1TQIA

Crystal structure of a. fulgidus rio2 serine protein kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 91
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqiA02
2YA9A 4XYFA 4UALA 4AE6A 2TDXA 4XSXF 5HORA 4A9TA 4OIOF 3HV4A 3QTSA 2WOUA 2GAUA 1TNTA 3IKTA 2DWBA 5AA9A 1O3RA 2XAHA 2JLDA 4KBCA 4BTKA 5DVRA 3G73A 2CGXA 1ZYLA 1ZLKA 5FLXK 3RK5A 4TRLA 2WTVA 5DG5A 3QA0A 3UQCA 5E90A 4KBKA 4ZAUA 1I1SA 5DH3A 5ICFA 5FD5A 1J91A 3EQPA 2VBZA 2YCSA 3R7EA 5EI8A 5HG8A 1JQHA 5BVEA 1XH8A 4QP9A 1VYWA 5E1ZB 3OROA 5EEGA 4XG2A 4Y15A 2BROA 5IA1A 4JDIA 4A4OA 4FSWA 1UCRA 1RE8A 4ETSA 4N6YA 4FK6A 3FMRA 3PA5A 5ANDA 3NS9A 2MC3A 3UOLA 4BDGA 5DR6A 1PJKA 4MD8E 2VN9A 2R5TA 3PPZA 3BZ6A 1STZA 2P55A 1IXSB 2FNPA 3ZMVA 4GMYA 4O1OA 4W4WA 2WELA 3OXTA 5BUIA 3LW0A 3PTGA 4P5ZA 3QAHA 3Q2MA 4HLYA 1H1WA 2XK9A 1JKLA 4RFZA 2WMVA 2VTOA 4WD5A 2CKQA 3HRCA 1V0OA 3LOKA 3OVVA 3GW2A 5AX9A 3I59B 4WWCA 1NA7A 2C5XA 4FIGA 2XNPA 2Z3YA 3QQUA 2L01A 4RC2A 5EOLA 2W84A 3ZEPA 1S9IA 3L9FA 4RLLA 1R3CA 1XMAA 4ESJA 5ICPA 1FY7A 4Z7HA 3ZMDA 2JTVA 3HNGA 1OPCA 1AGWA 4LGDA 2CG4A 3SD0A 2O6GE 2VNYA 4RZWA 4GCJA 2VV9A 2GQSA 3M11A 4YNOA 1BX6A 2DAOA 3NUXA 4G6QA 1W7HA 1WBTA 5FRIA 1BN5A 2A6HF 2IZSA 1IAJA 3TV7A 4Q5HA 4C4IA 2FU4A 3OF0A 5AIKA 4YJQA 3DJ5A 1ND4A 2YCRA 3SXFA 2XRNA 4FT0A 3K5VA 3NPCA 1ZH5A 4MXXA 1PMVA 4R6VA 3F23A 5HX8A 1LDKB 3R7YA 2QO7A 4HGTA 5HNBA 3PDTA 2YPRA 1ZOGA 4EZ5A 4XV3A 2PMNX 4WXHA 5ILSA 4O96A 3GF2A 1PP7U 1U46A 1P6RA 2VWXA 4KAOA 1G5SA 3EFWA 4AFJA 1KU3A 3T8OA 5EYMA 2GFSA 5FTOA 3TZMA 2DQRA 4LB5A 2PZIA 1YG2A 4C58A 4RG0A 2AC3A 1XN7A 4QP1A 2E1CA 4FMQA 5IH5A 1B9MA 2FSOX 5HS7A 3PJ3A 4F70A 1PXIA 4XLPF 1P4WA 2OAZA 5JN2A 3ZO3A 2X8EA 1MP8A 3GC8A 3MESA 4KT5C 1G6NA 3DB6A 5KMIA 5HCZA 2GSFA 2RFSA 2RDPA 2WTKC 3IWZA 4MF1A 5CX9A 4YFKF 2QQAA 4HLXA 4O7LA 1MDMA 5ICGA 3I5UA 3QLGA 3HL7A 2HYGD 2UZOA 3JW4A 2IJMA 2VTMA 1BI1A 3RAIA 1O6YA 2WTJA 2Q2EA 3BBWA 3OWLA 3OWJA 4WXDA 4EWQA 2C3IB 5BVKA 4AZEA 4M3QA 2JRTA 3OOMA 2GHLA 4D0XA 3THBA 2M8EA 3QD2B 4NT4A 3ZRKA 4DFZE 4BCKA 1YTYA 2J6MA 2D1HA 3HP2A 4I92A 5KBRA 5HTBA 2D45A 1YDRE 3T8RA 3GC7A 1YOLA 4G9CA 4O7SA 5A14A 4Q5SF 4BI1A 2J90A 4AN2A 4FV0A 2HK5A 2P6TA 1B6CB 1FMKA 3NW5A 3VBXA 4GU9A 3KRJA 1DM2A 2F7ZE 2KRFA 4QQJA 4BBEA 2QR8A 5C4LA 1TVOA 2V79A 4QMNA 2XHKA 5D5XB 5M4FA 2XKPA 2J7TA 4NIFB 3E87A 1WAKA 4OLIA 3KFWX 3V04A 3KXZA 2IP2A 1O6LA 3JVRA 4GG5A 4L68A 2J4ZA 1OVEA 3CR0A 3QUEA 1JKTA 5CF5A 2XM8A 4LYNA 3HMNA 1S9JA 3TOBA 3IS5A 1S8NA 5E91A 4QPMA 5D7VA 4QMYA 3F72A 1EH4A 5C8MA 4LFIA 4UVCA 3KP2A 4EJWA 5A2QZ 4FV1A 5IQIA 3FMKA 5H20A 4LGWA 4N0BA 1VR2A 4FL3A 3F3WA 4EZ3A 1YHSA 5GZ8A 4U0WA 4AA5A 3BDDA 4L9JA 2X2KA 3RKXA 5CVIA 2VX1A 3GUDA 2GFCA 4Y13A 4I4FA 2PY3A 3FEGA 1F5QA 4DYMA 3VBWA 1OECA 2O0UA 3OOGA 3SQQA 3AXWA 2UW4A 1XR1A 5BMZA 4IZAA 4EOIA 5E8GA 5HD4A 3R7OA 2HCKA 2R7IA 3BE9A 4FEWA 3F7WA 2M30A 5LHGA 1KQ8A 4Q47A 3QF9A 3SQNA 2V22A 5EHOA 3DAKA 1O3TA 3WU0A 4YLLA 3ZLYA 5AR3A 5CEMA 4RGUA 3RTRA 5HCXA 2XEZA 2X4ZA 2BDFA 3L8SA 4XRLA 2XBAA 3CD8A 4TYEA 3ULZA 1HKSA 3ORPA 4FKOA 4FKLA 2F5DA 3TDVA 4NWMA 4USEA 1XH9A 3EN6A 1FVRA 3A61A 5C27A 3OCGA 1Z57A 4UWYA 4MWHA 3ZXZA 2B1PA 3RI1A 1MRYA 4X2KA 3VS1A 4Q5EA 3QD4A 3VBYA 3DNDA 2Z9OA 5IH6A 1PMNA 4BZDA 5D4SA 2HZIA 4RRVA 4B9DA 4FKGA 5JRSA 1OZ1A 3DPLC 4DTKA 3HV6A 4X2GA 1Q24A 4M6XA 3ZH8A 3WTZA 3SG8A 2VT2A 5LGTA 2PVYA 4FKSA 5CSWA 4X3FA 3TJDA 4AZSA 5K4JA 4C3RA 4G31A 3KZYA 2BHEA 3ZEWA 2ITPA 2DPUA 3TV6A 4EI4A 1E1XA 2E9PA 1KQ9A 4NM5A 4ZK5A 4V01A 1B4AA 3JVSA 3EOCA 3R9RA 2CKEA 1PKDA 4FG9A 2ZO4A 4OMYA 1YLFA 4FIIA 5EQPA 1IRFA 4FSMA 4XP2A 3DP7A 3OG7A 2YX7A 2WTWA 4A6DA 4FNYA 2ADUA 3ZPLA 3W8QA 2VT3A 1O7LA 3FPMA 2OZAA 5TR6A 4K1BA 1H01A 5IUGA 3GEZA 5HLNA 3R02A 1J0RA 4AOIA 2G2IA 3C4ZA 5GJGA 4DFYA 4FVQA 1YW7A 2YLEA 1Z9CA 2C0IA 2PMHA 3E3PA 4XMOA 4XLIA 4FV9A 4O5VA 4A0YA 1TKIA 1H9GA 1ZG5A 2XZSA 5LMKA 2W5BA 3IRRA 4GG7A 3AD5A 1UFMA 4NFNA 2X2MA 5J79A 2XK3A 4FT7A 3SRVB 2XAJA 5CU2A 5B2LA 2PI0A 4E4NA 1T46A 3FXXA 3BBTB 3TTJA 3TEIA 2UV2A 4W8DA 4L00A 3GXOA 5LLQA 4YC6A 4BDJA 5TO8A 3RPVA 5LMBA 2VTAA 2WU6A 1P2FA 1W0XC 4JBOA 1Q1HA 3KZZA 3FZRA 4BI2A 4DHFA 3RK9A 3JTGA 3PZEA 4MX9A 4BWPA 3S2WA 4EM0B 4TXCA 1XB4A 2UZWE 2QOLA 2F7XE 3P9IA 4E4MA 5FBNC 2H27A 3ZO1A 3JAMK 4BWXA 5CANA 4O7ZA 1YFHA 4XHKB 4TNBA 3FI3A 5M56A 3DXQA 3GCUA 2STWA 6PAXA 3UIMA 5BVOA 4EV0A 3ZONA 3CSVA 4E73A 4HPTE 3SX9A 1ZMWA 4EOJA 4CCBA 5FWKK 4AG8A 4UYAA 5HVKA 5EQYA 2XK4A 5CAOA 4RA5A 1GZOA 3LWFA 4AGCA 2PUIA 3CQUA 1YS7A 4RWKA 4O0XA 3NDMA 5AA8A 1YOMA 3QTIA 5DEQA 4O7RA 4M0YA 4MTEA 2ITNA 3GZ5A 4RB0A 3I81A 2C30A 2C5VA 2PL0A 1YDSE 3P5KA 4DH7A 5ACBC 3NCZA 3VS2A 1ZGAA 3C5UA 2RV8A 4FV5A 4EQMA 3DKCA 4CT2A 4CFFA 1A06A 3WILA 4Z7GA 3BU3A 4ANLA 4KRCA 4PGHA 4QMQA 2E9UA 3MVLA 4C59A 1H1RA 2FBKA 3WIGA 3TQNA 2JFLA 4G5JA 4KWPA 3KE2A 4HW7A 3DBCA 2ZDUA 1GVJA 2YJSA 4II5A 1W82A 3V5PA 1LEAA 2B54A 5AP1A 5AR2A 4C36A 3WZEA 3A8XA 3VOEA 2IA0A 2J0JA 1JKKA 1JWHA 3F69A 3ZRMA 3R6XA 4HGSA 4U41A 4UMUA 2GS7A 4AX8A 4DFBA 1KU7A 2X0LA 1PXPA 4U3YA 2J0KA 4KIFA 3ANQA 1W7PB 4EBWA 1B6AA 4YSMA 2VBWA 4MEYF 1RNLA 3NVKI 1I27A 5DI1A 