CV8A 3LHJA 4Q48A 3RI4A 2WMRA 5CT0A 3VEPA 3R04A 1U54A 4G2FA 5M53A 1GXQA 4TTHB 4LGWA 1WI9A 3RPVA 3FZOA 2QO9A 3OS3A 4FEQA 5EOLA 3I53A 3UC4A 2J5OA 3T3UA 4DTBA 3P9IA 5DR6A 4E8AA 1H0WA 5CAOA 5JGDA 4G9RA 3O8UA 3CTHA 4BCQA 4FTIA 3R83A 1SVEA 5HE0A 4FV6A 2OJJA 4ERKA 1ERKA 1Q8ZA 1NY3A 3S4QA 4AFEA 2Z5UA 5M4UA 4MXYA 1JAMA 2VTRA 3QC9A 2QBYB 1L0OC 4JDKA 2OJIA 1T0FA 4IRHA 3ROUA 1SD7A 5K5NA 4FKOA 3R8LA 1R5GA 3TUCA 3TM0A 5HO8A 3PIXA 4QP8A 2KKOA 4I6QA 3ZXTA 3MDYA 4KIOA 4AE6A 5DLSA 5AR4A 4RC2A 4PDSA 3DGKA 1Q97A 2VT3A 4AGWA 1ONVA 2YX4A 2IVUA 5A4EA 5L2SA 2GQGA 5CXHA 3FX3A 3KC3A 4N57A 1YQAA 2PFBA 5DE2A 3RM7A 3R61A 3VAPA 2M45A 2OSCA 2H34A 4KIKB 4A06A 1L3RE 2J0IA 4WSYA 5LVMA 2EK5A 2Q83A 4ID7A 4CMOA 5I3RA 2QONA 1H28A 3QALE 4WWCA 2R9SA 4UVCA 3CQEA 3ZLSA 4QYYA 5G1XA 3HYHA 2DK5A 5FEQA 3LIJA 3Q9SA 2WIPA 1M7QA 2VOOA 5CEIA 1BX6A 4BWPA 5K5QA 3V3VA 4Y46A 5IEYA 4QYHA 3BDDA 1B38A 2H9VA 4A0YA 3EQCA 5AP7A 3TJDA 3BWFA 2GA1A 2O0UA 3KETA 1RIOH 3EZRA 4OTRA 3CIKA 1TKIA 3CTJA 2VD5A 4UXNA 4OIRF 5JKGA 5M4FA 5EH0A 2OH0E 3TIYA 1XHAA 4D2SA 4CT1A 4BHBA 1ZRCA 4M12A 2GHGA 3HEGA 2C3JA 4QMZA 4UYNA 2DTRA 2VN9A 4IWPA 1PMVA 4FKSA 1PYEA 4CFMA 3ATTA 4QMTA 5FP5A 3JAMK 2VTLA 4HVSA 2ETHA 4EC9A 3W8QA 2XUUA 1APME 5AMNA 3JYAA 5CSVA 4UXLA 3J80K 3IKAA 4QMYA 2BAQA 1ZG1A 1M2PA 2RN7A 1IRGA 2JKOA 4OTQA 3VS7A 4PP7A 1XMKA 3EYIA 4YLJA 2Y6OA 4DFXE 3RIRA 2FSLX 3E7OA 3DBFA 4C3RA 4D58A 1NVSA 3R8PA 4DGOA 4OBQA 2BR1A 3ZHPC 2CGPA 1NXKA 4WRGA 4FKIA 3K3IA 2O8YA 1IXSB 2ELHA 5L6WL 4KSPA 4A5NA 4RWKA 3K2ZA 4BI0A 2ONLC 4LYNA 1BI1A 4IDTA 5AAEA 3EKKA 1ZMUA 4IAAA 2NNYA 3S2PA 3HL7A 4YPSA 4XG7A 4C58A 2FA2A 4I1ZA 1KV1A 4UVBA 4XHKB 4U41A 1ZRFA 3GZ6A 3MV5A 4L46A 3SZTA 4RIWA 4RX8A 5AR8A 5GINE 5E1XA 3H9FA 3N4TA 1U5TB 4J7BA 4X7QA 2UXNA 2RNJA 2PUNA 3MCZA 1NT2A 4BKZA 2AC3A 4FF8A 2IG7A 1YXVA 4IRIA 2MH2A 1B6CB 1LEWA 3PA3A 4BIEA 2Z8CA 2W25A 4O0TA 2B9HA 3KGAA 3PP1A 4BCPA 1MP8A 1PXLA 2QHMA 5K9IA 4MTDA 4GT3A 2F7ZE 4EJWA 2DI3A 5JR3A 2EU9A 4BI2A 4IXPA 3JR1A 1Z5MA 2OXXA 3POZA 1YXUA 4CLIA 3ZM4A 5IQCA 2V7OA 2IVSA 3G0EA 4PL5A 1Q8WA 3L8VA 2XASA 4HNIA 4AA5A 5E8GA 5EM6A 2L02A 1LNWA 3PSCA 3QQFA 3B2TA 4HYHA 3UOHA 4RB3C 4IE9A 2C5YA 4JQFA 3U9NA 2MLKA 4ZTNA 2AXLA 3OWLA 3I5ZA 3Q9WA 1BUHA 1OM1A 3AC4A 2EXCX 1GIJA 1VTNC 2V5QA 3NYOA 5J1WA 2G9WA 4NKSA 5FQDC 3COHA 3ETAA 4R8HA 5HICA 4MX9A 2FB8A 3DK6A 3HUBA 3ZLXA 1OKVA 5AR2A 2RC4A 3E3VA 4WO5A 1YWRA 5D5VB 2F5FA 3LMHA 3C4EA 3QQLA 1JNKA 4BTJA 2YM8A 1KSWA 3SFZA 4CNHA 3OT8A 4DEHA 4IHPA 3V8KA 3WYXA 2KIFA 3B73A 3AXWA 1OMWA 3G6GA 4YFNF 3R7YA 4E4NA 3V8JA 5DBXA 5D7AA 2GCDA 2WMAA 2P5KA 4PUZA 4L67A 4X6QC 2UZBA 2HKOA 4M6YA 2YU3A 3BE2A 5C4KA 5C1QB 4FSTA 4M14A 4APCA 3UIXA 4PY1A 1AD5A 3FDNA 3ODYX 5HESA 1WZYA 4GK2A 4FNZA 5BYZA 3E8CA 1FYKA 3PY1A 5IH6A 1HXDA 3BYVA 3BV3A 2X7OA 4ZY6A 3NW7A 4C34A 3ROYA 2IW9A 5KKRC 3BJOA 4D2TA 3GOKA 4ZY5A 2O3FA 3UNZA 3A61A 4XOYA 2XNBA 2VWBA 3E64A 2X1NA 3KREA 4AG8A 1IRFA 3F7ZA 4YGAA 4PMMA 2PBIA 2QQBA 4DEIA 2H96A 2GPHA 2ZDTA 1PDNC 3JUHA 1IUYA 5GNKA 3QTSA 4RAZA 3LCDA 2OJFE 2Y4IB 3RM6A 3KXZA 4GEOA 2XAGA 1H9GA 2F5DA 3G6HA 3C5IA 4TZRA 2Z7SA 4GIHA 3AD5A 5E90A 2RFDA 2I0EA 5CEOA 3OXIA 2TDXA 2ITNA 4I21A 2HS5A 2COMA 4HBLA 4D2RA 4YZMA 4DINA 2QYOA 3G73A 4EMSA 4U5JA 4X3JA 5IT3A 1X3UA 3QBNA 2ITUA 4MNEA 3CEKA 5J8FA 1G5SA 2L01A 2YM7A 1J7IA 2C6KA 2ISZA 3HRCA 4PF4A 4L01A 4RG0A 4LB5A 3CE3A 3F8FA 2QZ8A 4J52A 1YW2A 4ZZOA 2HYFA 4W4VA 3R8UA 5H8GA 4HZRA 3HMIA 4FSMA 2WQEA 3NCZA 4PL4A 3FXRA 3BHYA 4EQUA 3R7GA 2STWA 4LK0F 4M6XA 3KP2A 1LJ9A 5DA3A 4KUJA 4QMOA 4UVAA 1J7LA 1E17A 3F88A 4HYIA 4G94A 2XJ1A 2C0OA 3E6DA 5HCXA 3D2IA 3U8WA 1XWSA 3ENHA 2Z60A 3WTUC 5L3EA 5I0BA 2V9VA 4XS2A 4IX6A 3AGLA 3DV8A 4G7HF 1HSJA 4WHZA 2VTIA 3EFKA 4FYOA 1XKKA 2QOBA 3WE4A 1DPUA 4EH4A 5CQWA 1YXXA 4EWHA 5HE1A 2Z7LA 3GU8A 4KBKA 3IG7A 3CY3A 2HW7A 1OKWA 4FT9A 1Q8TA 4CFWA 3CUOA 5TF9A 1BN5A 2V6CA 3EQHA 1RZ4A 1OPLA 4MYGA 5H2UA 2ITZA 2PZYA 1GY3A 5B0XA 1GZ8A 4ENJA 1LVAA 3HRMA 4LGDA 3CQWA 2WPAA 2FSTX 2IPXA 3EETA 3EYGA 2YJRA 4DFBA 3IRQA 2UZUE 5M09A 5CVGA 1K78B 2YCRA 4I41A 4MTEA 3DLZA 3QPTA 4F1TA 4KUMA 3VB2A 3VRZA 4Y83A 2G1TA 3GXOA 5D5UB 3WU0A 3QA8A 3EN5A 2OD5A 4RJ4A 2XA4A 3RYPA 4HDVA 4CXFA 3AC8A 2FUMA 4X2KA 1YRPA 2W24A 3RWQA 2JC6A 1K7AA 2GS7A 4IVNA 1LPUA 3GBZA 4BYIA 3BGQA 4CG8A 1WBWA 3EQBA 4KD1A 4EV0A 4XV1A 4AW0A 5CT7A 2JGZA 1YDTE 4USDA 3WTTC 4FOCA 2ITVA 4ZAUA 3C5UA 4UN0C 3KK9A 