1TQIA

Crystal structure of a. fulgidus rio2 serine protein kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 91
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqiA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqiA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqiA02
1G3WA 2CSNA 2GNLA 4FEXA 4H39A 4HW7A 1DS5A 3FQSA 3WE4A 4X7QA 5E8VA 4QT1A 5IA3A 4QNYA 3TIYA 1UNHA 2C47A 3O2PE 3GQLA 4G2FA 4FYNA 3L1SA 4FSMA 3ROUA 5D5XB 2CGVA 4F6WA 4IZ7A 3QWJA 3RDIA 4I01A 4ZJJA 2IN6A 3LA2A 3R8ZA 4IQ6A 4G8XA 2XIKA 1YXTA 3W6JB 3DZQA 1AGWA 2VTAA 2ZV2A 5L2WA 5HE0A 4QD6A 2JLDA 4XOYA 4FIEA 2WTKC 3OY1A 5IUHA 2O8XA 4LV8A 2QKWB 4O7LA 3FC1X 4DBNA 2WNTA 3U6JA 4BCKA 3T8RA 5HLIA 2KJCA 4XX9A 4GFMA 4LD5A 1PP7U 5JH6A 3LCOA 5DD4A 1XDUA 4BHNA 1HKTA 5BUIA 5EEHA 3IDCA 3I5NA 2R2PA 4O2ZA 3HIFA 2JZYA 4EOIA 3BEAA 3F7WA 3AOXA 2HZTA 4RIWA 4NSTA 1OVEA 3BKBA 2XK8A 3VS5A 3DBFA 2XUUA 1FBQA 2O65A 3BYUA 4M8TA 4JBPA 5AP7A 2OSCA 1LB2A 4CFVA 4FL1A 5ITAA 5DT0A 3D15A 4FL2A 4OTPA 2OJJA 2BUJA 4L45A 3RK9A 2UW6A 4JT3A 5IT9K 3BYSA 3GEQA 2MH9A 3PY0A 4B0GA 3ALNA 1L8TA 2BZJA 3MH3A 4FKOA 3LFCA 1H08A 2J5FA 2VBXA 3M2WA 1R1WA 5JFSA 2J50A 4BB4A 2WQMA 3RWPA 2OIQA 3W8LA 3PWYA 1J9IA 4HDVA 4XLPF 4CSVA 5E1ZB 2VWZA 4EZ3A 1VYZA 3EFKA 3TUDA 4YJQA 3J7AO 4DT8A 4J71A 4FTNA 1NY3A 2W5HA 4KIBA 3QGYA 2OK1A 4M9ZA 4XMOA 5HBEA 1Q8UA 3G0FA 5E91A 5CWZA 4MH7A 4XBRA 3PFQA 3D9VA 2QQ7A 4WBOA 2PHKA 1Y8YA 3WTWC 3FLWA 5I9YA 2IZTA 4DG2E 3JSOA 2OKRA 2RQPA 4BCGA 1PRYA 3IO7A 3R1SA 2UW0A 3D94A 3G3ZA 4QMOA 5FG8A 2GNJA 3DB6A 3SGCA 3TUCA 2XEZA 4P2KA 1UFMA 1BBYA 2YX7A 2GA1A 3PXQA 2QO2A 4IZYA 3DAJA 2GA2A 4Q9SA 5AADA 5IQGA 3LFKA 4IX5A 4QMYA 2K27A 1ZMWA 4TWPA 5BVDA 5EM7A 1QPJA 4UHTA 5IQAA 5JMSA 3I5UA 3I5ZA 1R3CA 4BTKA 2W96B 1H1SA 4CLJA 4OGRA 3WE3A 1SMYF 2QOHA 3PQJA 4FHTA 3SXYA 2HR3A 5LRRA 4UV9A 3FE3A 1B1BA 2VWBA 4KRCA 2JDVA 