5D5VB 3KY2A 4U7BA 2H34A 3TV4A 3OBGA 5L3BA 2UZNA 4UXLA 1SVHA 3A60A 4QMSA 1NVSA 2WMSA 2VX3A 4RIYB 5D12A 2AS5F 1OUYA 1KU9A 4CDGA 3K69A 5ANOA 2VU3A 2DTRA 3EMGA 3JR1A 2FSTX 1SMTA 3LFSA 5EK7A 2WB8A 3DLSA 3QZHA 3O8PA 3R1SA 3QRUA 5J9YA 4RC4A 2XVCA 4IFGA 4CICA 2UVYA 2PQ8A 3MEXA 4XBFA 1IA9A 3GCPA 4U42A 4IVDA 3A7HA 1I5ZA 2L4MA 3AT3A 4KKHA 3P1AA 3C7QA 2OBPA 4EQCA 4PZJA 2Y8OA 4RPVA 4JI9A 4R7IA 3DZQA 2V1XA 5E8SA 3HGKA 5C26A 3Q5ZA 3NIEA 4WBOA 4CZTA 4XS2A 3I6WA 3ZN1A 3LM5A 4O7VA 3IOKA 4FV4A 4IMYA 2R3PA 5CU0A 4HCUA 5E8ZA 2H6DA 3HRSA 1G3WA 5D6FA 3KN6A 4AVPA 4D4VA 3UQGA 4DH1A 3HYIA 3Q9ZA 4FSYA 3QQGA 1F4KA 5JR3A 4F9CA 2ZYBA 5AEPA 4AQCA 5CEQA 4NM3A 4F0FA 2GCDA 1XJDA 3RAWA 2UW3A 2MA3A 4LK1F 4O6JA 3K1NA 1UNGA 4A0ZA 3R8LA 3V51A 3WTVC 3SHEA 4EJTA 3GQIA 4FKRA 2ZOQA 4XV1A 2GNIA 2XNEA 4UV0A 3I53A 4TKSA 2PE2A 2E7XA 3UE4A 4H58A 2GNLA 2X4FA 3UPXA 2I0YA 5F94A 4WXCA 5M57A 3KP4A 1OKWA 3K3JA 4EGZA 3TKYA 2QENA 3QALE 1PXKA 3QOPA 3D94A 3COMA 3BX5A 4J52A 4X6QC 5LWNA 5IH4A 2W9FB 3AC8A 3MI9A 3A4OX 2YHVA 4C37A 4BIEA 2CWEA 5CI7A 3SA0A 3H10A 3GCQA 2D1VA 3NUSA 2YX4A 3GBZA 5EI2A 2YITA 2C6DA 4P9UA 4B0GA 4USFA 5FTGA 2R7FA 5E7RA 1WWXA 4I94A 4I2OA 4L9TA 2ZB1A 3QTXA 2HKXA 4XJ0A 2WHBA 2BAQA 2CMWA 3UIBA 1Q3DA 1OKVA 4BDBA 1L3RE 4MXCA 3VUIA 4D5KA 4IACA 4FT5A 2P6SA 4L67A 4L9VA 1Y6AA 2W1ZA 3KP5A 4WKQA 5E8YA 4CKIA 3UG2A 1J59A 4RWJA 4JQ7A 4BXUA 2BRNA 4BICA 5L2SA 2FF4A 3GENA 3C7JA 2EWNA 2C5OA 1W7PA 3MB7A 2YABA 4PMMA 4M72A 3DK3A 4NZWB 2ETKA 5A6OA 3EH9A 3ZDUA 4IC7A 1FP2A 3DY7A 2QURA 1ZGJA 4O81A 2WIHA 2LKPA 1FBQA 4YZNA 3V5LA 3TG1A 3Q4CA 5LJJA 1LDJA 2ITTA 1DS5A 3O8TA 4FT9A 5CS6A 4O27B 3MW1A 4XH6A 1JSUA 3ZZEA 4F4PA 4FKWA 5A4TA 3VUGA 3VRYA 3ELKA 4FC0A 1U5TB 1XQZA 2PPQA 3JY0A 3LPBA 3IDBA 4L9NA 2YIQA 2HYYA 4EHVA 5JZNA 5AP5A 3VNTA 2UZTA 2VO0A 5CSVA 3R1YA 2BR1A 3A7GA 3BWJA 5CALA 3WU1B 3ERKA 5TF9A 3IPHA 2BV6A 5E4HA 3HSFA 2GXBA 4P4CA 3NSZA 2I40A 2FH9A 2QNJA 3BGQA 3C1XA 3A7JA 3OOPA 3G9LX 4P90A 3ORLA 1U54B 3MBLA 3MTLA 4DGNA 4JBVA 5LEKA 3GI3A 5E1EA 3DS6A 3AC1A 4CG8A 2Y9QA 5HO8A 3AT4A 3ODYX 4GJ2A 2OXYA 1HW2A 4EK8A 4BFMA 2XKDA 3ISPA 3PJ2A 4DEIA 2C6EA 2BIKB 5IEXA 2BZJA 1ZWSA 3B2WA 3A8WA 1UHWA 2GU8A 5KMOA 4XG8A 2BDWA 3IKAA 2RQPA 4RIWB 4QTAA 4FV3A 4X2JA 1F3MC 3FQHA 4FIFA 2ZKZA 2WWYA 4LGGA 3NYNA 5DE2A 4X2FA 5JEBA 3G33A 3J7AO 5CXZA 3VQHA 1HKQA 3CJFA 1XGMA 4UX9A 2QOOA 3LJ2A 1XWSA 2B9FA 4D4RA 5LHIA 3HV3A 4QYYA 2HZ0A 3PIZA 5DCMA 2YISA 3O96A 2C3JA 4BKJA 3F7ZA 4DGMA 1M7QA 3CD3A 3ATSA 3DDPA 5TRDA 1H28A 3RVGA 3K2ZA 4DEDA 4K2EA 3QZFA 2QLZA 1CKPA 2BRMA 4ACMA 4A9UA 2UVZA 2Y4IC 4LLLA 5CSXA 1J7KA 2F49A 3NYXA 2QD9A 4PMTA 4QP2A 5D1JA 1KV1A 1H1SA 3QUDA 1R78A 5K5NA 2RVCA 4KIKB 2JPBA 3UO5A 4YZBA 4NU1A 4IHTA 4HAMA 4FNXA 1YQJA 4CXFA 2RGVA 4OGRA 2XRWA 5C1QB 1YWVA 3PP0A 3M1SA 3FC1X 5LVMA 3AC4A 3AGLA 3ZO4A 5L8JA 1WVYA 3Q60A 4U79A 3EIDA 3PE1A 3LFDA 1LEZA 4DINA 1WSUA 4U7ZA 3SC1A 2XK7A 4F7ZA 2CGWA 3DNEA 4FT8A 3C1DA 1W84A 2JDOA 1H27A 4M13A 4EH2A 4F63A 4CFVA 3TNPC 3BY6A 3BWGA 5FO5A 1STCE 2HZ4A 4E4LA 4D1XA 2B0QA 4A9RA 1G3TA 5AV3A 2Z02A 2O5KA 4XNEA 4M69B 3MH3A 3F88A 5CU6A 1H0MA 5GHVA 3VF8A 3DBQA 5I9XA 4ZMEA 3LCKA 4UB7A 5JGBA 3P7NA 3QRJA 1J9IA 1SD5A 4LG0B 4EUUA 3R30A 3DLZA 4ASXA 2FNAA 2RFDA 3MPAA 5E9EA 4BCMA 2IVMA 2XJ1A 4RVMA 4RVTA 5FUTA 2IZUA 3FX3A 3LFAA 3G90X 4GGGA 5F4NA 3BPVA 4JNWA 1K79A 3PLSA 2R0UA 3QGWA 5GZAA 2X6EA 3BOQA 4U6RA 4LB6B 2WEVA 1IXRC 1P4OA 1CSNA 5D8LB 3OCBA 2QODA 3RZFA 4BWKA 5BYYA 3MY5A 3EYYA 4C4EA 2XIYA 4ZY4A 3E88A 4WNOA 3KP7A 2R3GA 5IQAA 3R8UA 3G0FA 3DV8A 3NUAA 3D15A 4EK5A 5AP3A 4XV2A 3RCJA 3Q9VA 2PE1A 3F8NA 4G3GA 4KINA 3HV7A 3DTCA 1TW2A 3D7ZA 3HHGA 4O83A 5I9YA 2W9ZB 4TT7A 4C57A 3GVUA 3P7CA 2Z99A 5GINE 1TNSA 2ITXA 4IAIA 4A9YA 1MDMB 3VIDA 1XH5A 4J1RA 5HBHA 4DTBA 3ANRA 1A9UA 3NNWA 4KIKA 3RYPA 3BHTA 4F7NA 4IVAA 5M07A 3I6UA 5EOBA 4BCJA 5EYCA 5DOSA 3I79A 3KEOA 3VB2A 5E1SA 4LOOA 2L3DA 1R1WA 4L18B 3FLNC 4FX3A 1PUEE 2P7VB 5EW9A 4ITIA 1Z7UA 3R0TA 4LLNA 4I0SA 4AF3A 5DCMB 2BRBA 2K7LA 4BNCA 4JRVA 4O6EA 1CMKE 4YNEA 1YW8A 2K02A 2XNGA 3IW7A 2A3SA 4KIOA 5B2MA 3ORTA 3ULIA 2NS0A 3R0JA 3D2KA 1YVJA 2C6IA 4EKLA 4B4LA 4DITA 4KABA 5K4IA 2WQNA 4PL4A 4JVGA 2QLUA 2YERA 4LMYA 3ORNA 5AIRA 1ZHFA 4A6EA 4JX7A 4L8MA 1YXSA 3KFAA 4M71A 4DBNA 4RJ3A 5A4EA 2J0LA 2CCIA 5CAUA 5JMSA 2ITWA 2OIDA 4TWPA 2W1IA 5L8LA 2XH5A 4FTIA 4HVDA 3CTJA 1FPUA 1LR4A 1YWRA 5AJQA 5CAQA 4KA4A 4PF4A 3P9CA 3GGFA 5A54A 3WE3A 4ZJJA 5JHUA 1IZ1A 3TO6A 4E6CA 3R1QA 4Z3VA 4L52A 3CTQA 2PEXA 1YXTA 3QYZA 4CTBA 3AOXA 3GC0A 4H3BA 4E20A 3DB8A 2EXMA 3RIRA 4HVIA 3VUDA 3GFWA 4QPSA 5KMMA 2ITOA 3OUNB 5BUEA 3EQDA 4YIFA 3R9NA 3FZ1A 4PTEA 5IA0A 3FI2A 3OW3A 5CF4A 2PZ5A 4R3CA 4RFYA 3BE2A 2AYPA 5EEHA 3DDQA 3O50A 3L2CA 1QPDA 3QCXA 2RC4A 3EQFA 4R3RA 4E5AX 2UXXA 5C01A 3SGCA 3MWMA 3I7CA 2HELA 2YLFA 1ON2A 4IIRA 5GNKA 5LVOA 1YOJA 1EH6A 4G94A 4FA2A 4MQ9F 4ZIMA 3UIUA 2DQLA 2FBHA 5CVRA 4Q9SA 2Y4IB 3PP1A 2XKCA 3LHJA 4K18A 3Q6UA 4W9XA 1FLIA 3FLYA 5JRQA 4QD6A 4ENNA 4R1HA 4F7JA 3BROA 2G7HA 3ECOA 3PPJA 4OBOA 2HZTA 2M87A 1KQ0A 4FX0A 4KIGA 3Q5IA 4LJZF 3DAEA 4TL0A 1IAWA 