1TQIA

Crystal structure of a. fulgidus rio2 serine protein kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 91
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqiA02
2FO0A 1KE7A 2O0YA 1DDNA 4YFXF 2JKQA 2H8HA 3NUUA 3QTUA 1P2AA 3U1DA 4LRKA 4S31A 3HV5A 1YXSA 1XD7A 3AC1A 3SXYA 4I4FA 4BTMA 1Z5MA 4BDAA 3KCFA 2J9MA 4I5MA 4QMMA 1S9IA 2J5EA 4XSZF 2PZ5A 5D8LB 4BKZA 5I9WA 3GI3A 5B7VA 2YM8A 3KP6A 5K5OA 3OZ6A 2WNTA 4AT5A 4E5BA 1OUYA 2E9OA 1H27A 1GVJA 4UB7A 2YCSA 4IXPA 4FSQA 2ZOQA 1Z7UA 3S1HA 5F1RA 1IRFA 1JSTA 4KAOA 5EW8A 4GW8A 3NR9A 2R3JA 4FSYA 1ZHFA 2F2UA 5BNJA 5ERIA 2YABA 3D5XA 4IM3A 4ZYEA 4U43A 1D8JA 1XH9A 3UQGA 1O3TA 4IB5A 4G7HF 3NWWA 4R8HA 4AGCA 3UO6A 4E20A 1RJBA 2ERKA 3R22A 5J1VA 4ZS0A 2IJMA 3VBWA 2YM3A 5JFXA 5IQHA 5FLXK 3FZRA 1J3HA 3MCZA 2OH0E 1A06A 2WKMA 3ABTA 4IRGA 4BVUA 2OG8A 3TUDA 3EOCA 3RAKA 3I5ZA 4F63A 3R9DA 1CDKA 5AFVA 2LDUA 4LL0A 5J8FA 3WG9A 2YCFA 3SAYA 4BDBA 4V05A 4QT1A 1ZWSA 3F3TA 3FI8A 3GOKA 1PP8F 2CW0F 3A62A 3HMNA 5IG1A 3OTUA 4ENJA 2IPQX 4YNEA 1ZRCA 5CANA 4TPTA 4BZDA 2G1TA 5CF4A 3E3VA 4RC4A 1Q62A 1ZOGA 3G9NA 5AA9A 3UJGA 5DCFA 2X4FA 4PWNA 3CSVA 3HTUA 1KQ8A 2KRFA 2UW5A 3ZZEA 3RK7A 1P4AA 4V04A 3FM3A 3OW3A 1OPCA 3EMGA 2BHHA 5FUTA 2AC3A 5DYMA 3BYVA 1T2KA 4EH4A 3HDNA 3L9LA 3FBVA 1H1PA 4I0RA 2IRFG 2VWWA 2A6HF 4FSRA 3QD4A 3GCUA 4K18A 3MSSA 4HX8A 3NMUF 3EQCA 3P7AA 3F2RA 3NEUA 2QWWA 3GU5A 3NVMB 1H01A 3R8LA 3KREA 3C1DA 4D55A 1DM2A 3I79A 4QP2A 4LLNA 2UW7A 5HCZA 2B9HA 4CTCA 4XLPF 3NNVA 5M4FA 4DF3A 1ZYRF 1OL7A 3QCYA 1IAHA 2WMWA 3BJ6A 1I6XA 4BDCA 3A8XA 4HF1A 3E63A 4NCTA 3RJPA 4L5IA 3IDBA 3Q9VA 4FTKA 2WEIA 2JKMA 2OA4A 5KHWA 3ZO1A 4KICA 4LL5A 2RDPA 4XLIA 4CYJA 5AP5A 1ZG1A 3B2TA 3NZ0A 3GXLA 5EEGA 3TOAA 4KMFA 5HOOA 3E6BA 3E8DA 3VBXA 3OT3A 4DT8A 3IQ7A 1YHWA 2EXCX 4EH7A 3ZZWA 4DH5A 3RCJA 2JBOA 1TQIA 3RAWA 1U54A 2OU2A 1FLIA 4BTKA 4IZ5A 4HPUE 5A2QZ 2LF8A 5C4LA 3CJFA 3R1NA 1JXSA 3EN9A 1JSVA 2W1FA 1XO2B 2W99B 2OQRA 1BIBA 2XB7A 4H1MA 3LAPA 3QUPA 3TUBA 4NEUA 1PW2A 3DXQA 3E7VA 2UZNA 1OPKA 3R0JA 3K3IA 1MDMA 2WTDA 4PQNA 2YM5A 1Y6BA 1ERKA 3F5UA 1JBPE 3RHKA 2VWUA 3SW7A 3FMEA 5TF9A 2UXNA 3ZTXA 5I3RA 4LUDA 2MLKA 1CKJA 4G3FA 2WO6A 2ITTA 3W55A 1CF7A 3A7IA 3R71A 4HLXA 4ZY4A 1SYKA 4MK0A 3BP8A 2PTKA 3TKYA 4GSBA 3GZ5A 3ZC5A 4QMVA 1V4RA 3H92A 4TL0A 4BHCA 2BCJA 1RQQA 3L7WA 1YI6A 3C4FA 4DH3A 4FTMA 3BYMA 4FOBA 4AAAA 4CHUA 4LG0B 2HEOA 3ZSIA 2UVXA 4IW0A 1QPEA 2B0QA 3DTWA 2UZVA 2GQGA 4KNYA 2P5VA 2WMXA 1JSUA 4UWBA 3FI2A 3ZUUA 4P7EA 3V8KA 3LE6A 3J81Z 3ZSHA 2OBJA 2UXXA 3COKA 4GRBA 3LFEA 2CWEA 5CVVA 4I0TA 4FL3A 4EVIA 2BDFA 5DMZA 2F5FA 4RWIA 3I60A 2R7IA 2EXMA 4FEXA 2VGOA 4D2PA 1FBSA 3VBYA 4MXAA 4O6JA 4YG2F 4AA4A 4FT3A 3RPOA 4CXFA 3KULB 2C3IB 2PE0A 4ZTRA 2LAVA 4M6YA 4PL3A 1SNXA 4U88A 2FSTX 4N6YA 2WMSA 2UW0A 3NNWA 3HECA 2YPRA 4QMOA 4HCTA 3QOPA 4AA5A 3TTJA 4ZZLA 3W6KB 4QP7A 4C3PA 1PKGA 3ANQA 1OYYA 4FZ6A 4IZ7A 1DP7P 2L4MA 2UW4A 1U59A 3QQFA 4S2ZA 3V8LA 5JGDA 3UOHA 3PRIA 5FTQA 5DBXA 1JGSA 3F7WA 3NQOA 2XNEA 3GQLA 3ML6A 5L6OA 2GFCA 4FODA 3H30A 2BVAA 3ODYX 4IHPA 5CENA 3O50A 3UMXA 2J4ZA 1KA8A 1BKXA 2QI8A 5DWRA 5GJFA 4F08A 2WXVA 2JGZA 1H1SA 2VX0A 1FMKA 1IN7A 4JT3A 3ACJA 3PE1A 4YC3A 3GBZA 4XBRA 5FO5A 5AUVA 2VO0A 2W5AA 2ZB0A 3TGNA 1D5VA 1HW1A 1YFHA 3F69A 4G31A 4RFZA 2V9VA 5CVIA 3TIZA 3MZHA 1REKA 1R7JA 4H05A 2VN9A 5A14A 1ZMUA 3OBJA 4UNOA 5M08A 3UZRA 2DW4A 4TXCA 5D5XB 2HWOA 4O3MA 3F88A 4U0VA 1H0VA 4BZOA 2ZDTA 2XM8A 4HF0A 3KL8A 2HZTA 2P5KA 4GT5A 4LRJA 4KRCA 2DYLA 1PXMA 3ZMTA 4JDJA 1FINA 3FE3A 1KE8A 3QQUA 2M87A 3LW0A 4DGGA 4FNWA 1GIJA 3R2YA 4O38A 3OROA 4I24A 2VV9A 3PIXA 4AZFA 5FM3A 5B0XA 2EB3A 5LVNA 2WMBA 1A04A 2XZSA 1UHMA 3QPTA 4M72A 3PIZA 3HRBA 1APME 5CI6A 4U80A 1H1QA 3VQUA 3LFQA 4O0TA 4BHPA 2GTMA 4B0GA 4B7TA 1PRYA 5L2QA 4N9IA 4CKRA 2J0LA 3RIRA 3JTHA 4RWKA 1W5TA 2Y4IC 2FMYA 4P5OA 2Q0BA 1U5QA 3EQGA 5HBEA 1R1TA 4LB5A 2A5YB 1IRKA 4L6QA 4NW6A 1E2XA 3FPQA 2WELA 4S32A 4R6VA 3RINA 4IAIA 4K2EA 4IVNA 2QO7A 5DA3A 1ZY4A 4U0WA 3KEXA 1PMEA 4DG0E 5A9UA 3QFVA 4F1OA 4EONA 2DU9A 3JVSA 4M0YA 5CSWA 3LA2A 4FKGA 2HTJA 5H8GA 5IA1A 3KC3A 3BEAA 4DEIA 1DPRA 3O7LD 3GC0A 3KMWA 3UYTA 4D5HA 3R7IA 3AMYA 5FXRA 2QOQA 3U2RA 5E8WA 5DR2A 2RGVA 2W1CA 4TYEA 4Z2YA 4OR5A 3PSBA 4X0MA 4RGXA 3NUSA 1OL5A 1S7AA 4FICA 4QWQA 5FXQA 3LCTA 2QLZA 2VNYA 3SXSA 5FD6A 2ISZA 4HYIA 1OYIA 5AUUA 5JZNA 5HE1A 2PBIA 4KFCA 5BVOA 3ZOSA 4YBKA 2JDRA 3G15A 3GFWA 5BVWA 1BM9A 5TO8A 4EKLA 4MH7A 4GFOA 2ZMEB 2H34A 3FSKA 3BOQA 2X8EA 5HLNA 2XBAA 2C5NA 1LB2A 2XIKA 3RKWA 3E6DA 2YLFA 1YW8A 4O7YA 3K2ZA 2D45A 1YW2A 1GZOA 4YLJA 4XP2A 2DTRA 2OAZA 5BYYA 5DRBA 4X6RA 4LK0F 4EH8A 2YWPA 5CF8A 2P6TA 4QPAA 3ZM4A 3ORKA 4NIFB 4RJ6A 4IX3A 3JVRA 4XRJA 4RJ3A 4OIRF 4YURA 4A5MA 4WO5A 4PV0A 4P4CA 1J1BA 1UKHA 1YOJA 4C57A 3PLAE 3KEQA 5AV3A 4FT0A 3FZOA 1FGKA 1USSA 4JG7A 3UNZA 4AGUA 4AZEA 3BLHA 3OS3A 5LMAA 1IRGA 2TDXA 4IJAA 2O6GE 2HENA 4OIPF 4AZTA 3BY6A 4OBQA 2EJRA 2X7GA 2ZNZA 4HPTE 1BI3A 4UWYA 2OJ9A 1GY3A 1O3SA 3V8TA 3ANRA 1F3MC 5FP5A 4MEDA 2GQSA 1O57A 4A12A 3NVKI 3I59A 4LGHA 4PL5A 3MY0A 3ORXA 2JDTA 2QCSA 2J5PA 2R3LA 3KXZA 