1TQIA

Crystal structure of a. fulgidus rio2 serine protein kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
total genus 91
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqiA02
4KD1A 3DK6A 4DC2A 1P4OA 3HTSB 4CFWA 4I6FA 5J7HA 5JQ8A 1QGPA 1NVSA 2H34A 1FGKA 4H3QA 3RI1A 5D5WB 3W33A 3MTLA 3GWZA 1J1CA 4YMJA 4QMLA 1NW1A 1R00A 1DPRA 2UZDA 5HVYA 3AD6A 1S9IA 2FA2A 4GK2A 2GNGA 3IL2A 2UW7A 4EKLA 1QL6A 5D1JA 3GFEA 4N6YA 4FT8A 3QRIA 4Y17A 3R7GA 5HBHA 3LFKA 4JRNA 4JX7A 5AFVA 3UC4A 2PG4A 5FFZA 3NW7A 4FI1A 5KK1A 4FEWA 4OU0A 4N0BA 2OXXA 2PU8A 3QHRA 2ZXJA 4RVKA 1SD6A 4JBOA 3A7GA 5FGKA 4GFOA 3CUQB 4F1MA 3OWPA 5H8EA 2OBJA 4UMPA 4OTRA 1T6SA 4HX8A 2OG8A 2EFQA 4O3MA 4LGWA 1SD7A 1GIHA 2GNIA 2XH5A 2E7XA 5TKDA 3TKHA 4B09A 5CU3A 3NVMB 4YFKF 3E8DA 1OKYA 4YUQA 4Y85A 5E90A 3RM7A 4QT1A 3L9PA 3ORKA 3C4XA 2G01A 2PE2A 2BR1A 3ZQ7A 1Q5KA 3A8XA 4HX4A 2NRUA 2PZPA 5DD8A 4UEUA 4JIKA 4II5A 4EVIA 2G15A 4F9WA 3S3IA 4QMTA 4I6HA 4QLCU 2FNPA 1KU7A 2DAOA 2XM8A 2CJMA 3D14A 1Q8ZA 3ZMDA 5K5OA 4TZRA 4EC8A 2YM7A 3DAKA 4O84A 2AUHA 1R5GA 3AT2A 5DWRA 5IMEA 5CT7A 1ZGAA 2I1MA 4U6RA 5KZIA 2HDCA 1W84A 4V01A 1T46A 1FOTA 3FI2A 3Q5ZA 3R71A 2ITWA 3C4CA 2E1CA 5CSPA 2YISA 3DAEA 4C37A 4BIDA 2XUUA 3NYOA 3QQUA 4IVAA 3IRQA 4I0BA 5CLSA 2HENA 1E1XA 2OGVA 3EH9A 4YC3A 2RC4A 3ZLWA 2W57A 4LB5A 4C59A 5T3QA 4AA4A 3LA7A 4FEXA 2RKUA 3WGHA 3BYUA 4Y72A 4BDGA 3C1XA 5CI6A 3LCOA 3U2RA 5EYMA 4C3FA 5DUIA 3OBJA 3BQCA 2G9WA 4RT7A 1XBAA 5DRDA 5A2QK 4YPSA 4ENYA 3LZBA 2DU9A 5BPDA 2OFVA 1YS7A 4DQ2A 3CKWA 3TCPA 1O6YA 2VONA 1KWPA 5HNGA 2FH9A 1M2RA 2JBPA 2C3LA 1V4RA 3AC8A 2QOIA 3V5PA 4AVPA 4PP7A 4EQQA 2DYLA 2YIQA 1LQ1A 2PYWA 4CXAA 5ANEA 2ITPA 1AOYA 5IQDA 4L9IA 2HAKA 3RPUA 1ODDA 3MH2A 5E92A 3Q9XA 4JI9A 5A4EA 3EYGA 5D7VA 1SYKA 2Y75A 2C1BA 2DW4A 5KVRA 4ZIMA 2FMYA 4F9AA 3OROA 5JRQA 4M7IA 4QO9A 1BN5A 3PA5A 2C5OA 4GIIA 4U8ZA 1JSTA 3HRFA 1XH4A 1URCA 5LVLA 3I4PA 2GWRA 3EL7A 4E6CA 2PTKA 3O51A 3O6BB 3KN5A 3D0SA 3LQRA 5LGUA 3QC9A 4NTSA 2EA2A 3S00A 2IVSA 5EDQA 1J2XA 1OPCA 4K18A 4AU8A 1B59A 4L46A 4C3RA 2CNVA 3N4TA 4ZJJA 3C7QA 1J9IA 3FKOA 2R3LA 1O3SA 5JGDA 3FM5A 1OBGA 4PDSA 1BC7C 3UNZA 5IA0A 1YKRA 5CU6A 3Q04A 4BBEA 5K4JA 2G1TA 4ALUA 3A62A 3BDDA 2DPUA 3PJ1A 2A07F 4ZZMA 1O3RA 4ON0A 3RK7A 3TO7A 4P9FA 3LKMA 5KE0A 5L2SA 4M6YA 5JGAA 2CQKA 3K3JA 2C3KA 1QPDA 5DYJA 4ZSLA 5L6OA 4YTIA 5FO5A 5LRRA 4KWPA 2OI4X 2X0LA 1PXMA 5J8IA 4O7LA 2WTJA 3KFWX 5DH3A 2YAKA 3VJNA 3FI8A 2HOGA 3BU3A 2NO3A 4S31A 2QU6A 2PULA 3UJGA 5IH4A 3RYRA 1WMKA 3MB7A 3R9OA 2VD5A 5DA3A 2Q2EA 4EH7A 1BJAA 1ZOGA 3TACA 4M8TA 5FG8A 2CNQA 3B73A 3Q2JA 1IAWA 2JPCA 2XIKA 4EUTA 3UO6A 3DDQA 3FC1X 4ZK5A 4DAWA 4YHFA 3CTHA 5BPYA 5D5UB 2IVMA 2YN8A 1IASA 3TV6A 5JH6A 1TNSA 2X8EA 4CZUA 3LXLA 5FEEA 3OMVA 2ZV9A 5J8FA 3JW4A 1ZYSA 4AN3A 2P4IA 4UB7A 5GZ9A 5DEQA 3ZLYA 5C8KA 1KE9A 5IZFA 1BMKA 2XJ0A 3KF4A 4ZY4A 5HS9A 4BWKA 3MA3A 4YZNA 1M7NA 1OZ1A 1W7PD 1QZYA 3KFAA 3WF5A 4CMOA 4CKJA 3R1YA 3F3VA 3F72A 3DK7A 4CCBA 4QMNA 3I58A 3AGLA 5EHLA 2GU8A 1IA8A 5LVMA 4OIPF 1M2QA 2A1AB 4MH7A 4RA5A 4I01A 4C38A 1BKXA 3J80K 4NL0A 4KIKA 3R01A 2XM9A 4YR8A 4YZBA 1ZRCA 3JY0A 1NHAA 3F22A 1G8SA 4D55A 1Q24A 3LCSA 1XJDA 1TQMA 3O96A 1H25A 4GMYA 1MP8A 3J7AO 3VUDA 4U44A 4NKAA 3HUBA 1OGUA 2R3PA 2Q0OA 3RDIA 3AT4A 3BYMA 4AZFA 1PP8F 2HKXA 5HLPA 1SAXA 2Y8OA 3GFMA 1H1SA 1OL2A 2W24A 4XG6A 4A6DA 4EYJA 1U5TC 4IAYA 4QMWA 4ENMA 2VT3A 3WTVC 2KRFA 5GZ8A 2UZNA 3LXKA 3JR1A 4IVNA 1YWVA 4IC8A 4IXPA 4P55A 4NFMA 1SD4A 2IZRA 2GIVA 2RFNA 1YO5C 5AR7A 2NNYA 1H26A 1AGWA 3A60A 2F9GA 2WU7A 1PXOA 4PPBA 4FL1A 3OT8A 3G51A 4XYFA 5IQHA 3LVPA 4YFXF 3HV3A 3D83A 3GZ6A 1FOKA 5ETAA 4L52A 1YDRE 1VYWA 5D5XB 5L3FA 4A4LA 3KEQA 4KIGA 5I9XA 3GCUA 4WNOA 2W84A 2WMRA 2FNAA 3ZC6A 1BC8C 3R61A 2QNJA 3KZYA 3POOA 4NM5A 3BE9A 1ONVA 2E9PA 1IXSB 4P4CA 3E88A 2XYNA 1QPEA 1R0EA 2WMBA 5HNBA 1DI8A 4G3FA 2P5LC 3F88A 3K1MA 4ZYDA 2WB8A 4K11A 3THBA 5HORA 1R22A 5AP6A 4G9YA 2Z60A 2VXZA 3DLZA 3R4KA 5HG8A 3HMPA 3KF7A 2PPQA 3LQ5A 1YHWA 2GQRA 4TYIA 3BV2A 2VC1A 2V7AA 5JGBA 1LP4A 5BS6A 4GS6A 4PZJA 2QC6A 1LEWA 4ZP5A 4U7ZA 2VTRA 4CLJA 3W16A 2VU3A 3F3WA 3E5QA 4AWXB 1U78A 4GCJA 1R0PA 3QTSA 3QC4A 4DGLC 3HGKA 2XEYA 4YP8A 2WV0A 4D9UA 3S2PA 3SRVB 3NUUA 2K7LA 2XBAA 3R8LA 2OZOA 5LMKA 3CPCA 3AMAA 5HVJA 3V8JA 2WMQA 2G2HA 3WGIA 1JKTA 3SG9A 2GHGA 5CI7A 3V5LA 4W4YA 2EXCX 3OP5A 2VWWA 5ANKA 4ARKA 4DEBA 3QQFA 5DLSA 4O83A 2B0LA 3LFBA 3E5AA 4WG4A 1SZMA 2Y0MA 1G6NA 4FKLA 4CTBA 4AXAA 5IEYA 4GV1A 4FSMA 4KKHA 4DH5A 3EZVA 1YOJA 4FT5A 3UG2A 4EQUA 1FPUA 3BYVA 4LFIA 2J0LA 2KJCA 3JSOA 3H9FA 1U5QA 5BUEA 5FFXA 4UXQA 2B4SB 4OIQF 4HOKA 1XSVA 3ZRKA 1U8RA 4R1YA 1S3JA 1TW2A 4AGWA 4RGJA 1JWHA 4MQ1A 5HG9A 4OTPA 3POZA 5DNRA 3ZO4A 5K1YA 4M15A 3TTIA 2Z8CA 5B0XA 2C6IA 1ZMVA 2GTNA 4GH2A 2BAQA 2VNWA 3G6HA 2OXDA 1W82A 5IU2A 4J99A 3VS4A 1XB4A 4TRLA 4GEOA 3UNJA 2C6MA 5LEJA 5E7RA 1O3TA 3K0LA 4PNKA 3HDNA 2MC3A 4EL9A 1ZYLA 5HGIA 3BELA 1G8AA 3NNVA 3K5UA 2EFWA 4OTIA 2OF2A 2JTVA 5JHUA 2EV5A 5CY3A 4GFGA 4O82A 3LM5A 4NIFA 4CKRA 3V8SA 1J5YA 2JSCA 3IW6A 5EYDA 1LR4A 3Q53A 1TBXA 4QQ5A 4BCFA 3FHIA 2C6TA 