2YWVA 1R1TA 2NRYA 1YI3A 3VUKA 5DWRA 2VX0A 1L0OC 4HJOA 3S4QA 4O86A 4NL0A 4JBQA 5IDPA 5TE0A 4IZYA 2F4JA 3UOJA 3TZ7A 3WGIA 1H8FA 3BPXA 3RMFA 2JKQA 4FTTA 4KIQA 3TO9A 2XP2A 2R3FA 2YDJA 3F5XA 2FQ3A 4K0YA 3WYYA 4M15A 5I9VA 2XMYA 4JQEA 1BLXA 4NEUA 5HU3A 3GFEA 3RNIA 2OW3A 3SZPA 4X3FC 3ZP5A 1BJAA 5HDGA 3QGYA 2FEZA 4E93A 5KO1A 5D6EA 3NW6A 4D28A 3P9JA 3ABTA 5L2QA 3F8CA 3PY3A 3DEUA 5JFWA 4MEDA 2NPQA 2A68F 3UDBA 2H09A 4FOCA 3POOA 2MLKA 3DK6A 3SG9A 4MTAA 3E63A 5EFQA 5ANKA 5HTCA 1W98A 4I5HA 1H0VA 4KN4X 3KL8A 3KP6A 3MVJA 2DI3A 4NJ3A 4FG7A 3RAHA 3GFJA 5FEDA 5JFVA 4I41A 4EEVA 3GFMA 2XIXA 3LFQA 1JBPE 1QGPA 4EQQA 3BYUA 4DFXE 3U55A 4IXAA 4ORKA 3RAKA 2QU5A 4HQEA 3PSCA 1W8CA 5KKRB 3W1FA 4RAYA 5LEJA 4DN5A 2ESMA 2VC1A 4AE9A 1H07A 1MJBA 1ZYSA 1ZMUA 4FTOA 3CE3A 4KS7A 2EFNA 3T9IA 4I0RA 3GT8A 4ZJIA 3UNKA 2IW5A 4U43A 2HYFA 5T3QA 1FWZA 2JC6A 2E9VA 4OU0A 3CJNA 3O8UA 2QONA 4K77A 4F1TA 3ZMUA 2WQMA 2JGZA 4FL1A 3PE2A 4CFWA 3MA6A 3LQQA 3M42A 4AW5A 1KYZA 1XGNA 3CP9A 2COMA 5J8FA 3W55A 3UMWA 3FV8A 3WIKA 4MXZA 4BHPA 3ZUUA 4CKJA 4RQKA 4BBMA 5AR4A 2ZVAA 3ZU7A 2OJGA 1YHWA 4Y46A 5FM3A 5M09A 5H8BA 4DGOA 4GK4A 4PDKA 3ET7A 3DJ6A 2OFVA 4O0WA 3FLZA 3TUCA 2R0IA 2HW6A 4EH7A 4DFNA 5FM2A 3UC4A 5HI2A 2ZJ2A 4R1YA 4JT3A 5HNIX 1UU9A 2QBYB 4EOKA 4KN7X 3ORXA 2C6MA 2IZRA 2GIVA 2QOHA 4EJUA 4FX4A 2PMOX 4M84A 1IW7F 4ALUA 4E1ZA 4RB1A 2WMQA 2W1DA 3KK8A 2EB3A 2EV5A 3R01A 2HIWA 5JGDA 3IRQA 2YIRA 4FSNA 4F99A 2ERKA 4D1SA 3U6IA 1OIUA 5LBQA 4IB0A 3HKOA 2BEOA 4BHBA 4ZYEA 1JKSA 4FZFB 1UKHA 3IL2A 2XYNA 4BN1A 3OV8A 5HBJA 4WOVA 3AC3A 4MBJA 4MWIA 3OCSA 2QHMA 4TY1A 4GT4A 1JHFA 4BL1A 3DKGA 2VTJA 3CO7C 1XCVA 2X9FA 3LCDA 3A7FA 5HVJA 5CF8A 1NW1A 5DIAA 3V01A 5E17F 1WRJA 4FTUA 1PXLA 5BUJA 2PMIA 3ZN0A 4YJOA 2E2BA 2HTSA 3NVMB 4A5NA 3CTHA 3E3VA 5JFSA 3LCOA 4FIEA 2OO8X 5EDPA 5LVLA 4Q2AA 5HE2A 3SV0A 3VJOA 4BCHA 1H25A 3TZ9A 5DUKA 2CLQA 1RQQA 4EJOA 2XGXA 3S0OA 5M51A 3ORMA 1T2KA 4CMUA 5AIPA 2Q0BA 2OWBA 4IM2A 4PL3A 4V05A 4F0GA 5L6OA 4X3JA 1REJA 3OMVA 3FWEA 3E6MA 4ZTQA 3JS2A 2KTYA 1NVRA 5HVQC 3HUGA 2GNHA 3RM7A 2YFXA 4CKRA 2QZ8A 3AT2A 4YHTA 3KXMA 2QQBA 2IO6A 2VE8A 4KNYA 4F64A 4QQTA 4DH8A 3WYXA 3ZUTA 1W83A 2BALA 4ANSA 3UP2A 5JFRA 3LFFA 4KUMA 3SKCA 4E3CA 4AXAA 5BVDA 3BYOA 4BTMA 3HAVA 4R7HA 4Z9LA 3VS6A 3VFZA 1ZRDA 1Q4LA 3U2RA 1WZYA 2Y75A 3WTSC 4RB3C 4X21A 5FXRA 1GZKA 1UHMA 2R3MA 4G17A 2M5WA 2OFUA 4IDTA 3R0AA 3TUBA 1PYEA 4RFMA 5LXMA 4DE4A 2OGVA 4FUYA 1R7JA 5L3CA 5HCYA 1R36A 2OJ9A 1FVVA 2J5OA 5BMMA 5FB2A 5IQEA 5AUXA 4RGJA 3ULQB 2HOGA 4YBKA 2SRCA 3OY1A 2O64A 3KP3A 3PZHA 4IX6A 3IW4A 1Q97A 2JIVA 3LA7A 4J98A 4DC2A 2OJJA 1QPCA 1GIHA 2FUMA 3QQFA 4HVSA 4P7EA 5BVNA 2PMLX 2A27A 5ANIA 4BDDA 1DPRA 3ZMSA 4D2VA 2B9JA 4UHTA 4LLGF 4E4XA 1YI6A 2V0DA 5A4QA 2X0GA 4JQ8A 2IA1A 3L9MA 4EWHA 3DTWA 1O9UA 5DYMA 4UVAA 2W1EA 1OL7A 2F2UA 3LQ5A 4DFLA 3SOCA 4LV8A 5D8KB 1BIAA 1I6XA 2QG5A 3QTUA 5DGZA 2O8YA 4R77A 4DEAA 4GSBA 3GU5A 1BUHA 3FXRA 3W33A 3B8RA 5M53A 3MWUA 1PRYA 3PXYA 5M4CA 4IBMA 1KE7A 5I9UA 1B38A 3QKMA 4HYSA 2IVSA 3CKXA 5JK3A 2XKOA 5J6XA 4UZDA 3RPYA 5EKOA 5EW3A 3F3ZA 4MNEB 3F8MA 3QWJA 5L2WA 2BIYA 3KF4A 4QRCA 4IRIA 2JD5A 4RA4A 2QYOA 4CRSA 2Y48A 4WNMA 3FXUA 2W5HA 2JDSA 1T98A 1GXPA 3QX4A 3BI6A 4M68A 5J1VA 2OZUA 3SHFA 3AMAA 4I6FA 1ZN2A 4M9ZA 4BGHA 5L3GA 2VOPA 3KA0A 4JDKA 2C6LA 1OL5A 1KSWA 4YJUA 4KRDA 1SNUA 2YM4A 3GLXA 4PNIA 2FGIA 4CLIA 3Q5FA 2XAQA 4I01A 1ZYJA 3RNYA 4RQVA 5HICA 1FQ1B 3I0TA 4I93A 1OYYA 1J1CA 4S31A 4AW0A 5C4KA 4F7SA 2R4BA 4RJ4A 4BGQA 4AW1A 4F08A 5AX3A 3MB6A 4W4VA 3VHEA 4CTCA 2UUEA 1K3AA 4G3CA 3II5A 1OITA 3HDNA 2JITA 3SVVA 1WBVA 3I59A 4U40A 3CTAA 5IT9Z 1XDUA 3O23A 3DBDA 3Q32A 3RPSA 3SDJA 4EBVA 4UYNA 2FE3A 1IXCA 3V8SA 4XRFA 4UXQA 2WPAA 3QQLA 4RIWA 3CPCA 1V3FA 3M8EA 2UVXA 3E62A 3ZRLA 4NYEA 3CXWA 4QMUA 3C13A 4IX4A 4G5PA 4E8AA 3QU0A 1SFEA 5KZ0A 5F6FA 5FTQA 4I02A 2JSCA 3V5TA 4HNIA 1EH8A 3QQJA 2G7UA 2CKOA 1H9TA 4V04A 2ELHA 3ETAA 1GIIA 4FTRA 3R9HA 1IRGA 3EN9A 1FBSA 4MK0A 4K11A 5HDNA 4ENKA 3C4EA 5H8EA 4NB5A 3R2YA 3VS3A 1XGSA 3DGKA 4UN0C 4KBAA 2VC0A 2DPDA 2VTTA 2A5YB 2E7WA 3L9LA 5DCFA 4EJVA 1FZPB 2J50A 5CSPA 2WU7A 5HG7A 4IXPA 4BIDA 2R3NA 2OIBA 3W8LA 1ZZLA 2FRHA 1W7PD 3MJ2A 3FMNA 1ZXEA 3GUBA 2LF8A 3REOA 3ITZA 3DK7A 3V8WA 3GO5A 4MKCA 3K2LA 2PYWA 4C7TA 2P0CA 4P96A 1KOBA 4CQGA 4HZRA 5LCJA 4YO4A 3ZLWA 4PRJA 1Z9XA 4DT9A 1Q99A 5BOXA 3PUPA 3FAAA 5IA2A 5FG8A 4U8ZA 4EGYA 2XROA 2BILB 3H4JA 2A69F 3W10A 3TM0A 2JIUA 3U9NA 1YRPA 4BR3A 4G7ZF 4WK8F 2OU7A 1LNWA 2YM5A 2CQKA 3MIAA 3F22A 3MFRA 2BTSA 4FEVA 3BLRA 3F2RA 4ZEGA 5DRBA 2DFIA 3JTHA 3ZFYA 3FE3A 3DXPA 1YXVA 4Y83A 3TKHA 4NUSA 5FQDC 3BCEA 4FEQA 2WMBA 3BU6A 4U0IA 4OBQA 5IQDA 2BYVE 5HIEA 5E1WA 5AUYA 4CXAA 3ZS5A 4M14A 3FXZA 3T5XA 2XCKA 2FMYA 1K6OA 3BP8A 4A2UA 1R00A 1R0PA 4PX6A 4PUZA 1PKGA 2BAKA 3HMOA 4BCOA 2NYXA 2VGPA 3Q4TA 4JXFA 4IRGA 1FOKA 2F5CA 4O84A 1J7IA 1J2XA 3EL8A 2RKUA 1URWA 2WMRA 4GFGA 4O91A 5HHWA 3NEUA 3LCSA 2ZJWA 4LG4A 2GNGA 4XG4A 4FR4A 1WBNA 2ITZA 3FY0A 2Z7RA 3PXQA 4KICA 4QT1A 3NEWA 1TQMA 2X6DA 1U54A 3QRTA 3FHZA 4QTBA 3VBTA 3VBVA 1CKIA 3UZPA 1OBGA 4KDPA 