1Y91A 4HDUA 3QKLA 4F65A 4A9RA 5CEPA 4Y8DA 4IM0A 2F57A 2PMOX 1T0FA 3R0AA 1H24A 1G3YA 1IASA 1XMKA 5ETIA 4ALVA 4XRFA 4UXQA 4FC0A 3RKXA 1QCFA 5HI2A 3WZEA 3ERKA 3F66A 4UMTA 3IHUA 1PXLA 4BCHA 4UXNA 2XEYA 1ATPE 4EGZA 2BHEA 1XBAA 2YISA 5ETCA 3VUTA 3KRWA 3FMSA 4A2UA 3TL8A 3UOJA 4PMSA 2W1EA 3IKTA 4IAKA 4M71A 3ALOA 5FM2A 2HDCA 3FMJA 1B9MA 4WBOA 4UZHA 4E3CA 3U8WA 1H25A 4BHNA 5L2WA 3V8WA 4J8NA 5M06A 5I9ZA 4EZ7A 4G6NA 4FVQA 3DFGA 2M1BA 5E1XA 3EZVA 2BR1A 1YI4A 3LFSA 1FZPB 4XV1A 3PY0A 4KMUX 5C9CA 4P90A 3FI3A 3AC5A 4DE4A 3TKUA 4DGMA 4DHFA 4X2NA 1Q3WA 1ZZLA 2X0GA 3NDMA 5CLPA 4WXHA 4YSMA 1OM1A 4A07A 2G7HA 3WTVC 5CY3A 5ANOA 2UZBA 2EV6A 1STCE 1OYWA 1W7PB 3RK9A 4EQMA 4DH1A 5CVJA 3CJNA 1L0OC 4AW1A 5HE2A 4DT9A 1PMNA 4LOOA 2VOPA 4QMZA 2BAJA 3I54A 3KZZA 5HO6A 4IC7A 4Y17A 2QONA 3U6JA 3DZOA 2PZIA 1FPQA 3KY2A 4G94A 3LQ5A 1WMKA 4WSYA 3NUYA 1B6AA 1FVTA 1WAKA 2PMHA 3AG9A 5BVNA 3ORTA 2ESNA 2RN7A 1W7PD 4GK4A 4IPAA 1HKQA 4R8QA 1OPLA 4ZYDA 1UHWA 1BJAA 3W10A 2UZKA 2GNIA 2FSLX 4NM0A 2JKOA 4G9RA 2RF9A 3VWAA 4EUUA 4GK2A 5CT0A 1F5TA 4ACGA 3QU3A 4M8TA 3R9RA 3FMRA 3VODA 2YM6A 1XR1A 4F70A 4MNUA 5ACKA 1YS7A 2VTAA 4GV1A 4JQ7A 4QD6A 2JIIA 1IXCA 5B2MA 3VS7A 4AX8A 2EU9A 3M7GA 5M51A 3CTHA 1T6SA 1GHCA 1BI0A 3F5XA 2C6TA 3LSTA 4JIKA 2VNWA 1KQ9A 2VTJA 2ZYBA 5EHLA 1XQZA 4QTBA 1GAGA 1O7LA 2B55A 4WUNA 4R5YA 3ULIA 4UWCA 3ORNA 4WA9A 1FGIA 3HKOA 2Y8OA 3SRVB 3RAHA 4CYIA 4ZTQA 4TYJA 5KMOA 3GXOA 2RV8A 3QL8A 2I1MA 1SMHA 3FXQA 3K1PA 4ZLZA 3V04A 1M2QA 2PUIA 2OICA 3KRXA 5T68A 4I21A 1AOYA 1SM2A 1PY5A 3FKNA 2I0EA 5M57A 4FBXA 2A1AB 5BPDA 3TEIA 5A46A 3FHIA 4M13A 1WVYA 4GVAA 1MRVA 4AZSA 1ON1A 4NH1A 1PXKA 2K86A 5M09A 4R3PA 5AP3A 2GWRA 4NKAA 2HOEA 4GO1A 3H4JA 2HK5A 1DI9A 3SFZA 3EB0A 1Y8GA 5FXSA 2A4LA 4A9SA 2A61A 1XH5A 4RFMA 4AF3A 5J7BA 4ANMA 5E18F 4FKTA 3D4QA 4FKQA 2XV4S 3QU6A 3GO5A 2XEZA 3CJGA 3ORZA 5DPVA 4ANQA 5EH0A 2WWYA 3ECHA 3CUOA 4W8DA 3BPRA 3F7ZA 4YJPA 5JFRA 3ZSGA 3N4UA 3Q4ZA 4CSVA 3I0OA 4C59A 2XKFA 4XH6A 3A4PA 4X2GA 4YTCA 3MB7A 4EJ7A 3WF8A 3UMWA 3DKGA 3MYGA 5EM8A 4Z3VA 3DDPA 5HNGA 5A4QA 4AT4A 3F6XA 3D9VA 1WSUA 4OMYA 5ICFA 4FV2A 4KIBA 5LBQA 1J59A 2ETRA 1A9UA 4Y5QA 3V7SA 3FJQE 4BGQA 4JAJA 5IH4A 3ZFMA 2HTSA 1OIYA 5ANIA 2VN2A 3PJ2A 4HZFA 4KIFA 4NM5A 4EHEA 1H0WA 4FSNA 4RAYA 5I4NA 3VN9A 4TN6A 3SG9A 3Q9WA 2C6OA 4ZSAA 3UZTA 3M42A 4JDKA 3QZFA 1YQAA 3ZP5A 4NCTC 4IWPA 3W6JB 2C3LA 4FE2A 2AUHA 1U5TA 2W57A 4CRSA 1Z9XA 3VUKA 2XK9A 4X7QA 4LGDA 4E4XA 4L7FA 4ZTLA 3DKCA 5IU2A 4G3CA 3P1AA 4O7NA 1PKDA 2BRBA 4MHAA 1FOTA 4I0SA 2J50A 3O23A 4QNAA 3ZRMA 3S2PA 3R28A 4M73A 1U46A 4KDPA 4EOOA 1KOAA 3R8MA 3ZLXA 5KMMA 3BIZA 5EI6A 3ZFXA 3II5A 4L00A 2LKPA 2P3GX 3HMOA 5IA3A 5AIKA 3ITZA 5G1XA 3COMA 3R0TA 3O7LB 4HAMA 2YDIA 3J7AO 5DN3A 4BWPA 3QD0A 3UBDA 3WTSC 5A4TA 4Z55A 2C3KA 4GKIA 3QRUA 5L2IA 5DHJA 3DBQA 1USTA 2WHBA 1IA9A 4IJPA 4JRVA 5D6EA 3ZQ7A 4Y95A 4DNCA 2VAGA 4KWPA 1JWHA 3V01A 2OW3A 3FZPA 3TNPC 3EJ1A 4ZTMA 1S7OA 1FYMA 2FSOX 4RC2A 3OG7A 5AP2A 2UWMA 3JSPA 4WCGA 4RZWA 5HTBA 4LGGA 4KIGA 3ATSA 5KMNA 3D7TB 3WE4A 4E1ZA 5KBQA 4Z7GA 3A7GA 5HNBA 4I2OA 3ECOA 5C03A 4PPBA 4CD0A 5IQBA 4BFMA 2X39A 5E8YA 3TM0A 1BN5A 5AX9A 4P9FA 1CMKE 4GVJA 2I6LA 4I0BA 1MKMA 1Q8TA 3ZMMA 3F2NA 2R3IA 3KFAA 5AR3A 4J8MA 2FYSA 2R3OA 2CYYA 4ENYA 4DFZE 4X2FA 3VBVA 2HKXA 5E8VA 2V1DA 2FEZA 3KA0A 3SRVA 4O22A 4UVAA 5K0XA 1XB4A 3Q6WA 2EUFB 3UOLA 1SVGA 4CT2A 5BVEA 2GA2A 3KF7A 2EVAA 3HRSA 3TZ9A 4FI1A 2CGWA 4O2PA 3WZDA 4C3RA 1WRJA 1CKPA 1JKLA 3R61A 3E88A 2CQKA 3AMBA 4WNOA 4O82A 1ZYLA 4AW5A 1EV7A 3EH9A 5KHXA 1HKTA 3GU6A 2L3DA 5TRDA 4GYIA 3PDTA 4CFWA 4IAAA 4U7ZA 1UU7A 2PLYA 4HV6A 3QZGA 1VYZA 2C6LA 2UZOA 4IIRA 2VODA 2EFPA 2L4AA 3V5TA 2X9EA 2XCKA 5CU2A 3I58A 1QQIA 2JIUA 4HVIA 4XV3A 4L68A 4BIEA 4JBVA 3OCSA 1IR3A 4ZSEA 2HYYA 5EYMA 4S30A 3SW4A 3WODF 4C62A 2HFHA 3UDBA 1H07A 1SNUA 3ZHPC 5DDGA 3R7GA 3I81A 1XGOA 2WOTA 3LQ3A 3SA0A 4C4EA 3BKBA 4ASNA 4QQJA 3EYIA 4C2VA 2WB8A 1G3WA 3UPZA 3PXQA 1FX7A 4YC6A 4RPVA 5BQTA 3H9OA 4DCAA 4G3EA 1NY3A 5CAPA 4XOZA 3W2OA 1XH6A 5JFVA 1KUTA 2QYOA 3SLSA 3HRUA 4I4EA 4FTNA 2OJGA 4RG0A 5LARA 4ZTNA 1UU8A 4XSXF 4BDJA 2R7BA 4FIEA 4MKCA 3I6UA 2Y48A 2HZ0A 4U81A 5AV2A 3I59B 1R5GA 3C4EA 1ND4A 1WBTA 3QQGA 5DEQA 5JRSA 4NIFA 3FMQA 4X3JA 1J7LA 4D1SA 1GIHA 4O7SA 2RIOA 4DH8A 2E7WA 3PLSA 3MA6A 3AD4A 1U3EM 3TNHA 4AGWA 3GUBA 3WZUA 2A69F 3K69A 5LLQA 3TV6A 2XNGA 2F9GA 4I6QA 1YHSA 3E87A 4JQ8A 4YJNA 3ZMUA 3W18A 3KVXA 3L9NA 3IK3A 3TDWA 5IQIA 4LK1F 5AAGA 3GCPA 3FZ1A 3R83A 1YDTE 2QHMA 4PNKA 4HDVA 3UO4A 2JDVA 5GIOE 4WKQA 4PGHA 4GFGA 5CAUA 3BPXA 2RSVA 3OCTA 3QU0A 2CCHA 3F61A 3RPUA 2WMUA 3N4VA 4XRLA 4BI0A 5JMSA 4FA2A 1QZYA 5HD4A 4O5VA 2GXBA 4BC6A 3CC6A 4G8XA 2C6KA 2VC1A 2P4WA 2J5OA 4TZRA 2A68F 1DS5A 5JGBA 2OZAB 4ESBA 3R00A 2QLUA 5HG7A 3ZC6A 1Y8YA 3Q4TA 2QR8A 2E9VA 2EFOA 3M11A 4DFYA 4FUYA 3OOPA 3EQPA 2YJSA 2ZDUA 3FLWA 1ZRDA 2I0YA 4I1ZA 3GCVA 4BCJA 2KKOA 4ZIMA 2F2CB 3BBWA 3KRJA 1EH6A 1M7NA 3T9IA 3E5QA 2OFUA 5IUHA 3HP2A 1V0BA 3ZYAA 5HVQC 3SD0A 1ZYCA 4RQKA 3WARA 2FH9A 3I71A 4XCUA 1Z57A 2B9FA 3GT8A 2XAFA 4F9YA 1UNGA 3IS5A 3HX4A 3PP1A 