2ERKA 2F57A 5KX8A 1W82A 2YHVA 3TGNA 2F2EA 4GFGA 2PZIA 4HYEA 2BTSA 3E92A 4AD9A 2FO0A 5EYCA 3TEIA 2ZXJA 4HGSA 2ZNZA 1QPDA 3SHFA 1ZARA 2PJPA 2H6DA 2W9ZB 3ZO2A 3FLNC 3MY1A 4ZLYA 3R1QA 4LMYA 5FEDA 4AIHA 3H10A 4FKJA 2EXMA 3HV6A 2QBYA 2VWXA 3FE3A 3FY2A 3TO7A 3MWUA 5K4IA 4QP6A 2YLEA 4HQEA 1PXMA 3FMDA 4BTMA 1WWXA 2WQNA 5ILUA 2CQKA 3VNTA 5HZNA 3J7AO 2WMXA 3FSFA 1SFUA 1PP8F 5ITAA 3DQWA 4QMVA 3MH1A 1ZRDA 3W6KB 5DNRA 4FX3A 3FMEA 2XZSA 2PVLA 4K2RA 3GCPA 4MXCA 4RAYA 4KIKA 4XJ0A 3LJ2A 4FUXA 1IA9A 3D14A 4EOSA 4MWIA 3CGFA 3MH3A 3EZVA 4Y13A 2XK9A 5D4SA 1ZAOA 4OIOF 4FV7A 5AP0A 1ZRZA 2QQAA 3EYYA 3QKKA 2E9UA 4KFCA 2XIYA 4R5YA 5HORA 2X4ZA 2HQNA 3O8PA 3W2SA 4UHTA 4WXDA 4JDHA 4MF0A 2OU2A 4FKWA 2X9EA 5GHVA 1UA2A 4IB1A 4WUNA 1BMKA 5ICGA 3KXMA 3ZUTA 4DG2E 2GU8A 4MNUA 2GNGA 5CEQA 5EYDA 4DEAA 2YIXA 3JVRA 5E17F 3LQ5A 4M69B 5J1VA 3WZDA 1SAXA 5E8SA 3OTVA 2WV0A 2R7DA 3OBJA 3GU6A 4O0UA 3BELA 4F65A 4GK4A 3IQ7A 4DYMA 3QFVA 4DH5A 3AOXA 1BYGA 2F4JA 4E6DA 5JN2A 3Q9ZA 4D55A 3K2LA 3R7IA 1G4DA 4AOIA 4XNEA 5A9UA 4TYJA 3QOPA 4AGUA 1H8FA 4GL9A 3OCGA 4UZDA 4HOBA 2OFUA 3R28A 5KMKA 1W5TA 5AAFA 5AP4A 3S00A 4ZZNA 4MKCA 2VGPA 5K5XA 1OGUA 2M1BA 4XP0A 3M1SA 4XP2A 2MC3A 5LWMA 3QTWA 3EN7A 5GJGA 4F63A 4IB3A 4U88A 3TNHA 3SA0A 5DR2A 5A4CA 3BPRA 4RIYB 2HDCA 3HMMA 2XV4S 1R5HA 4KMUX 5FXSA 1A04A 4N6YA 1ON2A 4DH3A 4CZYB 3TUDA 4TWNA 3Q4CA 5D10A 2A0CX 2V22A 3VBWA 3A60A 1G3WA 3E93A 4YBJA 2E1NA 5I9VA 2R3QA 2DQRA 3LCKA 4YTHA 5HS9A 3RAIA 1G8SA 5IU2A 1GZKA 3EJ1A 5GZ8A 5E8YA 5CAVA 3BWGA 5L3FA 2PUIA 4F70A 4MXOA 3R8ZA 5KK1A 3UPXA 2HOGA 2XNGA 4AW2A 5K5OA 2J7TA 3TNPC 2F2UA 4Y85A 3HIFA 4CFVA 3Q52A 2XRWA 4QQ5A 3V8WA 4QP7A 4U0WA 3K1PA 3ZLWA 2ZV7A 3ZTXA 5FBOA 2CCIA 3GNIB 5JGBA 5KUPA 2FGIA 4U80A 4BTFA 2XVCA 4KIBA 3WYYA 4HYUA 5DUKA 2ZBKA 5CANA 3ENMA 1OYYA 4BKJA 5ICCA 1JPAA 2YIQA 3ZO1A 1ZMWA 3LOKA 1R1WA 1AWCA 3R0AA 2YDJA 5AX3A 4IWDA 3SQQA 2QVOA 2O64A 2RG5A 2HZ0A 5LMAA 2JFLA 2GIVA 5HEZA 3R00A 3F3WA 1JHFA 2WZJA 5K3YA 4NM7A 3IGOA 4AE9A 3LFEA 3J81K 3PSDA 5F94A 4Q5EA 2OICA 4MCVA 4BXUA 1O3RA 4DHFA 4WIHA 1ZG5A 5I3OA 4RVMA 2GQSA 3QUPA 3Q32A 3BYOA 5LMKC 3LPBA 4FE2A 4GT4A 3Q9VA 5AP2A 3FV8A 3KRJA 2WELA 4EHEA 4I02A 4IC7A 4WG5A 2JSCA 3KRWA 5J7HA 4IAKA 3RK9A 4N4SA 5DEQA 3MPTA 1Q1HA 5CS6A 3EQFA 4DGNA 3MPAA 3JAMZ 4YU2A 1I1GA 4EH9A 4EOMA 3QYWA 3DZQA 3VUHA 3PXQA 3NEWA 4W4YA 2HENA 3NZ0A 5AV4A 4QRCA 5CEMA 2FMYA 3MFRA 2PMLX 2G01A 5DFPA 3AC1A 5JI6A 3LFFA 5IZFA 1PUEE 5C4LA 5L2IA 3W32A 4IB0A 2W85A 3UOKA 2OZOA 4E93A 1FC3A 1LB2A 3C0GA 4JK1X 5DYMA 2YIRA 4K33A 2OZ6A 4RPVA 4CICA 3R6XA 3G0FA 2G7HA 2OGVA 5LGUA 4FIGA 2V0DA 4DEBA 4RJ7A 3QPHA 1ZGAA 4BWKA 2ZVAA 3BEGA 3R7EA 1I5ZA 1AQ1A 1HW1A 1FP1D 5LVNA 2WMBA 3VIDA 1ZYJA 1HW2A 2YDIA 3GF2A 2WWYA 1VZOA 2YZLA 4JIKA 4A9TA 3C4CA 4H05A 3KA0A 4R3PA 2R3RA 5GIPE 2UZWE 2C6DA 3RAHA 4ANNA 3SVVA 3BQCA 3O8TA 5DT4A 3GUDA 3QL8A 1WVXA 4L9NA 3A4OX 4ENYA 4QNAA 2L4MA 5DPVA 4E70A 2GTMA 2G2IA 1VEBA 4QP4A 4QT1A 3MIAA 1R1VA 4L7FA 5K5RA 5L3AA 2XKFA 3NUPA 4DT9A 2CGXA 4FEWA 4S2ZA 4HGEA 3VODA 4WRSA 3R9HA 3Q5FA 3LJ1A 4ANOA 2X7FA 5JVTA 2XCKA 3FMKA 3HGKA 4EL9A 2DT5A 2IA1A 5DCMB 4BGQA 3FQSA 4WG3A 4D0WA 3D7ZA 5BVKA 3C7JA 3DB8A 1STCE 3FMJA 3BLQA 1MD0A 2BRNA 4QTEA 4MBJA 4FTRA 1Y8YA 4M3QA 4C36A 1BC7C 5LVPA 4JQEA 5DR9A 1C0WA 5BUJA 3SGCA 1KE9A 4LB6B 2GQRA 2AYPA 3DQVC 2VX3A 4KS7A 2FRHA 1TW3A 3DBQA 2W17A 4LGHA 4M0ZA 1U2WA 5B2LA 5BPDA 4BQAA 3UPZA 1OKYA 4BCOA 3HRSA 1ZREA 3DOGA 4Q9ZA 1LP4A 4UALA 3R60A 2GA2A 2YZAA 5J8IA 3TOAA 5IF1A 3DPLC 3LQ3A 2K86A 1OUYA 4KS8A 5EM8A 1WBTA 3DKWA 3T3VA 2W1GA 3I54A 2VC0A 3MTLA 4QWQA 1QZZA 2BKKA 4QP2A 3KRXA 1XBBA 4F64A 2XIRA 3WIGA 4YJSA 2F7EE 3S0OA 3KULB 1YYVA 3AG9A 5CVIA 1G8AA 4E4LA 4HZSA 3UQCA 1YI6A 2ITWA 2KJCA 3QA0A 3PE1A 1H08A 1YI3A 4MQ9F 5L2TA 1YIOA 3T0YA 1G3YA 4Z7HA 4NFMA 5FLFA 2QURA 2BKZA 4C8BA 1K78A 1OMIA 4BRXA 4Q9SA 1QO0D 2G2FA 3EDPA 2V1UA 4BZNA 4JOAA 3PJCA 2ITQA 4L42A 5BYLA 3RTPA 4Y72A 3EIDA 5E8WA 3UVPA 4NKAA 4G3EA 5BVEA 4R7BA 2PMUA 4PMSA 4R79A 2QO7A 5L3BA 1KQ8A 2BILB 5FLXZ 3PVWA 2JTVA 4J97A 5A54A 1YS6A 5BVDA 5J8CA 3FXXA 4IXAA 1B4AA 2J50A 3UYSA 4X2NA 5D6EA 5HNBA 3ULIA 5CI7A 5BVNA 3HHHA 3Q5ZA 5KCVA 2B9IA 2WB8A 5D6FA 1CSNA 1URCA 3R30A 2GS6A 4KIPA 1I27A 2EFNA 5KMNA 5AFVA 3ZRKA 3GU4A 2UW0A 3ANRA 3WILA 1U8RA 4MXZA 3SW4A 4C0TA 4AXAA 3OG7A 1PP7U 2PVJA 3ZO4A 3P9CA 3FMQA 3R9RA 4CKRA 2XK7A 5J6XA 1YI4A 4GRBA 2BHEA 5IQFA 2ZDUA 