5LVPA 3FC2A 1ZY5A 3CJGA 1ZG1A 5AONA 4PPAA 2DLLA 2YM7A 5IQBA 3TN8A 5B2KA 3QFVA 1CM8A 4AT4A 3ATTA 3C0GA 5DEYA 3ZSGA 2H6BA 3OWKA 2ERZE 4QMVA 1RZ4A 3KCFA 4QWQA 3Q6WA 3F3XA 3R04A 3ZSHA 4EHGA 4PP7A 4Y85A 4NH1A 3NR9A 4MQ1A 4I5CA 3WODF 4YIIA 4I21A 5IU2A 3AQVA 5H9BA 4QOXA 3K3IA 4BTJA 4BZNA 3PJCA 3H3ZA 3HAMA 3FF5A 5AUUA 3QX2A 3AAFA 2C47A 2RFEA 4LUDA 5J7HA 5CU4A 4C02A 4CLJA 4O0YA 4FSQA 2X1NA 4ZSEA 3WZUA 5BQTA 3TWJA 1BIBA 4PTCA 2RN7A 2YAAA 2WMXA 1X8BA 3PQKA 4P5OA 1YXXA 4CGAA 2PG4A 2KULA 4QP4A 1ZG3A 2HS5A 3WGHA 1ULYA 2ACJA 2CNUA 4ACHA 4OR5A 4FSZA 3H9FA 3POZA 3PJ1A 5LARA 3IK3A 1YI4A 1FGKA 1UU8A 2ESNA 4XX9A 5E8TA 5IPJA 3L8PA 2A61A 4TWNA 1TQIA 5E18F 2NRUA 4FGRA 2C6TA 3EHAA 1U5QA 3HRBA 4IB3A 2W1CA 2ONLA 4KD1A 4YFXF 4FVPA 3Q4UA 3O7LB 3I5NA 2I6LA 4CFNA 3JSPA 5HE3A 2DT5A 2ZV2A 4MD9E 4WSQA 2GZWA 5IF1A 3EFLA 3U87A 3GX4X 3TT0A 2Z33A 4W4XA 3VS0A 3EFKA 3L9PA 4KYWA 1OIQA 5J9ZA 3QXOA 2H96A 2WO6A 2IPQX 2BE5F 3ZMTA 2XAGA 5IISA 1JSTA 5CAVA 3V8LA 4DEEA 2C5YA 2HXLA 5LVNA 5DDGA 4R8HA 5HEZA 2O61A 2JZYA 3VF9A 1XH7A 2CKPA 4C3FA 2B55A 2DQ7X 2WNTA 1KYWA 1TQPA 4FSTA 4RX9A 3KRWA 3W18A 4WSYA 5AV0A 3CQEA 5F95A 1YW9A 2W05A 4I23A 5AFVA 4X6RA 3K5UA 2WTIA 4NKAA 1XGOA 1H1PA 4B8XA 3FDNA 5I4NA 4ZP5A 3KKVA 1W5SA 4YPSA 4N9HA 3FLWA 2V5QA 4BY9E 3ZBFA 4HZFA 2XVDA 3VHKA 3D0SA 4EH5A 3DCVA 2BCJA 2IA2A 5CTPA 2HQRA 3WF5A 2VWWA 3N4TA 4EK6A 3L7WA 5KMJA 4TWCA 4EH4A 2HQNA 2PVMA 4CGZA 5IDNA 3TJCA 3OP5A 3A99A 4EKKA 3TCPA 3W2SA 3KXXA 2WAJA 3G2FA 3PA3A 4CFUA 4ITHA 1P4FA 4FT3A 3ZSIA 5HDKA 5EI6A 4WUNA 4UV9A 3ZCLA 4R79A 2W24A 2ZB0A 5L3AA 3TIYA 5BYZA 4CFMA 2Y0AA 4IEBA 3HZTA 4ENMA 4GKHA 3DU8A 5IQCA 4RIXB 2X2LA 4LI5A 4NW6A 2ZMDA 4GUBA 3IOPA 5CZHA 2BFYA 4S05A 3K54A 3OZ6A 3HRTA 1DPUA 3G6GA 2R3OA 1XCBA 1Q8YA 2ZMEA 3LE6A 2VXZA 3W32A 4DG3E 4CSVA 1T6SA 1J3HA 2OD5A 2Z7QA 4FZAB 1U6GA 1P92A 3LCTA 2UZEA 4R5YA 1K7AA 4QP7A 5HO6A 4JOAA 5HBEA 3SZTA 2W0JA 5CQUA 2XIKA 2RFNA 4L5IA 1Q8TA 1Q41A 3LFKA 5HD7A 4RWIA 3H3CA 1GXQA 2DUVA 3E5XA 2QQ9A 1ZRFA 1QMZA 3HRFA 3LMIA 2LAVA 4F6WA 3EZRA 3HMIA 3MFTA 4DLIA 2DBBA 1XKKA 2OA4A 4XOZA 5H3QA 4DF3A 3P79A 3NNUA 1WBOA 1DDNA 2MBFA 2IZTA 4EJNA 2M1BA 4WNKA 3UVQA 2PVJA 4HYIA 2VONA 1ZOEA 3R28A 5AUWA 5DRDA 2CGPA 3MN3A 4UMPA 1H08A 2J2IB 3WZDA 5JFXA 5A4LA 1FSHA 4IE9A 3FKLA 1PDNC 1SZMA 2P5KA 3CS9A 4H3PA 5CJ9A 2A19B 4HOKA 3F3VA 2HR3A 2W4OA 4RSSA 2IWIA 5JVTA 4O21A 4DEGA 3QHRA 3O17A 3FPQA 1Z1DA 4G6NA 5FP6A 3EQCA 3CKWA 2R3HA 1JHHA 4JIAA 5AIQA 3FHIA 4NQWA 5A46A 4Z55A 3IGGA 3UO6A 1FYMA 4FKJA 4QTEA 4ZLOA 3E6DA 4HW0A 4GV1A 2EUFB 4KNBA 1AD5A 4C38A 4AAAA 4EYMA 4J8NA 4CMTA 1YS6A 2ZM3A 4FIJA 2GPHA 4C34A 4GH2A 4G8XA 2HOEA 3I60A 4QP6A 1QL6A 2XIZA 3BEAA 3A4PA 3BHUA 4YZDA 5D7AA 4F09A 4U3ZA 1V1KA 4UMTA 5CAPA 1OB3A 3OD6X 2BRGA 4C0TA 4M67A 3WZKA 2V1DA 4ZTHA 1G3SA 5HS8A 2HY81 3QPTA 3LFCA 3PVGA 3PXZA 4H0EA 3AC5A 2JKKA 3KCCA 1KE8A 1OGUA 1FP1D 2YCQA 3WARA 2C1BA 3VRZA 4G7HF 4AIKA 5CT0A 4OTFA 1YO5C 4BYYA 3K1MA 2OI4X 2PUPA 2FMLA 4PP9A 1ZOHA 3U4UA 2UW6A 2P2HA 5L6PA 4QP3A 3Q96A 2GS2A 2PBIA 3U9CA 3JAMZ 3KRLA 1XBCA 3KEXA 3O7LD 5CASA 4HDVA 2PZRA 1OI9A 2W1HA 4JDHA 1BI2A 4DEHA 1Z5MA 3O0GA 3PIYA 4QPAA 4CYDA 3G3ZA 3KVXA 3FMLA 3NLBA 2OBJA 5K5OA 3NWWA 3TXOA 4L0YB 3KREA 2CCHA 4FTLA 4ZSAA 2R7BA 4IHPA 1IN5A 3OCTA 3QPHA 1U5TC 4UY9A 3HMPA 1SVEA 3LXLA 1FC3A 2B9IA 3F3TA 4G16A 5EG3A 4I7HA 4RIOA 4O6LA 2G9XA 2CW0F 4YHFA 4FTCA 5LRSA 2XAFA 3HX4A 4TYGA 3FMSA 3M7GA 4Q4ZF 4EH6A 1WBSA 4AW2A 4LV5A 4RGRA 4CT1A 2VWVA 3NW7A 5L4QA 4LD5A 4ZS4A 1E2XA 3QCSA 5KCVA 3LJ1A 2C3LA 4ESFA 1B39A 3ROUA 1IG1A 5J87A 4AWIA 4YR8A 3TKIA 5IMEA 5CLSA 1USTA 4H36A 2HTJA 3FXWA 4JG6A 5DFPA 5C03A 4MHAA 4CEGA 1PXJA 3ZHPC 4DTAA 5E20A 2E9NA 3BELA 3N4MA 3KCKA 2PVRA 4RX8A 3M1EA 3DQXA 4FNZA 5EYDA 3PRIA 4C61A 3SRVA 3R8MA 3EZVA 4FK3A 2JIIA 2XASA 1KE6A 3KMWA 2F2CB 2GS6A 4GYGA 4LRJA 1OKZA 3WG9A 1GAGA 2AC5A 5K5XA 3CGFA 2XF0A 4LQMA 3HOTA 2P5LC 4XV9A 2DYLA 4U9AA 2YIXA 3O71A 3S00A 3P78A 2ZNYA 3MY1A 4TYJA 2QOBA 1H26A 3MVHA 1PP8F 3R1NA 2P2IA 5KMNA 1KGSA 4MXAA 2CNVA 3V4GA 4BKYA 4ZTRA 3GU4A 1S3JA 3FQEA 3FMJA 3P9KA 5CEPA 3FMDA 2GXGA 4B99A 5HZNA 4N6ZA 3BLQA 4KSQA 3KULB 4RJ5A 2PVKA 3UJGA 1YWNA 2JBPA 1R1VA 4AA0A 3VC4A 2CO5A 4FTJA 4BC6A 4ZY5A 2C6KA 4ZLZA 1PHKA 5J5SA 2J5PA 3TNWA 1GZNA 4G6LA 1M7NA 4EZ7A 3Q52A 5FDXA 1Y0UA 2QKRA 1DAYA 5IEYA 4YJNA 5E8WA 4FOBA 2EA2A 3RGFA 1GHCA 3T0YA 3F2AA 4XG3A 1ZRZA 2QO2A 3N4VA 4W9WA 4DEBA 3VWAA 1NT2A 3BJAA 2BKZA 3DZOA 4FKTA 4TPTA 4TWOA 4IX3A 2Z7LA 2I7QA 4BDCA 1I09A 1YKRA 5KUPA 4S2ZA 4ZMFA 5KMLA 3GOKA 4AZTA 2QC6A 1KWPA 4E5BA 3RPOA 4H1MA 2HWVA 3P86A 1WMKA 5A2QK 3MCZA 1FINA 4I24A 4RS8A 2WIPA 2W17A 5EYKA 2Y4PA 4XBUA 2O0YA 4PGGA 4IRHA 4D1ZA 3BU5A 2HFHA 4NKSA 4F9AA 4PY1A 4PL5A 3VW8A 2KIMA 5I9ZA 2IVTA 3HIFA 1U2WA 5ILVA 2EXEA 2XV4S 4CCUA 4O3MA 3NIZA 4D58A 2YJRA 3V7SA 2L02A 4FTKA 5TT7A 4KMUX 1ZZ2A 2PFBA 4AZVA 5DR2A 1H00A 5HLPA 4GU6A 4LFUA 3HUBA 5KX8A 1YW2A 4J96A 4WG4A 5AP7A 3MIYA 4GJ3A 1GZ8A 4HZSA 4JK1X 5HLWA 3LLAA 3FZPA 1B1BA 2X7OA 2B0LA 2NNNA 4K33A 5HO7A 3UVPA 3JYAA 3TI1A 3DFAA 3NAYA 4P5QA 2X8IA 4BTFA 5FEQA 3NUUA 1D8KA 