2WMRA 1Z6RA 3FHZA 1CDKA 1QZYA 4KWPA 3GFIA 4L00A 3RZFA 4ANNA 5BOXA 1OIYA 3VS1A 4GJ3A 1YYVA 1KV1A 2V7AA 5EDQA 1I44A 4JVGA 5CYIA 1ZWSA 5F94A 1ZY4A 4CZTA 5JR3A 3JYAA 3BLRA 3V5PA 4XS2A 2VWXA 4AIHA 1BX6A 1WBPA 2QHNA 5JRSA 3VW8A 3C4FA 1STCE 2A69F 2GXBA 1TKIA 3WTUC 4L52A 1W7PA 2GIVA 3PJ8A 1LEBA 1JVPP 4H0EA 4CFUA 1Q8TA 2UZDA 3DLZA 2E2BA 5D4RA 2OFUA 2DT5A 1K9AA 2I0VA 1G3NA 5BPDA 4YJTA 4WRSA 3DK7A 4C59A 2QBYA 2DFIA 2YITA 4FNYA 3D14A 5EDRA 1XR1A 4FKIA 5DOSA 1MRVA 4MXZA 2GNFA 1PXKA 5C8NA 4BYJA 3RHKA 2V9VA 2ZMCA 1XN7A 2PZIA 3JY9A 4ZTQA 2XNPA 3HNGA 2QODA 3P7CA 3SC1A 1UU8A 3GX4X 3QU3A 4QQJA 1GHCA 4PTGA 5M51A 3VW6A 4DC2A 4HV6A 3BLHA 2HKOA 3O3KA 1OYWA 4L42A 3AAFA 3F66A 4FV2A 4JG7A 1NXKA 1R0PA 3GC7A 3ERED 3JAMK 2V7OA 4ON0A 3ALOA 4TT7A 4OINF 1KE6A 4MAOA 5AR7A 3V8TA 3I7CA 3WZUA 2WD1A 2NPQA 4D2TA 3M1EA 1A04A 3F5XA 1Z1DA 4Y85A 4YTHA 3MYGA 3CGFA 4YBKA 1UV5A 3DAKA 5E8GA 4CYJA 2HIWA 3ZU7A 3MZYA 4DFLA 2D1HA 4B8MA 5M44A 1FOKA 1XH5A 4JOAA 4AZFA 4Q2AA 4JJRA 1YG2A 2J51A 2IPQX 1SYKA 4X0MA 3TZ7A 4JNWA 2BPMA 3R83A 1ZYRF 2H94A 5CEOA 1LDKB 1TW2A 4RQVA 2BRBA 4E6CA 2ZB1A 2PE0A 2GAUA 2F7EE 2YM7A 3NMUF 4CT2A 1ZG1A 1PYXA 4WHZA 1MRYA 3Q4CA 4XEYA 4Q5EA 4WXHA 5LRSA 3MFRA 2ITWA 4UV8A 5I5ZA 4ZLZA 4NCTC 5E1WA 1QPDA 2ESHA 2ITUA 2QENA 3UGCA 2GU8A 5TRDA 1PF8A 4DF3A 3HMMA 2Y6MA 4EOPA 4G6DA 3I64A 2VWIA 4AGCA 4C35A 4DHFA 5KUPA 1UVRA 1YRPA 3GVAA 2Z99A 4ANMA 1UA2A 4BIBA 2P4WA 3BJAA 4PP7A 2R3QA 2ETKA 2P55A 5HHWA 4G7ZF 3TDWA 4MNEA 2QD9A 4QYHA 4ENXA 3GP0A 3R9DA 5M06A 3JSPA 3Q96A 1IA9A 5CSXA 3HRFA 2KIUA 5KMNA 3T0YA 3QZIA 4DGNA 2OWBA 5CX9A 4XG9A 3ODZX 2ZJWA 3QYWA 4FTIA 3GFEA 4ZMFA 1UNGA 3UBDA 4L9TA 5EM8A 2G15A 2JRTA 4EOQA 3MFUA 3FMSA 1XGOA 3A7GA 4D5HA 2HY81 2STTA 2XYUA 3UMXA 4KMFA 5IQEA 3IPHA 2C5XA 4YTFA 2CGXA 4F1TA 3OC1A 3KCCA 4IW0A 3WTXC 1YQAA 2WIPA 2VAGA 2EUFB 2WIHA 4CRSA 1Z57A 2QC6A 