3UGCA 2A0CX 4AG8A 2BZHB 4FKSA 5JR3A 4FSWA 1GY3A 2GTMA 5D41A 4RIXA 2A69F 1WRJA 2VTMA 4F0IA 1ZARA 1H07A 3CTQA 3BLRA 3VS6A 1UWJA 4G6QA 3C0HA 5CZHA 4YZCA 5EDRA 4MWIA 2BKKA 1J7UA 1KOBA 4UXLA 4OMYA 4QYFA 4AT5A 2R3MA 4C7TA 2YX4A 1JBPE 3K54A 5IUGA 4AW0A 1OPJA 3L2CA 4RJ6A 2REIA 3B8QA 1Q8YA 4KN4X 3C0IA 3MDYA 2B55A 4JR7A 1WVWA 3QUPA 3FYJX 2MD5A 3QLGA 4YBKA 4HPUE 3LFCA 1U2WA 4ZZLA 3VW8A 2GCDA 2OKRA 1YW9A 1LNWA 1ZY4A 4R1VA 4PP9A 1FLIA 1OKZA 3N4UA 3NR9A 5CU4A 2EJRA 3W8QA 5JT2A 4J8NA 2R7IA 1W4MA 4P5OA 3D94A 1IN4A 2EXMA 1VR2A 4UBAA 4RB1A 4AW2A 3OOPA 4Z16A 2Y4IC 1CDKA 4R5YA 3OOMA 2BBYA 3ABUA 1ERKA 3CP9A 1Z1DA 3BROA 4OOIA 1ZLKA 3KLOA 4IEBA 1T0FA 4L9JA 1G3YA 5EQEA 3AC1A 5J1VA 4HQMA 1OIQA 1FVRA 3OF0A 3FZOA 1U54A 4BWPA 3AC3A 4E26A 3C3WA 2CDZA 3UMXA 3A4OX 2BCJA 1Y8GA 3EL8A 3RPVA 1VEBA 4XG9A 2OBPA 3FHZA 2R4BA 3R7OA 4P7EA 1KYZA 4ZTLA 4QMMA 2RFEA 2A27A 2EB2A 1ZLTA 1BM9A 3UOHA 4DH7A 2OZAA 2IW6A 4WSQA 4L3JA 4PDYA 4IWOA 1Y6BA 2BEOA 4ZTMA 1YOMA 2VTLA 1Q8TA 3QLFA 2OIBA 4IZYA 1UU8A 1Q97A 2UZVA 1KQ9A 2H9VA 1KQ0A 3CDHA 3R63A 2VNYA 3I64A 1FT9A 1MRYA 1D8JA 2HFHA 3TT0A 2Q83A 2Y4PA 3HTUA 1G3WA 3MVLA 5HTCA 3EYYA 2ZNYA 2EA4A 5DCMA 5HD7A 2J90A 5ERIA 4AN2A 4O6JA 4ZAUA 4GT5A 4RX9A 3B2WA 4OR5A 1OUYA 3HA8A 1UNHA 2C0OA 2VTJA 3IS5A 3IWZA 3RWQA 2WMXA 5CAOA 3HKOA 4MQ2A 4J52A 2QD9A 5CLPA 2K4JA 1OVEA 4U3YA 1YXSA 2FA5A 3FXXA 1TLHB 5LARA 3CKXA 4WRSA 3FMJA 3FLWA 2V22A 4BDAA 2HS5A 4RBLA 4C2WA 1H4LA 4YG2F 3SQQA 4M71A 5L2WA 4L68A 4GVJA 3TDUC 1QCFA 2WEIA 4N70A 1WBVA 4FSZA 2GAUA 2PQ8A 2A68F 5FDXA 3MWUA 5BVNA 4L18B 3WG9A 5CS6A 3V3VA 4IAKA 3VF9A 1YXUA 2XKOA 3E3PA 5DEYA 3QALE 2W9ZB 3E5UA 1GXPA 3IG7A 4CVAA 1ZLJA 2JKKA 1S6LA 3VHEA 3C18A 2JKQA 3GOKA 3WARA 4O7VA 3BJ6A 2P2HA 5FEQA 1PJKA 5EKOA 3HYHA 4IB3A 4C34A 4MEXF 5E91A 5J1WA 1J7KA 3ULIA 1GVJA 3C51A 2FF4A 1XH6A 4OMZA 4F9YA 3EYHA 4E4XA 4AT3A 5CYIA 3UE4A 3UP2A 4FK6A 5ACKA 3FPQA 3TNHA 2QONA 1UV5A 1ON2A 4TWCA 4BIEA 4UY9A 3E6MA 3GFJA 1NVQA 3V5TA 3FWQA 4L43A 2XIZA 1GNGA 4QOXA 5K0XA 3Q9WA 4S2ZA 4RB2C 2E9OA 1IZ1A 3CJNA 3F6VA 4KYWA 4YGAA 2IZSA 3ODZX 4HF1A 5AM6A 5FD5A 2PVMA 3UIUA 4A4XA 1QNTA 2PLYA 2J0MB 4FKVA 3ATSA 4JX3A 5LJJA 4MHAA 4BHNA 2CMWA 4ERWA 3TXOA 4QYEA 3R8UA 4M9SA 4IB0A 5J5TA 3QCYA 4NQWA 4RS8A 5AAEA 4HLXA 2VTHA 5LMAA 4H58A 2ITVA 2WELA 3A7FA 3RI4A 4EOMA 2JT1A 3OY3A 3MCZA 4M84A 2RGVA 3VS1A 5CEQA 2CGPA 4I20A 3VS2A 3FY2A 4KIKB 3R60A 1J59A 3RGFA 2IVTA 4JAIA 4OAVB 3Q3BA 3K1PA 3ALOA 4FKQA 4AGCA 4LGDA 2BV6A 4I4FA 2KTYA 5HNIX 4F6WA 5JKGA 3RKXA 5BNJA 2HQRA 1OMIA 2XJ1A 4DNCA 2L01A 4L3LA 4FKGA 3DXPA 1K2PA 4P96A 2QQ9A 3GX4X 2W1HA 4XH6A 4BBMA 3Q5FA 4HBLA 2RG5A 2XK8A 1P2AA 2VT2A 5CJ9A 2W5AA 4H36A 3RTPA 5CEKA 4KUJA 3HRTA 4UHTA 4FTKA 4PQNA 2J9MA 3KXHA 5FLXZ 3WTXC 4FT9A 5HIEA 3DDPA 2PMOX 4JXFA 4AGUA 3L8XA 3NPCA 4IXAA 4QP9A 1U5TB 1KE8A 4KAOA 4E7WA 5LXMA 3HV6A 4MF0A 5CQUA 1BLXA 3FZPA 3CIKA 4RLKA 4CV9A 3WGGA 4AT4A 5EOBA 3WIGA 2F4JA 1V0PA 3SZPA 5ACBC 2VGPA 1E17A 4IQ6A 1HKSA 3EN6A 4M13A 2OXYA 1K78A 1BL7A 4NKSA 2H09A 2BPMA 3QP6A 3QRFF 3NYXA 3CR0A 4L8MA 4I5CA 2IA1A 5FGMA 2CCHA 3R00A 4MHGA 2ETRA 4MWHA 4XSXF 4HVGA 4XP2A 4TNDA 2CW0F 4YLKA 4ACDA 3E92A 2PZRA 4EZ5A 1ULYA 2HY0A 3RPQA 4D58A 2CGWA 1MJAA 3F2RA 1R78A 2YFXA 3QTIA 3GLXA 3R8VA 5D4RA 1YWNA 2O8YA 2BDWA 4Y95A 2YEXA 2R0UA 2R3NA 4F7SA 5EKNA 5HE2A 3HV7A 1CSNA 3ZHPC 3AAFA 1A06A 5IH5A 3ZU7A 4H1JA 5IF1A 1F4KA 2IVUA 3KEOA 2C6EA 3TIZA 3N4MA 4LL0A 4I3ZA 2XP2A 3DLSA 5H6RA 2C5XA 2X8IA 2WKMA 5M06A 3IO7A 3R8PA 2CO5A 2F2UA 2UZOA 3AC5A 4LMNA 4O5VA 2ZB0A 1REKA 2BIKB 3F3UA 3VOEA 3ZC5A 3WF8A 5IA2A 1OECA 3ORTA 4ENXA 4X6RA 2YR2A 3I4BA 5D10A 4AUAA 4YHTA 4F0GA 4AF3A 1UHMA 3DQXA 1Z05A 3WYXA 4LI5A 3QD4A 4UWCA 3H30A 4E3CA 3UVPA 2FXAA 5EYCA 2OSCA 4OTGA 4CGAA 2A6EF 5F20A 3LJ1A 3CD3A 3COIA 3NCZA 4JOAA 1PHKA 5EM7A 3QYWA 4CFUA 4F9CA 4FX4A 4AGDA 4DEGA 2V62A 3L09A 3FQSA 4O1PA 4AAAA 5TJJA 3MQ0A 3TZ8A 5AP0A 2Z2WA 3QD3A 5D6FA 3KLNA 5M4IA 1S8NA 3MVHA 4USFA 2P3GX 1UHWA 3EQBA 4IX3A 3V8TA 4NTTA 4LRJA 3A99A 2XS0A 1MDMA 4EHEA 4NZWB 1J1BA 3QTXA 5FXRA 4HVHA 1XGMA 4YTFA 4BKYA 1ZWSA 5ANJA 4L9VA 1JKSA 5IQGA 3AXWA 4KRCA 4M6XA 5AP2A 3F66A 2E9NA 2EUFB 2W5BA 2UZBA 2J4ZA 4YURA 2GFCA 4ASXA 4M9XA 4GKHA 4FKUA 1MUOA 4CT2A 5HIDA 2RFSA 4ZZOA 3HMIA 4FKRA 5HI2A 2XVDA 2OLCA 5JMSA 2QBYA 4BFMA 3H9OA 2WC2A 4ENKA 3JAMZ 4Q4ZF 4LG4A 4CFNA 3PA3A 4YO4A 4WIHA 3SD0A 4JG7A 4CFFA 4A0YA 3GBZA 3DZQA 2UZWE 5B7VA 3WU0A 3V6SA 3C5IA 3PXQA 4ZS4A 5KHXA 4O7SA 5DDGA 4RRVA 4RIXB 3H9RA 1DS5A 4RG0A 2GA2A 2ZAZA 3COMA 5AR3A 4WD5A 4CXFA 1FPQA 4UWBA 4BHPA 2B54A 2A19B 3Q6UA 3W8LA 4WHZA 4I02A 3CJGA 1PMNA 5EEHA 3RKBA 2R7BA 3DFGA 3CUOA 4ZXTA 3E87A 4G8XA 3QZIA 4YTHA 3GGFA 2P33A 3V04A 2HZTA 3PZHA 3IW7A 4RJ4A 4EOQA 5TF9A 4PMPA 3ZTXA 3LJ2A 1WBNA 4EI4A 2BKZA 1HW5A 4HDUA 2ZM1A 3IW5A 4BCHA 3SHFA 4AFJA 3COHA 3BWJA 5ANOA 4M9ZA 2G2FA 5ETIA 1Y91A 4FV1A 4IE9A 3ABTA 3GOPA 4TYEA 4G6OA 4OINF 3GW2A 4HAMA 1KGSA 3GUDA 4S34A 4X3FA 4NU1A 1KE6A 4BIBA 3BYSA 2F5EA 3NQOA 5BMZA 3F69A 4FODA 2FVDA 2QOFA 1OIUA 1R58A 4I0TA 3I71A 4WO5A 1LDDA 2O61A 5L3GA 3VUMA 4A07A 1FBNA 3BU6A 4ASDA 