4AWXB 3R63A 4A4XA 1HOWA 4JQFA 3COAC 4ZZOA 3FMHA 2IVVA 5FD2A 4KS8A 4WG3A 1E17A 4DGLC 3PXFA 4M8TA 2IPXA 1DI8A 5HS9A 1VJYA 3FMMA 3U54A 5EM6A 4YTHA 5JQ5A 1JNKA 5KHWA 3H0ZA 1FT9A 1BI0A 2HAKA 5CWZA 5DD4A 4AZFA 2BPMA 4FSUA 5KBQA 3DQVC 4GCVA 3KXHA 4ALVA 2WMTA 2VOOA 2WGJA 1WQ2A 5AAEA 4RMZA 3RJPA 5EM8A 5C8NA 2DK8A 3LFNA 1CKJA 1H4LA 2YAKA 2A6EF 3O2PE 4IHSA 4AGWA 1RW8A 2BGCA 5D11A 4PQNA 5GIPE 4CZZA 1FPQA 3HDMA 4ID7A 4W8EA 4XLNF 4A06A 4IJAA 2YM8A 4N57A 2NRAC 2YIYA 2Z7SA 4L7FA 2PZYA 5HQ0A 2EV6A 5ANJA 4O0SA 2PUNA 4RZVA 1HKTA 2IW6A 4GT5A 1SYKA 3T3VA 1NVQA 5L3DA 1JAMA 4WUAA 4JJRA 4YMJA 3UP7A 4I0BA 4KIPA 1BBYA 1HCLA 4DCAA 1Q8WA 4EUTA 3A62A 1LVAA 3OWPA 3F6VA 2WTCA 3COKA 4M69A 3PY1A 1S7AA 3OTUA 3HECA 2HEOA 3IG7A 3QTZA 3NAXA 2YACA 3NRMA 3RJCA 5CVJA 1AWCA 3RCDA 1SD6A 3V8KA 2UW7A 3ZDIA 4FTNA 1BMKA 5K3YA 3QTRA 1T39A 4HOBA 3Q04A 1O7FA 1PYXA 4E7WA 2K4JA 1E9HA 5T68A 4AOJA 3PFIA 4YBJA 2J5FA 4J95A 1OPLA 4CVAA 2FOKA 2GTMA 4FKPA 3BRBA 3HA6A 5ERIA 1OPKA 4NM7A 3I64A 2V62A 3GYHX 1YIOA 3Q2JA 1JSVA 3ZM4A 1WI9A 2L54A 3FL5A 2ZBKA 3RPRA 3HUCA 2GMXA 4Y8DA 3E5UA 4D2SA 3SW7A 4ALWA 1AOYA 3COIA 4ANNA 1LEBA 3K1PA 4LG0A 3HRMA 1K78A 3A7IA 1WKMA 3FHRA 4D4YA 5DD8A 3FM3A 3KLOA 3OFMA 3LQ3A 3R61A 1M52A 4GK2A 1SD7A 3T1BA 2FBIA 5EDRA 5AM7A 3MPMA 4BBFA 4X7QA 4NTTA 3Q3BA 3I0QA 3E92A 3CDHA 3AG9A 3D7TA 3HP5A 1IUYA 3F6OA 1FBUA 2YZLA 2VRXA 2W1FA 4KIBA 3NUPA 1L8TA 4FZDB 3FSFA 2A4LA 1NXKA 1P4AA 1FVTA 5FFZA 4AN3A 1UVRA 5BQ0A 4C4JA 4EHZA 4A5MA 5DEWA 3FXQA 3QL8A 2XIGA 4HYEA 1ZLJA 3HOSA 5AV4A 5C8KA 3V5JA 3RK7A 3RTPA 5M44A 2PVFA 4DA5A 4HX8A 2ZCWA 4TTHB 1XH4A 2Q0OA 4ZOGA 1Z6RA 3AGMA 3PYYA 3UIXA 3MA3A 4KMFA 4QP8A 4J71A 5CSHA 4HGEA 5DR9A 2DW4A 4AD9A 4ZZLA 4LMUA 5HLGA 4O7TA 3EYGA 4A4LA 3MFSA 2BRHA 4BI0A 4PCQA 1XD7A 4NCTC 2OZOA 5H2UA 1U8RA 5LGUA 1Q3WA 3R7VA 3RP9A 4JL9A 1U59A 5M08A 4ENXA 3HEGA 4ANMA 2L4AA 1LPUA 2R3RA 2XIRA 3W2OA 2ZV9A 3Q53A 4I0TA 4AZWA 2VWIA 3DV3A 5J1WA 5I9WA 5ETCA 4C4HA 5IG1A 5HG5A 3EQHA 2J51A 3QRIA 4QMTA 4QLCU 1ZREA 2XEYA 5HIDA 4ONAA 4M66A 5M4UA 4IWOA 2E1NA 5AV1A 3ZO2A 4RWLA 5GJDA 4ACGA 4BYJA 4I3ZA 3NZ0A 1PXMA 4BDEA 3H3UA 3DAJA 3PPKA 2GQRA 3L09A 1T38A 5CT7A 4C62A 3VJNA 5F64A 3TACA 3N51A 1FX7A 3PVUA 1XHAA 5J8CA 3UC3A 3E8DA 3L8VA 3FJQE 3LMGA 4C4GA 2BAJA 4YC3A 2PTKA 2R3SA 3IO7A 5E92A 3PSDA 2UZUE 3ZOSA 5L3EA 2PU8A 2HGCA 3R00A 4JG8A 4EQUA 1TTYA 1JVPP 5CEKA 2VZ6A 3QRKA 4P55A 4NHJA 3DQWA 5HKMA 4FVRA 4PMSA 3FZTA 1HCKA 4EC9A 3RZBA 1OM1A 4NSTA 3IDPA 4OIRF 4FIHA 2XK6A 5EM7A 3S95A 2PLYA 3DKFA 3C0HA 4E6DA 3D0EA 2ZMCA 3HYHA 3RINA 3VUTA 3F21A 4O0RA 5KK1A 4UEUA 3HLLA 5B0XA 5JH6A 4CYJA 4QQ5A 2WXVA 4FKUA 4ZYHA 3KETA 4LM5A 2R2PA 1MUOA 1UKIA 4WCGA 3D9VA 5FGMA 3CGOA 3F3UA 4UZHA 2MH9A 3QQKA 5H6QA 3QLFA 5J95A 4C8BA 3LA2A 4QNYA 2OJFE 3NMUF 3MZHA 4FHTA 2DU9A 5KHXA 4ZTMA 3E8NA 3REPA 1F0QA 5HE1A 4B8LA 3LKMA 4IVBA 5G6VA 4YU2A 2UZLA 3R7UA 3ACKA 5IZFA 2JEDA 4FL2A 2UZBA 4B7TA 4O7WA 2JDTA 1PMUA 3K0LA 4D9UA 4JS8A 5IKWA 3ZLSA 2FSLX 1GOLA 3EETA 3NUYA 4I09A 1RDQE 4WG5A 5T6KA 3L1SA 2J9MA 1S6LA 2VUWA 1OYWA 4ITJA 1OMWA 1Z91A 1WCCA 1T45A 5AR8A 4Y73A 3V5WA 4EHEA 4XP3A 5ILUA 3QHWA 2UZVA 4CQEA 4FUXA 5E8IA 4QTCA 5TJJA 2P8TA 1BC7C 4C33A 3V5QA 3EFJA 2REIA 3VBQA 4L5JA 2F57A 1KU2A 4YTFA 4OTGA 2WTEA 3SXRA 3GNIB 4YSJA 4V0GB 3ZMZA 1YXUA 3L9NA 3B73A 3GWZA 4L7SA 4BB4A 5L6WL 3VS7A 3IWFA 3ENMA 4EH9A 2OF4A 1IN7A 5DT3A 2XS0A 4CFXA 5BPDA 3S1HA 5LGNA 4ENYA 4F9BA 4WHZA 2YDIA 2BZKB 4ZTSA 3GU8A 2PHKA 4O2ZA 3VS5A 5TOZA 4AOTA 4FEUA 3U8WA 2OJIA 4CZYB 4EOQA 4U80A 4RC3A 1M17A 4UVBA 4OTWA 4X2NA 1SM2A 5BS6A 2NAZA 3JSOA 4MAOA 5ETAA 5CNNA 4ASDA 1IN8A 2O65A 4HVGA 5F20A 1WVXA 3DF8A 2NNYA 4MBLA 5GJFA 3H92A 3IW6A 2YCFA 4UWBA 2B9HA 4CHUA 3OTVA 4M74A 5KVRA 5K5RA 4L45A 4OTPA 2EJRA 5M55A 5IA3A 3C0IA 3O6BB 4EVIA 4ZSGA 4IX5A 4D0PA 2F7EE 3M9AA 2LNBA 3ABUA 1FNNA 4M0ZA 3P4KA 1P4XA 1BKXA 3MPTA 3G6HA 4FSRA 2R3LA 4BDHA 4QO9A 2QI8A 4ZSLA 2XKEA 1P5EA 3CY3A 4G6DA 1I1GA 3N4UA 1ON1A 4ZY6A 2C0OA 5HLHA 3KVWA 2OIQA 2VO6A 2V9VA 5I3OA 1CTPE 2OH4A 4G3DA 1R23A 1H1QA 4IAFA 3VODA 3OC1A 4M12A 1R5HA 4BCNA 3QTWA 4QMXA 3UBDA 5JGAA 2YWPA 3FSKA 2J0IA 3IC7A 3RM6A 2C1AA 3ENHA 2YU3A 4GVAA 3U6HA 2P7CB 3HMMA 2EK5A 1IRKA 5I0BA 1ZY4A 3MS9A 1D3YA 3IECA 4UWCA 4G3FA 4JBPA 4WRGA 3UVRA 2VTRA 3CUOA 3BQRA 5L2IA 3NCGA 3VULA 4N4SA 3FWQA 2HKOA 4M73A 2ZFWA 2GNFA 3BQCA 3KLNA 2C69A 4YFNF 4H05A 4L46A 3S2PA 5DYJA 2RL5A 1GY3A 2C6YA 3AD6A 3CLYA 3WTXC 3FI4A 3RBWA 2B7AA 4IC8A 4D2RA 5FDPA 1UU7A 4YJRA 3PG1A 1PXOA 4JX3A 4P9FA 3AD4A 1AQ1A 2GDOA 3C50A 4PDSA 5E8XA 4D9TA 5A6NA 2H94A 2LGCA 2M45A 4AN9A 2AUHA 3CC6A 3E93A 3FMEA 4MNFA 3D5UA 3OEFX 3R71A 1G4DA 4RX5A 4YURA 3W6KB 5IEVA 5AM6A 1J75A 4IAAA 3LZBA 3D5XA 3WE8A 3FBVA 3MH0A 4JAIA 4FKIA 1JOWB 4G3EA 4OAUC 3R7IA 3QYWA 4QTDA 5IUIA 2P5VA 1KE9A 3EQRA 1APME 3MSSA 3TDUC 3VQUA 3R73A 3W6JB 4RIYA 1O6KA 2VWUA 1CF7B 2G15A 4C2WA 4HX7A 4EM2A 2GQGA 5IT3A 4IQ6A 3DXJF 3QZIA 4FG8A 4DCEA 3UNJA 1BYGA 2VO3A 3R9OA 4YZMA 5CY3A 4IM0A 3RKYA 1QPJA 4PV0A 3TIZA 2UXNA 5ICCA 5K0XA 1R58A 1IN6A 3PXKA 2ITYA 3W2PA 3I7BA 4DG0E 5BNJA 2JKMA 4F9YA 3J80Z 4YC8A 