1Z57A 1JHHA 3LFBA 1YS7A 4KWPA 2V79A 3GFJA 3AT4A 3PFIA 2C5VA 4G6OA 3VHEA 4IJ9A 1OPCA 4K77A 3F8BA 4A12A 4JJRA 5IQAA 2MA3A 4ZYDA 4M0YA 4KKGA 4J98A 5CNOA 3QWKA 4R6VA 3F2NA 1OUKA 3SXFA 4FGBA 2R5TA 4YZNA 4BHPA 4KRCA 3E6MA 5AONA 1FYMA 4D1XA 4OTHA 3MVHA 3K69A 1Z9CA 2P5LC 1SD5A 3UQGA 2R7BA 1ZXEA 4S04A 2VTSA 5AIQA 4O82A 2XJ0A 4JDIA 4A6EA 3AMYA 3GWZA 4EHVA 4EBWA 4HLYA 4G3CA 4XSXF 1LDJA 1W83A 4I92A 1YG2A 4FTTA 2X6EA 5JT2A 5JRSA 5E18F 5AP1A 4KBCA 3PRFA 1UKIA 5CU3A 3H92A 1IN6A 4JBVA 3F3VA 4A4XA 2O0YA 4RFZA 1OI9A 4FTAA 3BROA 4JG7A 4M69A 5D4RA 4OAVB 4Q4ZF 4HYSA 1JXSA 3LE6A 2XKPA 2QOOA 4FVQA 5CALA 2PHKA 2G15A 3NNWA 3IKTA 2VWYA 4UX9A 4UMQA 4AU8A 3U87A 3PFQA 2YJSA 1IASA 3AT3A 4KABA 2QKRA 4U81A 4PZJA 2NPQA 4FIIA 3R01A 1GXPA 5LMKA 3O3KA 2YACA 5JK3A 3UGCA 2VO3A 4FTJA 4DCAA 4NM0A 3SXSA 4E6AA 1YO5C 2XEYA 4BB4A 4OT5A 4C4EA 4FODA 4AWIA 4G9CA 4WNMA 1S9JA 4BTKA 1IEPA 2VU3A 3CS9A 1MUOA 1IG1A 5HE3A 3LFNA 4C02A 4MWHA 3L00A 3O6BB 2XNNA 2M87A 2OJGA 5E8XA 2R3IA 3ZUUA 4BHZA 2ITXA 4LOQA 2NS0A 2OG8A 4LFIA 5CF5A 3LAUA 1KE7A 3TO6A 4QMSA 4X2JA 4L5JA 2FEZA 4U7DA 3V7CA 4D9TA 3KXXA 3BJ6A 4ANLA 2WTKC 4ZTRA 4MGRA 1GOLA 2E9VA 1ZY5A 2XVDA 2ZV8A 2XBAA 4YJQA 1Z05A 3O2MA 3QTQA 2P3GX 2OQGA 4E73A 3E8NA 2E2BA 1ODDA 4HVDA 1J7KA 3KXHA 4RFYA 4JRVA 1BBYA 3L1SA 2BRGA 4WNKA 3TT0A 5CNNA 1NVQA 3OCSA 4O81A 3ULQB 2BDFA 3ZFYA 3W2QA 2CGUA 2LSOA 4DITA 5IUIA 3WIKA 3GEZA 4KAOA 2H94A 5AV0A 3F69A 3ELJA 3Q5IA 4X2GA 1BLXA 3NEUA 2OWBA 1G3NA 3MEXA 4EWQA 4E5BA 4WCGA 3GFWA 2IVVA 2UWMA 4UV8A 4G8XA 2NRAC 1QBJA 5HX8A 2VTQA 1OBDA 1OIUA 1HQCA 5GZ9A 1YWVA 3MYGA 1OIQA 3GQLA 4W4XA 4Y5QA 3A2CA 5LGNA 5KO1A 3CPCA 2E9NA 3BQRA 4L8MA 2YM5A 3BYSA 4KYWA 2EUFB 3UZTA 3SAYA 4B09A 5LJJA 3V7SA 4O38A 4C38A 4L9VA 4CXAA 3EQRA 3IW7A 2F9GA 3DLSA 2F49A 3I5UA 3QZIA 2C0TA 2W06A 2A61A 3A7IA 3IW8A 4K2EA 3JSPA 1R39A 1O7FA 2HXQA 2I6LA 3HA8A 2YAAA 3OY3A 3Q6UA 2PUPA 4OTWA 5HGIA 4RBLA 4RJ5A 3UP7A 3QP6A 1XSVA 4FTQA 1FVTA 4XP3A 1TBXA 1FOKA 5IUGA 4ESBA 1FLIA 3KEQA 4FV9A 3COMA 1V1KA 4CD0A 3VOEA 1LR4A 4OT6A 4F7JA 4EONA 4XLIA 4L9TA 4WKQA 3RALA 2CKOA 3DK7A 3FMMA 2REIA 3R9DA 1BIAA 4EUUA 4YHTA 3QKMA 3TO9A 1NHAA 4NU1A 3MSSA 3VBXA 1O3SA 1ZZLA 2LKPA 4QD6A 4C2VA 1QMZA 5D12A 3U6JA 4RGRA 3R0TA 5E91A 2XS0A 4EJUA 2C4GA 1WMKA 3CDHA 1FZPB 1JKKA 3LM5A 1E1VA 1EH4A 1J2XA 4AZWA 4RLKA 2XYUA 1B9MA 2BGCA 2QLUA 2K7LA 2ACXA 3V51A 4D0XA 3I6UA 5EW3A 1YLFA 3L7WA 4DG0E 5HVJA 2OU7A 1Q62A 5LGTA 4BBFA 2RFNA 1UHWA 1WBSA 4H3BA 5IKWA 1R78A 4OTIA 3F2RA 4N9HA 4EK3A 5FBNC 2QWWA 4D0PA 2DLLA 3MW1A 4QMXA 5CASA 4U79A 3AAFA 4W9XA 3PQKA 4P55A 2XIGA 5HLHA 4J99A 5BUIA 4O3MA 4DE4A 2K4JA 1KOAA 3FZ1A 1H24A 5E8UA 4HPTE 2CMWA 5KMOA 3QRJA 4D1ZA 1EH6A 1UU9A 2V62A 2IT0A 2KIMA 4I4EA 3G2FA 4O5VA 3IL2A 5TOZA 2BV6A 4CGZA 5CSXA 2QENA 3KCKA 4B99A 5I9WA 2G9XA 4NHJA 5FDXA 5E1EA 3HX4A 4TWPA 5DCMA 3PP0A 3EQIA 2E1CA 3FPQA 4I4FA 3HAMA 1IA8A 2PUUA 5ANKA 4H36A 4GS6A 3PXRA 1D8KA 4UB7A 4HPUE 5CU2A 5K0XA 5TR6A 4CYJA 2W96B 4B8XA 3C9WA 1E2XA 1E1XA 3I64A 3LFDA 4FKLA 2RIOA 5IMXA 4NJ3A 4CZUA 3IECA 4RWIA 1WBVA 3J81Z 4GFOA 2FXAA 4BYYA 4LG4A 3ZH8A 1G6NA 1U59A 3I4BA 4WBBB 4QOXA 4AFJA 4FTNA 3BY6A 3TI1A 3HKOA 1XCVA 1TQIA 4CFFA 5HIDA 1R0EA 3DNEA 3KN6A 3PLAE 4AQCA 3QZGA 2YCQA 1JBPE 4AT5A 4B8MA 4MHGA 3S1HA 4I94A 5E8VA 3QRIA 4AVPA 3RK7A 4O7LA 2O3PA 1S9IA 5AR3A 1YHWA 4C35A 5M57A 3M9AA 3QXOA 5TJJA 4AIJA 1J91A 4CMUA 3OEZA 2WGJA 2KJBA 5HX6A 4O7WA 3OVVA 3W2RA 5LEKA 5ANEA 4AGDA 4EK5A 2GAUA 1ZYCA 2VBXA 2C6IA 2RVCA 4GYIA 3F3TA 3FLQA 5I9ZA 4HF0A 4BFMA 2ZFWA 4I20A 2XKDA 5CAQA 5HLPA 3VF9A 1B59A 1P6RA 2OQRA 3RJCA 3KVXA 5D8LB 3SOCA 2XAQA 4IWQA 2ETRA 4YLLA 5EG3A 2JD5A 3BGZA 5AM7A 4CSVA 3MB7A 3UIBA 5DN3A 4Y73A 5FXRA 3F22A 2R0IA 2CJMA 4L0ZB 1RI7A 2RKHA 2PLYA 5LQFA 4O2PA 3LFQA 1KOBA 1S3JA 3FMRA 3BU5A 4OBPA 4HAMA 1H01A 1JSVA 4YO4A 1P2FA 4F9BA 3CO7C 5IA1A 1CF7B 4TYHB 3F2AA 4M67A 4FOBA 4S31A 5CTPA 4BKYA 4D2VA 4GO1A 1YVJA 2RDPA 3D5XA 1IXRC 2ETKA 2FBHA 3E6BA 3FM5A 3EN6A 4UMTA 3UODA 4EM2A 1OL6A 5L6OA 1PKGA 4IJPA 4FG8A 2J90A 2C68A 2CLQA 4EZ3A 4EM1A 2UW4A 4O83A 2VE9A 4MNFA 1BL7A 2J51A 4KIFA 4FTMA 2FOKA 4ALWA 3BRBA 1WAKA 3ZQ7A 4XV9A 2QI8A 3UQFA 4IZ5A 2DPDA 3F21A 4C59A 5JHUA 3DS6A 4G17A 3V8SA 3E63A 3F3UA 1B39A 2P5VA 4OTPA 3V01A 3BE9A 1FGKA 1G3SA 3QU0A 3GB2A 1UCRA 2GXGA 4WUAA 3C4XA 4O91A 2YWVA 4FK6A 3GX4X 2XUBA 2AUHA 3R1NA 1R23A 3DAKA 3GZ5A 1R1TA 1Y91A 3ZDIA 4PL3A 3N51A 