3VBQA 2P5VA 1SNUA 4L67A 3KMWA 5AUZA 4AW0A 3TUBA 3QX4A 3QKLA 4ZS4A 4IXAA 1BL7A 4N9IA 1GIHA 3FLNC 3UOKA 4QQTA 2ZKZA 4PDKA 2FSLX 4GCJA 3ZLXA 3FY2A 2W17A 4BKYA 2C4GA 4IB1A 5CVJA 5H8GA 4C57A 2GS6A 1ZARA 2CLXA 2IW8A 2JDRA 3F2NA 1QPCA 2EA4A 4R77A 2J2IB 3QBNA 5LOHA 5K4IA 3ZN1A 4NYEA 5DMZA 2ELHA 2GQQA 2CPKE 4ZTRA 5KZIA 4AWXB 4JIAA 1H4LA 2K7LA 4IMYA 4GU6A 2DS1A 3CQEA 4JDHA 3EYGA 3PZHA 2HW6A 5CF8A 1Q61A 3Q9YA 2CJMA 2VTLA 4GUEA 4V0GA 4F0IA 2MD5A 1H1WA 4EOMA 1UB9A 2CDZA 4MQ2A 4H36A 4GL9A 5CVUA 4HW0A 5CQWA 3EETA 3KKVA 2XIRA 4U9AA 3GC8A 1Q1HA 1REKA 1PW2A 1O3TA 5EEGA 4YJRA 2C69A 2C3JA 2PVKA 1U5QA 2ZV9A 4CO8A 3J80K 4CQGA 4UVBA 3A7IA 1R78A 3PXKA 4O7NA 5DEQA 5D8LB 4AT4A 2E7XA 2ZV7A 2WEVA 4PDSA 5D12A 2J5EA 3TKYA 3DEUA 2PMUA 3EJ1A 1IZ1A 2EFWA 2XMYA 2BDWA 3CIKA 3PY1A 3ZFMA 4IFGA 3K2LA 3TDUC 2P5KA 1NVQA 4BCFA 4KNBA 4ASDA 2X6DA 4FTCA 5F20A 4HF2A 3U55A 3BZ6A 4K11A 4MNUA 2MLGA 4A6DA 4Y17A 3AMAA 4XG7A 3LQ8A 4FKUA 5A54A 1S29A 1G8SA 4M69B 5F1RA 5CENA 3PPKA 3CLOA 4KIKB 4H3QA 3GCPA 3F21A 3MESA 2FNAA 4EK3A 1M2PA 3GENA 4G16A 5FBNC 4UMRA 3Q4ZA 4D2RA 4U0VA 4EJVA 4HF0A 2ZFWA 3B2TA 4EOKA 3IRQA 5IU2A 2V5QA 1YWRA 2CNQA 4DH8A 2IVMA 3M1SA 5LMAA 3ACJA 4KN4X 1XHAA 4QP2A 5HIBA 1DI8A 3GVUA 3CQWA 2UZWE 1YQJA 3GO5A 4GJ2A 5CVRA 2VTSA 3O7LD 3RPSA 4IAYA 2WTEA 1V0OA 2P7CB 2P2IA 2B4SB 3NYXA 2B55A 2BRGA 4WG3A 4YNEA 3H0ZA 3DNEA 2OLCA 3MV5A 3OCTA 4UALA 5CASA 3IG7A 1HOWA 2C3LA 2WTDA 3OXTA 4DLJA 3GF2A 4TRLA 3DNDA 5DG5A 5AMNA 4IWDA 2KULA 1QBJA 2XV4S 2GDOA 4IAAA 4NFMA 3V7RA 5DEYA 4G1WA 2NNWB 3EZVA 4OLIA 4A4XA 5FTOA 3UG2A 1WCCA 2FH9A 1UKIA 2ACJA 4FZ7A 3TV7A 2D2WA 4MTEA 4AT3A 2Z7QA 3KMMA 5J1WA 4CG8A 1M14A 3CPCA 3FZRA 3F5UA 3OTUA 3BRBA 4ZAUA 4EV0A 3F3UA 3TACA 1H1PA 5EOLA 2CGWA 3GU4A 2QVOA 3SOCA 3PPJA 5AP6A 4GYGA 3EFJA 4EM2A 1FX7A 3ORZA 3VS0A 3I53A 4IJ9A 5FQDC 4Y13A 1OYIA 3ENMA 3POOA 4GCVA 5EH0A 