2EV0A 4YG2F 4YHJA 4BAYA 1V0PA 1BI3A 1YHVA 5HVYA 1Y8GA 2QOQA 5CQWA 4XG7A 3F5GA 4PTGA 2W7XA 2V7AA 2BDJA 3GVAA 4A7CA 4ERKA 2EVAA 1QBJA 4RX7A 3OY3A 4HBLA 5E8UA 1GJOA 5LCKA 1R1UA 5JSMA 4L3LA 4WA9A 4Y5QA 4G9YA 1F5TA 2CLXA 2OZAB 1UU3A 1D8JA 1JPAA 4B8MA 1OKRA 4RVLA 4GUEA 3PSBA 1G3NA 4OINF 1XBBA 3BYSA 4BHNA 3BIZA 2XM9A 3L00A 4DAWA 2VAGA 4HNFA 5AMNA 4XBRA 4ASNA 1V0BA 4EOPA 4U44A 2R7DA 5AP6A 5AAGA 2IJLA 3A2CA 3PXRA 3F8FA 4FYNA 4O0VA 5JQ8A 3N97A 1TLHB 3ERED 4L43A 4E26A 2RGPA 4ZJVA 4BDFA 4CZUA 1OIRA 5ANGA 5LWMA 1RIOH 2W1GA 4QMPA 4U81A 3TUDA 4LRKA 4GFMA 4BCGA 1YQAA 2QQ7A 4I6HA 3NUNA 4H1JA 5AP4A 5CEIA 2RG5A 2RG6A 4YZ9A 2RSVA 2P4WA 3TKUA 5J8IA 4A9SA 2PSQA 4HCTA 3WF8A 4EC8A 3RKWA 2QOIA 3F9NA 2ZM1A 2CFXA 4WO5A 2JDVA 4ENJA 5C9CA 5ICEA 2VODA 1IF1A 2EXCX 2F5FA 4RAZA 3MH2A 3TNIA 2YDKA 4U45A 3SAYA 1SFXA 5KKRC 4ZSJA 3BKBA 1S7OA 3EN5A 4R1VA 4AT3A 5FLXZ 5KZIA 3OW4A 1XSVA 5B7VA 3LM0A 3BPRA 2FXAA 4ZLYA 2X9EA 2BTRA 4F1MA 5L8KA 2VBXA 2YM3A 4APPA 3QAME 4BH9A 3F82A 1PW2A 4IWDA 2WFYA 1IR3A 3ID6C 2LF7A 2RF9A 4MHGA 3WTYC 1J7LA 2WQOA 2BMCA 3ZC5A 3F5UA 4U5JA 4A0XA 3E64A 1U78A 3TOAA 4YLKA 4M9SA 2ZV8A 2BFXA 4DGGA 4YP8A 4QMZA 4FKVA 5DMZA 4ZXTA 3UTOA 4IZ7A 1JXSA 2C5NA 3GCVA 5EHYA 3O2MA 4FZ6A 4IDVA 1HSTA 5AUVA 4RJ7A 2VWBA 2HWPA 5EKNA 4CV9A 3GXLA 2VTLA 3V7CA 1MZBA 3OT8A 3LLTA 3LSTA 3C5IA 4R3PA 4L3PA 1P14A 4MCVA 2R64A 1IAHA 4HQMA 4DG2E 3CUQA 2OXXA 2K4BA 2C0TA 3C18A 4Z2YA 4I5MA 1QO0D 3HHHA 5IMXA 5DLSA 3FUPA 4KA3A 4FNWA 3D4QA 5ETFA 4I6BA 3R8PA 1ZYCA 4KUJA 3D7TB 2WKMA 3R60A 3DFGA 4UMQA 5AR5A 1UB9A 3H0YA 2I0EA 2FVDA 3GB2A 4EOSA 4F1OA 4M7IA 4M6YA 4YUQA 3KQ7A 3EN4A 1MJAA 2FB8A 2PK9A 5BX0A 4BGGA 3I0OA 1IA8A 4U7DA 2CYYA 4O22A 4F6UA 5DBXA 3GZ6A 2XKFA 3IW5A 2Q83A 2FA2A 4HF2A 2CPKE 5EQEA 4L44A 3MH1A 2HZNA 3PVBA 4QMLA 4RVKA 2QKWB 3IHUA 3BYMA 2XNMA 3CUQC 1Q62A 3KK9A 2I0VA 1XBAA 4IJ9A 3MQ0A 3ZMMA 3E7OA 2GWRA 4EMSA 4EH3A 3R9DA 2IG7A 2X7GA 4TN6A 4GVJA 4UV8A 1XDSA 1DAWA 4QNAA 4PDYA 3PA4A 4JG7A 3DBFA 2NO3A 3RPQA 5IA4A 5J5TA 3QP6A 3U1DA 1OPJA 2EU9A 4FKQA 5CXHA 2HW7A 1ONVA 4J53A 3CEKA 1DP7P 4TNDA 5FFXA 4MBIA 4FYOA 5HG9A 2ETMA 2Z2WA 4J97A 2YSRA 3ML6A 2PVHA 3BEGA 3SW4A 4MVFA 4WBBB 5EDQA 1TBXA 2WOTA 5I5ZA 3LXKA 4IADA 2XUBA 2BUJA 4FZ7A 3E8EA 2KJBA 2G01A 4MXYA 4EYJA 2GQQA 2HENA 1J1BA 4QYFA 2W96B 5ED4A 3IDCA 5M4IA 3F6XA 4DQ2A 3EWHA 3LQ8A 5BPIA 2VN2A 3MAJA 2IN6A 1B59A 5AP2A 2UW9A 4FV2A 3OXZA 3QD0A 4I6QA 2BVAA 5FP5A 2XNOA 4GFOA 4OTRA 3W16A 4ZYDA 4PPCA 5CVUA 4E70A 4XUFA 2MLGA 2X39A 3WI6A 1MRUA 4LOQA 3RI4A 3QD3A 3GU6A 2H6CA 1K9AA 2PVLA 3LVPA 4RGXA 4LOPA 2EB7A 4LK0F 3CIKA 2A07F 5DN3A 4U88A 4AIJA 2YR2A 3FI8A 3QQHA 4E6AA 3M8FA 3I1AA 2VTPA 4IF4A 3QWKA 1W4MA 2OK1A 4JDJA 5LQFA 1DI9A 2OZ6A 3GCSA 3Q4ZA 3O3KA 1WVWA 3F8BA 4L01A 1B9NA 4QMWA 3LAJA 3TNQB 2ISZA 4RT7A 3GQLA 3PIXA 3BV2A 4KKEA 2EFOA 4WRSA 3VUMA 1GNGA 3KMMA 4Q9ZA 1W5TA 2OG8A 1FOTA 1Q5KA 3BJ6A 4ZYGA 4BCIA 3G5DA 1QPMA 5DPVA 3VN9A 3DT1A 1KA8A 4K2RA 3NGAA 3UYTA 3ROCA 1Z6TA 2EFPA 2R3QA 3H30A 2KKOA 5AWMA 4IVNA 2W06A 2PN6A 1SVGA 3V8TA 4H39A 5HIBA 3U6JA 4I22A 3RPUA 4MD7E 3C3WA 3QKLA 4YO6A 1OR7A 1LP4A 1VTNC 1ZAOA 4UUVA 2PMUA 3E6BA 3U9GA 2IW9A 2O8XA 3EKKA 3I5ZA 3ZYAA 4DLJA 3PQJA 2QHNA 3COHA 3CUQB 2PUUA 4HGLA 3DOGA 4S32A 3EDPA 4U0VA 3PY0A 5HU9A 5TKDA 1P2AA 4K8AA 1E1VA 4H3QA 5IQHA 1VZOA 4N0SA 3D5VA 4FODA 1FGIA 3BJOA 2NNWB 2X7FA 4MGRA 3WGGA 5CVHA 3SLSA 3V7RA 3DKOA 3G9NA 3WBLA 5A4CA 1PY5A 5E1XA 5AP0A 5HLIA 5DV5A 3C4CA 2XYUA 3KB7A 2VTIA 3BYVA 5BVWA 3LIJA 4KSPA 2WTKB 4RJ8A 1FSEA 4Y5HA 4N70A 1F1ZA 2VWZA 3ORKA 5DT0A 3ZXTA 4KFCA 4IANA 5IT9K 2WC2A 1CDKA 4IWQA 2ZXJA 2XNNA 4GKIA 1MRVA 4M9XA 4JIKA 4QYEA 4L0ZB 4XCUA 3KC3A 1MQBA 5HGIA 4O7YA 4K9YA 2XK8A 3DKWA 2B4SB 1PF8A 3CQWA 4B09A 5D41A 3OUKA 2HWOA 4IAZA 4Y95A 3QC9A 4YJVA 4Y17A 2PE0A 3P23A 3GFIA 3QU6A 5IQGA 5IA5A 4D2WA 1IEPA 4ANBA 3JPVA 3GOPA 4TYHA 1IASA 3EN7A 2YEXA 4JR7A 3E5QA 4ZTNA 3I54A 5HOOA 3EYIA 3JXWA 3V6RA 2I0HA 2JAMA 1QPEA 5ANEA 4APCA 3HSRA 1IN4A 4XLVA 4FV8A 4ERWA 4C3PA 3UNZA 5HESA 4CMOA 2HDCA 2JT1A 2GHMA 4WNPA 3UG1A 3KULA 1R0EA 2YZAA 3QP5A 5KE0A 4OAVB 4AGUA 2C4GA 3ROYA 1OIYA 1Y8YA 4NCTA 3P0MA 3P08A 2W99B 1HBXG 3OEZA 4USDA 4HV5A 1ZLTA 3IW8A 4A12A 3FM5A 1NHAA 3TZ8A 3TNHA 5BMSA 2LSOA 4G1WA 5A3XA 4XSZF 2QO9A 1LB2A 4A07A 3UMXA 2R3JA 4BCQA 4ESBA 4X0MA 4EONA 1U3EM 3QXPA 4WF2A 2OXDA 4AUAA 4YJPA 1Y91A 3BGZA 4UNOA 3QCQA 4AU8A 3L8XA 1K2PA 2QOFA 3U51A 3MY0A 1MQ4A 3UQFA 4EM1A 2UWMA 2G2FA 3SXYA 5J9LA 3QCYA 1G8AA 4DBXA 1ZYRF 5EM5A 5CI6A 4D5HA 4C35A 4U97A 4Y72A 2BBYA 3LXNA 3LMHA 2PZPA 1VYZA 2G2HA 3ZUVA 3VW6A 3EQLF 2J5EA 2CGVA 2FSWA 3KMUA 2QVSE 4TW9A 3E6CC 5CZIA 2VTQA 5CENA 4OTDA 2QU6A 4DT8A 1EV7A 1SD4A 3F61A 1OL1A 5D10A 4FV6A 1J5YA 5FBOA 1X3UA 1SFUA 4OOIA 3TGNA 1M2PA 2XCHA 4K6ZA 2OQGA 4G6OA 1R39A 2KJCA 1Q61A 1T0FA 5DHJA 2RIOA 3ZZWA 4D4SA 4RGSA 4PDOA 3O51A 3CPBA 1CF7A 3P7AA 1EH7A 1XSXA 2VGOA 3VUHA 4YTCA 3BHYA 3FKNA 5LHHA 2OQRA 4WIHA 1HW1A 2JFMA 2PJPA 4OIQF 5GZ9A 3MV5A 4D0WA 5HNGA 2LDUA 4DNCA 3PFQA 3PWYA 2GA1A 1Y6BA 5LMAA 3ZFMA 2DO7A 1FMOE 5DT4A 3SXSA 2EFQA 4OT6A 1BL6A 5J7BA 4G7OF 