3VBQA 4DTKA 3Q3BA 4L3PA 3TTJA 4I0TA 2GDOA 4JQ8A 2HOEA 2PVYA 3RKYA 5HVQC 4NUSA 4BI1A 3UBDA 3VS0A 3MBLA 4NM5A 1A9UA 4CFXA 5JQ5A 4QMUA 4YJPA 4FUYA 2IZTA 3QX2A 4BC6A 4HX8A 2R3MA 4IX4A 3KLOA 2PQ8A 2XF0A 2VWWA 2X6DA 1P4XA 1D3YA 3IC7A 2QVSE 4DLIA 3SXRA 3G9LX 1IAWA 4AS0A 5L3GA 2JZYA 4L45A 5CU4A 4Z16A 4M71A 3FZSA 3I1AA 4MF1A 3DBEA 1CDKA 4U97A 3UC3A 4NIFA 3NNXA 3BWJA 4ZS0A 4EOOA 1W8CA 4AN2A 4IF4A 3OD6X 3FC2A 4TPTA 1T39A 2PK9A 4RFMA 5EHOA 4HDUA 3BIZA 3ZFMA 3DKGA 5IEXA 5FWKK 5L6PA 3MFUA 2QNJA 3M1EA 1R7JA 5DWRA 1XH7A 2VODA 4YFKF 2XJ2A 3F6VA 4X3FB 2BRMA 4AX8A 4H1MA 4RRVA 4WSQA 1H1SA 4ZP5A 5GJDA 3LA3A 5FFZA 5AP6A 4N70A 3QAME 3H3CA 5FM3A 3IWZA 2PL0A 4U7ZA 4TV7A 3KLNA 5AIKA 3T8RA 1Z91A 4JQ7A 4O6EA 5J9LA 3ZFXA 4RB1A 2JDOA 2QU6A 5IQIA 3C0IA 2HCKA 1I6XA 4G5JA 1USSA 3FEGA 4C37A 3A8XA 2ITTA 1BI3A 5E1SA 1BI0A 4RIXB 5E8IA 1ZG3A 3PXZA 1TQPA 2P4WA 4BZDA 3MZHA 4O1OA 2HXLA 3DFAA 2LF8A 5H8BA 2Z7RA 5KZIA 3LAPA 4A7CA 4JT3A 3SKCA 4KN7X 3O96A 3NW5A 4FX4A 3LFCA 3LKMA 4UWYA 3E8EA 4BDJA 2FE3A 2WOUA 3WZKA 4CEGA 1FMKA 4IQ6A 2CNVA 3GI3A 3TOBA 5AUUA 3FXUA 2D1HA 1UNHA 4KBAA 2E7WA 2QOHA 2CKQA 4F7SA 4FSUA 4TL0A 3ZEWA 3I0QA 3EQLF 2ZMDA 4IH8A 4ZYGA 2YPRA 3VS5A 4WT6A 2P2IA 4KIQA 3L9PA 1REPC 4MXXA 1SNUA 2Y48A 3AD6A 2CW0F 3I79A 3F82A 2R2PA 4C3PA 2J6MA 5EW9A 5DUIA 2R3KA 2ZM3A 4M68A 4W8EA 4YJOA 2J9MA 4A9YA 5L4QA 3LXPA 3DEUA 4AAAA 4YPDA 4PTCA 1O3TA 4LOPA 2DO7A 3L9FA 3RI1A 1XDSA 1UKHA 2VGOA 4BCKA 3QQUA 3JXWA 4YSMA 4YSJA 3ZEPA 5AJQA 4O7ZA 4GJ2A 4IZAA 2XAFA 2BZIB 3EL8A 4LM5A 3MVMA 2V1XA 3IOKA 4FC0A 4PPBA 5EEGA 4H0EA 4FKRA 2E7XA 4DNCA 2XRUA 3NRVA 1Z6TA 2R3JA 4L68A 3W8LA 4GU6A 2PTKA 3FXZA 3K5VA 1PXNA 4N0SA 3E5QA 1SFXA 1ZYRF 1TQMA 4OBOA 3WGIA 3C0HA 4FBXA 1XGSA 2FVDA 4GKHA 4O7NA 3DP7A 5E4HA 4NFNA 3VUIA 3L09A 3MFKA 3EL7A 2O63A 3O7LB 3GCVA 3L2CA 3BZ6A 2X2LA 2WQMA 2JDRA 5HS8A 3DKFA 2GS2A 4ACMA 4XOZA 5HIEA 4XG9A 3WF9A 2YDKA 3COAC 3I58A 4LMNA 4MQ2A 1BI7A 4UYAA 2HZTA 3V6RA 2I40A 5HNIX 2PN6A 4IPAA 3SG9A 2YABA 5IA3A 1SNXA 2ZB0A 4FT3A 3WF6A 3BBTB 4L43A 3M8FA 1T38A 5M08A 2W99B 5F4NA 4V0GA 4EUTA 4CFUA 4IB5A 1FOTA 2OIDA 3BOQA 3F72A 1ZZ2A 2RG6A 5A4LA 4KICA 4DQ2A 4GCVA 3G3ZA 4QPMA 1Q3WA 2DQLA 4F1MA 3ZS5A 2QR7A 3P7NA 3ORMA 3OHTA 4OMZA 2CLXA 5HTCA 5LWNA 4GT5A 4R7HA 1BC8C 3IS5A 4P2KA 3MVLA 3EWHA 5C8MA 2O2UA 2A19B 4CGAA 2QO2A 1KGSA 4O86A 2W9FB 4TWOA 2WTIA 3G15A 3HRFA 4N0BA 2WXVA 4H3PA 3TDUC 1B9NA 2UUEA 5DGZA 4GSBA 2XNEA 1W5SA 2Z3YA 1FPQA 3D0EA 4IX5A 3N97A 2CSNA 3G90X 3TV4A 4O0YA 4FGRA 3A62A 4FT8A 4GW8A 4BAYA 2JDVA 4RSSA 2XKEA 4OUCA 2HQRA 4F99A 1STZA 3U4UA 3KN5A 2Y0AA 2FSOX 5EHYA 2YIYA 2P0CA 4FV5A 3WARA 3LLAA 3HUCA 3WF8A 4CQGA 4DH7A 3V7RA 3FZPA 5D5XB 2BROA 1AOYA 1OL5A 2C5OA 2C1AA 4F7NA 5ILVA 4E4MA 5FB2A 4RGUA 4NT4A 2JLDA 4FTKA 3KF4A 4QQJA 3ROCA 2QU5A 3GC0A 4FV2A 4FKGA 2OXDA 4XMOA 3VS2A 4GMYA 4AT3A 3PVGA 3GCSA 3F5XA 1XGMA 5CVJA 2HY0A 4O7TA 4BNCA 3L9MA 4OIQF 2C6TA 1SVHA 4A2UA 2HWVA 5CU6A 2CHLA 3TV7A 4RQKA 4WD5A 3PG1A 4LRKA 3Q9XA 3M8EA 4JR3A 3MH0A 3GOPA 2JPCA 1M2QA 3MVJA 4YR8A 5CX9A 4J8MA 4I93A 2P6SA 1O57A 3P5KA 5AEPA 4EVIA 2VUWA 3OCBA 4IMYA 2XAJA 4EZ5A 3AC2A 2FSMX 4DG3E 3S95A 3HRUA 3UZRA 3RVGA 2OF2A 1JKLA 4F0IA 3TG1A 4NH1A 4HQMA 1W0XC 2PVHA 1O6YA 4RB2C 5HVYA 2OJ9A 1DPRA 2BBYA 3SHEA 3OOMA 2ESMA 1IF1A 4HX4A 3FHIA 4FZ6A 2VTJA 4Q47A 2QUFA 1IAHA 3QX4A 5FD5A 3RKBA 3UMWA 2WMQA 1R36A 2A68F 1V0PA 4QP9A 1Q8UA 2PYWA 4M8TA 2PZ5A 4YJRA 2P4IA 2Z99A 5DCFA 4BCJA 3CBLA 4CO8A 3WTYC 2FYSA 2O61A 1RW8A 3UG2A 1CF7A 4TYHA 3SRVB 1OYWA 3MIYA 5D5WB 1U54B 5AP3A 3KE2A 4HJOA 5J79A 3O51A 4RS8A 3HRBA 2OA4A 1V3FA 2X39A 3FLZA 3LMIA 2JDSA 3Q96A 4GK3A 4HW0A 1LEAA 2HKXA 3TZ7A 3HTSB 4O84A 4JI9A 1JVPP 4IM2A 4B0GA 1XH9A 1KWPA 4CTBA 5JFWA 5CF6A 2VBWA 2NRUA 1KYZA 4V01A 2OK1A 4KIGA 4YTFA 5HTBA 4EZ7A 4AZSA 3DFGA 4IM3A 3CKXA 1NA7A 4R1YA 4PCQA 1JKTA 2I0YA 2Q0NA 4LMUA 2YCFA 2W1CA 4G1WA 4BBMA 3QQHA 4ZSAA 4O7VA 5JZJA 4LI5A 4JLCA 3ZN0A 5BMZA 3HV5A 3P0MA 1ZLTA 3HV4A 1J75A 4AZTA 1F9NA 3WE2A 4YC3A 3DY7A 1LEZA 2W4KA 2WTWA 2M30A 2JAMA 2OKRA 4YFXF 5BMSA 2IO6A 3KMMA 3KP4A 4A5MA 1IZ1A 5C03A 4EQQA 2CNUA 3L9LA 1QL6A 3SLSA 1HOWA 2DFIA 5EM7A 5EW8A 2WMUA 1GHCA 3NUYA 5DEYA 5D9HA 1YW7A 4JRNA 1O7LA 3HRTA 3TIZA 3PTGA 1OPJA 2CNQA 1WCCA 1Q8YA 2FQ3A 2WKMA 3QYZA 4HW7A 3IKVA 3Q04A 4AGCA 2J5PA 2UW8A 4D5HA 3OCTA 4J71A 4PX6A 3DT1A 2H6CA 5LARA 4G16A 4HA8A 4A0XA 3WE8A 3QD0A 3ITZA 5AV2A 1OB3A 2EFPA 