2RFDA 1GIJA 2WMSA 2VNWA 3K0LA 4BIDA 1O9UA 3GZ6A 3EDPA 2WTCA 4E93A 5M4FA 2YM5A 3ZMDA 5IEYA 3FKNA 3HEGA 3GZ5A 4FKTA 5K5NA 3DKWA 3TI1A 3FM5A 1OB3A 4TXCA 3UTOA 2GQSA 1Q8YA 4EEVA 3IS5A 3K54A 3OY3A 3LCSA 3IGOA 3DA6A 4FR4A 3RK7A 3KF7A 3C51A 4IAIA 1J75A 3HA6A 1OKYA 4ZMEA 4UXQA 3PXRA 4ANBA 1YO5C 1Y6BA 3A99A 5HNIX 3RYRA 3BPRA 3WGHA 4BTMA 3PQKA 2ZJ2A 5HDNA 1V4RA 5JVTA 1H9TA 2FNPA 5A6NA 5LHHA 5CU6A 4O27B 4M66A 4X3FB 3VUGA 2OBJA 3M9AA 3LJ1A 5J8CA 4J95A 3OCGA 4RGJA 4W9WA 2PMIA 2X39A 3HDMA 4HNFA 3L2CA 3PG3A 3E63A 3R01A 4LL0A 4U79A 3PP1A 3T5XA 1XBBA 4BKZA 1FP2A 4GG5A 4A9YA 3Q4UA 3EQLF 4ZZNA 1BOAA 1FZPB 4GK2A 1OBDA 1IRGA 4LGHA 5J79A 3SZTA 3ZS5A 2VTIA 2HCKA 4EJWA 4DGOA 4EC8A 4NIFB 1VJYA 2QO9A 4XV2A 5IQHA 2E9NA 3DK3A 2YFXA 4C3RA 2GNGA 2WZJA 2PE1A 3BYVA 3FMEA 3OVVA 3DY7A 1AQ1A 2XNBA 4YTIA 2PMHA 3LQ5A 5KX8A 3EL8A 3HAVA 3H10A 3N9XA 3SX9A 4AFJA 5JQ8A 5EI8A 2I0YA 3QLFA 4ZEGA 4D2PA 4V01A 4HLYA 4BDJA 3HMOA 3MPMA 4ITIA 3D7TA 2XNEA 2BTRA 4BXUA 1ZH5A 4AACA 1RIOH 1YW8A 2GS2A 4J8NA 4FZDB 3TQNA 4LB6B 3AMYA 2GWRA 4BCJA 5HS8A 4FKQA 1FT9A 3VBYA 2FUMA 2C5YA 3WILA 4E73A 5L3CA 4FKGA 2Q2EA 1Z5MA 1MGTA 5IA2A 1NW1A 2IA0A 3P9JA 1Y8GA 4RX7A 5FM2A 3T8OA 4AN3A 1BJAA 3HAMA 5M56A 3OEFX 3KZYA 4M9XA 4TYGA 4QMQA 4ID7A 5KKRB 1OPJA 3V3VA 4RQKA 5L3FA 3AT4A 3G9NA 3FXUA 3UZTA 5IH5A 5M4CA 2R5TA 4B6LA 3HDNA 3LW0A 5BMMA 3ZPLA 3WF6A 4MGRA 4YJNA 3LA3A 2PVFA 1IN8A 2BTSA 2COMA 2FA5A 1QPMA 1B4AA 2ZNZA 3ZM9A 2HEOA 3CP9A 1ODDA 3FZTA 3R21A 3C7JA 2WOUA 4YHTA 3TNQB 2VRXA 3OF0A 3G0EA 2VOOA 4YPSA 2XASA 5IH6A 2Z8CA 4GIHA 4FTLA 3VRYA 4DFZE 5EYMA 4IH8A 3WI6A 4I5MA 4QP8A 3LJ2A 5L8JA 2H96A 5CANA 4UY9A 4O82A 2P5LC 1QMZA 2Y4IC 5CJ9A 3JVRA 3C5IA 3O17A 1P6RA 4OTRA 3VVHA 3IW4A 1F3MC 1PMNA 2YIYA 3H3UA 5AIQA 3F8CA 3F8MA 2WQOA 2HTJA 4C2VA 5DHJA 4B8LA 3TL8A 3FXRA 2BZHB 2RFNA 3IECA 5IKWA 2OZUA 4QQCA 2BCJA 4WSYA 3GEZA 