5A9UA 2YM6A 3V6SA 1WBPA 5BPYA 3CY2A 2YIWA 2CDZA 3W2QA 4TYIA 1HSJA 2F5EA 3J81K 4I5PA 2XNBA 5ITAA 3HA8A 5JKGA 3NNXA 3RKBA 3SOAA 4ZZDA 1LDDA 2P3GX 4ZTLA 4NFMA 1HQCA 2ITVA 4EOLA 4HV6A 2CNQA 1LUFA 2C68A 4CV8A 3UODA 3BHHA 4QQCA 2C3KA 3DPTA 5F1RA 4IAKA 4V0GA 3WTWC 4CG9A 4IAYA 3KU2A 3TDWA 2MH2A 3IKVA 2CGUA 2Z60A 4G34A 5FGKA 1UA2A 4XG9A 1S29A 3RHXA 1USSA 3VO3A 4WX9A 3LJ0A 1D5VA 2ZV7A 1ZARA 4NK9A 5CVGA 1URCA 5LRRA 5IQFA 4J7BA 4EK4A 3FQSA 4GEOA 4QYHA 1H0WA 3OS3A 3QKKA 4ZS0A 3DPKA 2G9WA 5CF6A 1XSDA 1JGSA 3VEPA 4AT5A 4LMNA 4F9WA 5FLFA 3DXNA 1MGTA 1LEWA 1CGPA 1LJ9A 2Z8CA 5K5QA 2Y6MA 3NX8A 1NY3A 4OTIA 3F5PA 4YTIA 4PPBA 2IW8A 3TDZC 4RIXA 5ETIA 3EL7A 5KNJA 4NIFA 3UYSA 4EK3A 2D2WA 4DH3A 3MJ1A 2W5AA 4BF2A 4OMZA 3HTUA 3J81Z 3TTIA 1U4DA 4AA4A 1KOAA 3ORIA 3I4PA 5IUHA 4ON0A 1VEBA 2P4IA 4C2VA 3RWPA 2ZMEB 2CN5A 3F2NA 2IT0A 4JBAA 5DUIA 1BL7A 4HA8A 3WF9A 3R8ZA 4BIBA 3M2WA 3R8VA 5CNOA 4BDIA 3MFUA 4IZ5A 1MD0A 1ZMVA 3K9TA 2QG7A 3D2IA 4YGAA 4HF1A 4CRLA 1BI8A 3AC2A 2BHHA 4MTDA 3JY9A 5FD6A 3WE2A 1UNHA 5AV2A 3PG3A 5D9HA 4AFEA 2V7OA 4IM3A 2ZM4A 4FV7A 1OMIA 2JKOA 3T8TA 2GNJA 4ACCA 2X4HA 3E3BX 4MYGA 1HW5A 4OTHA 5AAFA 2EA4A 3EYHA 2OLCA 5LOHA 3JUHA 4FICA 3WZJA 3ZC6A 3ZFXA 5JZJA 1REPC 3NYVA 3BV3A 4AGDA 3TO7A 3QTQA 3KRXA 1PMEA 3DFCB 4KB8A 3GC9A 2O3FA 4LUEA 4CYIA 5CEOA 2A0CX 4EH8A 5H8GA 3KEQA 2FYSA 3QBNA 4FTQA 1YDTE 2VO7A 2VTNA 5K9IA 1BC8C 3IGOA 3N9XA 3AMYA 2BZHB 3R7GA 5HOAA 3BGPA 4YJTA 3DBEA 3LQRA 1KV2A 3Q9WA 4R7BA 1ZYDA 2K27A 3R22A 4M97A 3FYJX 3W2CA 5FEEA 1U5RA 2OU2A 1FYKA 4IH8A 4QYGA 4BVUA 4JR3A 3KGAA 2IVUA 1ERKA 1O57A 3C4XA 4AS0A 1JE8A 1R22A 5LMKC 1M14A 1F9NA 2OH0E 2WMWA 3KN5A 5CYVA 2ZAZA 3QUPA 4N9IA 4FE2A 2QUFA 4BQAA 3EUHA 5I3RA 4R5SA 4L3JA 3EQGA 4NW5A 3CO6C 1WBWA 2ITUA 3G51A 3BZ3A 2HXQA 1UNLA 3DA6A 3FZOA 3U4WA 4DH5A 2EB2A 1I44A 5AUTA 2RKHA 5HE0A 2QWWA 4L42A 2W4KA 4S04A 3HTSB 2K86A 3S3IA 3AMBA 4UMRA 3R83A 3EQIA 4O38A 5CLPA 5F9EA 2OF2A 5D4RA 2ISYA 2CSNA 2R3KA 1OL2A 2EFWA 3RYRA 1QZYA 3HRUA 1SNXA 4MNEA 2A2AA 3B02A 3HV5A 5H6RA 4XP0A 3B2TA 4O2PA 3VS4A 2VBYA 4FI1A 1OKYA 2R3IA 3CCNA 3IONA 2ETHA 5D5WB 5M06A 1ZRCA 2GHGA 3FYKX 1TW3A 1OL6A 3I71A 2WMAA 1V4RA 4PWNA 4LRMA 5DA3A 4IB5A 2Y7JA 3MVMA 3GU7A 3Q9XA 1C0WA 3C4WA 2PWLA 2OICA 3UZRA 3ORZA 4GL9A 4I1ZA 3MYGA 4S33A 1QNTA 3D14A 4XEYA 4GXOA 4GIHA 3WTTC 3GP0A 2XRUA 4ASZA 4BRXA 4E6QA 2FA5A 2STTA 4LL0A 3FY2A 1BM9A 2GA2A 2QR7A 3G0EA 3VVHA 4BCFA 3ECHA 4HCVA 3FZSA 5EW8A 3NQOA 4EOMA 3WTUC 5JI6A 3H9RA 3NRVA 2DK5A 2BKKA 4MXOA 2MD5A 3FL4A 2UW0A 4D2TA 5DNRA 3C4FA 2GTNA 4LGHA 4BCPA 3T3UA 1BOAA 4GK3A 2XB7A 1XO2B 1OBDA 3EJ1A 4C4FA 4GRBA 4OIPF 2QM3A 5HX6A 4O1PA 2W85A 4CD0A 1SAXA 1OUKA 2UW5A 4BZOA 4U0YA 3LFBA 4HX4A 3BHVA 2O63A 4MH7A 5ACKA 1YYVA 4S30A 2WQBA 3LXPA 3W2RA 2Z5UA 3TL8A 1SMHA 4HYUA 3QZGA 4YPDA 3G15A 3ZBXA 5FXQA 3I4BA 4IWPA 3LFEA 2B52A 2ZDTA 3PVWA 4I0AA 3LA3A 3QU3A 2Q8KA 4EORA 3D83A 1G8SA 4D2PA 2PULA 2V55A 3FLSA 3R21A 1UV5A 4JAJA 4W4YA 4B6LA 5AUZA 2ONLC 4UXNA 4D55A 4XG6A 1UWJA 4JLCA 3BWFA 2WZJA 4YLJA 2R9SA 2W57A 4ANQA 3KXGA 3CBLA 4NTSA 4WT6A 2UZKA 2UZDA 5JT2A 4L53A 3BLHA 3QC4A 3NNVA 2KIUA 2ETRA 4BKZA 4LL5A 2QBYA 4FBXA 3E5AA 2WV0A 3ZLXA 3HSEA 1H24A 2H9VA 3MZYA 1Y57A 3WF7A 3GFLA 2VTSA 4QMOA 2PVNA 4GIIA 4X3FB 4FF8A 4MEXF 3C9WA 1Z05A 4RJ6A 4ACDA 3RWQA 1BI7A 4GT3A 4S34A 2JBOA 5CVFA 1Q8ZA 4O7NA 4I4EA 2C6OA 2UW8A 4KKGA 5HTIA 5AR7A 5L3FA 1Q8UA 2QLQA 1ATPE 4RBLA 4PDPA 2CN8A 4XRJA 5D5UB 4OBPA 3OBJA 2CJMA 4E5WA 2A1AB 3WF6A 1M2QA 4EJ7A 1RJBA 4XOYA 4EOOA 2WQEA 2BZIB 3QRFF 1DUXC 5EH0A 2EWAA 2VD5A 4ZZMA 3P7BA 4P2KA 1FYLA 1RI7A 3PWDA 4OW8A 4HF0A 2JDRA 4OUCA 3MFKA 3OHTA 1O3QA 4TZRA 2DS1A 2XUUA 3H9OA 5L2TA 4BDKA 4PNKA 1G3YA 3J80K 2XA4A 3ALNA 4AACA 3EQBA 3UOKA 2XJ2A 2O3PA 5KMKA 3R4KA 5FXSA 4O82A 5F1ZA 2IRFG 4JRNA 5CYIA 2NP8A 4F6SA 2QOKA 3D5LA 4ZH4F 4HPUE 4MNUA 3ZM9A 5K1YA 4GO1A 4ASEA 4DFUA 4R78A 2JAVA 3FZVA 3R6SA 4BHZA 1GIJA 3HVCA 4F0IA 2AXLA 2Y6OA 3NYOA 3MGYA 3PRFA 3FKOA 4NJDA 2J0MB 1ODDA 4QMMA 4GYIA 1QZZA 2W4JA 2F9GA 4TYHB 1LQ1A 4PMPA 1A48A 1OYIA 3T9TA 2ZNZA 4ANOA 1RUNA 5CVVA 2XJ0A 2X81A 4OTQA 3PJ8A 2G1TA 2CSOA 3SFZA 1A04A 5E8VA 4AP7A 3E8CA 4RLKA 2VWYA 2QOCA 4HYHA 3Q9YA 1U5TA 4YZCA 3RDIA 2WD1A 4O0TA 1KE5A 3I58A 3Q9SA 1REKA 4BYIA 4YJSA 2ACXA 5EHLA 2ESHA 1QCFA 2O03A 4MQVA 1L3LA 2JPCA 2OSCA 3DJ7A 1HXDA 3IQ7A 4R8QA 2OKRA 3C51A 3ZQ7A 4IW0A 4I20A 2P33A 3OT3A 1R5GA 4L9IA 1M2RA 3E7VA 3OXIA 3R2BA 4CNHA 3VAPA 5BYLA 2Y0MA 4OT5A 3UOHA 5G1XA 4IVCA 2B53A 2ITQA 1QQIA 4F7LA 3UPZA 1K78B 1SMYF 4G9RA 4L6QA 5AADA 4IPAA 3ZTXA 4UBAA 2QVOA 2F2EA 4HDUA 4I98B 2QCSA 2XBJA 3CLOA 4FTMA 2X8DA 3FMQA 4TV7A 4Q48A 3KXNA 4G2FA 1WFCA 4BHCA 2WTDA 2YN8A 2FSMX 1XMKA 1KUTA 4BDAA 2KIFA 4CO8A 3D5WA 4FTAA 4FEXA 2V1UA 3UO4A 2WEIA 3QA8A 2Q0NA 3ELJA 2W25A 3KRRA 4RB2C 5K0KA 2E9OA 2WMUA 4ARKA 3WOWA 3ACJA 3UGCA 2VNWA 4HVHA 5CU3A 3V3VA 4AIHA 2I1MA 3MTFA 4MF0A 4ZZNA 3LAUA 1RUOA 1PXNA 3B8QA 5GIOE 2VTHA 4IFCA 2FO0A 1O3SA 1MJ9A 4Z16A 4GW8A 3F66A 4IJPA 2VE9A 4GS6A 4IB1A 3GEQA 5BVFA 3ODZX 3KF7A 2RNJA 3E97A 4O0UA 4EL9A 1FBNA 3WE4A 3LAPA 3EB0A 4J8MA 1MKMA 3UZTA 1UWHA 4MQ2A 2CHLA 2O2UA 3EKNA 3PLAE 3ALOA 3RHKA 4NM0A 2V6CA 3V8JA 4F65A 3MDYA 1JLUE 2H8HA 4FGBA 3FLQA 3RALA 1XH6A 2HY0A 1J7UA 4J99A