2W4KA 3FLYA 4FSMA 4X2JA 3PA4A 3PSDA 1KE5A 3RKYA 3PG3A 3DTCA 1AGWA 2WTWA 4FHTA 5AUWA 4YMJA 3FSFA 2V22A 3LFDA 5CAQA 3D2IA 4QP9A 2GS2A 3VVHA 3OV8A 5FEDA 2DAOA 5CU4A 4G6DA 5FFZA 3QZHA 3DAEA 5IZFA 2CGPA 5IEYA 2KTYA 3EFKA 4I22A 1W84A 3FY2A 1ZMVA 2VTIA 4CEGA 5J7HA 3COAC 4F1MA 2WV0A 3UODA 3Q9ZA 1PJKA 3ATTA 3M1EA 4HZSA 3NW7A 3RI4A 3OFMA 2PJPA 2EXEA 4IRIA 4BBEA 4XBFA 4U44A 1ZXEA 3GW2A 2PVJA 4C4HA 4QTEA 1P5EA 3LFKA 1KOBA 2UZUE 3RPSA 5HG8A 3SXFA 4FV8A 2YIRA 4D28A 3CQUA 1XSDA 4E6QA 3KVWA 2WFYA 1R00A 4OTIA 5HG9A 3ZDUA 5JHUA 4L9NA 5E17F 3R7EA 2ZM1A 4MWHA 1ZYJA 4F09A 2PVRA 1IN4A 3QYZA 4KIPA 2C6MA 2PEXA 2GSFA 5IDPA 2QVSE 3R60A 1RUNA 5HHWA 3PYYA 5EM7A 3F21A 3F3ZA 4EM0B 3HSRA 4R7HA 5LCJA 5CYVA 4Q5HA 4EYJA 4PCQA 4KIOA 3PJ8A 4FTOA 3P78A 4U9AA 1KGSA 5J6XA 4RJ5A 2HY0A 4CZZA 1WKMA 4KIKB 1VEBA 3PA5A 1TQMA 1FYKA 4E4LA 5ICEA 1FNNA 3IOKA 1TVOA 5HBJA 4QPSA 4E6DA 5BUJA 5D1JA 3VUDA 2OO8X 2GPHA 2W5HA 3UIXA 3R7YA 3ETAA 1TLHB 3WE3A 3DT1A 3OWJA 5AR4A 4RIWB 2R3FA 4J96A 5CEQA 2EA2A 3TKHA 4E5WA 3BGZA 5L2SA 5DD4A 3MY1A 4QYFA 2BIYA 1SD6A 4FK6A 1BC8C 4MXOA 4Q5SF 2W0JA 1Q8WA 2PUUA 1Z1DA 4O91A 1IAWA 3HYIA 2J90A 5FWKK 4I20A 4ZYHA 2IZUA 3EQFA 2P7CB 3IKAA 3FYJX 2B7AA 3Q5IA 3O8TA 2DO7A 4O7VA 4MGRA 2E1NA 3N51A 4FIGA 5DUIA 4TY1A 3L9FA 5GJDA 3FUPA 4QYEA 4XP0A 3POZA 1LDKB 3OY1A 3TO6A 2C47A 5LHIA 1ZG5A 1H9TA 4H58A 4QNYA 4C3FA 1ZRFA 4PMMA 3H3ZA 3UZPA 4FTIA 3UP2A 2FQ3A 3RNYA 4LJZF 5F95A 3EIDA 4JRNA 5FBOA 2VBXA 3FHZA 3Q6UA 3GLXA 2CKPA 2Z99A 2KJBA 2QOCA 3JUHA 1U5TB 1B6CB 5DOSA 3PA3A 4JAIA 3J81K 2GDOA 3RPQA 2QVOA 3V8SA 3MJ2A 4JBPA 3G5DA 4L5JA 3DPLC 3K3JA 3VO3A 5LGNA 1H00A 2J0MB 4L9VA 1GXPA 1JLUE 2VZ6A 4KA4A 2WTKB 3GFJA 2C5XA 4HF2A 4A0ZA 3FPMA 3QCXA 4O0RA 5EK7A 3DDQA 1XCBA 3BWGA 4F6WA 5CEMA 3CS9A 1ZLKA 4GEOA 3RPRA 1OB3A 3PZEA 1J2XA 1OIRA 4F7LA 3BELA 4NW5A 5F9EA 5CTPA 4EEVA 3SOCA 4EQQA 4WNKA 3DGKA 3F8FA 4DQ2A 2WIPA 5J95A 3T1BA 1V0OA 3ZM9A 4G3GA 4N0BA 3LA3A 4RB0A 5KKRB 2CGXA 3I5UA 3LQ8A 5E92A 2P2HA 2W1IA 4G6LA 3JAMK 2VWVA 4XYFA 2P6SA 3AGLA 3R8PA 4YJVA 2H9VA 4AN2A 3BU5A 5T3QA 3VW6A 5DFPA 2HWVA 1QPDA 4DFNA 1SD5A 2O65A 4CFMA 2D2WA 4X3FB 2HW6A 4AWIA 4DFBA 3BHHA 5HZNA 2P0CA 1P4XA 1Q1HA 3LCDA 3KU2A 3ZFYA 4EH6A 3KLNA 3SHFA 5CXHA 4CFUA 4O0SA 3CGOA 5E8ZA 1T38A 5KMIA 4Y73A 2LNBA 2WAJA 3NAXA 4DN5A 2JZYA 4TYIA 2YM4A 3FLZA 2CN5A 3PY3A 4DTBA 1KU9A 3KRLA 4IZYA 2YIQA 1Z05A 3R8VA 1MJBA 2ONLA 3QWJA 4N0SA 1AD5A 3DA6A 1MDMB 3DKFA 3L8XA 3I4BA 4GJ2A 3MB6A 1EH4A 3ZMDA 2OGVA 3DXPA 3J80K 4A9YA 2QUFA 1XSVA 2GTNA 2CLQA 5AMNA 5CU3A 4OU0A 1YW9A 3CDHA 2LGCA 1Y57A 3KK8A 4DINA 1M52A 5FGMA 3U9GA 1YDRE 5ANEA 3P9IA 1E9HA 1O7FA 3JAMZ 1J9IA 1XBCA 4AW2A 4EV0A 4RJ8A 1W7HA 3FLSA 2WMRA 3R9NA 5DRDA 3TDZC 3NAYA 4N6ZA 4I7HA 3GF2A 3NYNA 2NRYA 3E8EA 4OAVB 4R3RA 2VWBA 2Z7RA 1V0PA 3RM7A 3VS1A 5LOHA 3KK9A 3TWJA 2UZDA 1NVQA 4CFVA 5CNOA 3WIKA 1URWA 5G6VA 4I23A 1XN7A 4KS8A 5JK3A 3IDCA 2CKQA 4BCPA 4D9TA 1W83A 4LV8A 4CICA 1QZZA 4V0GA 3NLBA 1JQHA 3FMLA 5I9XA 5DCMA 2X1NA 4PF4A 4DTAA 3C4CA 4HX7A 4OTFA 2CFXA 2Z7QA 2HKOA 3FL4A 3LOKA 2W06A 3V6RA 2YDKA 4BL1A 2FBHA 5EYKA 3ULZA 2OZOA 1Q97A 4EOJA 3WTZA 2PVYA 1G3TA 1EH7A 4FX4A 4UVBA 4EH2A 4PMPA 5HTCA 4ZAUA 4FV5A 3RWPA 2JLDA 3CR0A 3LWFA 4CCUA 4N9HA 5LMBA 2Y9QA 2YACA 4I6HA 5FLFA 1F4KA 3KXNA 3E5XA 1C0WA 2F7EE 4O7LA 2PQ8A 4BHBA 2YM7A 1IA8A 4EOIA 3I7BA 4FEVA 4E70A 4R5SA 1J7KA 2HCKA 3UOKA 4QP8A 4NJ3A 5IA4A 4LD5A 2B54A 3Q5ZA 3KRRA 4ASEA 1BX6A 4D9UA 5A6NA 4BDIA 2YU3A 4ENNA 2FOKA 4WX9A 3V51A 2YX4A 4JDHA 4Y5HA 3PVGA 1L8TA 3CBLA 3A4OX 3CPBA 4D4SA 1PYXA 4UMQA 1Q8ZA 4C2WA 4IVAA 2ITYA 3PPJA 2VWIA 5JT2A 2GQRA 4CZUA 2BGCA 4GU9A 1LQ1A 2Y4PA 3W2SA 2Z5UA 4RGSA 4H1JA 1FC3A 4GIIA 4YJQA 4JDIA 2XKDA 3OXIA 5L8LA 3WILA 2C68A 2PN6A 2OZ6A 5CT7A 3TO7A 4CLJA 3LM0A 2X81A 2QNJA 1J75A 1UFMA 5AP6A 4NU1A 4RFYA 3RWQA 3MFRA 3ELJA 4MNEB 2PFBA 3QZIA 2ZV8A 1EH8A 3MIYA 3R2BA 3JY0A 1S3JA 4BYJA 3WZKA 1GIIA 2QBYB 3ROCA 3BQRA 2Z9OA 1YWRA 2RKUA 4NTSA 2OKRA 4LMYA 2OU7A 2X7OA 3EFWA 3HLLA 1OECA 3FXXA 3DB8A 3BHYA 4PUZA 5HESA 4F0GA 1M14A 2VONA 4WXDA 2C69A 4LG0A 4PNIA 4GYGA 2GHMA 2GQQA 1ZYDA 3G0EA 5HVYA 2QOFA 1VJYA 2O64A 4KIKA 4A9TA 1OL2A 4P55A 3KP2A 5IUIA 1Q61A 5HDKA 3GVAA 4KSPA 2XNNA 4HNIA 3PP0A 2ZM3A 4YLLA 3ID6C 5DE2A 2JFLA 4FV7A 4PL4A 5E8UA 2R0IA 4RVMA 5KZ0A 2PSQA 2RQPA 4E4NA 2AC5A 3FKLA 4C37A 1V3FA 3NSZA 3RP9A 3P4KA 4NT4A 2WMAA 4EGYA 5T6KA 4AGDA 4Q4ZF 2B4SB 1GZKA 4CFXA 4DH7A 3UE4A 4IAZA 4ENMA 1TNSA 3W8QA 5LHHA 5ICGA 1SVEA 2V7AA 4BCOA 4GT3A 1FYLA 1XCVA 3QHWA 4FX0A 3RTRA 4KABA 3QTSA 3PG1A 2EB2A 4HGSA 4ITIA 3LLTA 2GNGA 3DP7A 4IH8A 2RKHA 3JPVA 3KN5A 1E1VA 4G5PA 1L3LA 4HX4A 4FT7A 4IMYA 3TN8A 3SKCA 2GNJA 5TJJA 3BX5A 5TR6A 1H1WA 3QA8A 3TV7A 4LLLA 4EOSA 4CFFA 2BAQA 1QGPA 2PHKA 4IBMA 3ENMA 2Y6OA 4GCJA 2OXYA 4W4YA 5EOBA 5KE0A 5EDPA 4R7BA 3FX3A 4G7OF 1UWJA 4JJRA 5D11A 4W4XA 4BI1A 4BDGA 5JN2A 3L9PA 3KCKA 4DBNA 3BGQA 4ESFA 4WWCA 5TT7A 4ZTSA 3RYPA 5DIAA 2BZKB 1Z6RA 3QALE 1O3RA 1YOLA 3IG7A 2HZ4A 3U55A 5L3GA 1ZMWA 4YIFA 3FL5A 1FMOE 3QTRA 2W05A 2R3NA 2YX7A 1XMAA 2DS1A 2QENA 4F99A 5LRRA 4H39A 2STWA 1I09A 4ON0A 