5KNJA 3FZVA 1XH4A 4I4EA 1R00A 3VEPA 2M8EA 3H9OA 1Q24A 1CMKE 5HLHA 3Q9ZA 3RKXA 3QCQA 5IG1A 4C0TA 2WTKB 2I40A 2RIOA 2UVZA 4I0TA 3V5LA 2BDJA 1QPEA 1BKXA 3HV7A 1YXXA 2R3IA 3KY2A 2XH5A 4NU1A 2GZWA 3E6DA 1OL6A 5FD5A 5EHYA 1GNGA 2JBOA 3IWZA 3CGOA 5HX8A 1Q5KA 2NRAC 2J9MA 2XF0A 4JDIA 4HAMA 3HHGA 3LFSA 2YCSA 5I9ZA 1S3JA 3RJCA 1P4XA 4OTHA 5AR8A 2WQBA 2XKFA 4CXFA 3UDBA 5FTGA 5CSPA 4L9VA 2JAMA 3EN4A 5AP0A 2Q0BA 2EFQA 4G5PA 4EBVA 3EKKA 2JFLA 5CNNA 3V5TA 2PVNA 2W05A 3VRZA 3FMNA 4A6EA 3KK9A 4JK1X 1K3AA 5K9IA 2QQBA 4QP3A 3H92A 4YC8A 3M7GA 4XP0A 4BHZA 1ERKA 2YSRA 4PPCA 2RF9A 4ZTLA 4BL1A 3R2YA 2F2UA 3BGQA 1FINA 4L46A 3UO4A 3ATTA 3KXNA 2QOBA 1O7LA 4ZLOA 4LUEA 4FE2A 2ACXA 2OW3A 2X7OA 1VTNC 4L8MA 2OZAB 4Y73A 4DGMA 2PFBA 1PHKA 4I22A 5J5SA 3NIZA 3VNTA 3DF8A 2V1DA 1U54B 3D4QA 3LMIA 3UVQA 5E8TA 4ITHA 3PLSA 3WE2A 4QMWA 2FU4A 4I6QA 2DU9A 3DOGA 3E88A 5I9UA 1W82A 4YURA 2I6LA 1KOBA 3C9WA 2X9EA 2HZ0A 1K79A 3D5LA 3U1DA 4EZ5A 2W57A 3O51A 5IQCA 3WU0A 2ETMA 4NW6A 5D11A 2HQNA 5HG5A 3LSTA 4Z2YA 1REJA 5HBJA 1Q62A 4FTJA 4IAZA 2RSVA 3QTSA 4L5JA 4HVGA 4PPAA 4X6QC 4QPAA 4G94A 2JTVA 4DEAA 3ID6C 4G7OF 2G7HA 1SAXA 2C6LA 3QRKA 4FEWA 3VS4A 5AUYA 1D5VA 4IWQA 3Q9XA 4O1PA 4RLKA 5CALA 4ZSAA 3VUKA 5GZ8A 1T0FA 3GI3A 4WIHA 4EMSA 4YHJA 4HGTA 3FUPA 3REPA 1PXJA 4AXAA 2UV2A 2VO7A 2O61A 2GHMA 4ANSA 3LCTA 4RAZA 4AGDA 4HGSA 2HAKA 3H0YA 4O81A 2WAJA 2G9XA 2Y4PA 4MWHA 3A8XA 2GHGA 3GQIA 3QWKA 1Q8ZA 4Z16A 4IM0A 3FSKA 5DT4A 2XNMA 2GSFA 4KICA 3M11A 3RNYA 2CW0F 4O7VA 3I58A 3ORNA 4I4FA 4C58A 1YS6A 5J8FA 3TTJA 4P7EA 4L9JA 2EB7A 2QVSE 4MHAA 2C3IB 5J9ZA 4IX3A 3E87A 3ABUA 4BF2A 4L0ZB 4CFXA 2I0EA 2XM9A 4CLIA 2UXNA 4BY9E 3R9NA 5CS6A 3FI4A 3TM0A 4ESFA 2EV5A 3FI3A 3THBA 4WX9A 5LWMA 3KXHA 3ZM4A 4JQ8A 4NKAA 5EHLA 5BVNA 3JY0A 2DPDA 2NRYA 1W84A 2JDOA 5E1XA 4FSWA 2X0GA 3UG1A 3Q60A 3R2BA 3FLQA 5KO1A 2L4MA 3OS3A 4U6RA 