5KMJA 4LUEA 5D11A 1U54B 5K5NA 3KXGA 4APCA 4AZVA 2BAKA 3MW1A 3S4QA 4MXZA 3ZBFA 3AD4A 4EOKA 3KXNA 3O7LD 3R1QA 2RF9A 2WEVA 2CFXA 5E8VA 2OZAB 2A6HF 5K4IA 4WXHA 3Q52A 3UDBA 1FINA 2C3IB 3BPRA 4EOIA 5L3AA 4O2PA 2GMXA 2VUWA 3FMRA 5IQBA 4DGMA 3TDWA 2XA4A 3CJFA 4IJAA 3HL7A 3QWJA 3U54A 4MBJA 3IK3A 3E7OA 3M42A 5CF5A 3P5KA 2AC5A 4LMUA 3IGGA 4F08A 4ZMEA 3R8ZA 5DCMB 3N97A 1ZMUA 3AG9A 2ZBKA 5E1WA 1OUKA 1PXKA 2UZLA 3OT3A 3BOQA 2WTDA 4N6ZA 3UZRA 3G6GA 4GIHA 4BYYA 3OG7A 3LCTA 2I40A 3HECA 2GHLA 3IC7A 4BTFA 4PDOA 4ID7A 2P5VA 4LD5A 2YZAA 4EJTA 4YSMA 2VOOA 2C68A 4A5NA 3SOAA 2EU9A 3TIYA 3O8PA 3HZTA 2GZWA 1R5HA 2I6LA 2OJIA 4BGQA 4OBQA 5DMZA 3BP8A 5AP3A 1R7JA 4QYGA 1B38A 3DKOA 5M4FA 4BCQA 4KMFA 3IHUA 4L0ZB 2W1EA 2YZLA 3FQHA 4CZTA 5J5SA 3P9JA 3SQNA 4JDKA 4U9AA 3M8FA 1UCRA 2Z7QA 3GVUA 3FMNA 5I9WA 2LSOA 2CPKE 2HQNA 1SMTA 5EW3A 3I54A 4P9UA 2X8DA 5GIPE 1C0WA 1I5ZA 4XX9A 4JR3A 3C9WA 3OXTA 3MPAA 4FTAA 4G5JA 2QOQA 4ZS0A 3BHUA 4H3BA 4BNCA 4BYIA 5HX6A 2WMAA 2O5KA 3L9LA 1V0BA 1IG1A 4E5AX 2WTWA 5DI1A 3NUXA 2HZ0A 5HG7A 2W9FB 5F4NA 4AD9A 2F7EE 2BDJA 4HDVA 3PFQA 4HJOA 4NCTA 4N0SA 4APPA 3IW4A 2JIUA 3NWWA 3TNIA 5EQPA 1FBUA 3G0FA 3N4VA 1OBDA 4KRDA 2G2IA 4MNUA 3EWHA 3VUGA 5CAQA 3QUEA 3FXUA 2JBOA 4FVRA 4Z7HA 4LYNA 5CVIA 4UN0C 3CGOA 4K33A 2XIGA 1B39A 4U97A 1VZOA 2QQ7A 4GT4A 1M14A 3WF7A 2OZUA 3FI4A 4IWQA 3BPVA 1FMOE 4LGHA 5A4CA 4RAYA 5HLIA 1PMEA 3GI3A 4Y5HA 3VF8A 2W1IA 4BTKA 3OTUA 3MYGA 1CF7B 3O3KA 4RA4A 4UVCA 4CSVA 4EMSA 4ZY6A 4XG4A 2CLQA 3QL8A 5E8ZA 2C47A 3W2RA 5L2IA 4G6NA 4IACA 3IW8A 4U0YA 5FP5A 2VBWA 1YI3A 3VNTA 5A4QA 3FUPA 2XK3A 4U81A 1B9NA 2RDPA 3LM0A 4A9TA 4ZMFA 3GCSA 2OAZA 1O6KA 4E6DA 4KB8A 5D9HA 2ZM4A 1K7AA 2X81A 4HZSA 1R36A 3EKNA 4J97A 2VTSA 4FUYA 5L2TA 3TTJA 1B6AA 4PGGA 4QP3A 3SXYA 3DBFA 5HVKA 4QNAA 3EN4A 5EFQA 4I0RA 1BI1A 3AC4A 2FE3A 1S7AA 2ZKZA 2GNHA 5FD6A 2OZ6A 3HV4A 3KZZA 1KYWA 3KY2A 2PUNA 3GENA 1MJBA 2YCSA 5E4HA 1LDJA 1D3YA 2XAGA 3KCKA 4HW7A 4FIIA 4DN5A 2F7XE 3ZEWA 4D28A 1YW2A 1YTYA 3OCGA 2XIXA 3G9NA 5HS7A 3NAYA 4FV2A 5J9YA 2JDTA 4QTBA 4A7CA 2R3JA 3SDJA 3SXRA 2WTEA 2Z3YA 3S2WA 2XRUA 1GZOA 3IWFA 4Z3VA 2M45A 3Q2MA 3EQIA 5DG5A 2LF8A 3ZZWA 4M97A 4FE2A 5C4LA 4FOCA 4I93A 2AYPA 2TDXA 3A8WA 2BROA 2VN9A 2HELA 1KA8A 4EWHA 1JNKA 4GUEA 3HAMA 3MEXA 4MXAA 1PF8A 1K78B 2UV2A 4EH8A 5IDPA 3CEKA 4XUFA 1J3HA 2VTTA 4O7ZA 2XBJA 2Q0NA 2X1NA 5C1QB 2YPRA 4G7HF 3SFZA 5F95A 2ONLC 4G9CA 2YABA 4JDJA 5J7BA 4RX5A 4QP1A 4OTDA 2ZMEB 1U3EM 3EHAA 2NS0A 2BZKB 3DXQA 3T8OA 4F99A 4EONA 4DBXA 3HOTA 3DPKA 1WFCA 1P2FA 1Y57A 4DT9A 1M52A 2X7GA 4C35A 4B8LA 1P4XA 3RAKA 3DS6A 3EB0A 4YJNA 5IUIA 3QGYA 1V1KA 3PVWA 2V1DA 4I22A 4LQMA 4WBOA 4BDDA 5KBQA 3R30A 3GC7A 4IDTA 5KMMA 4WA9A 1YG2A 2HZNA 5H2UA 1TVOA 2X6DA 2YACA 5EYKA 4FKTA 4DEDA 4FA2A 4O91A 3HYIA 3OWJA 1HBXG 2ZCWA 2WTKB 3DV8A 4L9TA 5IDNA 3ZFXA 1PXPA 3RNYA 3QTUA 4QMOA 1GJOA 1JXSA 3RBWA 3OS3A 3OC1A 4RJ8A 4GYGA 5HLGA 4GO1A 3W10A 1G3NA 3I0TA 4AE6A 3DQVC 3MIYA 4CQEA 5FLXK 5HBJA 4F63A 1Y6AA 4FGRA 4C57A 1NT2A 2VO7A 3R0AA 1F0QA 3R7VA 2XNOA 3QZGA 1XH8A 3ZFYA 3TDVA 3QGWA 3TO6A 3BHTA 4XBUA 5IA4A 2PUPA 4I7HA 3R8MA 5HHWA 2QOKA 4FTMA 1MDMB 4J1RA 3KA0A 4CTCA 4C4JA 4QMQA 4IDVA 4G94A 1GAGA 3ZXZA 4DEEA 1XQZA 1XWSA 2JEDA 4LLNA 5A4TA 3OCTA 2GS6A 3BWGA 1DUXC 2W7XA 5ANGA 1MQBA 3CLYA 3QBNA 4RC2A 3C50A 2BRBA 4Q47A 4XMOA 5KMIA 1Q8WA 2OJFE 4IX5A 3ZONA 2WOUA 3FC2A 2QBYB 2XNPA 3ODYX 2ZOQA 3NUAA 4A0ZA 6PAXA 4B99A 1G3TA 4OTWA 2I0VA 2W4JA 4F4PA 4R3RA 4LRMA 3GCPA 3QU6A 2CKOA 5D8LB 4PTCA 2ZJ2A 2D1HA 1DP7P 1WCCA 2HWOA 5L6WL 1RUOA 3P9KA 4E93A 4ZSAA 1A04A 5EHYA 5AEPA 3ZDUA 2BHEA 2BZIB 3OV8A 3QPTA 1IW7F 4BDEA 5CF4A 3ORZA 4QPAA 4PL4A 3F21A 3JYAA 3S95A 3ZYAA 3OEFX 4PF4A 2OO8X 4M68A 2ITUA 2VWBA 3RZBA 3LAUA 3SZTA 4XNEA 3II5A 4FSQA 4J7BA 4JIAA 4ANSA 3SA0A 4HV5A 4PDPA 2H6BA 3G2FA 4M12A 4LB6B 4O7NA 2YLFA 1SNXA 5IMXA 3BI6A 3T9TA 2XK6A 3VC4A 2QQBA 4DFXE 2ZDTA 4C4HA 3H3ZA 3QFVA 1URWA 3RHXA 3GVAA 4RPVA 5KMNA 3IDPA 5H6QA 5C8MA 3EFLA 4AWIA 3QRTA 2VBXA 3ROYA 2JIIA 4ZYHA 3OW4A 2WQBA 5AP1A 3R1NA 2ESMA 5LWMA 4E8AA 5I5ZA 3ZSGA 1HCLA 4UWYA 4L00A 4TW9A 3SKCA 2WPAA 2QOLA 2PZ5A 3IECA 4GK4A 1H1QA 4R77A 3ATTA 5M56A 4I2OA 4L0YB 1Q4LA 1RW8A 2YWPA 3Q9ZA 4D9TA 5CEMA 4DEHA 3HAVA 3FSKA 3VB2A 4E6QA 1J75A 3ZM9A 5HCZA 2XNGA 1OKWA 2HWVA 2G9XA 3H3CA 3I5ZA 3QTWA 3DKGA 3NX8A 2C5NA 1BIAA 3JAMK 1QBJA 4KIFA 4C4FA 4LFUA 1B6CB 3EQPA 4CG9A 5IG1A 2KIMA 3QUDA 4I5PA 4XG8A 1XO2B 1PY5A 3BZ3A 4RMZA 1L3RE 4BDJA 4FZDB 3UOLA 4C61A 3R6XA 4O6LA 3R7YA 5L3EA 4IWDA 1MZBA 1ZXEA 4F70A 4NT4A 4YNEA 5D5VB 2ERKA 4XBRA 4KFCA 3WE3A 5BMSA 1SD5A 3RJPA 3R2YA 4G3EA 4IM2A 4RC4A 2XAHA 3PXKA 2NP8A 4EGZA 4HCTA 5I9UA 4RIYA 4EK3A 2FBKA 5D4SA 2W4OA 4HNFA 2WMVA 3MFKA 5FWKK 4ZTSA 3TKUA 3GP0A 5AX3A 4Y73A 3TV4A 1NXKA 4IFCA 4XHKB 2UWMA 3VRYA 3IRRA 2COMA 1G3SA 2QKWB 3F9NA 3EUHA 5GJDA 1D8KA 2VTQA 1XDUA 2QUFA 4Y15A 3D9VA 2JAMA 1JHHA 5CAUA 1O7FA 5BVEA 4KNBA 2V79A 2B9HA 1ZREA 5AR8A 3T5XA 5CZIA 2OICA 1P4AA 3LWFA 1F1ZA 2P6TA 1IXRC 1KQ8A 5BQTA 4JQFA 2W17A 4OT6A 2I0EA 4QD6A 4YC8A 5DT4A 3M2WA 4I23A 4EHVA 4LK0F 3HIFA 3PE1A 5E1SA 1DI9A 