4YBKA 4XV3A 4IACA 4DEEA 2I7QA 4MTAA 4XG8A 4ZOGA 5E8ZA 5AAGA 1W7PB 1V4RA 2I1MA 3H9OA 3T8TA 4I0BA 4ZTLA 4L18B 1ZY4A 3FYKX 2Q0OA 1XQZA 2ACJA 4CYIA 3NS9A 5H9BA 3OWJA 4N6ZA 1K6OA 1XCBA 2UVYA 1XGNA 3GFMA 1U5TC 5HVKA 3FLSA 3LVPA 4II5A 1Y0UA 3CO6C 3UG1A 3COKA 3R6SA 2QQ7A 2K4BA 5FLXK 5BPYA 5EDQA 1R22A 2GNLA 4FICA 4ZEGA 2NNNA 3ZMSA 4F9CA 2H09A 4D28A 1ZMVA 2UZDA 3CJGA 1J7UA 2W57A 1QQIA 3OWPA 3I0TA 4L00A 1ZYLA 1JKSA 4YJUA 3FLYA 2P7VB 4FNWA 4GVJA 3I71A 4LRMA 4IVAA 2I0VA 3VBVA 4QNYA 2KIUA 3C1XA 2Z9OA 2IW5A 3D0SA 3BP8A 4A9SA 4EOKA 5IQEA 2A4LA 3Q4UA 2NO3A 4L0YB 3NGAA 3R8MA 2JBPA 2W1FA 1IN4A 4U44A 1MGTA 3DPTA 3VS4A 2QOKA 4GG7A 5ANDA 1IN8A 4LUDA 4G34A 5AA8A 4XLNF 1TLHB 4EH3A 4YNEA 4LG0B 4FNYA 5DRDA 2A07F 2OBJA 2Y75A 1Q24A 3UE4A 2GNJA 3FLWA 4M7IA 3Q4TA 3FKNA 2JIUA 5F95A 3C13A 4RIWB 4ZTHA 2LAVA 3WGHA 1PY5A 3CR0A 4FZFB 3RPQA 4JXFA 3KVWA 4J1RA 3QXPA 1UHMA 2UXXA 3T1BA 2W05A 3FMSA 3ALOA 1DDNA 4FR4A 3RAKA 5FTOA 4UBAA 4R77A 1UWHA 2GNIA 2CPKE 4DFYA 4I5HA 4WG4A 3PXKA 2IZSA 2RL5A 1FBSA 3RCJA 5ANGA 5BQ0A 2R3GA 4QTDA 3RYRA 3V5LA 3PZHA 1XR1A 3TNIA 5E8TA 5HOOA 2VV9A 2VT2A 4ZJIA 2YCSA 4TNBA 5A46A 4IZYA 5CSWA 3ZP5A 4H3QA 1KYWA 4CRSA 2ZCWA 2ZJWA 2CCHA 5HNGA 2LDUA 1PXJA 4V05A 2OLCA 2CN5A 3C1DA 3PA4A 5KMJA 5KZ0A 5I9XA 4EJOA 3ZONA 5HQ0A 1OKZA 4YZCA 3RWPA 3M11A 3ZSIA 3LJ0A 5EK7A 5J7BA 4RMZA 2MLGA 4NWMA 3HVCA 3ODZX 3IHUA 2EB3A 2PMHA 4XUFA 4A0ZA 2G7UA 2Y4IC 4YTCA 1OL1A 2BZHB 4BCHA 2B9JA 5CVVA 1HKQA 2OIQA 3QUEA 3CP9A 5IDPA 4OTGA 4M9XA 5HG9A 4OTDA 4G6QA 3W1FA 4IBMA 2VNYA 4L7SA 3DFCB 3H0ZA 3CUQB 4L3JA 3PJ8A 2P6TA 4IJAA 3OOGA 5A4QA 3NYXA 5CENA 5HD4A 3QCSA 5BX0A 2ITOA 3HYIA 4Y95A 2C3IB 4X0MA 2HAKA 4I23A 1U5QA 4KMFA 4ZJVA 4ENXA 1VR2A 2ADUA 2OZAB 4RA5A 3DKOA 4FT7A 1YDRE 5HBHA 5KBQA 2ZMEB 4YHJA 3BHHA 4O21A 2QLZA 1PKDA 3OWKA 4EGZA 3P86A 5D8KB 3LCTA 5EQPA 3F8CA 3K3JA 2DYLA 1XH4A 4YC8A 2VTAA 2A69F 2XB7A 1UV5A 3NX8A 3NUNA 2O03A 4P4CA 4JNWA 3R7UA 4IWOA 4HOKA 3W2PA 4RA4A 2XYNA 5AIPA 5DDGA 5EKOA 4H39A 2R3SA 4NCTC 1HSTA 3ZOSA 2CDZA 4BCGA 4JL9A 2EV5A 1HKTA 3KMUA 4JG8A 4WNOA 2C1BA 4XX9A 1DI8A 2WNTA 2X8DA 3D15A 1BJAA 1SVGA 2ERZE 4C4IA 4DCEA 3DDPA 4IM0A 1OPKA 5ETIA 3NUXA 3F3ZA 4ACHA 2HK5A 5GJFA 1F5QA 2JT1A 3NYVA 4K0YA 4RC4A 3C3WA 4O96A 3R4KA 4RGXA 3JPVA 3CCNA 5ANOA 3OXZA 1PXIA 4K18A 2ZNYA 4ANMA 3DJ6A 1I44A 3DAJA 3LMGA 4MNEB 3FSKA 3LA7A 3H0YA 3BYMA 4FVPA 3QRUA 3O2PE 5JEBA 1H26A 3R2YA 1KE6A 1UB9A 4NW6A 2F5EA 5KHWA 3MJ1A 4R1HA 3UOLA 4FV0A 4IAYA 2RGPA 3HMPA 5LHHA 3MGYA 2W1HA 1FP2A 3E88A 3UTOA 4AOTA 3PYYA 4AUAA 4EJTA 2XBJA 4CZZA 3GGFA 1DM2A 1GIHA 4ANBA 3NPCA 3MA3A 4KRDA 2R3OA 1H0VA 2RKUA 3MFTA 1SD6A 5FFXA 3NW6A 4AT4A 2B9FA 4ONAA 3VQHA 3V04A 3MESA 3EN4A 4KNBA 4N9IA 4XG6A 2IW8A 4DH8A 4NW5A 3VS3A 3UP2A 3QGWA 4CVAA 1XB4A 3DBCA 4B4LA 1BM9A 1VJYA 2WQBA 3KP3A 4RC3A 5HOAA 4M84A 5JH6A 3LQ8A 3GVAA 4CYDA 4AIKA 4BDEA 2GWRA 2BE5F 4KINA 3QHRA 4YLKA 1H1QA 3Q4ZA 5EM5A 5HS7A 1PMNA 5K4JA 4KT5C 4ASZA 5G6VA 2J0JA 5ETCA 5H20A 5HO7A 5J9ZA 4A9RA 1GIIA 1JSUA 2EWAA 5D41A 1TVOA 4AZEA 3HOSA 2PY3A 2H6BA 3EH9A 3EUHA 5FDPA 4YP8A 3QRKA 4DT8A 3UNKA 2QC6A 3PA5A 1H1PA 3Q9YA 5EDPA 1OECA 4EOIA 3O7LD 4HNFA 4FK3A 3HP2A 2YA9A 3JY9A 5DD4A 2HY81 4LLLA 3FMNA 4BGGA 2PI0A 4FSWA 3W2CA 3SRVA 3I7CA 2OFVA 3LCOA 5L8JA 4FSQA 3PUPA 4C33A 1U5TA 2OW3A 5EQYA 3ISPA 3P4KA 2J4ZA 4ENMA 2C6YA 4R1VA 3TACA 1ZH5A 5LVLA 1W4MA 5E92A 4O7RA 2ETMA 1MZBA 3E5AA 5ED4A 1JLUE 2HTSA 1CKPA 4OIPF 3E3PA 2YERA 5GIOE 4FYNA 5J5TA 2A6EF 3ZM9A 5LHGA 2JIIA 3N4UA 2EVAA 3Q2MA 3RJPA 2X8IA 1DAYA 3EB0A 2PU8A 2W1IA 4ANQA 3VBYA 4FA2A 3SDJA 3T5XA 1GZOA 3W2OA 4BCIA 2EJRA 3F8NA 3LXNA 3BHUA 5H8EA 4HGTA 2ITPA 2IP2A 1OVEA 3ZUVA 3NVMB 1YKRA 3EFWA 2BZKB 2OXYA 3QGYA 3QHWA 3K54A 4YNOA 4W4WA 2BTRA 4LGGA 5F9EA 3HECA 4IVCA 1XBAA 1T45A 4JDJA 1USTA 1FGIA 5T68A 1YW9A 3P78A 2PE0A 4HLXA 1K3AA 3VRYA 2VZ6A 4MBIA 1YDSE 3FJQE 3A7GA 3F6OA 5CXZA 4M13A 1Z7UA 2YN8A 2UW6A 3BEAA 2G2HA 2VTHA 5LVOA 2ZV9A 4Q5SF 3I81A 3W55A 4BN1A 3G33A 4O0XA 5C01A 4ZTSA 1FYLA 2CGVA 3KXNA 2PVNA 2LNBA 2C69A 5F1ZA 3B8QA 2EA4A 1H1RA 3ALNA 4PNKA 3GP0A 4UMUA 5DG5A 3HTUA 4X6RA 4EJ7A 3FWEA 4EBVA 4FEXA 5HTIA 3E87A 3CJFA 5L2QA 2HFHA 5FG8A 2VO6A 5HCZA 1Y8GA 1CGPA 4D9UA 5IPJA 4JS8A 5E20A 3NQOA 5GZAA 1W7PA 2CKPA 3AGMA 4P5OA 4AA4A 3H3ZA 3EQDA 3BJAA 3HUGA 3S3IA 4RWLA 2GXBA 3MN3A 5FTGA 3GYHX 3W33A 3HSFA 3KRRA 4E5WA 3MPMA 3ECOA 4IW0A 3U55A 4QMPA 4QO9A 4U7BA 1P2AA 