4BR3A 2C6YA 2ADUA 4GUBA 1SVHA 1W4MA 4E5AX 4AWXB 2QOLA 3NUPA 4RWLA 3H10A 3EL7A 2YAAA 4FTAA 1SD4A 3GGFA 4ACHA 4LFUA 4YBJA 3VHKA 4LQMA 3QLFA 2C1BA 4UX9A 4LMUA 5LVOA 3NIEA 2QO2A 1DAWA 4E26A 2OF4A 2PE2A 5BMZA 1G8SA 4F4PA 4QO9A 3C1XA 2XUBA 4OGRA 4UYAA 4FV1A 5CF5A 4BRXA 3D0SA 3NPCA 4RBLA 4USFA 2ESHA 4EJNA 2XUUA 4UZDA 2O63A 3IWFA 2G15A 3PXRA 4XBUA 4WNMA 5IISA 3QQLA 1AQ1A 5J9YA 4YSJA 2ACJA 5A4CA 4ZZMA 3DLSA 1K9AA 2ACXA 4ACDA 5D41A 1NVSA 1PXJA 1VR2A 3EQBA 5M4UA 4FNYA 4O0XA 3ZXZA 2F7ZE 2IO6A 4JLCA 4W8EA 3MIAA 5E1WA 2ZV7A 2ZVAA 4HCVA 5FQDC 5ILUA 3ZU7A 4CGAA 1R23A 1JKSA 2VXZA 4FKSA 2K4BA 2B53A 4CTBA 3DK7A 3GFLA 4WRGA 4X6QC 2A3SA 1DI8A 4AW0A 1YXTA 5BOXA 4YHJA 1PMVA 3BJOA 4RA5A 4AACA 4LLGF 4ETSA 4QMUA 3OUNB 4BF2A 5JR3A 4DTKA 3E6MA 4I0AA 2J5FA 1JHHA 5HBHA 4ESJA 5GIPE 2UZWE 1OPJA 3ORPA 3U87A 2HZNA 1WBNA 4HYSA 3BDDA 2C4GA 3ODZX 5IKWA 4CKJA 3NCGA 4WK8F 3ZUVA 2HW7A 2CJMA 4NM7A 4I5HA 1LR4A 4EH9A 4MHGA 2IA1A 1JE8A 1ULYA 2VT2A 3T8RA 4AIKA 3DK3A 2IVTA 5GNKA 3C7JA 1M17A 3F6VA 1TW2A 2XAQA 2W96B 4JVGA 3JSOA 3FI4A 4M7IA 2YITA 3CO6C 4OMZA 2QM3A 1LPUA 2C6EA 4NM3A 3KKVA 3C4WA 4ACCA 4ITHA 4PPCA 4NFNA 2UZLA 4HQEA 3F6OA 4MQ1A 1UVRA 4I98B 2IG7A 1WBOA 4RLKA 1W82A 4M67A 3ZLSA 3MS9A 5KCVA 1IN6A 3V7CA 3DBFA 2WD1A 5HE0A 4I01A 3LFBA 5L2TA 4KYWA 4WT6A 5HOAA 2R2PA 3D0EA 2JPBA 3ORIA 4JS8A 4D2VA 3P86A 4O6EA 4ZOGA 4YJUA 3LHJA 3C5UA 4QP3A 4AOIA 3ZLYA 3LMIA 1IN8A 2XKEA 2X4HA 1PMUA 2KULA 3IWZA 4YZDA 4MYGA 4FSTA 4XUFA 5J87A 4XJ0A 2DFIA 1ZGJA 2RFNA 3K5VA 4HBLA 3RNIA 3QXOA 5H8EA 4FTTA 1WBVA 2JAVA 3ET7A 4R78A 4AIJA 4U3YA 3BYUA 4TYGA 1XHAA 4RMZA 4GIHA 2PVNA 1O6YA 4IX6A 4O7RA 3BV2A 4OTDA 3UVRA 1FT9A 2Q0OA 4II5A 4D2TA 2M5WA 1I1SA 4A06A 3NYXA 2GNLA 5DR9A 4L53A 3CXWA 3OD6X 2NPQA 4D0PA 4FIHA 5IEVA 5LHGA 4CCBA 1BI1A 3ELKA 5L8KA 2C30A 4FOCA 4U5JA 3QC9A 1R22A 4RIYA 2BMCA 5M07A 2SRCA 1ZREA 1WI9A 4J1RA 3KCCA 3HOSA 5BPIA 3L9MA 1ZOEA 3H9RA 4MNFA 3ZLWA 5EKOA 3H3UA 5HE3A 5M55A 5AAEA 1GXQA 1LNWA 2OLCA 1PXIA 2H27A 3B2WA 4GL9A 4B8LA 3KFWX 4DG2E 3CKXA 1LP4A 3W2CA 4NQWA 3KP3A 4IJ9A 3JR1A 4KBCA 4MBJA 5E8SA 3LXNA 3AC2A 4FK3A 5K4JA 3D14A 3BU6A 5A2QK 4BGHA 2GNHA 4YJTA 2QURA 2J6MA 4G9CA 5ILSA 1SZMA 3OEFX 3UC3A 5AUTA 1TNTA 3E8NA 3QCSA 4BIBA 4EQCA 2IVSA 4UXLA 4UYNA 4L3PA 4FIJA 2KJCA 2FB8A 2NYXA 4F0IA 4F9CA 3PWYA 1JNKA 5DEWA 2OZAA 5FTGA 5HEZA 5IF1A 1OKRA 4IWDA 3CEKA 2PE1A 3FXZA 2Z2WA 3QAME 3NGAA 4EORA 2HXLA 3HSEA 4BIDA 2OJIA 4FKWA 4TRLA 3TT0A 5K4IA 1SMTA 4C4JA 4LFIA 1O9UA 4D4RA 2ZFWA 4O27B 3LMGA 3NX8A 3NUAA 3C0HA 1H08A 3SXRA 3EETA 3LJ2A 1OKZA 1SFXA 4PZJA 3DB6A 4Z9LA 5E8GA 5BS6A 1J1CA 2C6IA 1OL1A 2IVUA 2PVMA 2DQRA 5C4KA 3TXOA 1D3YA 3F82A 3S3IA 4YO4A 4IHTA 5TOZA 4GS6A 5AUXA 5F64A 4YZBA 1S29A 2ZV2A 2CNQA 4OT5A 3K1MA 3MDYA 2VOOA 4QMQA 3KXMA 4R1HA 3VRYA 4XG3A 3ZRLA 1REPC 3ZDIA 2O03A 3LFCA 4I6FA 4O2ZA 5BPYA 4BXUA 1G3SA 2A27A 3UQFA 3FMDA 3VS0A 3QA0A 1JVPP 2YA9A 4QTCA 2A0CX 4FMQA 4EOLA 4AE6A 2DI3A 3N4MA 1LDJA 4RX9A 5I3OA 4O1OA 3BHUA 2MC3A 1HSJA 5LWNA 3WU1B 4M84A 4EWQA 3F5PA 2ZXJA 2COMA 1WVXA 5D5UB 3UO5A 2L54A 3QXPA 1UU3A 1FSHA 3U51A 2YAKA 2D1HA 4LOQA 4MWIA 3RI1A 1Q3DA 3IRQA 4PDKA 5KUPA 4HGTA 4L01A 3PSCA 2Q83A 1S8NA 2XBJA 2X2KA 1MJAA 2F5CA 3DF8A 4BCGA 2R3PA 3DCVA 4HYEA 1WQ2A 5BVFA 2WQNA 2ESMA 3Q4UA 3QRJA 4RX7A 3DK6A 3LCSA 4EJVA 3KMMA 2H6CA 4R79A 3QTQA 4U45A 3G9LX 5ITAA 4MVFA 3CQWA 4FIFA 2E1CA 5DI1A 3MY5A 3WIGA 4LM5A 3HAMA 5HICA 5CEOA 3MH3A 4A4XA 4IVBA 4R1VA 5IUGA 1WBWA 2G2FA 4ZJJA 2Q8KA 1R39A 3TTIA 3W2RA 5FDXA 1NXKA 4B8MA 4NYEA 2XVDA 2V0DA 5L3BA 1K2PA 4C02A 3POOA 5EG3A 3R8ZA 3BI6A 3OEZA 2OJFE 5TE0A 3F3UA 4FIIA 4WG4A 4WOVA 4BAYA 3GCSA 3T3UA 1H28A 4M74A 3VUGA 2UW9A 1XGNA 2BDJA 4AN3A 4EHVA 2WTCA 2HZIA 5CZHA 2BZHB 1KU3A 4H3PA 1YTYA 3MQ0A 2YJRA 5K5XA 2XYNA 3QLGA 3O0GA 3GUDA 3P5KA 4B4LA 1R58A 1Y0UA 1FQ1B 3ZPLA 4J99A 4FTJA 5HQ0A 1LEWA 4I3ZA 4S05A 3DU8A 4RB1A 3WU0A 1HW2A 1GOLA 1IN5A 4O84A 4IACA 3OVVA 2PZRA 2O61A 4J97A 4IDTA 1QPMA 4BB4A 5FD2A 4TWOA 4MD8E 2FRHA 1DAYA 4A9UA 1F5QA 2JRTA 1LVAA 2UZEA 4P96A 1H0MA 1YKRA 4XG6A 4L44A 5HD7A 5HKMA 3RTPA 4H3QA 4B09A 1FP1D 2XH5A 4X2KA 4KRDA 5BVDA 5D12A 2QOOA 3Q9SA 3EQDA 3I0QA 1M7QA 5CI7A 1SFEA 5CX9A 4QMYA 3ORLA 3E97A 4M9SA 2H09A 4BQAA 2HOGA 4FYOA 4O81A 3HL7A 3QAHA 3A8WA 5KK1A 4EMSA 5AADA 3CKWA 3I53A 1OIQA 4LI5A 2GFSA 3KXHA 5CJ9A 1PXOA 4L46A 4HVSA 4MXZA 5LMKA 4C8BA 3BBTB 1XSXA 5HX8A 3BQCA 4YJOA 2VTTA 3R1YA 4MBIA 3WYXA 3RZBA 4FKOA 4EM2A 5IQCA 1T98A 4OTWA 5CWZA 4FTUA 3TJCA 2FSWA 4XNEA 3HRMA 2Z02A 1RE8A 4IB3A 3TKIA 3BZ3A 4OTHA 5HO7A 3WYYA 5FB2A 1B59A 5ANDA 5J9LA 4L9TA 3FZVA 1B39A 4I94A 4ALWA 1OBGA 2F2EA 3D2KA 4DG3E 2Z7LA 4QQCA 2W1ZA 4XHKB 2A2AA 4PX6A 4RX8A 1J7UA 5AONA 3IW8A 4EL9A 4L52A 1ZRZA 2BPMA 3QQJA 1XH8A 1BL7A 4XLNF 2P7VB 5AWMA 1P6RA 1O6KA 2OZUA 5E1SA 2BEOA 4EKKA 3C0IA 2WMQA 1LEZA 3EQLF 1UWHA 2QHNA 5DGZA 1PDNC 1U54B 2PMUA 1OKWA 4M0ZA 2NRAC 3TIYA 3PXFA 2G9XA 5DT4A 2BDWA 1K79A 2IZTA 2XRWA 5EFQA 2J2IB 3EDPA 5AM7A 2YFXA 3ZUTA 4OBPA 2FBIA 3BEGA 2VE8A 4YZNA 4LUEA 3B02A 4PGGA 4CVAA 4UV0A 4EZ5A 3L09A 4EOKA 3PWDA 1JKTA 5I5ZA 2VE9A 3PVUA 2H96A 