5BVDA 5CEOA 3K2ZA 2R3KA 3SGCA 3ERKA 3JY9A 1V0OA 5J9ZA 1KU9A 2UW4A 2YM4A 1PXLA 4NK9A 4DGOA 3K1NA 4MD9E 2Y0AA 4BHZA 4BDIA 4BYJA 3CY3A 2XKDA 4KS8A 1SVGA 4PNIA 3MSSA 2Z99A 3HP5A 1H01A 4EBWA 1KU2A 2JDVA 5HG5A 4X2NA 4W9WA 3QCXA 3ZLXA 4YLJA 4C33A 4V04A 2DTRA 3KKVA 4DFYA 4MNFA 2MLKA 1VYZA 5CANA 4P90A 4QNYA 2JLDA 4I98B 2L02A 3NIZA 3U55A 3K5VA 5A46A 3F8FA 4EHZA 3UOJA 3DNEA 3ORXA 4ZH4F 4FIGA 2HYGD 2V55A 3R73A 3P23A 5BYZA 2OIDA 3CC6A 4U3ZA 4RX7A 3ZCLA 3ETAA 3DBQA 4IPAA 2Q0BA 2VTIA 3U6HA 4I6QA 3ET7A 1ZYRF 1BYGA 3RPYA 3I53A 2UW6A 3QX2A 4J98A 3R9NA 4AIJA 2WD1A 1RZ4A 1FGIA 2PVHA 3RWPA 5AADA 4A9UA 4HF2A 4HX7A 1YXTA 1F5QA 4B6LA 5E8IA 2PMIA 1IAJA 5F9EA 4RWLA 4R6VA 5JZJA 3QAHA 4M66A 2HZIA 3DU8A 3PWDA 4H0EA 5M07A 2AS5F 2F57A 4B7TA 3GCQA 3T8TA 2ZMDA 4K77A 2XKPA 3QAME 1Q61A 4AZWA 1UWHA 3HUCA 5CQWA 2MA3A 3UO4A 4U0VA 2XVCA 4R1HA 3VODA 2QQAA 4ANBA 3DJ5A 1YXVA 4FTCA 2HCKA 4NEUA 2WAJA 3TKIA 3EYIA 3NIEA 3WI6A 2FBHA 4HV6A 2WMWA 3ORPA 2OU7A 3V01A 4MAOA 5A4LA 4HGLA 3EQFA 1J7LA 3SVVA 4KABA 5A6NA 3CUQC 3TUDA 1P92A 3D7ZA 3RPOA 3DY7A 2VWIA 4DTBA 2O03A 4WSYA 2HR3A 3VUHA 2M1BA 2YCRA 4BCIA 3QU0A 4KS7A 1LUFA 3O8TA 1XGSA 3E62A 5FTQA 3ACKA 4BKJA 3LE6A 4R7HA 2PVKA 5M53A 3DEUA 2XJ2A 5CVRA 3BIZA 5F94A 2QU5A 1YI4A 3ZZEA 4CT1A 2IW8A 1MQ4A 3DJ7A 5DD4A 3EDPA 2GXGA 4W4WA 2WQOA 3O23A 4GG7A 2KKOA 2QOHA 4QTDA 3E6CC 4IVCA 4R8QA 4AOTA 5CWZA 1IUYA 2X4ZA 1Y0UA 5DR6A 2QG7A 2X39A 3HMMA 3RAWA 3BCEA 5GNKA 3KXMA 3LSTA 3AC2A 2RFDA 4V0GA 4W4XA 5CT0A 3PIXA 4F9BA 2VTNA 1YQAA 2HGCA 3PE2A 3QTQA 3BYOA 4F09A 2W85A 3I5NA 3TOAA 4WRGA 3M1EA 4BCPA 3SW4A 5I9VA 3U87A 3WZDA 4D1SA 3FV8A 2C6OA 4MGRA 1FWZA 5AV0A 1QO0D 4DEIA 1FSEA 4YU2A 2Z7SA 2EVAA 2W05A 5J6XA 2IRFG 4UALA 3RPRA 3P7CA 1JOWB 3UC3A 2ZB1A 5AUZA 1WBSA 3QOPA 2CHLA 3QWKA 1S7OA 1GZ8A 3UNKA 4LJZF 5D6EA 3EMGA 3EN9A 1SVHA 3MVMA 1TTYA 3DTWA 1DAWA 5J79A 2Y6MA 5CEPA 2R3OA 5HE1A 4D2WA 2ZMCA 3EJ1A 3CO7C 3FMQA 4J96A 2A61A 2BRGA 3RK5A 2W0JA 5FB2A 2SRCA 2GNLA 1TNTA 1U46A 4FTOA 5BOXA 3I60A 4P5ZA 4RGRA 2DI3A 2XK4A 3LFFA 3PLSA 4O6EA 4KA3A 4L5JA 4AS0A 2O64A 3KVWA 4XEYA 4FV8A 2DLLA 3HRSA 3VRZA 1JE8A 4MD7E 2QO2A 2ZVAA 3MVJA 1IRFA 4DLIA 4XJ0A 3ZUUA 4FICA 3R9RA 4RZWA 1FBSA 4RJ3A 5DT3A 1OL5A 3P7AA 5IA5A 4TT7A 1F3MC 2NNNA 4QMSA 4GYIA 4EK6A 2E7WA 4Q5SF 5F64A 4BVUA 4RWIA 5KMLA 3WZUA 4GKIA 4B8XA 2CKEA 1GOLA 1O57A 3F2AA 5BVWA 4QPSA 1PKGA 5LGTA 4HQEA 3FLSA 5LRSA 3C7JA 3P0MA 3UO5A 2AXLA 4PMMA 3KP6A 4BICA 1HOWA 3MY1A 3IDCA 2IZTA 4ACCA 2XCKA 3F8BA 2WQEA 2WTVA 2ESNA 2ITNA 3C4WA 3Q32A 4M74A 4BCKA 1FZPB 4QP8A 4G7OF 1EH7A 5C8NA 3UZTA 2DO7A 1CM8A 1ZGJA 4GW8A 1BOAA 4FC0A 4EQMA 3L8PA 3KP5A 5HU3A 3NCGA 3WTWC 5FTOA 1IXCA 4HCVA 1OL7A 4V05A 4G2FA 3VN9A 4TL0A 3BKBA 2QO9A 3PJCA 1MKMA 4GU6A 4D5KA 1STZA 4AZTA 5LHIA 4FT0A 4G31A 1SFEA 5GHVA 5IA1A 1JKLA 3CY2A 2KIFA 3E8CA 2NNWB 3W6JB 3PDTA 5M51A 5HBEA 3IPHA 1U5TA 4IRIA 4DGNA 2RV8A 4DITA 2F7ZE 5HCYA 3VS3A 3QA8A 5FD2A 5GINE 2V6CA 2BTSA 3W6KB 4LRKA 3NW5A 2X4FA 4JNWA 3BY6A 4MNEB 3KE2A 3AMYA 5CSHA 4ANMA 3HMNA 5L2QA 2RQPA 1STCE 3ZH8A 3E6DA 3N51A 1FY7A 1JLUE 4IFGA 1U4DA 3FLNC 5JFRA 2BILB 5K5XA 2K4BA 4JVGA 3R21A 4AIHA 3P7NA 4U80A 4H39A 3GFIA 4U88A 4F1OA 2AC3A 3FBVA 4JL9A 1VJYA 3T1BA 4FX0A 4Q5HA 4RQVA 4K6ZA 3TM0A 3JXWA 4EOLA 5LVNA 1WBOA 4N4SA 3G33A 2IA0A 4CZYB 1LEBA 3DT1A 2VE8A 4J8MA 4IX4A 3UP7A 1YVJA 1FVTA 3EQDA 3ACJA 2A3SA 4EJOA 2PVFA 4FBXA 3LOKA 4JRVA 2ITXA 4RB0A 3JVRA 4RJ7A 3LAJA 5KBRA 4NYEA 5EI2A 3F6OA 1ON1A 1H08A 2UZKA 1Q41A 1X3UA 5LCJA 1YYVA 1ZZLA 3UQCA 1T39A 4FTTA 3MN3A 4RWJA 3Q96A 5DR2A 3GC0A 4BDFA 3REPA 4H05A 3M9AA 4G1WA 2Y48A 4ENJA 4EEVA 5EI8A 3ELJA 3RAIA 2XUBA 3VS5A 4MTAA 3GZ5A 5ETCA 3I0QA 3ML6A 2C6LA 4RGUA 1EH8A 2QVOA 1W5SA 2GSFA 2XRNA 3HUGA 5CVGA 3HSFA 3RZFA 1HQCA 2J5OA 2PZIA 4G3DA 4FMQA 4XOZA 2YCFA 3TJCA 1SFXA 4R8HA 3UVQA 4ZJVA 3BGPA 4YPDA 2Z33A 3SXSA 4C4GA 3KU2A 4YJUA 2XNBA 2KJBA 3DP7A 4AX8A 2FEZA 3CQUA 4HZFA 2J0IA 3SX9A 2P4WA 5FBNC 3PG3A 4W8DA 5M44A 2OJGA 3F7ZA 3NUSA 4Y13A 3IOPA 5HESA 2LGCA 2XHKA 3OXIA 5ANIA 3OOGA 2ZV2A 3UTOA 1QPJA 2BTRA 2ZJWA 4BDCA 5JVTA 5ILUA 3RNIA 4IAIA 3E97A 1Q1HA 1GIIA 4GGGA 1H24A 2WTIA 1FC3A 3HA6A 3U4WA 3MZYA 3ERED 2XNMA 3FKLA 3FY0A 3M7GA 3UODA 2QWWA 4YJSA 3U6JA 1O7LA 4F0FA 4IZ7A 3NNWA 3GYHX 5KO1A 5FXQA 2FU4A 5CX9A 2XB7A 3WOWA 3D5LA 4XLVA 3TN8A 1BI7A 4BY9E 2XIRA 2ZYBA 4BAYA 3TWJA 4EK4A 4RIYB 2FO0A 3BV3A 5E20A 3DF8A 1L3LA 4I4EA 5CNNA 4EH4A 1IN5A 4FL3A 5EK7A 4D2VA 1GXQA 4FTNA 1TW3A 4AW5A 3KP2A 3BU5A 3L9MA 3UIBA 4L6QA 1F5TA 4KBAA 3I5UA 3PG1A 2D1VA 3PYYA 1Z6TA 5AUYA 2DK8A 1PXNA 5AWMA 4ACGA 4WK8F 2P55A 2J5FA 5ILVA 1MRVA 3KVXA 3O17A 4XRJA 2FB8A 4JBPA 5TR6A 2ZFWA 1Q62A 4ZY5A 2WU6A 1XMAA 2YM3A 3ID6C 1WBWA 2WTCA 2MH2A 3NLBA 2W1CA 1YHVA 5IT9Z 3BLQA 3OWLA 3ZXTA 1E9HA 4IADA 3WTTC 3KRXA 5IKWA 1ZYJA 1BI0A 2ESHA 1W8CA 5BUJA 3F3ZA 5E1EA 3DGKA 4CKIA 3DZOA 4TWOA 2QVSE 4XRLA 4FVPA 4G17A 4WUAA 1AWCA 1XD7A 3KCCA 3NS9A 3NRVA 4C36A 5KNJA 2F49A 4CICA 2W5HA 3T9IA 2FUMA 2XGXA 4BCNA 2WXVA 1PRYA 5AV1A 3U8WA 4BN1A 3G5DA 5KX8A 3EQCA 4X6QC 2PN6A 1WBPA 3GF2A 2IO6A 5G1XA 4S04A 1YOLA 1CMKE 4S32A 