4J96A 3NYNA 1PJKA 2DS1A 1Y6AA 4BZOA 3IW6A 4D4SA 4GJ3A 1PXOA 3AD4A 4QMQA 6PAXA 4FL1A 2XRNA 4EI4A 3A7JA 5AV1A 4XCUA 3NNVA 4W8DA 4ASXA 1ND4A 4F7LA 1QPJA 4FEVA 3VF8A 2AS5F 5D11A 1PMUA 3RTRA 4NL0A 1PXPA 3DAEA 2XNOA 2V7AA 5LOHA 2RF9A 5HDNA 2V55A 4DF3A 1P4OA 3UJGA 3ZCLA 4E4XA 3FUPA 4JX3A 2B7AA 4UNOA 4FV3A 2GSFA 4YJNA 1KQ9A 4DEDA 1YOJA 4ZK5A 3LA2A 4DA5A 2PVFA 3OFMA 5BVFA 3A8WA 2WTJA 4MD8E 2GHMA 2R3PA 4TXCA 5F20A 4C2WA 4LG0A 5IQGA 3FI2A 3LFKA 3LQRA 3RZFA 5KKRB 4UY9A 5CI6A 2RFSA 5C27A 4ESJA 3EFLA 4FTCA 4WK8F 1H00A 4D2PA 2YM6A 3V5WA 4BBEA 2YSRA 2B53A 4ITHA 2JRTA 3WTWC 3D5LA 3BLRA 4F1OA 1ZOGA 2YITA 4NCTA 3ZZEA 4JVGA 3E62A 2C5NA 3CC6A 3MFSA 1FNNA 1UU8A 4AZFA 4G6LA 1ATPE 2HTJA 4NJDA 4P9UA 3V8TA 3FM3A 3Q53A 3KFAA 1GJOA 3R7VA 1IN5A 5F64A 3K0LA 2ESHA 4I2OA 4QYEA 3GT8A 3GC7A 3A4PA 5AP5A 3VVHA 2CYYA 5H6RA 5IH4A 4UXQA 5TE0A 2UW9A 4KN4X 3UIMA 4ZMEA 3WG9A 2WC2A 4WNPA 3REPA 5EQEA 2QOIA 1HKSA 4ZSLA 3RZBA 3NRMA 3TN8A 3OOPA 5IA0A 4IAFA 4TYIA 4NZWB 2EFOA 1YXTA 4M66A 5LCKA 5A2QZ 5JSMA 2GHLA 3D7TB 4OTFA 5CVHA 4U0VA 3T8OA 4QMWA 3UNJA 4WXHA 3E3BX 2RQPA 5C8KA 3V5QA 5JZNA 4PMPA 3IDCA 3TZ8A 1UNLA 4U45A 3SOAA 3TKHA 3JS2A 3LWFA 5HDKA 4Y5HA 2DK8A 4M9ZA 3TJCA 1UWJA 4ITJA 3MY0A 1RJBA 4UWBA 5B2MA 2W5AA 4ZLZA 2C47A 4Y15A 3CUQA 4PPAA 4XG4A 3B02A 3QZHA 5ETFA 3KZZA 1P5EA 4BHCA 1R3CA 4MAOA 4EJVA 4CCUA 4YHFA 5HO6A 3EQGA 2QODA 3CXWA 1W7PD 3ZC6A 1H0MA 4XSZF 3MY5A 4EEVA 4BY9E 3IGGA 2OZAA 2SRCA 2ZMEA 2W5BA 3BX5A 4QP3A 5DD8A 4RZVA 3SG8A 1CKJA 2KULA 1QPMA 1MRVA 4F6WA 4L44A 4F6SA 4FV1A 2F5CA 5IISA 1FSHA 5AUWA 5JFXA 4MH7A 1TTYA 4U3ZA 4A07A 5BNJA 3P23A 4E1ZA 3WF7A 3HAVA 1Z9XA 3PQJA 1XJDA 1HW5A 3FF5A 2PE2A 4FV4A 1URWA 4EOLA 3A7FA 5A14A 1YW8A 2VTTA 2Y0MA 1CTPE 2PMOX 3UMXA 5AR7A 5CY3A 3N4MA 5HLIA 4Z55A 2PVMA 3R1YA 3TCPA 2J0LA 2VBYA 3OW4A 4GG5A 5AADA 5J5SA 1MJBA 4JBPA 3D4QA 3GXLA 3RKWA 5JRQA 3KP5A 1J9IA 3BBWA 3ELKA 3TKIA 4Z7GA 4LD5A 2BFYA 2OAZA 2X9FA 4Z9LA 4BGHA 2D1VA 1QCFA 4ALVA 4APPA 4QMMA 4LOOA 2KTYA 4RZWA 3WU1B 3IO7A 3FBVA 2XH5A 2P2HA 1MRYA 2GNFA 1R0PA 2P33A 3HV7A 3R1SA 4EYMA 3NAXA 2WTEA 5IMEA 3VC4A 5ILSA 2UV2A 2X0LA 2VX1A 3FPMA 4IANA 4FTUA 4M9SA 2XHKA 4M97A 3AT2A 4IAZA 5A6NA 3PE2A 2JIVA 5I9UA 5DHJA 5IT9Z 4G6NA 2L54A 4I01A 4C61A 3ORZA 2WMTA 4FIEA 5H3QA 3WODF 4C4JA 2FNPA 3U6HA 2QD9A 3U9GA 4PTEA 2YISA 4EKKA 4I5MA 4YMJA 1P4WA 4B9DA 2DPUA 5EEHA 3CQUA 5ACBC 3IPHA 1BKXA 4P90A 2BAKA 2ISYA 2C3LA 3VUGA 4PDKA 4PMTA 4AN3A 4EKLA 3CPBA 2P7CB 1REKA 5EKNA 4FNXA 4U0YA 4OINF 1MQBA 2K02A 4KKHA 4QYFA 5LEJA 2X2MA 1K2PA 3D5UA 2VE8A 3ATSA 3ZXZA 4BCNA 1F1ZA 2MBFA 3TZ9A 3FHRA 2QHNA 1MKMA 4QTCA 2BZJA 4S32A 4JBQA 3QTZA 1B6AA 3NAYA 2UW7A 2I0HA 1WFCA 3ZU7A 3ZSGA 4HVHA 1W7HA 3M2WA 3QD3A 3KFWX 3WGGA 2R64A 4UWCA 1P92A 5AUTA 3KU2A 4NYEA 2Q8KA 4PV0A 3WTZA 2W1ZA 2A27A 4O27B 2CWEA 4RIYA 3PXFA 4BDIA 3KQ7A 3OBGA 4XLPF 2ZO4A 4XRJA 4I6FA 1JWHA 1U46A 3VN9A 4BCMA 4BDCA 3VUMA 5HD7A 1J0RA 4GU9A 2B4SB 4HVIA 3F61A 3PY3A 4B7TA 4UMPA 2HGCA 3OC1A 3P9KA 4CKIA 4EOPA 4QPAA 2B0LA 2HZ4A 3ET7A 4GXOA 2WO6A 3DTCA 2WAJA 2WOTA 5CZHA 3IOPA 4E6CA 2UZLA 4M72A 3NDMA 5LCJA 2JEDA 4S34A 1MJ9A 3REOA 4RJ8A 5KMMA 4ZTQA 2CSOA 2BEOA 5DRBA 2EB2A 2WMSA 2R7FA 1YWNA 4I6HA 3DXQA 4PQNA 3EKNA 3O71A 5HG5A 3PIZA 3I0OA 4DGGA 3QCXA 2V1DA 2X2KA 3ACJA 5IQDA 5M56A 4GGGA 3NMUF 1LUFA 5D1JA 3GC9A 4O6JA 3F3XA 3WOWA 3C7QA 5I4NA 3WE3A 5LHIA 5DT3A 1MDMB 3ZO3A 4TRLA 3NLBA 4D4RA 1XN7A 1YQJA 5D7VA 3K9TA 4CQEA 2R3FA 2C6LA 4AW5A 3ORIA 1H1WA 5JFRA 2HZIA 4U6RA 1I1SA 2VRXA 2IJLA 4FT0A 4RT7A 1TW2A 5AV3A 4YIFA 1JOWB 4AA0A 4O7YA 4GVAA 2ONLA 3NNUA 2PG4A 3QU6A 2IPQX 2C30A 2QQ9A 3OUNB 3VQUA 4I0SA 2W1EA 3TQNA 3EMGA 4F7ZA 3OT3A 3FI4A 4FIFA 4TW9A 2FH9A 3DKCA 5KVRA 3FKLA 3RNYA 2XP2A 4NM3A 3TL8A 3R02A 4ZZMA 1ZN2A 4FL2A 4CKJA 2O5KA 5HG8A 3R22A 1O6KA 2XIKA 3LM0A 5JMSA 3ORPA 2R7IA 4XLVA 4BDBA 4PP9A 4Z2YA 5ETAA 4LLGF 4O7SA 1J59A 5H6QA 1EV7A 1QPEA 3L8SA 4O0WA 1OKRA 2OBPA 3S2WA 3RHKA 3TWJA 3SV0A 3BCEA 4QQCA 3ZSHA 2Y8OA 1KE8A 1FQ1B 4LV8A 1ZOHA 2BDWA 3KK8A 2A6HF 3R0JA 3NUSA 2WEIA 3U2RA 2CFXA 5M07A 2XK6A 3DA6A 3ZPLA 3SX9A 3PIYA 4QMLA 4EH6A 4E7WA 2E9OA 4HVGA 4O1PA 2NRYA 4PTGA 2O8XA 2OF4A 4PDOA 4ESFA 5ANIA 2UZNA 3RBWA 4G9YA 5EDRA 4P9FA 3P79A 2OO8X 2GQQA 5HCYA 3VULA 4TKSA 3UVQA 4C4GA 2QKWB 3D5VA 3QLGA 2IA2A 5EHLA 3ZMDA 4D2WA 3B8RA 1R1UA 3DZOA 3DQXA 5KMIA 2VOPA 2P55A 1U78A 4IHSA 1YXSA 2WD1A 3V8LA 4RLLA 4CTCA 5F1RA 