1H27A 1NVSA 4FVQA 4E7WA 3LA7A 3FWQA 3QKKA 4W4VA 2IVUA 1FVTA 3HRCA 4RB2C 4AFEA 4E4XA 3B02A 3ROCA 4GT3A 2X2KA 4DNCA 1LQ1A 3IW8A 3A7HA 2W85A 3FMMA 3MB7A 2OIDA 4ZZLA 4HGLA 4NQWA 4BCNA 3EB0A 4ASNA 1PMUA 4MXYA 4JR7A 4A9RA 3KP6A 1OKZA 3P7BA 2C3KA 1RE8A 1JWHA 4BH9A 4OIOF 3OV8A 4AGWA 5LQFA 4C3PA 2A5YB 4Q9ZA 5K5QA 4Q5HA 1ZYLA 1GZNA 5CU2A 4EOLA 3TWJA 4WWCA 4OR5A 2IVSA 3C4CA 4U40A 3V8SA 2J7TA 5J87A 3I0OA 3ML6A 1XGMA 4IVAA 1LP4A 2Z7RA 4CQEA 2HS5A 2XIGA 3PSDA 4JBQA 1IXRC 2IA2A 4HOBA 2F5DA 3VHKA 3O8UA 4IHPA 4YPDA 3Q32A 4RBLA 1JSTA 3ZONA 4O0WA 5HD4A 2JBPA 5LCKA 3UO6A 3NUNA 3TV6A 4ACMA 1J7UA 1VZOA 1ZZLA 4KA3A 2P3GX 2YJSA 3F22A 3L09A 4GT5A 1ZRCA 5ETCA 3D0EA 4OT6A 1YWNA 4EK5A 3QXPA 2SRCA 5L2TA 3IDPA 4ZSGA 2PU8A 2PWLA 4AAAA 5A4QA 1G3YA 5BMSA 2P2HA 1CM8A 4LRJA 4K6ZA 2YR2A 2JDSA 1BI7A 5K1YA 3VUIA 2P6TA 4L5IA 4ZSJA 2FO0A 1XGSA 1WFCA 3DBQA 2HK5A 5T3QA 4I93A 1U59A 3A7FA 2HZIA 2BDFA 5CI7A 5TT7A 4WG5A 3ZEPA 5GNKA 4QMVA 1IG1A 3SDJA 3VS2A 3LM5A 2QG5A 5LHGA 4BWKA 2X7GA 4CVAA 3GCSA 3I60A 3UNJA 3HTSB 3R9HA 1H07A 1YKRA 2AC3A 1FPUA 1URCA 3DTCA 2W1CA 1PP8F 5IQIA 5H8EA 1XH9A 2EXEA 4E20A 3T3VA 1WVWA 1SD7A 5AA9A 4R6VA 3OBGA 2ADUA 5CU0A 4U97A 3EN7A 4KRDA 3RKWA 1ZY5A 5CSHA 4CV8A 1DP7P 4RZVA 3QTQA 5JGBA 1ONVA 3FKOA 5HCZA 3N4VA 3L9PA 3FAAA 2RVCA 5ILSA 2A2AA 5C27A 2PVMA 2X8IA 4JDKA 2M1BA 3BHVA 4KYWA 5LBQA 4M7IA 5JZNA 4MQ1A 4UEUA 3T1BA 4EUUA 4FSQA 4DEEA 1W4MA 3LCDA 4QWQA 3L9FA 2W9FB 5L8KA 3N4MA 4KIQA 2OO8X 4RSSA 2LNBA 1CKPA 2W1HA 3BX5A 4EK8A 5DIAA 2XK9A 4FG7A 5ILVA 5CSWA 4BBMA 2QLZA 3RPRA 3VQHA 1G3TA 3G9LX 4UZDA 4PNKA 3GLXA 3QX2A 5CEMA 3Q04A 4YLJA 3M8EA 5F9EA 3ZUTA 4PCQA 2QWWA 1YWVA 3C3WA 4G5JA 3KREA 4MEXF 4FT9A 1HCLA 4M74A 1E2XA 2ZDTA 4MEYF 4P90A 3OWJA 4LL5A 3COKA 4IM3A 2ITNA 5CSVA 1W8CA 2J0JA 2JSCA 4RC2A 6PAXA 3WGIA 4BTJA 3PXZA 3GFLA 5HTIA 3NX8A 3NIEA 3ORKA 4H1JA 3GCQA 