3WBLA 3TL8A 1R3CA 3BPXA 3JUHA 2GQQA 5J9LA 5CVUA 3LA3A 1KE5A 2VZ6A 3ENHA 3Q4CA 5LQFA 3TG1A 4YJQA 3UMWA 2VBZA 4QYHA 4D1XA 5FUTA 5DIAA 3V5QA 3GNIB 1JAMA 2VX1A 1R1TA 2OH0E 4R7BA 4ANNA 4JQEA 1UNGA 1USTA 4D1ZA 4BQAA 1PYEA 5FQDC 4IJPA 3Q4UA 4GU9A 1WZYA 3RALA 4M3QA 2BRHA 3L8SA 2IWIA 1H8FA 3HHHA 3R7EA 3ZO3A 2PI0A 4U79A 4F1TA 3MFSA 3CTAA 3PPZA 3BJOA 4N9HA 4DG3E 3Q9SA 2E9UA 4WOVA 1H28A 5AR4A 5AP5A 1I44A 3DQWA 3TOBA 4EJWA 5KKRC 3W2SA 4D0XA 3QCQA 5LCKA 3F3XA 3IDBA 2HZ4A 3E7VA 1G4DA 4ZSGA 5F6FA 1ZHFA 5ICCA 2BUJA 4E70A 2BDFA 4A4OA 5JEBA 4FNWA 3RAHA 1WBTA 4DFZE 3PUPA 4X2JA 1Y8YA 4EHGA 3C13A 5CSVA 1W5TA 3TZ7A 5B2LA 4USEA 2W1GA 5DE2A 2M30A 3HRBA 4U7BA 4UMUA 4HYEA 3DCVA 5AUTA 3Q4TA 5JFWA 3T3UA 2HOEA 3GEQA 4O7RA 1OMWA 4AA5A 2R9SA 5DR9A 1HXDA 3ZUTA 3BZ6A 4UX9A 5L3DA 2JD5A 4TPTA 5HE3A 2HXLA 3GCVA 4NHJA 5T68A 4ITHA 4L44A 4HVIA 3FXQA 3TEIA 2GQGA 4HYUA 3C4FA 3PJ2A 4FTQA 1OI9A 2R3RA 3LFDA 2X9FA 4IZ5A 2RIOA 4KKGA 5H9BA 1FP2A 2C6KA 3ZO1A 5FDPA 2D2WA 2LDUA 3HRUA 3KRWA 4UV0A 2V1XA 4YO6A 4V0GB 3PJ8A 3WYYA 1FSHA 1ZG3A 5HX8A 3MWMA 3A7IA 5J95A 4M0YA 1EH4A 2IPQX 1IEPA 4ONAA 3QZFA 1Z9CA 4CYIA 3I6WA 3WF6A 2H27A 4FT7A 2YAAA 4UV9A 2B0QA 3A7JA 1BI3A 1O6LA 5KMKA 4OTQA 4QP4A 4WT6A 3GXOA 4MTEA 4FTUA 4FSYA 2HYYA 2UW9A 4E4MA 1Z7UA 4LV8A 1XH7A 1Z5MA 2PSQA 2QHNA 5M57A 3CBLA 4IB5A 3O50A 4XS2A 1JHFA 3AOXA 3DKWA 4I0SA 2STTA 3K9TA 4MKCA 4ZLOA 3M1SA 4EJVA 3QXPA 4JBQA 2J5EA 4AQCA 4BI0A 3HLLA 4I94A 3FXRA 1H1PA 5AP7A 4FKOA 3UQGA 5HOAA 3VS0A 3EFWA 4PY1A 2UVZA 2YIYA 5C27A 4N9IA 2QLZA 2QR8A 3MY5A 3SXFA 3COAC 1FYMA 5LBQA 3W2CA 3TNQB 1XKKA 3U9CA 4FTRA 4TYJA 2Y7JA 3EETA 3ZN0A 3E8EA 3EIDA 3W32A 4TYHA 4L53A 1IN7A 1JPAA 3FZ1A 1RUNA 3ANQA 4IC7A 3EQRA 1CF7A 2HIWA 1T2KA 4P5QA 5FM3A 4JQ7A 4K8AA 2IJMA 4UMQA 5IQIA 3VFZA 1PXIA 1QZZA 3VBXA 5LOHA 2F2EA 1UU9A 4CYJA 1ZRDA 4DFNA 4CMTA 5JFSA 4TY1A 4RX8A 3P79A 4U7DA 4U0IA 4CZZA 2W06A 2BFYA 1OM1A 2R7FA 3I0OA 5H8BA 3CD8A 4L42A 3LMGA 3PPJA 4WBBB 4Y83A 3WTZA 1S9JA 3FI3A 4XCUA 1K6OA 3GFWA 4CDGA 1PKDA 3F8NA 3I59B 5BMMA 2XASA 3KRJA 4H3PA 2HWPA 4YC6A 4ITIA 3ZMMA 3JPVA 3COKA 5AV3A 2YCQA 3F7WA 3MI9A 4KIQA 5HO7A 2DBBA 5KHWA 4ESBA 4WCGA 2WHBA 1MGTA 5EH0A 3ORMA 5CXHA 3LQQA 2NRYA 1JKKA 4GG5A 4EH9A 2X7FA 1SVEA 5CNOA 5HO6A 4GCVA 5AIRA 4ALWA 2R3QA 2XRWA 3ITZA 1ND4A 4HF0A 4A5MA 4O7YA 3WZKA 4A06A 1F9NA 5DBXA 1XGOA 3F5PA 2O0UA 2PJPA 2FSOX 2C6DA 5EM6A 4JT3A 5JZNA 4A0XA 3PP1A 5DPVA 1CTPE 1Z91A 2KIUA 4OIRF 5FLFA 4RVTA 4AE9A 3QRUA 3KB7A 3ZS5A 4O2ZA 1ZRZA 2XAQA 2VTAA 5CU2A 3MGYA 2PHKA 4FYNA 3VHKA 3LFNA 5HLHA 2PVRA 2JC6A 3H3UA 4I5MA 4C4IA 4NSTA 1NY3A 3W2QA 3RM6A 2RGPA 5CAPA 3B02A 2YM5A 1JQHA 3QD0A 3IKVA 2H8HA 3D2KA 4YIFA 4YNOA 4O1OA 4R79A 3V7CA 4ZTQA 2EWNA 1ZG1A 1R1VA 5L8LA 2JDSA 3RK9A 4ORKA 4FV0A 4RZVA 2ZMEA 2H96A 3FL4A 4D5HA 4KT5C 4A12A 1CKPA 3QXOA 3L9FA 3KK8A 3HRMA 1OKVA 2YA9A 3LQ8A 3RJCA 4E6AA 3NUPA 4Q2AA 5DN3A 2ADUA 2BALA 4KINA 3JTHA 3F5XA 3V7SA 1LEZA 3UQFA 4ALVA 3ZDIA 3UBDA 1GIJA 2VWVA 1H1RA 2JKMA 3IOKA 3VIDA 2E9VA 4FVQA 4ETSA 2YIRA 4JBVA 4TKSA 1W7PB 3EZRA 2BYVE 3ISPA 5JI6A 3IGOA 3QRJA 5AP4A 3QQHA 3LFEA 5K9IA 3P9IA 5AJQA 3F5UA 3DA6A 3ANRA 3CQWA 4O0SA 4I5HA 5HVQC 2M8EA 5DT0A 4R5SA 4M73A 1KUTA 4IHSA 4LOQA 4IMYA 4OLIA 1HKQA 2Y6OA 2CGUA 4XP3A 3FLQA 3PVBA 5IQCA 3TNPC 1P5EA 3ZMSA 4O0TA 3PVUA 4EZ3A 1V3FA 3D7TA 4FR4A 5J87A 4BZOA 3ELKA 5BQ0A 4I92A 1K79A 5CVJA 4X3JA 3VVHA 5CVVA 4RGXA 3HVCA 3PXRA 2FSMX 2RN7A 3WTYC 4RFMA 3PXZA 3B2TA 4AW1A 3CLOA 4IF4A 2PY3A 4D2SA 4FSUA 5HS8A 3ZN1A 1SNUA 1DAYA 3TDZC 4D4RA 3OCBA 3BHHA 5LGNA 1VTNC 3QQKA 2RG6A 2FRHA 3KREA 4FUXA 1WSUA 3KMMA 4C62A 4LOPA 2YWVA 2OQGA 5E18F 3MJ2A 2OQRA 4AIKA 5IQAA 2YLEA 2W4KA 3W1FA 3WZJA 2XKEA 5TE0A 5BVKA 4GK3A 4G16A 2YIWA 5KUPA 2A4LA 4LM5A 4M67A 4JG6A 4KIPA 4X2KA 4ZTNA 4IHTA 4ASEA 3U4UA 2FSWA 5DOSA 1H27A 2WZJA 3SHEA 2R7DA 4D4SA 3QKKA 5J8CA 3AQVA 4CRSA 3KXZA 4I0AA 1RDQE 4D2PA 2CGVA 3ZRLA 3E6BA 3ORLA 4ASNA 3W55A 3KP7A 5IUHA 3WTUC 2HK5A 1KU3A 4PPCA 1RI7A 4DFBA 5EM5A 4IB1A 1OPLA 5IEXA 4KICA 3UPXA 2DK5A 4I6BA 4CCUA 2ZNZA 5TOZA 1SM2A 5LHGA 5ETFA 1T45A 3F8CA 2F5FA 5CVFA 4WXDA 4F7NA 4F7JA 5LWNA 3OW3A 4WXCA 1JSVA 3GU4A 4X7QA 4EOOA 5LMKC 1R1UA 4QTCA 3MH3A 4L9NA 3QD2B 4JG8A 4J53A 2VBYA 2QO7A 4JS8A 4UNOA 4EGYA 3E63A 4O38A 3WE4A 4W8EA 4X2FA 5FP6A 5GZAA 5F1RA 5K5RA 2X2KA 3PXFA 4BZDA 3R7UA 1Z57A 2B9JA 3QKMA 3ZMZA 4WNKA 5E1ZB 4CV8A 2EV0A 5M4CA 4LUDA 3FXZA 4EM1A 5HQ0A 3F82A 4EH3A 3MFRA 1P6RA 4GSBA 4PUZA 2J0KA 4TYGA 3G9LX 3QX4A 1ZYCA 3E93A 4GJ3A 3D5XA 3D5UA 3FZTA 4FL2A 5BYYA 3PQJA 4OGRA 1BX6A 3FMHA 4PL5A 4E4LA 3K3IA 5DV5A 5L3CA 2PE0A 4QP6A 1YW7A 4J71A 4YJVA 5F1ZA 1BUHA 5E9EA 1R23A 2WFYA 2B7AA 3HP2A 2BGCA 3DPLC 2B9IA 4BB4A 1Z6RA 4EH6A 5AA9A 3U6IA 2C4GA 2Y4IB 4QTAA 5HD4A 3LHJA 4ZTRA 4ACHA 4BCOA 1I1SA 4D2TA 4EJ7A 3WILA 1FNNA 4F64A 4CNHA 4XLPF 3FMMA 2C30A 3SLSA 4X2GA 4AFEA 3PXYA 2UUEA 2GHMA 3M8EA 4KA4A 5E8SA 4PX6A 1PMUA 1H00A 4I41A 4R78A 2GS7A 2H6CA 5AMNA 2R5TA 4QWQA 3KP3A 3FMEA 3SW7A 4IANA 4EM2A 2QR7A 4UZDA 5E8TA 3H0ZA 2W99B 4F6SA 3NSZA 2IT0A 1XCVA 2GNFA 3LLTA 4USDA 4BWXA 2Y9QA 1DM2A 4XV9A 1KSWA 1I6XA 