1HCLA 3D5WA 1HBXG 3QTXA 2QR8A 2JKMA 3BZ3A 2YFXA 4UEUA 1PMEA 4L6QA 4WBOA 2IJMA 1RUOA 1AGWA 2HIWA 3KCFA 3D2KA 2ITYA 4ZMFA 3W6JB 2ZM4A 1KU3A 5EI2A 5HI2A 5TRDA 3O23A 4D5KA 2VWZA 4CLJA 3RNIA 2XIZA 3OUKA 5LRRA 1FMOE 3H9RA 2ESNA 3OEFX 4HF2A 4AOJA 5DI1A 5ACKA 3G9NA 1T6SA 2ZM1A 3BPXA 4ZYEA 2GTNA 3ORLA 2PEXA 3KEOA 2UW3A 3RGFA 3WF5A 4O6LA 5CZIA 1KA8A 1FVVA 1LEBA 4IX3A 1NW1A 3HSEA 3TXOA 3CTQA 3VHKA 3HA6A 4DAWA 3UO6A 3EFJA 1ZYSA 1OYIA 3V5PA 2YR2A 3C18A 2NNWB 2BCJA 4JIAA 2VO7A 4BDFA 1QGPA 2J5FA 3FXWA 5BVWA 1S7AA 4E5AX 1XH8A 1RDQE 4ENNA 3TDVA 3QP5A 3I59B 3KCCA 4GH2A 4YZDA 4U8ZA 2EB7A 1B1BA 5IDNA 1ZLKA 3IW4A 2PMIA 3KP7A 2IZUA 1L3LA 1XDUA 3CKWA 1SZMA 3DPKA 4YO6A 4FL3A 3T9IA 2BHHA 1JQHA 4I09A 4XRFA 2IVMA 5EOBA 3BPVA 1O6LA 2HW6A 1SMTA 3KULA 1PHKA 3IONA 2EFQA 2M5WA 1OBGA 4UV0A 3FL4A 4ZJJA 2YM4A 3GEQA 5IQHA 1OR7A 3W10A 4FX0A 3D7TA 2ZJ2A 4L3LA 5FM2A 4IVBA 1PYXA 4OAUC 3N4VA 2W4JA 3K1NA 1WQ2A 5E1WA 3HDMA 2X8EA 3UZPA 3TZMA 3SQNA 4XEYA 4ANSA 2Q2EA 4ZZDA 4TYGA 2UW5A 4BWXA 3NR9A 4EC8A 2STTA 3RMFA 1DS5A 4MEYF 4QLCU 2K27A 4EGYA 5FD2A 4NK9A 3QCYA 4DFLA 3QKLA 1IR3A 1IN7A 1JE8A 5EFQA 3DXPA 4FEUA 3LW0A 4X2FA 2F7XE 2XGXA 4FZ7A 5BPIA 5IUHA 2BALA 3E97A 1PF8A 3DDQA 2VC1A 4BCFA 4ACCA 3J80Z 4YG2F 2Z2WA 3FZVA 4CCBA 2HR3A 3QLFA 4IADA 1I09A 2RGVA 4GUEA 1CMKE 5BOXA 4EJNA 3FL5A 4EH5A 3E5UA 3P08A 4XV2A 4A9UA 2B1PA 2JDTA 3PWYA 3GCQA 2HELA 3PXYA 1CKIA 3UO5A 5DMZA 5L3CA 4M15A 4XG2A 2PMNX 4G7OF 2VTPA 2KRFA 3V4GA 2VTMA 3ORXA 5AWMA 3MH2A 1R00A 5TKDA 4HF1A 4F0FA 4DGLC 5EYKA 3THBA 3PPJA 3FZTA 1KU7A 4JAJA 3RCDA 3H30A 3KB7A 2PE1A 4KSQA 4LL5A 4LUEA 5KE0A 3LCSA 1XD7A 2XCHA 3ORKA 5DYJA 1H07A 5FXQA 4IHTA 1FSEA 1M52A 4E6QA 3FHZA 3QC4A 4YIIA 1FINA 2R4BA 5CSHA 3C4ZA 3WBLA 4G7ZF 4FZAB 5IG1A 2XK3A 2JKQA 4DH1A 3Q6WA 2JFMA 3DXNA 4XH6A 2VWUA 4JAIA 1S7OA 4QYGA 4C62A 3II5A 3NWWA 5M4IA 4MQVA 3NUAA 3F5UA 2MH9A 1EH7A 4E26A 2J5EA 2WEVA 1MQ4A 4FIJA 2WU6A 1YHVA 5DT0A 1DI9A 5LXMA 3UO4A 4L9IA 1UFMA 3DU8A 4TYEA 4OOIA 2RV8A 2XKOA 2X81A 1OITA 1EH8A 4ENKA 1IAJA 3BV2A 3JW4A 3PY0A 4FZDB 3WZEA 4R3RA 2B0QA 2X0GA 3ZMTA 3CY2A 5AUYA 2IWIA 4R3CA 3NVKI 2CN8A 1YOLA 4H1JA 4LLNA 4BDAA 2MD5A 3DBDA 3HZTA 2DW4A 3IK3A 3IW5A 4GUBA 3A99A 2CO5A 3OY1A 5E1ZB 2BVAA 4JBOA 2FBKA 2J2IB 3UIUA 4HX7A 2X4HA 4TNDA 2JPBA 3U6IA 2C6MA 4PWNA 3AQVA 4IRGA 5HLGA 2UVXA 3ML6A 2WTVA 3F66A 1G3TA 4ZSJA 4OLIA 1SD4A 1A48A 3E5XA 3GFLA 4FI1A 2WMWA 4RVTA 2VTNA 2J0KA 5JFSA 3BLHA 4FTOA 5ICEA 4RX7A 2QOFA 5JGAA 5CVUA 2WTCA 1XBCA 1X8BA 4EH2A 3AC5A 3LFSA 5BYYA 1LDDA 3TKYA 3U51A 1GVJA 1Q99A 1R58A 1MRUA 4XRLA 2XROA 1OIYA 4RJ6A 5AR5A 2BIYA 2IN6A 3PVBA 3GCUA 4K6ZA 2YEXA 4QMNA 1VYZA 4TY1A 2J0MB 1TNSA 4RX9A 4HV5A 4MEDA 4KKEA 5CYIA 3BU6A 2CGWA 3ABTA 1ON1A 1FBNA 2XEZA 4A6DA 1H9TA 3JVSA 4V04A 1L8TA 4NQWA 1S29A 1UU7A 2UVZA 4WF2A 4UMRA 3QWJA 2C5XA 3FQEA 4AACA 3SD0A 3ZMVA 2PWLA 1BOAA 3WTXC 1IW7F 4L9JA 4G3FA 4ZZLA 3ZMMA 5J87A 2BAJA 3CTAA 3TKUA 4QTAA 3PZEA 4C4HA 5M06A 2BUJA 1ZGJA 2YAKA 4K8AA 1K9AA 3PDTA 3U1DA 4ERWA 3FWQA 3CD3A 5TT7A 5A6OA 4AW1A 3GFIA 3CLOA 2XK4A 3KMWA 5CEPA 3P9JA 3UDBA 3E6CC 4DTAA 1MDMA 4NSTA 3RP9A 5K1YA 2PPQA 4LQMA 5ANJA 1QPCA 3I4PA 4EK4A 4DBNA 4IZ7A 4FIHA 1XH5A 1BI2A 3LLTA 2HEOA 3ZRLA 2M8EA 3KZYA 4R8QA 2C6EA 4CRLA 3F8MA 3CGOA 1OL7A 4JG6A 2QOQA 2NAZA 4CV9A 4GKIA 2EXEA 2WTKB 4X3FC 1YFHA 2BPMA 4FV8A 1UU3A 3PG3A 2B52A 3IDPA 2EV6A 1XSXA 4F9WA 4CDGA 5AX9A 3G51A 5CF4A 3V6SA 5DV5A 5FP6A 3VO3A 4HV6A 2PZPA 2XIXA 3OZ6A 3TDWA 5HLWA 2RSVA 4TN6A 3LXKA 1XH6A 2YX7A 3QTIA 5EI8A 4F09A 1SMHA 3K1MA 4PNIA 2F2CB 1Z1DA 2PVRA 3CJNA 4Y17A 5CEKA 3PJ2A 1KU2A 3MS9A 4DEGA 3ORTA 4RVLA 3H3UA 3NUUA 1GAGA 3PSBA 3TNWA 1RQQA 4OGRA 3HMNA 3MTFA 1F5TA 4I0AA 1SFEA 4WX9A 5M44A 1V0BA 3FC1X 2QCSA 4RIOA 5HBJA 4XBFA 5KBRA 2WTDA 4UUVA 4M73A 2W5HA 5L8LA 5AIRA 3ZMZA 4NIFB 2LF7A 1J3HA 1U5RA 4DFZE 1F4KA 3ZC5A 3EOCA 3PLSA 1FVRA
chains in the Genus database with same CATH superfamily