1LUFA 4UMRA 4ZSLA 2W24A 2F7XE 2RVCA 4M9XA 4EH5A 4YUQA 2Y7JA 3EUHA 3R9OA 3W1FA 3LA7A 4CV9A 3R21A 4Y83A 5E8XA 3HV3A 3QP6A 2R3GA 4C4GA 4BNCA 3VW8A 1BUHA 3LFNA 3Q04A 1FVRA 5CS6A 2M30A 3D5WA 3OMVA 4CXAA 3MVJA 2Y0MA 4JNWA 3V5LA 5JZJA 3HGKA 5EM6A 1CM8A 2DK8A 4KS7A 2STTA 5GJGA 3GU4A 2XNBA 1Z91A 2L02A 2P8TA 5HO8A 4DEDA 3SX9A 2BKZA 3IO7A 5CNNA 3OUKA 5FRIA 5L4QA 3W33A 4J53A 3C50A 3UGCA 4M68A 5GZAA 2OD5A 3IKVA 1ZH5A 3F3XA 3BHTA 2BBYA 1ZLTA 3RKBA 3JYAA 2OXXA 4R77A 3MEXA 4KKHA 4QTAA 4C38A 4YIIA 5CZIA 3SZTA 1G5SA 4K6ZA 5LGUA 1UB9A 4XOYA 4OTRA 2ZM4A 4X21A 2XS0A 4UMUA 3MFSA 3QYWA 1BMKA 4XG9A 1HCLA 2IW8A 1W8CA 3IC7A 4A6EA 3MVLA 2IA0A 1WWXA 4PDOA 4EK6A 4C0TA 2ZJ2A 1PXNA 2H6DA 3O2PE 3FHRA 5CVFA 3KQ7A 2GAUA 4L3LA 3NW6A 5HS7A 5L3DA 2MH2A 3KMUA 2J51A 3G0FA 2BRMA 1B9NA 4LRMA 4FT8A 3E5UA 5EDQA 3UC4A 1O3QA 3FQSA 4EBWA 2FSMX 5CQWA 3L1SA 4DCEA 4O0VA 2XNOA 1PUEE 1QBJA 4FG7A 1LJ9A 1UNLA 5HCXA 2OIBA 3IW4A 1RDQE 4U41A 3WGHA 3PPKA 3M2WA 4FUXA 1BYGA 3EN7A 4IAFA 3SV0A 4A6DA 2UW6A 3PZHA 3ZMSA 3FM5A 4EC8A 3IOPA 3O3KA 3AT3A 4JR3A 4DYMA 5KO1A 5M4IA 4U6RA 3S00A 3IL2A 2K4JA 3O2MA 4HYUA 4BCQA 4F1TA 5IA5A 3Q2MA 2IT0A 2PVLA 2CGVA 3QHRA 4HV5A 4G2FA 3AAFA 4RIYB 5EW3A 3G90X 3COIA 4BWXA 4ID7A 4QP6A 4HVDA 1MRYA 4YO6A 3GP0A 5AP7A 4L43A 5F20A 4QP4A 4CRLA 4HNFA 2G2HA 4E4MA 3GEZA 1P4OA 2UVYA 3P79A 2OK1A 3WF6A 2HQNA 3C0GA 4ZP5A 1QPJA 3C18A 5LEKA 5HLGA 3WTXC 4D4YA 1VZOA 2QD9A 2IA2A 4AUAA 3V5WA 4U0IA 5AR5A 3F8NA 3QX4A 3RPYA 2O3FA 3ULQB 2C5OA 4C35A 5JQ5A 3BYOA 2XRNA 5AUZA 1MP8A 2VTLA 5IQGA 3KP7A 3TJDA 3H9FA 3K54A 3TCPA 1OITA 3R8UA 4J98A 3PTGA 4MCVA 3TDVA 3VS4A 5DT0A 4CQEA 2AYPA 3H0YA 3P7BA 2EK5A 4TYHA 2HQRA 3C5IA 3D94A 4FKPA 4CZYB 3JTGA 3S4QA 3FC2A 2W9ZB 5CLSA 4FGBA 5CSVA 5D5WB 4EK8A 3VC4A 4MQ9F 4C33A 5CVGA 5J5TA 3L8VA 2WPAA 4GGGA 2UV2A 2XIYA 5L3CA 1OGUA 3Q2JA 5HS9A 5HLHA 1BI2A 4APPA 1OMWA 2VX1A 3RJCA 5CXZA 3ACKA 4FT9A 4WNPA 2XIGA 1ZOHA 3AGMA 4IB0A 3DBEA 2VTMA 1W0XC 3KXXA 2M8EA 3G73A 5D4RA 2VUWA 3SG8A 3HEGA 2PY3A 3FY0A 5LMKC 3RYRA 2CCIA 5D7AA 3TI1A 2XJ0A 3LZBA 4WG3A 4BBMA 4NKSA 3EWHA 2XP2A 3OF0A 4L8MA 2VO7A 3NYVA 3AT2A 3O17A 2O8YA 1OI9A 3R6XA 3ZO4A 2WIHA 4AXAA 2QG7A 3AC4A 3T8TA 4KBAA 1WCCA 2RFDA 5J1WA 2BILB 3QCQA 4ZXTA 1JKKA 4Y85A 4X3FC 4XG8A 3A60A 3Q60A 4UMPA 4G16A 1H9GA 4YP8A 4ZMEA 4TTHB 2ZAZA 4AQCA 1IAJA 3GYHX 4FTLA 4OT6A 1R5HA 4IM2A 3AXWA 3AQVA 4OTQA 3RBWA 3N4TA 2XF0A 5KKRC 2JD5A 1XWSA 3FZTA 2YIWA 1R1VA 4ONAA 4FX3A 2CKEA 2X8IA 4ZZNA 3HP5A 2VWYA 3HHGA 4ERWA 3GFIA 1UU9A 3FZSA 3H3CA 4TNBA 2QODA 4J71A 2HYGD 5JKGA 3WF5A 4AE9A 4QYHA 2B9IA 2W1GA 4NTTA 5H3QA 3R7VA 3TNIA 2CMWA 3CCNA 4G5JA 4ZS4A 4O7WA 5HLIA 1YHVA 1OMIA 4DEBA 4ANOA 1ZLJA 4BHZA 4C4IA 2GXGA 2Q0NA 2BFYA 3FAAA 4F7SA 3IGOA 2CKOA 1CSNA 3P9JA 4LYNA 4XV2A 4YPSA 3EKKA 2PWLA 3R02A 4ZJVA 1Z6TA 4AIHA 4FT5A 3D83A 4O0YA 2XNPA 2F5EA 3E5AA 4J52A 1OZ1A 3BLRA 2OF2A 1P92A 1UA2A 4RIOA 2E9UA 4IFCA 4TW9A 4EYMA 2IPXA 2K02A 3NRMA 1VTNC 4LB6B 5H6RA 3WE2A 1G3NA 3I4PA 4L0YB 2G01A 3UG2A 4MBLA 3F72A 4ORKA 5IQDA 3FKOA 3GENA 4XG4A 4Z7HA 4N57A 4YHFA 1SAXA 2DQ7X 4G17A 5C8MA 4E73A 2DQLA 4QRCA 2Z7SA 3RAIA 3PVWA 2ERZE 3UG1A 4XEYA 3VF8A 4HZRA 3JY9A 4MD7E 5A4LA 4KA3A 3PFQA 2VTHA 3F3VA 3E3BX 4CQGA 2ZJWA 4KBKA 2R4BA 4YZ9A 3IW7A 3Q52A 4HJOA 4L3JA 1HXDA 3OXZA 3HZTA 3DS6A 3TNWA 4YZCA 5KMJA 4CFNA 3F8BA 4OAUC 4RB3C 3W8LA 3QRKA 3R73A 3C13A 4M69B 3MFKA 1RI7A 4QTDA 2OIQA 4L45A 1KE9A 2XA4A 4N70A 4FZ7A 3WTYC 3D5UA 4WSQA 2DUVA 2XJ1A 5AX3A 1IG1A 1IW7F 4ZY6A 2PVKA 4K2RA 3MTLA 2EFQA 4ASDA 4EJOA 3NW5A 3HV6A 4DEGA 4MXCA 1U78A 5JFWA 3A7JA 2ITZA 4C36A 2ETKA 5HU3A 4J7BA 4EOPA 3OT8A 3PJ3A 5CSHA 1F9NA 4AVPA 3KP5A 2XIZA 2OIDA 4WF2A 2GU8A 4PTGA 4B6LA 2LF7A 2CSOA 2PUNA 3GC7A 4OOIA 2VTQA 1B4AA 3L2CA 3FMKA 3DQVC 5LJJA 4RQVA 3LKMA 3QRTA 4FVPA 3IECA 3PPZA 2EWNA 4DFXE 4FGRA 2DPUA 1DUXC 4WBBB 4FTRA 1XGSA 2W4JA 4APCA 2WQOA 2ZB1A 1BBYA 3LXLA 5ICCA 2C0TA 2UUEA 4FTCA 4ASZA 3VS6A 4YHTA 3FYKX 2CLXA 2OBPA 2JSCA 4X3FA 1WBPA 5E8IA 3OWLA 2XROA 2R3RA 5JGAA 4AFEA 3SQQA 3P7CA 2XIXA 4DEEA 2NRUA 4JR7A 3ZCLA 2WTIA 5CAVA 2J0JA 2JDSA 4USDA 5DD8A 5BX0A 2OH4A 4UVCA 1IUYA 4JL9A 2CPKE 4RVKA 2EV5A 1SD7A 3CY3A 1ZY5A 3LCKA 2IVMA 3TG1A 3OHTA 4YR8A 3QTZA 4IX4A 3ZXTA 4P9UA 3AOXA 2X2LA 4I93A 5E9EA 3A7FA 3NUXA 3WGGA 3HMMA 3FXUA 4EHZA 4QMWA 4AA0A 1K3AA 4YTIA 4EK5A 1M2RA 4FKUA 4U42A 2MA3A 1QPCA 1RIOH 3LAUA 3WBLA 4B99A 3DBDA 3VBTA 1Q41A 4QQ5A 4IF4A 4XG7A 1FBQA 4M9ZA 4CMTA 2FXAA 3V8JA 1B1BA 4C58A 1MQ4A 3GFEA 3GWZA 5L3AA 4K8AA 1FBNA 2R3HA 2DWBA 2YHVA 1J0RA 5I9VA 1R78A 2YWVA 3I0TA 2DPDA 3DZQA 4TWNA 3V5PA 3JW4A 3IDPA 4G3DA 2YR2A 4FNXA 3VBQA 2H6BA 4F7JA 3LQRA 4RZVA 4PDYA 3FV8A 5L6WL 2VBYA 1XGMA 2OSCA 4OIOF 2X4ZA 3GC8A 1X3UA 2HY81 2WU6A 2FF4A 2BTSA 3PY1A 2YIXA 4HW7A 2YEXA 2PVFA 5IH5A 2YLEA 3CIKA 3DY7A 3FXWA 3FMHA 3B8QA 3CUQA 1R0EA 3DJ5A 2VTPA 3S0OA 4AP7A 2V7OA 2YZLA 4U7DA 3LXKA 4GKHA 2QOKA 5A4EA 1STZA 3Q9YA 5JFSA 2FUMA 5EM5A 5DH3A 5AIRA 1S9JA 4G9YA 2MH9A 2RNJA 2NO3A 3ZN0A 5FFXA 4V01A 2R7DA 2Y0AA 5KNJA 4TYHB 4QMPA 4E93A 1K7AA 2FNPA 1Q99A 3WOWA 4ZMFA 2HR3A 2D1VA 3KEOA 4W9XA 4EK4A 2BRHA 