chains in the Genus database with same CATH superfamily
3K2AA 2YA9A 4DZJA 4XYFA 1H89C 4UALA 2DYSH 1W36C 4AE6A 2TDXA 4XSXF 5HORA 2XAUA 4A9TA 4OIOF 2ECCA 3D5RC 3HV4A 3QTSA 2WOUA 2GAUA 2VJ5A 1TNTA 3IKTA 2DWBA 5AA9A 1O3RA 2XAHA 2JLDA 4KBCA 1OR7C 4BTKA 5DVRA 3G73A 2CGXA 1ZYLA 1ZLKA 5FLXK 4TRLA 3RK5A 2WTVA 5DG5A 3QA0A 3UQCA 5E90A 4KBKA 4ZAUA 3OL3A 1I1SA 5DH3A 5ICFA 5FD5A 2EINH 1J91A 3EQPA 2M2EA 2VBZA 2YCSA 3R7EA 1XC5A 5EI8A 5HG8A 3K7AJ 1JQHA 1ITYA 1GV2A 2A6TA 1MNMC 5BVEA 1XH8A 4QP9A 4DGWB 1VYWA 5E1ZB 2QSHX 2G0EA 4GDFA 3OROA 5EEGA 4XG2A 1TT5B 4Y15A 2BROA 5IA1A 4JDIA 4DYRA 2DA3A 4A4OA 5E3LA 4FSWA 1UCRA 1RE8A 1ZGWA 2VPRA 4ETSA 3W2AA 4N6YA 4FK6A 3FMRA 3PA5A 1WJEA 2L7MP 5ANDA 4KT6A 3NS9A 2MC3A 3UOLA 1YX3A 4BDGA 2NVYJ 5DR6A 1PJKA 4MD8E 4XLCA 2VN9A 2R5TA 3PPZA 3BZ6A 1STZA 1I3AA 2P55A 1IXSB 2FNPA 3ZMVA 4GMYA 4O1OA 4W4WA 2WELA 3OXTA 5BUIA 3LW0A 3PTGA 4P5ZA 3A02A 2LKXA 3CCMI 3QAHA 3Q2MA 3LSRA 4HLYA 3H5AA 1H1WA 2XK9A 1JKLA 4RFZA 2WMVA 4XLEA 2VTOA 4WD5A 2CKQA 2XAOA 3HRCA 1V0OA 3LOKA 3OVVA 3GW2A 5AX9A 3I59B 5M5XJ 5DM6F 4WWCA 1NA7A 2C5XA 4FIGA 3A03A 2XNPA 2Z3YA 3QQUA 2L01A 4RC2A 3DU6A 5EOLA 2W84A 3ZEPA 1S9IA 3L9FA 2K9LA 4RLLA 1R3CA 1XMAA 4ESJA 5ICPA 1FY7A 4Z7HA 2X48A 3ZMDA 2JTVA 3HNGA 1OPCA 1AGWA 1VNDA 3K4CA 4LGDA 2CG4A 3SD0A 2O6GE 2VNYA 4RZWA 4GCJA 2VV9A 2GQSA 5M5WJ 3M11A 4YNOA 1BX6A 2DAOA 3NUXA 4G6QA 1X1AA 1W7HA 1WBTA 5FRIA 1BN5A 2A6HF 2IZSA 1IAJA 3TV7A 4Q5HA 4C4IA 2FU4A 3OF0A 5AIKA 4YJQA 2R7TA 3DJ5A 1ND4A 2YCRA 3SXFA 2XRNA 4FT0A 3K5VA 1OQYA 3NPCA 1ZH5A 4MXXA 1PMVA 4R6VA 3F23A 5HX8A 1LDKB 2R5YA 3R7YA 2QO7A 2K5CA 4HGTA 5HNBA 3PDTA 2YPRA 1ZOGA 4EZ5A 4XV3A 2PMNX 4WXHA 5ILSA 4O96A 3GF2A 1PP7U 1U46A 1P6RA 2VWXA 2DMPA 4KAOA 3ML1A 1G5SA 3EFWA 4AFJA 1KU3A 3T8OA 5EYMA 2GFSA 5FTOA 3TZMA 2DQRA 4LB5A 2PZIA 1YG2A 4C58A 4RG0A 2AC3A 3LNQA 1XN7A 4N4NB 4QP1A 2E1CA 4FMQA 2HDDA 5IH5A 1B9MA 2FSOX 5HS7A 3PJ3A 4F70A 1PXIA 4XLPF 1P4WA 2OAZA 5JN2A 3ZO3A 2X8EA 1MP8A 3GC8A 3MESA 4KT5C 1G6NA 3OYAA 3DB6A 5KMIA 3I4MJ 4AYBN 5HCZA 2GSFA 2RFSA 2RDPA 1A6QA 2WTKC 3IWZA 4MF1A 5CX9A 4YFKF 2QQAA 4HLXA 4O7LA 1MDMA 5ICGA 3I5UA 3QLGA 3HL7A 3W0SA 2X9DA 2HYGD 2UZOA 3JW4A 2IJMA 2VTMA 1BI1A 3RAIA 1O6YA 2WTJA 2Q2EA 3BBWA 3OWLA 3OWJA 4WXDA 4EWQA 3UNGC 2HVQA 2C3IB 5BVKA 4AZEA 4M3QA 2JRTA 3OOMA 2GHLA 4D0XA 3THBA 2M8EA 3QD2B 4NT4A 3ZRKA 4DFZE 4BCKA 1YTYA 1K83J 2J6MA 2D1HA 1X3ZB 3HP2A 4I92A 5KBRA 5HTBA 2E19A 2D45A 1YDRE 3T8RA 3GC7A 1YOLA 4G9CA 2CJJA 4O7SA 5A14A 2VL8A 4Q5SF 4BI1A 2J90A 4QTRA 4AN2A 4FV0A 2HK5A 2P6TA 1B6CB 3CF5F 1FMKA 3NW5A 3VBXA 4GU9A 3KRJA 1DM2A 2F7ZE 3ZRGA 1R49A 2KRFA 3PJRA 4QQJA 4BBEA 4YELA 2QR8A 5C4LA 1TVOA 2V79A 4QMNA 2XHKA 5D5XB 2DJIA 5M4FA 2DTZA 2XKPA 2J7TA 4NIFB 3E87A 1WAKA 5F0FA 3AG1H 3HPGA 4OLIA 3KFWX 3V04A 3KXZA 2IP2A 3FHNA 1O6LA 3JVRA 4GG5A 2I10A 4L68A 2J4ZA 1OVEA 3CR0A 3QUEA 1JKTA 5CF5A 2XM8A 2DMNA 4LYNA 3HMNA 1S9JA 3TOBA 3IS5A 1S8NA 5E91A 1V54H 4QPMA 4IKFA 5D7VA 2NVUB 4QMYA 3F72A 1EH4A 5C8MA 4LFIA 3DTIA 3GLLA 4UVCA 4S0HB 3KP2A 1IC8A 4EJWA 3SZGA 5A2QZ 2VJIA 4FV1A 5IQIA 2VB6A 3FMKA 5H20A 4LGWA 4N0BA 1VR2A 4FL3A 3F3WA 4EZ3A 1YHSA 5GZ8A 4U0WA 2LOOA 4AA5A 3BDDA 3O8HA 4L9JA 2X2KA 3RKXA 5CVIA 2VX1A 4BY7J 3S16J 3GUDA 2GFCA 4Y13A 2EZHA 4I4FA 2PY3A 3FEGA 1F5QA 4DYMA 3VBWA 4ZDOA 1OECA 2O0UA 1RC9A 3OOGA 3AXWA 3SQQA 2UW4A 1XR1A 5BMZA 4IZAA 3TYKA 4EOIA 2LK2A 5E8GA 5HD4A 3R7OA 2HCKA 2R7IA 3BE9A 4FEWA 3F7WA 2M30A 5LHGA 1KQ8A 4Q47A 3QF9A 3SQNA 2V22A 1ST4A 5EHOA 3DAKA 2VQLA 1O3TA 3WU0A 4YLLA 3ZLYA 5GAEJ 5AR3A 5CEMA 4RGUA 3RTRA 5HCXA 2XEZA 4AXFA 2X4ZA 2BDFA 3L8SA 4XRLA 2XBAA 3CD8A 4TYEA 3ULZA 1HKSA 3ORPA 4FKOA 2R7QA 3GTPJ 4FKLA 2F5DA 1WCMJ 3TDVA 4NWMA 4USEA 2E5ZA 1XH9A 3EN6A 2JN6A 3TMOA 1FVRA 3A61A 1AKHB 3QYBA 3GCMA 5KAIC 5C27A 3OCGA 1Z57A 4UWYA 4MWHA 3ZXZA 2B1PA 3RI1A 1MRYA 4X2KA 3VS1A 4Q5EA 3QD4A 3VBYA 3DNDA 2Z9OA 5IH6A 1PMNA 4BZDA 5D4SA 2HZIA 4RRVA 4B9DA 4B43A 4FKGA 2FQ4A 5JRSA 1OZ1A 3DPLC 4DTKA 2Z1DA 3LSHA 4CCLA 3HV6A 4X2GA 1Q24A 4M6XA 3ZH8A 3WTZA 3SG8A 2VT2A 5LGTA 4ZJZA 2PVYA 4FKSA 5CSWA 4X3FA 3TJDA 4AZSA 5K4JA 3PNTA 4C3RA 4G31A 3KZYA 2BHEA 3ZEWA 2ITPA 2DPUA 1AKHA 3TV6A 4EI4A 1E1XA 2E9PA 1KQ9A 4NM5A 2B63J 4AM3A 4ZK5A 4V01A 4C2MJ 1B4AA 3JVSA 1OISA 3EOCA 3PIPF 1TZDA 3R9RA 2CKEA 1PKDA 4FG9A 2ZO4A 3CJTB 4OMYA 3QWLA 1YLFA 1ETWA 4FIIA 5EQPA 1IRFA 4FSMA 4XP2A 3DP7A 3OG7A 3AKLA 2YX7A 4HNTA 2WTWA 4A6DA 4FNYA 5JLWA 1TWFJ 2ADUA 3ZPLA 3W8QA 2VT3A 1O7LA 2TRTA 3FPMA 2OZAA 2F5VA 5TR6A 4K1BA 1H01A 5IUGA 3GEZA 5HLNA 3CZ6A 3BL9A 3R02A 1J0RA 4AOIA 4PUSA 2G2IA 3C4ZA 5GJGA 4DFYA 4FVQA 1YW7A 2YLEA 2ECBA 1Z9CA 2C0IA 2PMHA 3E3PA 4XMOA 4XLIA 4FV9A 4O5VA 4A0YA 1TKIA 1H9GA 5E3OA 1GT0C 1ZG5A 2NOJB 2XZSA 5LMKA 2W5BA 5IOZA 3IRRA 4GG7A 3AD5A 1UFMA 1Y1VJ 4MLOA 4NFNA 2X2MA 5J79A 2VQGA 2XK3A 4FT7A 3SRVB 2XAJA 5CU2A 5B2LA 2PI0A 4E4NA 1T46A 3FXXA 3BBTB 3TTJA 3TEIA 2UV2A 4W8DA 3H9QA 4L00A 3GXOA 5LLQA 4YC6A 4BDJA 5TO8A 3RPVA 5LMBA