1M2PA 2O65A 5AUWA 3C4ZA 1FX7A 5KKRB 2VGOA 5IISA 5AIPA 2B9FA 5FRIA 3RKYA 3MIAA 3QKLA 4L45A 3UIMA 5LHHA 5IT9K 5AAFA 2C5VA 3TZ9A 3GB2A 4IW0A 4EH2A 2EB3A 2VC0A 4EUUA 1UFMA 3HOSA 3TI1A 3E3VA 2FOKA 3DBCA 4L67A 2XF0A 4EORA 3DJ6A 3NRMA 4QMYA 3Q9VA 4MF1A 4HLYA 5DHJA 3VS7A 4M14A 2R3HA 2XNNA 4XV3A 3R83A 2E1NA 2YX7A 2PWLA 3KMUA 5AAGA 3V8LA 3FJQE 1ZY5A 4LG0A 2F2CB 3A4PA 4IM0A 2BE5F 2JAVA 5ITAA 1ZOHA 2NYXA 3VQHA 1REPC 5B2KA 1AD5A 2UVXA 2VE9A 2OH4A 1P4FA 2X7OA 4MEYF 1OPKA 2OJ9A 3S0OA 3D5WA 2PEXA 2VWYA 4FEVA 4HW0A 3OXZA 4UYNA 3EQLF 2VRXA 1GZKA 4DH3A 4HVDA 3P7BA 5FTGA 2ITZA 1UNLA 1RE8A 3C5UA 2PVJA 2ACXA 2QOBA 5CU0A 3OUNB 5LLQA 1LDKB 4HGSA 3QZHA 4BXUA 2IW9A 4TXCA 1T98A 5HDGA 2DUVA 4WX9A 5EI6A 1Q3DA 3HNGA 1XBCA 3ZMVA 2W96B 4K1BA 2I0HA 1YS6A 3QF9A 4QRCA 2WOTA 2WNTA 4U5JA 4YJPA 3WF9A 4WG5A 4U43A 2QZ8A 3TNWA 5L3BA 3BWFA 4UMRA 2ETHA 4G7ZF 4MXCA 1LPUA 5GJGA 4JAJA 1EV7A 3LCKA 4IX6A 3LMIA 4WNPA 1QMZA 4I1ZA 4MXOA 4DCAA 4W9XA 1UKIA 4G6DA 2QHMA 2VO0A 4E5BA 4PPAA 3MH0A 3U9GA 2XIYA 1OIRA 4BR3A 5TT7A 5K5QA 4QMPA 5EW9A 4XSZF 4NFNA 2JFMA 5HICA 1BL6A 2E2BA 3ZSIA 4ZSJA 2HY81 4FZAB 4PRJA 4DFUA 1OR7A 2UW8A 3E3BX 1HSJA 4P2KA 1U6GA 4O7TA 3C4EA 3PA4A 2P8TA 4RGSA 3A2CA 4NJDA 4TYHB 4G34A 4B4LA 2ISZA 5DEWA 2IN6A 3GU7A 5EEGA 2A2AA 2CNUA 3AD5A 1OB3A 2WMSA 1BI8A 3HSRA 2UVYA 3QTRA 2W1ZA 3HMOA 5CSWA 3ORNA 3PJ3A 3JVSA 4FSRA 4TV7A 3PP0A 5AA8A 3GC9A 3AT3A 3IONA 1JGSA 1HSTA 4J95A 2YJSA 2CSNA 4XG7A 1RJBA 4ESJA 3MH1A 2UW5A 4EM0B 4ZSEA 3DPTA 3PY1A 4I21A 3ZSHA 1HKTA 4LLGF 1ZH5A 2QI8A 5IQFA 3PFIA 4ZTHA 1CKIA 2QKRA 5HIBA 3UOKA 2O63A 3ZLSA 3MPMA 3R28A 5DYMA 4QTEA 3GU6A 3C0GA 2QLQA 5C03A 4ITJA 4RIWA 2C0IA 5JN2A 4L01A 2L3DA 2MH9A 5I0BA 1NVRA 1NA7A 4LV5A 4CHUA 4M69A 5IEVA 4CD0A 5LEKA 3L7WA 4KMUX 4UVAA 4JDHA 4LK1F 3VBTA 3MFTA 2NRAC 2VX3A 5I3OA 4A9SA 5M09A 4PL3A 3OHTA 1YIOA 3BEGA 2HKOA 2F5CA 3L8VA 3L9NA 4C02A 4EKKA 2VWUA 4XLIA 2ELHA 3VEPA 5HLNA 4F65A 4QQTA 4C4EA 4YFNF 2LNBA 4U42A 4FV5A 2XMYA 1K3AA 3RVGA 1ZOEA 3GQIA 3H92A 4KNYA 3MBLA 5FXSA 2B1PA 5L6PA 5DUKA 3FZRA 4CO8A 4ZLYA 4CEGA 4AZEA 3NEUA 4RSSA 4PDKA 4FG7A 3RPSA 4OW8A 2VV9A 1JSUA 3RHKA 3N9XA 2XYUA 3D15A 4Z2YA 3GXLA 2FBIA 3O71A 1R1WA 5JQ5A 3DBDA 3P9CA 3E5XA 2R3FA 3KEXA 4YZMA 2P6SA 4IM3A 3KQ7A 4X0MA 4BBFA 3GU5A 5E8YA 1IF1A 3G0EA 3TZMA 2IVVA 2GQSA 2WQMA 2CKQA 2VX0A 5CYVA 3TGNA 3VW6A 4LL5A 4WF2A 3RCJA 2ONLA 3PRFA 4YIIA 1IRKA 4MK0A 3WODF 3FMKA 4C0TA 1LJ9A 2PFBA 3Q9YA 3W2OA 3ECOA 2C69A 2X4HA 4ZOGA 4DGGA 2FQ3A 4GXOA 3LFQA 2VWZA 3T0YA 5M55A 2M87A 3BBTB 3FL5A 3FQEA 2UXNA 3A61A 4IVDA 2W1DA 1SMHA 3OY1A 4RJ5A 3P86A 2D45A 1XH5A 4CLIA 4ZLZA 4EV0A 1S29A 5K0KA 3U9NA 5DGZA 2OWBA 1OIYA 5GJFA 4BRXA 3DNDA 5CENA 3K2LA 3BE2A 5D12A 4XBFA 4U45A 4Z9LA 3R22A 5E1XA 3D7TB 2DQRA 3IKTA 2H6DA 4DFLA 4A2UA 4WUNA 3ZO2A 3TQNA 5G6VA 2OF4A 2ITYA 3GU8A 2YIXA 2PUUA 2PMLX 4LGGA 1PP7U 5IH6A 3EN5A 3QHWA 2JGZA 3LCDA 3FWEA 3GQLA 5JRSA 3SAYA 3CS9A 4NM3A 2EV6A 5ICEA 4G5PA 5HEZA 4GUBA 5CSXA 3G3ZA 2VO3A 4BHBA 4XRFA 2JFLA 4PMSA 4BKZA 5HE0A 5HDKA 4XV2A 2L54A 5LMBA 4DTKA 3FLZA 5AUXA 4A9YA 4MNEA 5CAVA 5IT3A 1MJ9A 4E5WA 3NMUF 4O86A 4EK8A 4XOYA 4ZZDA 1ZAOA 3OCSA 1WVYA 4OIOF 4DT8A 5D8KB 3WIKA 3RIRA 4D4VA 2PE1A 3LLAA 1UKHA 1MRUA 2IJLA 4EOJA 5EDPA 3U51A 5HTIA 2STWA 2BIYA 1T38A 4JLCA 4FK3A 1XHAA 1UVRA 4RFZA 3UVRA 2K27A 2ZM3A 4MYGA 3MV5A 2P7VB 4FX3A 4BHCA 1CGPA 4B0GA 3R2BA 4BI1A 2QOOA 4FIEA 4EBVA 3BGQA 2BHHA 4HVSA 1XH9A 1O9UA 4JJRA 1JVPP 5L8JA 2CN5A 3GFLA 1KV2A 3RYPA 4AA0A 2LF7A 3LFAA 5BUIA 3O8UA 3M11A 4RFYA 4FF8A 3WTSC 3O2PE 4O21A 4HPTE 5M4UA 3VUTA 5BVOA 1E1VA 4IJ9A 5EOLA 4K2RA 3FKNA 5LVPA 1M17A 4BTMA 2DS1A 4FOBA 2WTKC 4NH1A 2EK5A 3CSVA 1UU3A 4HZRA 3BLHA 4DG0E 3CTJA 2O0YA 4E73A 2X6EA 5FM2A 2VTPA 2CG4A 2V9VA 3RCDA 2RVCA 4EQCA 4NUSA 2YDIA 3FAAA 3OTVA 4QMXA 2YDJA 4R3PA 4S30A 4RLLA 3OBGA 5JK3A 1PDNC 3U1DA 4R7IA 3FDNA 3I7BA 2EB7A 1OYIA 5CF6A 3UPZA 3EOCA 4JBAA 3SV0A 1ZN2A 2ZDUA 1OL1A 1OL6A 3LXPA 5L4QA 5C26A 3OEZA 3NNXA 1YQJA 2IA2A 2VAGA 2QYOA 4OTFA 3HX4A 3NEWA 4C2VA 5HTBA 2DPDA 3JTGA 4EJUA 5CALA 2PBIA 3QA0A 2ERZE 3TV7A 3FXWA 1B1BA 3RKWA 3LMHA 3PY3A 2PVYA 4GL9A 4F7ZA 2GNJA 5AM7A 1A9UA 3OFMA 2I0YA 4EOSA 4YZ9A 3MPTA 1FBQA 5ED4A 1XGNA 3QQLA 3OVVA 1PW2A 3HRCA 4WG3A 3DTCA 1APME 3Q5IA 3GT8A 3TUCA 5BVFA 1WI9A 3MZHA 3J81Z 2XNEA 2BVAA 4YJOA 4UV8A 3QQJA 1YRPA 1FMKA 3DXNA 2DQLA 1XMKA 3ECHA 3TKYA 2OA4A 3BBWA 4ERKA 4ZZNA 4HYIA 4RC3A 2LAVA 2HEOA 2UW3A 3NGAA 4G3CA 1YFHA 5E8WA 3F23A 4RAZA 5H3QA 1YW8A 1WVXA 5AV2A 3KN6A 1IA9A 4OAUC 2MBFA 2P7CB 4KSPA 3ZM4A 2XZSA 3DOGA 5E17F 1WWXA 3VULA 4IRHA 3IQ7A 4Z7GA 5HO8A 4HGTA 5AUVA 5T6KA 5CTPA 4NWMA 4NB5A 4NIFB 4DG2E 4BDHA 4O0UA 4A6EA 3L1SA 4Q5EA 4ASZA 4FV9A 2J50A 4FKPA 4GFMA 3R6SA 3EKKA 3VAPA 3G90X 1J91A 3VWAA 3DFCB 2HW6A 4TNBA 4FG8A 1H1WA 3BGZA 3SC1A 4QP2A 2QOCA 2OJJA 3F5GA 5EHOA 3MY0A 2X0GA 3BHYA 4IRGA 4C3PA 2PUIA 3KL8A 1YI6A 3FE3A 2BAJA 2QURA 3DV3A 4S05A 4HOBA 3VO3A 2BRNA 3FPMA 2O3PA 3GEZA 1H9GA 3FZVA 1TKIA 4XV1A 3VBYA 2YSRA 2BFXA 2ETKA 4L7FA 4LG0B 2OFUA 4ANQA 5HKMA 3ULZA 1I09A 1XR1A 1HCKA 1BI2A 2KULA 2VOPA 3ENMA 1RNLA 2IP2A 