2WQBA 4EJUA 2BFXA 3WTUC 4HGEA 1HBXG 3IW6A 4ZK5A 3NNUA 4JI9A 2V5QA 4IFGA 3C7QA 2ZNYA 3M9AA 4FF8A 3FEGA 2C5VA 3F2AA 4FEQA 1KV1A 5EQEA 3BE2A 4FZDB 3TQNA 4RJ4A 1FOKA 2CDZA 3MFUA 3BJAA 2XNMA 3TZMA 1YXVA 3DFAA 2B52A 5ICPA 1HSTA 3RVGA 2NNWB 2PYWA 2JAMA 1J91A 3SDJA 2CGUA 5J8IA 3PUPA 2XK7A 5IDNA 3R6SA 2ELHA 4DGLC 5E7RA 2XM9A 3HRFA 5ANKA 1KV2A 2VD5A 3DQWA 3PFIA 4L67A 3LIJA 3ZBFA 2GA1A 3MVMA 4I5PA 1HOWA 5JEBA 4EH3A 1YVJA 2RGPA 3VNTA 2ITWA 3DJ6A 4IVDA 4IWOA 3V5QA 3O71A 2DK5A 2VC0A 3HHHA 2X7FA 4AS0A 2PG4A 2ZO4A 4KN7X 1WFCA 1RW8A 4G6QA 4MEXF 2R3MA 4O0WA 3HMPA 2MBFA 3F8MA 5CVRA 2P2IA 4BDKA 2WC2A 4WUAA 4I09A 1YW7A 5DCMB 3Q96A 4IADA 2GNFA 4RSSA 3MVHA 3QQKA 1TKIA 4KNBA 5B2LA 2VT3A 2ZMDA 3CUQC 4A4LA 4D1ZA 5IH6A 3FF5A 3VJNA 2XIRA 4ENKA 3V3VA 4EOQA 2BIKB 1P4FA 3HMIA 3KP4A 4ZSGA 4K1BA 5E20A 4UUVA 3UVQA 3PRFA 3KN6A 2DBBA 3UTOA 1NW1A 2BAKA 3HNGA 3P08A 2RL5A 1U8RA 5K5QA 3D7ZA 4O6LA 4I02A 1FBUA 4D2SA 1VYWA 4V0GB 2JBPA 2VTRA 3AD5A 3QTIA 2V55A 3VF9A 5GINE 4ASXA 2JC6A 3RCDA 5EI2A 5AP1A 3V7RA 3E64A 3FWEA 2IP2A 4EQUA 1DPUA 2YCQA 5D10A 4CDGA 3G33A 3UVPA 5L6PA 3FLQA 4HOBA 3QD3A 2I0HA 4E6CA 3OP5A 3R1QA 5C1QB 4E8AA 4XX9A 3LAJA 2VTSA 3VS5A 1OVEA 3CP9A 4KT5C 1WBSA 5DUKA 3DFCB 4MD9E 1MD0A 4BCFA 4YPDA 1MRUA 3A99A 2XK3A 2R3SA 4DGOA 2EWAA 4O21A 3AC3A 3LQQA 4E6AA 5FLXZ 2NNNA 2YCRA 5IMXA 5M4CA 4WRSA 2FA5A 2GCDA 2B0LA 4ANBA 2DT5A 4M14A 3I1AA 3NEWA 3ZEPA 4DEHA 3LPBA 1U2WA 2Q2EA 4BTJA 2GS6A 1HCKA 3VS3A 2YZAA 4FKRA 2HWPA 4OLIA 1H1RA 4P5QA 3PXZA 5CVUA 5D5VB 2FGIA 5DLSA 4AD9A 4GMYA 3VQHA 2XASA 2BZIB 3T0YA 5FTOA 3GC9A 4JX3A 4EC9A 4RIXA 4FV0A 1XDUA 3UYSA 4BYIA 5HLWA 3HA8A 3MPMA 2E7XA 4ZEGA 3Q32A 4Y46A 2PU8A 2XJ2A 3LFFA 1KU2A 3ZS5A 2K7LA 5E1ZB 4BDFA 3R04A 3RGFA 1G6NA 2R0UA 4WHZA 2JTVA 3CUQB 2A07F 4XS2A 4H3BA 2BYVE 2V79A 2FMLA 3OBGA 3AD6A 2DLLA 4Q2AA 5TKDA 1XBBA 2QQ7A 4BWKA 2C0OA 2LSOA 3PQJA 3KZYA 4A0XA 3O6BB 4CLIA 3E62A 3VB2A 4W9WA 4GJ3A 5J9ZA 5ED4A 1PF8A 2W84A 3VUMA 3ISPA 3HUCA 3ZEWA 4D58A 5KMKA 5E91A 4I6BA 2XRUA 3QRIA 4BICA 4UALA 4D1XA 3DPTA 1ZG3A 4M15A 2W85A 4YJRA 3UIUA 4FKLA 2OXDA 4LV5A 3HIFA 3PJ1A 5FDPA 5AR8A 3D5VA 2X6DA 4NB5A 3CPCA 2ZMEA 2VBZA 5AV0A 3GFMA 5KMLA 3BZ6A 5A6OA 4MF1A 2X2MA 4KUJA 4EUTA 3G3ZA 2OFVA 3EFJA 3J80Z 5FGKA 1QNTA 2KIFA 2RG5A 3UQCA 3QUDA 2NNYA 4RA4A 2ZKZA 4BDEA 1H8FA 4G6OA 3EN6A 3K5UA 3MPAA 5JI6A 1F1ZA 4M97A 4C34A 4RX5A 5CVHA 4HYHA 1I1GA 1YOMA 3KLOA 3HRTA 4Q9SA 3JS2A 5AJQA 5DNRA 3P23A 4LGWA 2JEDA 4IXAA 3HTSB 4CV8A 2OQGA 5GHVA 1Q8UA 3R4KA 4HW0A 1FVVA 3GQIA 4TNDA 2PMNX 4XP3A 4TV7A 2ITQA 1P2FA 3PJCA 1U6GA 2XMYA 3V5JA 5AIPA 2BROA 4BCNA 3QUEA 1ON2A 4YFKF 5KVRA 4IZAA 4HLYA 4IC8A 4BCMA 4NZWB 2VRXA 3N97A 3R9HA 4YNOA 5H9BA 3VFZA 3MFTA 2Z8CA 2QQAA 5D4SA 2WQEA 2VX3A 1GZ8A 3F9NA 3O51A 3MTFA 1OIUA 3SOAA 4J95A 4PTCA 2Y4IB 4RIWA 3QBNA 1NHAA 1OR7A 2ETHA 4RLLA 5DR6A 4K11A 4WIHA 3DAJA 4L7SA 1K78B 4UV8A 3CLOA 5E8TA 4CG8A 3SVVA 4FL2A 2HS5A 5CAOA 2ITVA 3GZ6A 3VOEA 1TW3A 4OINF 2ITXA 2P33A 2I7QA 4MXYA 2F5DA 1GNGA 5LVLA 2UZTA 1OL6A 2O8XA 4YGAA 3G6GA 3QWKA 4UHTA 2PMIA 2E9NA 4QMTA 2IVVA 4PY1A 4G7ZF 1MJ9A 3O96A 1U5TC 3WI6A 2WMVA 4RGRA 1SFUA 1GJOA 5EW9A 2WZJA 5HIBA 3G2FA 3CTAA 4RC3A 1YG2A 3SC1A 4KSQA 5AUYA 2YERA 5D8KB 5HG5A 3BLQA 3ZONA 1A48A 4QLCU 2CNVA 2NAZA 4MX9A 4ANNA 4KKGA 3B73A 2WOUA 1I44A 1YDSE 3KETA 1RUOA 3HUGA 4D2RA 5HU9A 4OTPA 1FWZA 5DV5A 1IEPA 3TNQB 4Q47A 5LVMA 1BIAA 3O8PA 5HIEA 2AS5F 5LWMA 2HIWA 4E7WA 3HOTA 1R3CA 3I7CA 5EHOA 2XVCA 3DQXA 4BZNA 3HDMA 3C4ZA 3CTJA 5CQUA 4MQVA 3VUIA 5L3FA 3HV4A 2R5TA 3QGYA 3T3VA 5AEPA 3W2PA 1OKVA 4CMUA 1X8BA 1YIOA 2C5YA 4MAOA 4OUCA 3W32A 4GH2A 2MLGA 2W17A 4UBAA 4ZLOA 2BTRA 3MWMA 1BLXA 4GXOA 2R9SA 4PP9A 5ANGA 3M8FA 1TQPA 1Q4LA 2B1PA 3MH2A 2JFMA 4PP7A 3M8EA 3R7UA 3DPKA 2W1DA 3KULA 2Z33A 3U4WA 2R7FA 5BUIA 2OI4X 2X8DA 2L01A 4MTDA 5AV4A 5IT3A 2XAGA 1UNHA 5C8KA 3E93A 2PZYA 2BALA 3FC1X 1ZGAA 4GU6A 2PUPA 3HV7A 4AZWA 2O2UA 3NYOA 4BDDA 4PTEA 2J0IA 4FV9A 1R36A 5C27A 3QX2A 2BZJA 1IXSB 4Y15A 3MN3A 4O86A 3QKKA 5DYJA 2JDOA 5FG8A 4ZZOA 5BMMA 5CEKA 5LCKA 2O5KA 2VWXA 1YS6A 4FTQA 1QMZA 2FNAA 1S6LA 3MJ1A 5K3YA 3KB7A 4LOPA 5BYLA 1M2PA 2QKWB 1KSWA 3WE8A 2GZWA 5A54A 5EQYA 1LDDA 5DVRA 4I41A 1PP7U 3MWUA 4JK1X 3UIMA 1YXXA 4O96A 3ROUA 2QU6A 5L8JA 5J5SA 3ZH8A 3DOGA 1OKYA 5DEYA 4K9YA 4ERKA 3E6CC 2ZBKA 2QQBA 1P4WA 4JBOA 5J8CA 2F4JA 3GB2A 1IXRC 4EHGA 3DJ7A 2IW9A 5H6QA 5JSMA 4NL0A 5HDGA 5AR2A 1XDSA 4DAWA 3D7TA 4OW8A 3ABUA 3MESA 4NSTA 2JPCA 1B38A 4LMNA 2W4OA 1HKSA 1O6LA 3MPTA 4ZJIA 1XKKA 2OJJA 3CY2A 4AU8A 1UKIA 5AAFA 4YTFA 4EK3A 5HS8A 1KYZA 4CT1A 2CG4A 2J0KA 3TO9A 1HQCA 5HVKA 4M3QA 4DLIA 2C6DA 2FBKA 2WTVA 3P9CA 1K6OA 3EHAA 2GIVA 1WZYA 2P55A 2CSNA 5BUEA 4F9AA 4S04A 3OOMA 4D0XA 5LXMA 3S95A 4BH9A 1E17A 4RB2C 4CG9A 2Z60A 3ENHA 3P9KA 2YDJA 2ITUA 1YI3A 3BYSA 2XAHA 2ZCWA 3WF9A 2EFWA 1Q8YA 4HA8A 4WXCA 3WGIA 4BGGA 3DXJF 4XMOA 1JPAA 4IVCA 4EM1A 3QQHA 4BBFA 5AIQA 3RPVA 3BRBA 4IX5A 2Z3YA 3THBA 4IRHA 4JG8A 4QYGA 4KIQA 4FL1A 2WTJA 3MZYA 4K33A 3ZO2A 5HX6A 3HA6A 4CYDA 5FEEA 4M66A 4FSWA 4MXXA 3FQEA 1R1WA 1OBDA 4U79A 2C0IA 4AN9A 4L42A 4S34A 