4CHUA 1ZR4A 4FSNA 3FI3A 2GNHA 1KQ0A 2DUVA 3W18A 4XRMA 2XAHA 4MK0A 5HG7A 5J95A 3LZBA 4I3ZA 3Q2JA 2WA0A 2XF6A 3DXJF 2HYGD 2QOLA 1UELB 3CSVA 3GTJJ 4XBUA 1CM8A 3R2BA 1IG7A 4AZVA 4GV1A 3GW2A 2VN2A 3SEQA 2LKXA 3ABUA 4BF2A 5JFVA 4WOVA 2KHMA 3AFHA 3ORNA 3E8DA 4MD7E 1XMAA 1X58A 4KNYA 5DH3A 2XNPA 5L2WA 3CCMI 2MD0A 2C6OA 3E0JB 3RPUA 1XSDA 2VAGA 4EH7A 3ERED 2R3HA 3C51A 1GNGA 3L8PA 3WZJA 5CU0A 3ID6C 4ON0A 2UZEA 2DQ7X 3NSZA 5FO5A 3WTSC 1WRJA 1NK3P 3QQKA 2C3KA 1SYKA 1Y6BA 1M17A 3FKJA 3OF0A 3QTUA 3RK5A 5CSPA 3PPKA 5M55A 4DN5A 3CCYA 5HU3A 5E7RA 4EOJA 1QNTA 4MD9E 4RDUA 4S33A 2D2WA 2Q0BA 2K9QA 4RJ3A 3FI8A 3QQJA 5HDGA 1MMGA 1Z6RA 1XMXA 4WXCA 3U4WA 1IRXA 5IYCJ 3A7HA 2V6EA 3RPSA 2ME0A 1Q4LA 4BVUA 3G2BA 3FXQA 1X3ZB 4CT2A 1ULYA 2DT6A 3F5GA 5KNJA 4NTSA 5ICPA 1BI8A 3HP5A 3BCAA 4I6BA 2ELJA 2VJJA 2CKEA 5ICFA 1TWCJ 4QPSA 4ZDOA 1GZNA 4O22A 2IS2A 5B7VA 3S1MJ 4P5QA 1FY7A 3E7VA 5AUXA 1GV5A 2YS9A 3I3LA 3ZBFA 3ZN1A 1DAWA 3HLLA 3ERKA 3OV8A 4ZH4F 1Q41A 2WMVA 3I59A 1VQ7I 2BFXA 3ZQCA 2BY1A 1HCKA 5L3DA 3GO5A 4DLJA 2W48A 1OIRA 4EH8A 3R63A 2CG4A 4BEHB 1WVYA 3P7AA 2A5WA 1KU9A 1QVUA 5LRSA 2UZOA 2X7GA 3DTWA 5C4XJ 1QZYA 5HKMA 3ZDUA 2OI4X 3L9NA 4J95A 2IXSA 4DDIA 3DB6A 3VWAA 2H8RA 4Y3OA 4FTLA 1Y57A 3K5UA 3OMVA 1P4FA 3MAJA 3DPUA 1JSTA 1H27A 3JY0A 5KMLA 5IA2A 2DBBA 2CQ7A 1WBPA 2IW6A 4D4YA 4C57A 3V5JA 3AMAA 1REJA 2ZB1A 3O50A 4PDPA 1W98A 4F9AA 2WFYA 4YTIA 3D5SC 5TO8A 3M1CA 3BGPA 3UYTA 5T6KA 5EI6A 3RDIA 4NB5A 3GVUA 2WY8Q 2ZOQA 5FTQA 2Y6MA 3VS6A 3RPRA 1F0QA 3H0GJ 4IEBA 4B4CA 2B55A 4BHNA 4F08A 5HU9A 3ULZA 4LL0A 1QZEA 4GIIA 1T2KA 4CZTA 3NIZA 1OZ1A 3BU3A 5KNLA 3DJ7A 4G31A 4EK8A 5CYVA 3VUKA 2FBIA 3KEXA 4ZIMA 3HNGA 3POOA 2JN6A 5IH5A 4ASDA 3EYHA 3QU3A 4XLEA 4AF3A 4U40A 1V54H 1G59A 1M2RA 3GU5A 1IRKA 2WADA 4XYFA 2HWOA 3R21A 5FGKA 2PZRA 3FMHA 5HBEA 5T3QA 3HMOA 3Q60A 3I4MJ 2AQEA 3MQ0A 2NYXA 3L8XA 3JTHA 4BDKA 3R9OA 2FSWA 3ZZWA 5HNFA 4ZSGA 2KZVA 2W1OA 5BQTA 2XMYA 2R3NA 3DNDA 4OW8A 4HCUA 3WTVC 3ACKA 3QPSA 3OL3A 4V19K 4X1EA 1M14A 2H8HA 2K9NA 4XBRA 4CYCB 1M7NA 4AM3A 4V0GB 4E3CA 3T9TA 4BDDA 4O0RA 4I22A 1H4LA 3PWDA 5HE2A 1XGOA 4U0IA 4ORKA 2X9DA 1EKEA 2O6GE 3PJ3A 2QEXI 5IA5A 3ZYAA 4JBAA 3GTQJ 1J1CA 4OMYA 1R4NB 3QRTA 2AEGA 1VYWA 2Y9QA 3EQPA 5BVOA 3S15J 4O0VA 4I5PA 3TDZC 3RPUD 2W84A 1GLNA 3GC8A 4ITIA 2IVTA 4USEA 2ZAZA 4RWJA 2FU4A 5CLPA 4YZ9A 4A4OA 3NAUA 3BHVA 1ZLJA 3MA6A 3PRIA 4PDYA 2BW3A 3PPZA 2GFSA 3NIEA 5DOSA 4BICA 3PJ1A 3CLYA 4UV9A 3U54A 2WIHA 3QRFF 2YWPA 5CF8A 4USFA 1W84A 3QD2B 3R73A 1MJAA 4H58A 3HSRA 2E9PA 4FG7A 5ERIA 4KB8A 4MHAA 4GFMA 3QUDA 4KA3A 5AUZA 3W2VA 2EPFA 2NS8A 5DVRA 4BIBA 2DMPA 3MJ2A 1BL6A 3HV3A 4NTTA 2VONA 2X4FA 3TUBA 1RE8A 3P7CA 5CJ9A 4KA4A 5J9YA 2HWPA 4S30A 2A5YB 3AL0B 4Q2AA 4IDVA 1IDYA 5BS6A 1UVRA 2EWNA 1X4PA 4DGMA 1ZELA 2HYYA 2JBOA 3BTCA 3N9XA 3ZLYA 4EK6A 5A2QK 4EHGA 2EZLA 2FNAA 5C8NA 3F7WA 2VXZA 4B8LA 4E20A 3HDNA 4U43A 2H27A 1XO2B 3FY0A 1D5VA 5HLNA 4FMQA 3B2WA 2BRHA 4MXAA 2DOFA 3BTIA 2DAOA 2RFEA 1LQ1A 1VQKI 2KRHA 4ACDA 4Y8DA 3ECHA 5K0KA 3KXGA 4IFGA 5FD6A 2VNWA 3QD4A 4ANJA 2BRBA 4PGGA 3DF8A 4X3FA 2ZKZA 5DIAA 5HIBA 4DBXA 1B8IB 1F3MC 2XF7A 4AIDA 2O65A 1J1BA 1LDKB 3ZR8X 3D9VA 1U6GA 2ZV2A 4H4KC 3PUFC 3AMBA 3VUDA 4BYJA 3BR6A 4BR3A 3LXLA 3S93A 5C26A 2BY0A 3O0GA 4C4FA 5LMBA 4IVDA 4FSRA 1SM2A 1TNTA 4L53A 2BDJA 2QSHX 1Q5KA 2A2AA 3ANQA 2XK8A 4L5IA 4OU0A 4KDPA 4LV5A 4Q5HA 2IRFG 3GFEA 4R78A 4F9YA 2VO0A 1JJ6C 4RIXA 4A3CJ 2XB0X 3FAAA 4GYGA 2UZTA 1E9HA 1FT9A 5CLSA 3WZUA 2BYVE 2PVKA 4BU2A 1X3WB 1D0ZA 3BI6A 4BBSJ 1T98A 4LK1F 4F92B 3I6WA 4I7HA 1T0FC 2OH4A 4UUSA 3NCGA 2HZDA 3FYJX 5FJ8J 2P8TA 5KHXA 3SXYA 1R49A 3MI9A 5IQBA 1P4AA 4K9YA 1D1CA 3U9CA 4OR5A 4ASEA 2PSQA 3LFAA 1O9UA 3C50A 1OL2A 4BXXJ 4A4LA 2R3LA 3HHGA 1DP7P 3MZYA 4EYJA 5FGMA 5F1JA 5EG0A 1VQ8I 5AA9A 5IA4A 4BIDA 3QOEA 4BDHA 4O2ZA 2L4AA 2XM8A 2BMCA 2JKKA 2EFWA 5AM6A 2VWIA 3OXTA 5CVFA 4DFNA 4D1SA 5GAHJ 2W7XA 3M7GA 2BIKB 1WSUA 4QP1A 2JITA 3VJNA 5B2KA 1SMYF 4N4NB 2L7MP 3SDBA 3O17A 1AKHA 4P5ZA 2FMLA 1U3EM 2W82A 4FKPA 3A2KA 5BUEA 4PPCA 4HCTA 3VFZA 3R8VA 1KV2A 1O3QA 4FE7A 1V5EA 3SZPA 4AWXB 4D5FA 3SC1A 4G5PA 4ZLOA 3RINA 1V0OA 5JHFA 3OP5A 1WKMA 1P7IA 4LFUA 5LLQA 1MBHA 4BL0B 1U4DA 5FEEA 1E3OC 2UZKA 5IT9K 1FWZA 3QCQA 3LQQA 4C7TA 4PGHA 3D94A 5HHWA 4F0GA 4IC8A 3OW3A 2A1AB 4C3HJ 3I60A 3KP6A 2WQOA 4K1BA 2VWVA 1K79A 2C0IA 4NEUA 1S8NA 2QG7A 1QHGA 4BXFA 1S6LA 1ZHFA 2JA2A 4CCJA 4HZFA 5CVRA 3G5DA 3FQHA 2X48A 3P1AA 4TWCA 4EQMA 3C4FA 4DFUA 4JX7A 4UZHA 4C2TA 3BKBA 1D8JA 4EQCA 4YURA 3GLXA 5M4CA 1NH3A 3F5PA 2Y30A 4YJVA 3KKVA 3OROA 1E3HA 2WU7A 4B6LA 2VBZA 3RKXA 4EHZA 2QLQA 3BHTA 3EN9A 3QZFA 1YOMA 3D83A 4ACGA 4ZTMA 3VJOA 5E9EA 2YLFA 5CAPA 3I5NA 2CUEA 4C2MJ 1ETXA 2Z33A 2Z02A 3GU7A 5AUVA 3G6EI 3LFUA 3A0HC 4QQTA 3V5TA 1KUTA 2L3DA 2Y4PA 4IIRA 2Y69H 4MQ1A 4W9WA 1J5YA 3ML1A 4G3DA 2R5YA 4TT7A 4FHTA 1ZWSA 4BL1A 4B1RA 4RQVA 3BC8A 1PXKA