4UYAA 5C9CA 1WKMA 5DCFA 3Q60A 3LJ0A 4OUCA 4CMUA 3VJOA 4LOOA 2YITA 2FSLX 1W98A 4Y5QA 3NDMA 3ZOSA 2XKCA 3PPKA 2L4AA 3R02A 4D0WA 4FNYA 4EYMA 4BC6A 4BH9A 1FYLA 3ORIA 2EFOA 4HCUA 5M08A 3EQGA 4FNXA 4BGHA 3FLYA 3G73A 5HCXA 4GRBA 4KBKA 4YJTA 2YM8A 3FZSA 4MCVA 4X3FC 3L00A 2EFNA 4MQVA 4RVLA 4AN9A 2J5PA 5BYLA 4FIJA 1FVVA 2UZTA 5A14A 1EH6A 4DINA 3PRIA 5LVOA 2XK9A 3VUKA 3P1AA 4BDBA 1L8TA 2IW5A 3LW0A 4YLLA 2YU3A 5DVRA 1M7QA 3FSFA 3CE3A 4CFVA 2YDKA 1USSA 3T3VA 2K86A 3I6UA 3VBWA 3BHVA 2JKOA 1FP1D 3KULA 2JZYA 1DPUA 2GXBA 2CCIA 3CXWA 3WE2A 3FMLA 4PGHA 5H20A 3VQUA 4TN6A 3P08A 2GA1A 3F61A 3DKFA 5H8GA 1R39A 4IAAA 3CGFA 3H4JA 2DFIA 2OU2A 3PQKA 3O7LB 5A3XA 3V6RA 4Y46A 3PSCA 2EFPA 4G3GA 3F3TA 4BF2A 4IWPA 5TRDA 3KK9A 5AUUA 5I9YA 3MTFA 1BBYA 2W1FA 4FZFB 3UG1A 4HYHA 4FSTA 4M0ZA 5A2QZ 5A9UA 4WWCA 3QQGA 4UUVA 4QQJA 3R0TA 4HYSA 2W25A 1YXXA 2RNJA 4KDPA 1OYWA 4EH5A 1UU7A 3R04A 3NVKI 4BCGA 2IG7A 1FYKA 3FM3A 3ZBXA 3CUQA 3DB8A 3QTZA 3NNUA 1QPMA 5FBOA 4IHPA 1BIBA 1P14A 2NPQA 4O0YA 1B9MA 4MXXA 2J6MA 3QU3A 5IQEA 3PLAE 4RIWB 3F8MA 3I7CA 1U59A 2Z7LA 3SOCA 5E8XA 4NJ3A 4M69B 4MQ9F 4ZYEA 4PMTA 3MFUA 3E8NA 4XLNF 4NM7A 4LLLA 2IZUA 3FF5A 2VODA 2R64A 4CRLA 4NW5A 4YJRA 3DAJA 1AQ1A 4FEUA 5DFPA 4O22A 1IN6A 1YHSA 4FTJA 5IPJA 4BL1A 3T8RA 4MD8E 3LAPA 5CF8A 1H0WA 4IH8A 2PZYA 4K0YA 3MB6A 2HW7A 4NW6A 1KE7A 2JPBA 3NW6A 4GT3A 5HLWA 3P78A 3UYTA 2HTSA 4D4YA 4MEDA 5HDNA 2PMHA 1XSDA 5BX0A 1PYXA 4WNMA 1H9TA 3Q4ZA 4NCTC 1XBBA 3JS2A 4X21A 5ILSA 4EK5A 1PXJA 3UYSA 4RIOA 4G9RA 3RP9A 1DDNA 4EWQA 1HW1A 5DRBA 2X9EA 3OUKA 2RL5A 2X2MA 5CASA 4YBJA 3PY0A 4CG8A 2WMTA 3DB6A 2J7TA 5A6OA 4HGEA 1LB2A 5ICFA 3NYNA 3LA2A 4AACA 2WWYA 4PTGA 4PCQA 4BGGA 3WZEA 5AV4A 1W7HA 2UZEA 4M72A 3FMSA 1SMYF 1J7IA 3W2PA 3H0YA 3PVGA 2ITQA 2WO6A 3W18A 2DQ7X 3VBQA 5E8GA 4UMTA 3BX5A 4DA5A 1J0RA 1OITA 4FTIA 4O27B 4MXYA 4MBLA 2QODA 4O96A 4BCMA 4FKWA 4QPMA 4W4VA 2PK9A 4D0PA 4S33A 1KOAA 3UZPA 3HSEA 2WIPA 1H0MA 3HV5A 4C8BA 5BPIA 2ACJA 5KCVA 3D4QA 2JITA 2EWAA 4DH8A 4HA8A 2VWXA 2PVLA 1A48A 4FT3A 3Q6WA 2PL0A 2RSVA 2RKHA 4E4NA 1WQ2A 5FEDA 1ZRFA 3FEGA 2JIVA 4WKQA 2G7UA 5AR5A 2XAJA 1Z9XA 2A5YB 3PZEA 1ZMWA 4FV3A 3QRKA 3ZUVA 4L7SA 3CO6C 2V7OA 4FGBA 1K9AA 3I1AA 1OYYA 1LEAA 4IVBA 2ITOA 4ESFA 2CSOA 1E2XA 3HEGA 4QP7A 2ISYA 4Y8DA 2FYSA 5CVHA 1ZZ2A 3KMWA 4U40A 3D5VA 4UVBA 5HOOA 4IIRA 4BDKA 3UIXA 3ZP5A 2FMLA 1XDSA 3I59A 4DH1A 3V4GA 1MD0A 3CPBA 2DT5A 2WIHA 4IAFA 3RINA 1IAHA 2XCHA 5EG3A 1O3QA 1X8BA 3MS9A 3ZMUA 3OZ6A 3CCNA 4YTCA 4MX9A 2BRMA 1IR3A 4JQ8A 4QMZA 3H10A 1U5RA 3ULQB 3KRRA 3DXJF 2C0TA 4FV6A 3J80Z 1QPCA 3EFJA 3V7RA 3MJ1A 4B9DA 4TWPA 5KZ0A 2UW0A 2HXQA 4FIFA 3C1DA 3OWKA 4O0RA 1YDSE 4U0WA 2R3IA 1IN8A 3KGAA 4F6UA 4O0WA 4IAZA 3REOA 4FZ6A 1YWRA 1CKJA 4KKEA 1TQPA 4OBPA 2J51A 3FX3A 4KIBA 4E1ZA 1B4AA 3DKCA 4YSJA 3V5JA 4PWNA 3R9HA 3TUBA 2UXXA 4DHFA 2WGJA 5AONA 5JFVA 5AX9A 4PV0A 1P4WA 3GUBA 4TWNA 1HW2A 2M5WA 4G6LA 4YHJA 2G7HA 2P5KA 4DYMA 3MAJA 5I4NA 2GPHA 3JSPA 4K9YA 2HTJA 1Q3WA 3PWYA 3IKAA 5B2MA 2F5DA 4O7WA 5HU9A 3R9DA 4QMUA 2PMNX 3HHGA 4ANOA 3ZEPA 4ANLA 4D2RA 3DBEA 4K2EA 3FMDA 4IBMA 2EXEA 5AIQA 2C3JA 4AOIA 4FV7A 4FV4A 4GVAA 3ZRMA 2O8XA 4FKJA 3TJDA 5HZNA 1OKRA 4DTAA 4L5IA 2Z02A 3O2MA 4EZ7A 3AGMA 5EQYA 4ZEGA 3BQRA 4R3CA 3KETA 1XSXA 4NM0A 2VTOA 4Z55A 2CLXA 5K3YA 3CQEA 5E8UA 3V51A 1W7PA 1PMVA 3V5WA 2YJRA 2HYFA 4QMVA 2XAFA 3PSBA 1UA2A 4BZNA 5I9ZA 4DEAA 2XROA 2O2UA 3FHRA 1XCBA 3WU1B 3ZPLA 3LFSA 3R7IA 2C1AA 2C5YA 2J0JA 3NZ0A 4H1MA 4KN7X 4FG9A 3ROUA 3V8KA 4FHTA 1LVAA 4GJ2A 4O0VA 2QM3A 3I81A 5A54A 2B52A 4UZHA 1YDTE 3WE8A 4KUMA 3TO9A 2QLUA 4PTEA 4AZSA 2VN2A 2OW3A 2CN8A 2ZV8A 3NYVA 3ZMTA 1QQIA 1REJA 3LXNA 4OTHA 3KRLA 3PIZA 3ZFMA 2WQNA 4EJNA 3QPHA 5KMOA 3NUYA 5D7AA 4U41A 1GZNA 2MLGA 4FZ7A 1Q99A 1SFUA 3D2IA 5AIKA 3DFAA 4EOPA 4YZDA 3AMBA 1GHCA 4ZYGA 4OBOA 2OD5A 1H0VA 4CGZA 2ZV7A 5JFXA 4FIHA 5CXZA 2YM6A 4KIOA 2B53A 4DE4A 3K69A 4AP7A 4UXNA 3VBVA 3KC3A 3P4KA 4RWKA 3BRBA 2Z9OA 2PVNA 3F6XA 4N57A 3NAXA 4B8MA 5L8KA 2Z5UA 4OT5A 4MTDA 3QP5A 3SG8A 2P0CA 2QG5A 3FYKX 1YLFA 4FEQA 2CWEA 2R3GA 4FYOA 4FTLA 4DBNA 1ZG5A 4RVMA 4I24A 3PSDA 1RIOH 5EM8A 2H94A 2DWBA 2OK1A 3BJAA 2PMUA 2QCSA 2Z7RA 3GC8A 4ACMA 3NUNA 1I27A 4DF3A 4BCJA 4EC9A 2BZJA 2XK7A 3R0JA 3EN7A 5I3RA 5EW8A 1IRGA 1WAKA 4CFMA 4I09A 4MBIA 3LIJA 3B8RA 5IA3A 1G5SA 3GO5A 2R3SA 2R0IA 4BI2A 2XKFA 4DCEA 4E20A 2YHVA 2ITTA 1Q8UA 3PTGA 4ENNA 5ANDA 2QENA 2I7QA 4HNIA 1UB9A 4Q9ZA 3MESA 4KSQA 5JSMA 2YERA 4O81A 1L0OC 2V1UA 3D0EA 2GFSA 2X2LA 1KV1A 5C4KA 2VO6A 4L3PA 3DK3A 2JRTA 4JDIA 5TO8A 4FSNA 4IZAA 5AR2A 3SRVA 2GS2A 2CKPA 4FKIA 3G15A 1FQ1B 5C01A 5CEIA 2IPXA 4ZJIA 2XEZA 4LMYA 2FSTX 4Q48A 2ETMA 1ATPE 5GIOE 2K02A 3RTRA 1ZYDA 3HDMA 3PIYA 3EQHA 2UZUE 2O6GE 4XP0A 4QQCA 2V5QA 2LKPA 3V8WA 3OD6X 4DLJA 3LPBA 2Q8KA 3F2NA 2R2PA 4XG2A 4RB3C 3MA6A 2L4MA 3QCSA 2J2IB 3I79A 2NAZA 3KXXA 3LQ3A 3J81K 2V0DA 2JDRA 4FNZA 2CGXA 1W0XC 3KP4A 4QYYA 3E64A 3RMFA 3O0GA 2CYYA 1I1GA 4CQGA 5ICPA 4RQKA 4XG3A 4X3FB 2WMUA 2JDOA 4KBCA 3S1HA 4MVFA 4A9RA 2BMCA 2FGIA 2XV4S 2ZO4A 2OIQA 1PUEE 3R1SA 4O0XA 4Q9SA 3A7HA 2C6YA 4F7LA 4BTJA 1D5VA 3VUIA 4AOJA 3QYZA 2O3FA 1XN7A 4C58A 4CYDA 1W83A 1RQQA 2GDOA 4CFXA 5ICGA 3EFKA 3KULB 3BEAA 4JK1X 3KCFA 3ROCA 3ALNA 1TQIA 4TTHB 2P2IA