4M69A 4FG9A 2QO9A 2J7TA 3PIYA 2CN8A 5JH6A 2PMLX 4B8XA 3Q9XA 2WMTA 5LEJA 3IPHA 4P2KA 3NCZA 5LQFA 5K1YA 3CTQA 1T45A 5CU0A 2VBWA 4MEYF 3EYGA 4EZ3A 4KINA 5I0BA 3NNXA 2IW5A 3AC8A 1QL6A 1JOWB 4QPMA 2O3PA 4UN0C 4JBQA 3GOPA 2C3JA 4BN1A 4H0EA 1RZ4A 1GZNA 3L00A 3G51A 5IA2A 1WVWA 1D8KA 3QPHA 2OWBA 1RNLA 3PQKA 2VO6A 3F5GA 4FKIA 4GG7A 2GS7A 2ITNA 4BDHA 4YZMA 1L3RE 3GX4X 3F23A 2QLQA 5HCYA 1I5ZA 4FVRA 3TUCA 4TKSA 3FLNC 5E1EA 1ZYSA 4W4WA 4YFNF 5CU6A 4L0ZB 2Y6MA 2A19B 2B9JA 5IQAA 2QG5A 5F4NA 1J5YA 4U8ZA 4L9IA 3Q5FA 4FZAB 3HUBA 3REOA 4C61A 2UVZA 2W1HA 1K78A 3OCGA 3RK5A 1UV5A 5AP4A 4I5CA 4L18B 2QOBA 5KZIA 5D6FA 1MQBA 3G6HA 5FP6A 4DA5A 2E2BA 5CSXA 4HVGA 4NFMA 3BWJA 2R3KA 3C3WA 3K1NA 2JKKA 4F9BA 4LG4A 4CO8A 5HTIA 3MW1A 4IAYA 4AG8A 5CASA 1XJDA 3DNDA 3MBLA 5AA8A 3NRVA 3ZMVA 4USEA 3QC4A 3NS9A 4FV6A 4AT3A 5E4HA 3VHEA 5HDNA 4EJTA 4DC2A 3E8CA 3LMHA 3WZJA 3EYYA 3QTXA 1ZARA 3OTVA 1HW5A 4O0UA 3KF4A 3EZRA 3U6HA 3QGWA 5HORA 4A5NA 5C8NA 2HYFA 4U7BA 2AXLA 4GUEA 4KUMA 2GHLA 3LCOA 1G8AA 3PVBA 3GVUA 4D2WA 3E7OA 4O83A 5GZ8A 3RHXA 2JITA 3MH1A 4YLKA 3BPVA 5ANJA 2P4IA 3FQHA 1BOAA 2ZMCA 4HCUA 4YU2A 4RJ7A 1URCA 1YWNA 3MV5A 5JQ8A 1BC7C 4R7IA 2V1XA 2XK4A 1V1KA 3ZN1A 2XCHA 3CE3A 1PYEA 1KYWA 3JXWA 4ALUA 4HVHA 2VGPA 4RGJA 5H2UA 1ODDA 2W7XA 3Q53A 2BUJA 3BCEA 1MZBA 1MUOA 5HIDA 4DLJA 2NS0A 3CLYA 5IT9K 4CGZA 3U54A 2PI0A 1H4LA 1REJA 3M1SA 4KKEA 5EDRA 4EI4A 2VO3A 3EL8A 4A4OA 5EOLA 3SHEA 5EYDA 4YJSA 4ZZDA 3VRZA 4GCVA 3DV3A 5DG5A 5FD5A 2Y75A 3BWFA 2WTEA 4H36A 3F3WA 4XLVA 3TZ8A 2KIMA 2YIYA 4BI2A 1U4DA 1YXUA 4JG6A 5B2KA 4ZLYA 2W5BA 3COHA 3DLZA 5M53A 2QQ9A 4JXFA 3K2LA 3TV4A 3BGPA 5CF6A 1TTYA 3T8OA 3CD8A 4FV4A 1F0QA 3LFAA 4TWCA 4O7ZA 5CYIA 4QMNA 5LRSA 1Z9CA 2R64A 5AM6A 3LM5A 4CKIA 4BY9E 3ZBXA 4DGNA 5ACBC 3DXNA 3OWKA 3QRFF 1YLFA 3ALNA 4BCIA 3KE2A 2HAKA 3DAKA 4K77A 2HGCA 4QMSA 3U9NA 2X6EA 5ILVA 3I64A 4FV3A 2IN6A 5M56A 3FMNA 4ARKA 3OC1A 5CALA 1NVRA 1W5SA 3D15A 3OXTA 5DT3A 3UNKA 4JBAA 2V1UA 3AMAA 2RFSA 2CO5A 4RRVA 4RWJA 4EJWA 3EQRA 5D9HA 4FG8A 3H0ZA 1CGPA 2PK9A 3QKMA 4A0YA 4PDSA 5HVJA 5EQPA 5LVPA 2I40A 3R01A 1UCRA 3FWQA 4MF0A 2G2IA 2FA2A 2ZV9A 2XYUA 3Q4CA 3MI9A 5FBNC 2VTOA 3P7NA 4RAZA 3BV3A 1YYVA 1PHKA 2QZ8A 3K9TA 2X9FA 1W7PA 5LGTA 4ZTHA 4JIAA 5EEHA 3DKOA 3EN5A 3GEQA 2XK6A 1BL6A 4U3ZA 4RIXB 4TT7A 4MTAA 4FKVA 2BRNA 3N9XA 1R1UA 2PPQA 3B8RA 1G4DA 3HRCA 3I5NA 5E90A 4YC8A 3C51A 4GG5A 3TACA 3S2WA 1H26A 3R7OA 4FSZA 5GZ9A 4PRJA 2E9PA 3BROA 5EKNA 1T46A 3DBCA 3ERED 3C9WA 3UPXA 5ETAA 2V62A 3HYHA 3VJOA 2XGXA 5I9YA 4R1YA 2XKPA 5IEXA 4AZVA 2M45A 5IA0A 3T5XA 5EYCA 1XH4A 4W4VA 4D4VA 3EFLA 1E1XA 5ETFA 3VS2A 1YO5C 1XH7A 4BCKA 3PE2A 3LJ0A 4F6UA 4RVLA 1KU7A 4G34A 1NT2A 2P5LC 4GT4A 1ZAOA 1QO0D 2ITOA 4ZY5A 2CHLA 2JT1A 2GHGA 4WG5A 4Z16A 5K9IA 3LJ1A 1YQJA 3IONA 4EWHA 3RMFA 3REPA 4QQTA 4AOTA 3VUHA 2VTNA 2H94A 4R3CA 1IF1A 3D5LA 4OTGA 5H8BA 5HNIX 3NUNA 5C01A 1AWCA 4AOJA 4WD5A 2HELA 4DBXA 2WTKC 4PPAA 4QOXA 3U4UA 3ZO3A 3EKNA 3Q3BA 4EBVA 3UNJA 2EA4A 2ISYA 1LEBA 4F9WA 5K0KA 3TDUC 4D0WA 3GU7A 3IW5A 1TBXA 5A3XA 2WQMA 3VAPA 1KE6A 1P14A 2PVHA 2ETMA 5IT9Z 5L3EA 4N4SA 4C4FA 3RM6A 3SGCA 2IZRA 2QKRA 2PL0A 2WU7A 3CQEA 2GMXA 1R0PA 3GU8A 4ENXA 4IDVA 4ANLA 3L8SA 1ZZ2A 4UV9A 1CKIA 1Q5KA 2NP8A 2UW3A 3LVPA 3A61A 1KQ0A 3MAJA 3MGYA 3FMMA 4GK3A 4MTEA 3CGFA 1W98A 4S33A 4HQMA 4ZYGA 3R1SA 3F8CA 4O1PA 4FSUA 3VIDA 2ONLC 1LEAA 4NHJA 1BI7A 3ZRKA 3HAVA 4B9DA 4F7ZA 5KX8A 2XHKA 4Q9ZA 2RG6A 1Y6AA 6PAXA 3EQIA 4M12A 2RFEA 4CMOA 4OIQF 3DEUA 5HLPA 4ZSJA 4IEBA 4Y72A 4FR4A 5CEIA 3PXKA 4IE9A 3SZPA 5BQ0A 4AFJA 3OWPA 4G1WA 3T9TA 5IQEA 3A7HA 4FNZA 3E3PA 2EB7A 4BKJA 5CSPA 4QP1A 2QOHA 3R30A 5D7VA 2G9WA 3OY3A 2YSRA 4FEUA 4JOAA 2QU5A 3FDNA 3VULA 3FXRA 2BKKA 1KWPA 4HGLA 3MH0A 4Y13A 2V6CA 2XKOA 3V4GA 3EYHA 4XG2A 2QOIA 3IRRA 2IJLA 4PMTA 1CTPE 3PXYA 5KBRA 4U97A 3P0MA 4RS8A 4ZH4F 3LLAA 3DKWA 3QTWA 1J7IA 5M44A 2KIUA 3DNEA 1CF7B 1ZN2A 3TZ7A 4UY9A 4Q48A 5AP0A 2EFNA 2IWIA 4EOMA 3WF7A 4Q5EA 4JQEA 3CO7C 3TOBA 4YTHA 2RC4A 4O7TA 3U6IA 5IPJA 2QR7A 2QBYA 4P5ZA 3BE9A 4NJDA 4F0FA 1FPUA 3W16A 3QD2B 4IHSA 1FSEA 3E92A 4U40A 5I9UA 3L8PA 4KB8A 3R63A 3RDIA 4IQ6A 1OUKA 4RGUA 4M6XA 4JX7A 4MNEA 4F64A 4A7CA 4JQFA 4QYYA 1IZ1A 3OW4A 2XK8A 3HVCA 3KXGA 4IB1A 2YN8A 3I6WA 2CNUA 2REIA 2FVDA 4PDPA 1YRPA 5JVTA 4CNHA 4F7NA 1BI8A 4RT7A 3UP7A 2QC6A 5K5NA 2VWZA 1SMYF 3C4XA 5C26A 5H20A 3AT4A 1JHFA 2BE5F 2IZSA 2BV6A 5IMEA 2BRGA 3QF9A 4DITA 5HGIA 4I92A 3ZMZA 5BVKA 2W25A 1T39A 2XAJA 3DV8A 4DFLA 3LXPA 2I0VA 4DEAA 5F6FA 3GNIB 4GFMA 3O8UA 4KD1A 4FEWA 2FE3A 4ITJA 3CD3A 5AV1A 4U0YA 3BU3A 4K0YA 4FYNA 1U5RA 4C7TA 4CZTA 3UIBA 4IWQA 1PXPA 2WGJA 3OCBA 4BYYA 5EI8A 3VEPA 4BTFA 2C1AA 1Q24A 2HXQA 4NUSA 3ORMA 3ROYA 4UEUA 2O0UA 3RALA 5AR7A 4HOKA 2MD5A 2PULA 5BMSA 5JRQA 3NIZA 3QP5A 2A6EF 3W2QA 1I27A 3IGGA 2R3QA 2PZPA 3A2CA 2UW8A 2G7UA 4QMXA 3OOGA 4D5KA 5F94A 1ONVA 4NK9A 2ITPA 2XKCA 3MA3A 3RZFA 1NA7A 5J79A 3KGAA 4MQ2A 1FP2A 4ANSA 4ACMA 4F6SA 3SQNA 3BHVA 2JIVA 3F22A 3K0LA 2W9FB 1FY7A 2X0LA 4TWPA 2WEVA 2EV0A 2VU3A 1MGTA 3HSFA 4QMLA 4IANA 5BYZA 4BKYA 4XV9A 4KN4X 5IQFA 4NWMA 4FKJA 2F49A 4OBOA 5F1ZA 5FEQA 5EHYA 3GCQA 3U9CA 4L9JA 3WTTC 4FZFB 1JAMA 5K5RA 4RVTA 2FU4A 2K27A 1YWVA 3V6SA 2IW6A 4DFUA 3EN4A 3WTWC 3EQHA