chains in the Genus database with same CATH superfamily
4KD1A 3DK6A 4DC2A 1P4OA 3HTSB 4CFWA 4I6FA 3W0SA 5J7HA 5JQ8A 1QGPA 1NVSA 4PFPA 2H34A 1FGKA 4H3QA 3RI1A 5D5WB 1IC8A 3W33A 3MTLA 2V6EA 2VKDA 3GWZA 1J1CA 4YMJA 4ZTFA 4QMLA 1NW1A 1R00A 1DPRA 2UZDA 5HVYA 3AD6A 1S9IA 2FA2A 4GK2A 3MZ8A 2GNGA 3IL2A 2UW7A 4EKLA 1QL6A 5D1JA 3GFEA 2FQ4A 4N6YA 4FT8A 3OS1A 3QRIA 4Y17A 3R7GA 5HBHA 3LFKA 4JRNA 4JX7A 3HZJA 5AFVA 3UC4A 4KITB 2PG4A 4YIRX 5FFZA 3NW7A 4FI1A 5KK1A 4FEWA 2Y9ZA 4OU0A 5J4YA 4N0BA 2COBA 2OXXA 2PU8A 4CUGA 3QHRA 2ZXJA 4RVKA 1SD6A 4JBOA 3A7GA 5FGKA 4GFOA 3CUQB 4F1MA 2MSYA 3OWPA 3LOCA 5H8EA 2OBJA 4UMPA 4OTRA 1T6SA 4F3QA 4HSRA 4HX8A 2OG8A 2EFQA 4O3MA 2EZHA 4LGWA 5EEAA 1SD7A 1GIHA 2GNIA 2XH5A 2E7XA 5TKDA 3TKHA 4B09A 5CU3A 3NVMB 4YFKF 3E8DA 1OKYA 4YUQA 2XB0X 4QDEA 3MKWB 4Y85A 5E90A 3RM7A 4QT1A 3L9PA 3ORKA 3C4XA 1ETWA 2G01A 2PE2A 2BR1A 3ZQ7A 1Q5KA 3A8XA 4HX4A 2NRUA 2PZPA 5DD8A 4UEUA 4JIKA 4II5A 4EVIA 2G15A 4F9WA 4PJNA 3S3IA 4M3DA 4QMTA 4I6HA 2ECCA 4QLCU 2FNPA 1KU7A 2DAOA 2XM8A 2CJMA 3D14A 1Q8ZA 3I3LA 3ZMDA 5K5OA 4TZRA 4EC8A 2YM7A 3DAKA 4O84A 2AUHA 1R5GA 2OC6A 3AT2A 5DWRA 5IMEA 5CT7A 2VI6A 3HL2A 2JVHA 1ZGAA 2I1MA 3BR1A 4U6RA 3S17J 1XS9A 5KZIA 2HDCA 1W84A 1SC7A 4V01A 1T46A 1FOTA 3X2QH 3FI2A 3Q5ZA 3R71A 2ITWA 3C4CA 1D1BA 5KNLA 2E1CA 5CSPA 2YISA 3DAEA 1UAAA 4C37A 4BIDA 2XUUA 3NYOA 3QQUA 4IVAA 3IRQA 4I0BA 5CLSA 2HENA 1E1XA 2OGVA 3EH9A 4YC3A 2RC4A 3ZLWA 3LSHA 2W57A 5GAGJ 4LB5A 1FOYA 4C59A 2OV7A 1EJ9A 5T3QA 4AA4A 3LA7A 4FEXA 2RKUA 2E60A 1GV5A 3WGHA 3BYUA 4Y72A 4BDGA 3C1XA 1Z7LA 5CI6A 3LCOA 3U2RA 5EYMA 4C3FA 5DUIA 4GFBA 4OWRB 3OBJA 2DOEA 3KX2A 3BQCA 2G9WA 4RT7A 1XBAA 5DRDA 2JK3A 5A2QK 4YPSA 3LZBA 4ENYA 2DU9A 5BPDA 2OFVA 1YS7A 4DQ2A 3CKWA 3TCPA 1O6YA 2VONA 1O4XA 1KWPA 5HNGA 2FH9A 1M2RA 2JBPA 2C3LA 1V4RA 3AC8A 2QOIA 3V5PA 4AVPA 3JRIA 5EDNA 4PP7A 4EQQA 2DYLA 2YIQA 1LQ1A 2DMUA 4W1UA 3AFHA 2PYWA 2IF8A 4CXAA 5ANEA 2ITPA 1AOYA 1G8KA 5IQDA 4L9IA 1POGA 2JUCA 2HAKA 3RPUA 1ODDA 3MH2A 5E92A 2NYAA 5IP9J 2R5YA 3Q9XA 3KIOC 4JI9A 5A4EA 3WHBA 5F1JA 3EYGA 5D7VA 5TISC 1SYKA 2Y75A 2C1BA 2DW4A 2CQ7A 5KVRA 2WB1A 4ZIMA 3BR0A 2FMYA 4F9AA 3OROA 5JRQA 4M7IA 4QO9A 1BN5A 2MC4A 3PA5A 2C5OA 4GIIA 4U8ZA 5GAHJ 1JSTA 3HRFA 1XH4A 1URCA 5LVLA 3I4PA 2GWRA 3EL7A 4E6CA 2PTKA 3O51A 3O6BB 3KN5A 3D0SA 3LQRA 5LGUA 3QC9A 3W0QA 4NTSA 2VUMJ 2EA2A 3S00A 2IVSA 5M5YJ 5EDQA 3MD2A 1J2XA 1OPCA 4K18A 4AU8A 1B59A 2LYCA 4L46A 3LFUA 4C3RA 3L2WA 2CNVA 3TMOA 3N4TA 4ZJJA 3C7QA 2XGCA 1J9IA 3FKOA 2R3LA 1O3SA 5JGDA 3FM5A 1OBGA 4PDSA 1BC7C 5J1UA 3UNZA 5IA0A 3RKQA 1YKRA 5CU6A 3S32A 3Q04A 4BBEA 5K4JA 2G1TA 4ALUA 3A62A 3BDDA 3IV5A 2HPIA 1HCRA 2DPUA 3PJ1A 2A07F 4ZZMA 5F08A 1O3RA 4ON0A 3RK7A 3TO7A 4P9FA 3LKMA 3M4OJ 5KE0A 5L2SA 2AXTC 2BY0A 4M6YA 5JGAA 4BDYA 2CQKA 3K3JA 1NG7A 2C3KA 1QPDA 5DYJA 4ZSLA 5L6OA 5B1AH 4YTIA 5FO5A 5LRRA 4KWPA 2OI4X 2X0LA 1PXMA 5J8IA 4O7LA 2WTJA 3KFWX 5DH3A 2M7AA 1MNMC 2YAKA 2ELJA 3VJNA 3FI8A 1YRNA 2HOGA 4BBSJ 3BU3A 2NO3A 4S31A 2QU6A 2PULA 3UJGA 5IH4A 4V19K 3RYRA 1WMKA 3MB7A 3R9OA 2VD5A 2QSHX 5DA3A 2Q2EA 1MBHA 1BJAA 4EH7A 1ZOGA 3TACA 4M8TA 1EKEA 5FG8A 2CNQA 3B73A 3Q2JA 1YITI 1IAWA 2JPCA 3DLLF 2XIKA 4EUTA 4CA0A 3UO6A 3DDQA 2JSPA 2O9LA 3FC1X 4ZK5A 2H1KA 4DAWA 4YHFA 3CTHA 1SFKA 5BPYA 5D5UB 2IVMA 1T8IA 2HVQA 2YN8A 1IASA 3TV6A 5JH6A 1TNSA 2X8EA 4CZUA 2F4MB 3LXLA 5FEEA 3OMVA 2ZV9A 5J8FA 3JW4A 1ZYSA 4AN3A 2P4IA 4UB7A 5GZ9A 5DEQA 3ZLYA 5C8KA 1KE9A 1BA5A 3M1CA 1ZR2A 3S3OA 5IZFA 1BMKA 2XJ0A 3KF4A 4ZY4A 5HS9A 4BWKA 3MA3A 4YZNA 1M7NA 3E0JB 5B1BH 1OZ1A 1W7PD 1ZELA 1QZYA 3KFAA 3WF5A 4XOTA 4CMOA 4CKJA 1ZTRA 3R1YA 3F3VA 2ZSIB 2IGMA 3F72A 3DK7A 4CCBA 4QMNA 3I58A 3AGLA 5EHLA 2GU8A 1IA8A 5LVMA 4OIPF 1M2QA 2A1AB 4MH7A 4RA5A 4I01A 2LMDA 4C38A 4RM2A 1BKXA 3J80K 4NL0A 4KIKA 3R01A 2XM9A 2KL4A 4F92B 4YR8A 2BW3A 4YZBA 1ZRCA 3JY0A 2DMNA 1NHAA 3F22A 1G8SA 4D55A 5JHFA 1Q24A 3LCSA 3WG7H 1XJDA 1TQMA 3O96A 1H25A 4GMYA 1MP8A 3J7AO 3OSGA 2X1DA 3VUDA 4U44A 4NKAA 1ZQ3P 1K4SA 3HUBA 1OGUA 3GTOJ 2R3PA 2Q0OA 3RDIA 3AT4A 3BYMA 4AZFA 1PP8F 2HKXA 5HLPA 1SAXA 2Y8OA 3GFMA 1H1SA 1OL2A 2W24A 4XG6A 4A6DA 4EYJA 1U5TC 4IAYA 4QMWA 4ENMA 2VT3A 3WTVC 2KRFA 3K70C 5GZ8A 2E5ZA 2UZNA 3LXKA 3JR1A 4IVNA 1YWVA 4IC8A 4IXPA 4P55A 4NFMA 1SD4A 2IZRA 2GIVA 2RFNA 1YO5C 5AR7A 2NNYA 1H26A 1AGWA 4ZDPA 3A60A 2F9GA 1X58A 2WU7A 1WJDA 1PXOA 4PPBA 4FL1A 3FK6A 3OT8A 3G51A 2CU7A 2F6CA 4XYFA 5IQHA 3H0GJ 4YFXF 3LVPA 4J01A 3HV3A 3D83A 3GZ6A 1FOKA 5ETAA 3D5RC 1YDRE 4L52A 1VYWA 5D5XB 5L3FA 4A4LA 3KEQA 4KIGA 5I9XA 3GCUA 4HRIA 4XLCA 4WNOA 2W84A 2WMRA 1XC5A 2FNAA 3ZC6A 1BC8C 3R61A 1R49A 2QNJA 1A6IA 3KZYA 3POOA 4NM5A 2KQRA 3BE9A 1ONVA 2E9PA 1IXSB 4P4CA 3RQ4A 3E88A 2XYNA 1QPEA 4MIMA 1R0EA 2WMBA 5HNBA 2JA6J 1DI8A 1J09A 4G3FA 2KDOA 5FLVA 2P5LC 4O4BB 3F88A 3K1MA 4ZYDA 5J1RA 2WB8A 2W00A 4K11A 3THBA 5HORA 1R22A 5AP6A 4G9YA 1PJRA 2Z60A 2VXZA 4XK4A 3DLZA 3R4KA 5HG8A 3HMPA 3KF7A 2PPQA 3LQ5A 1YHWA