chains in the Genus database with same CATH superfamily
2FO0A 1KE7A 2O0YA 2DMUA 2R0QC 1DDNA 1JUSA 4YFXF 2JKQA 1VLRA 2H8HA 3NUUA 3QTUA 1P2AA 3U1DA 4LRKA 4S31A 3HV5A 1YXSA 1XD7A 1ERDA 3SXYA 3AC1A 4I4FA 4BTMA 1Z5MA 4BDAA 2W00A 3KCFA 2J9MA 4I5MA 3CCLI 4QMMA 1S9IA 2DYSH 2J5EA 4XSZF 3CF5F 2PZ5A 5D8LB 4BKZA 5I9WA 3BT9A 3GI3A 5B7VA 2YM8A 3KP6A 5K5OA 3OZ6A 2WNTA 2GM4A 4AT5A 3CZ6A 4E5BA 1OUYA 2E9OA 1H27A 3AKZA 1GVJA 4KITB 4UB7A 5E3MA 2KP6A 2YCSA 4IXPA 4FSQA 2ZOQA 1Z7UA 3S1HA 5F1RA 1IRFA 1JSTA 4RBOA 4KAOA 5EW8A 1I6HJ 4GW8A 1GUUA 3NR9A 5E3NA 2CMPA 2R3JA 1D5YA 4FSYA 1ZHFA 1MMSA 2F2UA 5BNJA 5ERIA 2YABA 3D5XA 4IM3A 4ZYEA 4U43A 1D8JA 2R5YA 1XH9A 1WJDA 3UQGA 2CH0A 5E3LA 1O3TA 4IB5A 1X3WB 1D1BA 4G7HF 3NWWA 4R8HA 4BJTA 4AGCA 3UO6A 4E20A 3OYBA 1RJBA 2ERKA 3R22A 5J1VA 4ZS0A 2IJMA 3VBWA 2YM3A 5JFXA 2QKMB 5EG0A 5IQHA 5FLXK 4M6VA 3FZRA 1J3HA 3MCZA 1YX5A 2OH0E 1A06A 2WKMA 4G12A 3ABTA 4IRGA 4BVUA 2OG8A 3TUDA 3EOCA 3RAKA 3I5ZA 4F63A 3U21A 1ZQ3P 3R9DA 1CDKA 5AFVA 2LDUA 2WADA 1TZDA 4LL0A 4BEHB 5J8FA 3WG9A 2YCFA 3SAYA 4BDBA 4V05A 4QT1A 1ZWSA 3F3TA 3HKZN 3FI8A 3GOKA 1PP8F 2CW0F 3A62A 3HMNA 5IG1A 3OTUA 1IO2A 4QTRA 4ENJA 2IPQX 4YNEA 1ZRCA 5CANA 4TPTA 3HPGA 4BZDA 2G1TA 5CF4A 3E3VA 4MFEA 4RC4A 1Q62A 1ZOGA 3G9NA 5AA9A 3C2BA 3UJGA 5DCFA 2X4FA 4PWNA 3CSVA 3HTUA 1KQ8A 2KRFA 2UW5A 3ZZEA 3RK7A 1P4AA 4V04A 3FM3A 3OW3A 1OPCA 3EMGA 2BHHA 5FUTA 3TP0A 2AC3A 5DYMA 3BYVA 1T2KA 4EH4A 2V4JC 3HDNA 3L9LA 3FBVA 1H1PA 4I0RA 4AXDA 2IRFG 2XALA 2VWWA 2A6HF 4FSRA 3QD4A 3GCUA 4K18A 3MSSA 4HX8A 3NMUF 3EQCA 3P7AA 3F2RA 3NEUA 2QWWA 3GU5A 3NVMB 1H01A 3R8LA 1X19A 3KREA 3C1DA 3BTJA 4D55A 2DDBA 1DM2A 3MKWB 1VQ7I 3I79A 2CQNA 4QP2A 4LLNA 2UW7A 5HCZA 2B9HA 1U9OA 4XLPF 4CTCA 3NNVA 5M4FA 3RPUD 4DF3A 2LG4A 1ZYRF 4FRFA 2UV1A 1OL7A 3QCYA 2NVTJ 1IAHA 2WMWA 3BJ6A 1I6XA 4BDCA 3A8XA 4XONA 4HF1A 3E63A 4NCTA 5C4XJ 3RJPA 4L5IA 3IDBA 3Q9VA 4FTKA 2WEIA 2JKMA 2VQGA 2OA4A 5KHWA 1FTTA 3ZO1A 4KICA 4LL5A 2RDPA 4XLIA 4CYJA 5AP5A 1ZG1A 3B2TA 3NZ0A 3GXLA 5EEGA 1VQOI 3TOAA 4KMFA 5HOOA 3E6BA 3E8DA 3VBXA 4C2MJ 3OT3A 4DT8A 3IQ7A 4UB6C 1SFOJ 1YHWA 3LSJA 2EXCX 4EH7A 3ZZWA 4DH5A 3RCJA 2JBOA 1TQIA 2IXSA 3RAWA 1U54A 3SDBA 2OU2A 1FLIA 5EZGA 4BTKA 4IZ5A 4HPUE 4W1UA 5A2QZ 2LF8A 5C4LA 3CJFA 3R1NA 1JXSA 3EN9A 1JSVA 2W1FA 1XO2B 2W99B 2OQRA 1BIBA 2X1EA 2XB7A 4H1MA 3LAPA 3QUPA 3TUBA 4NEUA 3UDZA 1PW2A 3DXQA 4B1RA 3E7VA 2UZNA 1OPKA 3R0JA 2NS7A 4D7NA 3K3IA 1MDMA 2WTDA 4PQNA 2YM5A 1Y6BA 1ERKA 3F5UA 1JBPE 3RHKA 3JRAA 2VWUA 3SW7A 3FMEA 5TF9A 2UXNA 3ZTXA 3J7YJ 5I3RA 4LUDA 2MLKA 1CKJA 2G0EA 4G3FA 2WO6A 1D1CA 2ITTA 3W55A 1CF7A 3A7IA 2L0KA 2DMNA 3R71A 4HLXA 4ZY4A 1QRYA 1SYKA 4MK0A 3BP8A 2K85A 3TKYA 2PTKA 3GZ5A 4GSBA 3ZC5A 4QMVA 1V4RA 3WHCA 4XOPA 3H92A 4TL0A 4BHCA 2BCJA 1RQQA 3L7WA 1YI6A 3C4FA 4DH3A 4FTMA 3BYMA 4FOBA 4AAAA 4CHUA 2EBIA 4LG0B 4CUGA 3WG7H 2HEOA 3ZSIA 2UVXA 2X48A 4IW0A 1QPEA 3OYHA 2B0QA 3DTWA 2UZVA 2GQGA 4KNYA 2P5VA 1EJ9A 5F04A 2WMXA 1JSUA 4ITVA 3ZQCA 4UWBA 3FI2A 3ZUUA 4P7EA 5B1AH 3V8KA 3LE6A 3J81Z 3ZSHA 2OBJA 2UXXA 3COKA 4GRBA 3LFEA 2CWEA 5CVVA 1BOBA 4I0TA 1ETYA 1IJWC 4FL3A 1V5GA 4EVIA 2BDFA 5DMZA 2F5FA 4RWIA 3I60A 2R7IA 2E36A 2EXMA 4FEXA 4DOZA 2VGOA 1O4XA 2XRLA 4D2PA 1FBSA 3VBYA 4X1EA 4MXAA 4O6JA 4YG2F 4AA4A 4FT3A 2M0CA 3RPOA 3L2VA 4CXFA 3KULB 2FX0A 2C3IB 2X6OA 2PE0A 4ZTRA 3DTKA 2LAVA 4XLAA 4M6YA 1W0UA 4PL3A 2DDAA 3TYKA 1SNXA 4U88A 2FSTX 4N6YA 3DEWA 2WMSA 2Z16A 2UW0A 3NNWA 4HNTA 3HECA 2YPRA 4QMOA 4HCTA 3QOPA 4AA5A 3TTJA 4ZZLA 1OR7C 3W6KB 4QP7A 4C3PA 1PKGA 3ANQA 1OYYA 4FZ6A 4IZ7A 1DP7P 2L4MA 3CD6I 2UW4A 1U59A 3QQFA 4S2ZA 3V8LA 1RRJA 5JGDA 1IUFA 3UOHA 3PRIA 5FTQA 5DBXA 2BY2A 1JGSA 4DHIB 3F7WA 3NQOA 2XNEA 3GQLA 1QVUA 1E3PA 5K7ZA 3ML6A 5L6OA 2GFCA 3OS1A 4FODA 3H30A 2BVAA 3ODYX 4IHPA 4ZJZA 5CENA 3O50A 3UMXA 2J4ZA 1YIJI 2KRHA 1KA8A 1BKXA 2QI8A 5DWRA 4M3DA 5GJFA 4F08A 2WXVA 3BLAA 2JGZA 2X6YA 1H1SA 2VX0A 1FMKA 1IN7A 4JT3A 4BKXA 3ACJA 3PE1A 4YC3A 3GBZA 4XBRA 2F4OB 2IAIA 2QSFX 5FJ8J 5FO5A 5AUVA 2VO0A 2W5AA 2ZB0A 4XNFA 3TGNA 1D5VA 1HW1A 1YFHA 3F69A 4G31A 4RFZA 2V9VA 5CVIA 3TIZA 3MZHA 1REKA 1R7JA 4H05A 2VN9A 5A14A 1ZMUA 3OBJA 4UNOA 2WB1N 5M08A 3UZRA 2DW4A 4TXCA 4E7JA 5D5XB 1AHDP 2HWOA 4O3MA 3F88A 4U0VA 1H0VA 4BZOA 2ZDTA 2XM8A 2JA5J 4HF0A 2QQ8A 2Y0SA 3KL8A 2HZTA 2E1MC 2P5KA 4GT5A 4LRJA 4KRCA 1D0ZA 2DYLA 2M34A 1PXMA 4MO7A 2CQXA 3M3YJ 3ZMTA 4JDJA 1FINA 3FE3A 1KE8A 3QQUA 2DXIA 2M87A 3LW0A 4DGGA 4FNWA 1GIJA 3R2YA 4O38A 3OROA 3CQZJ 4I24A 2VV9A 3PIXA 4AZFA 5FM3A 5B0XA 3ASNH 2EB3A 5LVNA 2WMBA 1A04A 2XZSA 1UHMA 1ZTRA 3QPTA 4M72A 3PIZA 2IEWA 3HRBA 1APME 5CI6A 2ZB9A 4U80A 1H1QA 3VQUA 3LFQA 4O0TA 4BHPA 1W36D 2GTMA 1AKHB 1W36C 4B0GA 5IP7J 4B7TA 1PRYA 5L2QA 2ELKA 4N9IA 2BW3B 4CKRA 2J0LA 3RIRA 3JTHA 4RWKA 4O4FA 1W5TA 1FOYA 4BE1A 2Y4IC 2FMYA 4P5OA 2Q0BA 1U5QA 3EQGA 5HBEA 2ID6A 1R1TA 3X2QH 4LB5A 2A5YB 1IRKA 4L6QA 4NW6A 1E2XA 4OAYA 3FPQA 2M9HA 1YX3A 2WELA 4S32A 4R6VA 3RINA