2VTQA 4PV0A 1L0OC 4AOJA 2LF8A 3ZHPC 3TOAA 2CKOA 4ERKA 1P2FA 4EBWA 1TTYA 5IF1A 2YJRA 3SQQA 3K3IA 4RJ8A 3MEXA 3U9GA 4OBOA 5H8BA 5DE2A 4G3DA 3HRBA 1ON2A 3KRJA 2CN5A 3TGNA 4AGUA 3BQCA 2WXVA 3W32A 2GFSA 5HS7A 1FSHA 2OZOA 1U4DA 4QP4A 2W1EA 2P8TA 5CXHA 4J98A 4B9DA 4I1ZA 4EJOA 5F95A 3QALE 5J7HA 2BYVE 1B38A 4RWIA 2IZUA 3OXIA 1T38A 1S6LA 4RJ5A 3V7SA 2Z7SA 2VO6A 4FV9A 3HRSA 4CMOA 4ENMA 4BDBA 4YJSA 4U43A 2OJIA 2A07F 1MJ9A 2A0CX 2YM6A 4NT4A 3TNHA 2Y7JA 1PXLA 2UW9A 4AN9A 3RM7A 2E9VA 4GFOA 2UZBA 3UIBA 3ZO1A 4O7TA 1DPUA 3RKBA 2W4OA 4Y72A 4MBIA 4XP3A 3VUDA 5IZFA 1FSEA 2G2HA 2CKQA 3BU5A 4UXNA 3FJQE 4NW5A 3KXZA 2VX0A 3PWDA 4R5YA 1BM9A 4RJ6A 1J7LA 3WZEA 5E90A 4J53A 3CUQA 3MA6A 3ECOA 4IX4A 4BQAA 1KYWA 5E20A 5DA3A 4FICA 4IHSA 4KKEA 1DAYA 4I0BA 5I9WA 3ZMTA 2F4JA 4KS8A 2UXXA 2FOKA 4WRGA 3TKIA 4LG0A 4WOVA 2K02A 2FVDA 4OIQF 5H20A 2XIZA 2XKEA 4AF3A 4TNDA 4HVDA 4O0UA 1RQQA 3E6MA 5A46A 3HP2A 1XJDA 4PL4A 3ZTXA 5FXRA 5A2QK 4QTBA 4ZK5A 2RN7A 3R02A 2HENA 1YS7A 4FA2A 3R7VA 4LMUA 4XLNF 4MVFA 5CQUA 2ZNYA 2VTTA 2VBZA 4YC6A 3BDDA 2CN8A 3QAHA 2WO6A 3L8SA 3MDYA 1MUOA 4ETSA 4UXLA 4FYOA 1Q4LA 4WBBB 1BIAA 5CVHA 1S9IA 5LHIA 3RTRA 3ECHA 2PEXA 2O03A 4U3YA 3P86A 5TO8A 4CRLA 2PBIA 2LF7A 4HYIA 4AE9A 3BYOA 3RPYA 4AU8A 4ALUA 4DTAA 3GB2A 4IRGA 4YTCA 3UMWA 3GUDA 1XH6A 4C2WA 2KJBA 2B9IA 3OCSA 1J0RA 3OP5A 3VOEA 5D6FA 3WE8A 5AIKA 3ZMVA 3RIRA 3PVUA 5EQPA 2WGJA 3LCKA 1GZOA 4A9UA 3RBWA 3IGGA 4J8MA 3LAUA 3ZDIA 5LVMA 2DQ7X 4FSRA 1UU3A 4P55A 3ZLWA 1EH4A 1PYEA 2HW7A 1YOMA 4W9XA 3QP6A 3LKMA 3MIAA 4N9HA 4D2VA 4C34A 3R0JA 2RDPA 3V7CA 2Y0AA 3KMUA 3FLZA 1EH8A 5JFRA 4K0YA 3WF8A 2F57A 2AXLA 4IVBA 3AT2A 2PZYA 4EH6A 3BV3A 2R3SA 3LFNA 2UZVA 4CFMA 3GC0A 3R73A 4JXFA 2ITXA 4F09A 2O0YA 1W5TA 5F64A 1IRFA 2IP2A 4NTSA 4KS7A 5HEZA 4AT5A 2CKPA 4DYMA 4PX6A 1MQBA 3CKWA 2XJ2A 3ITZA 3P23A 4F70A 4XJ0A 2A61A 3CTJA 2VC0A 4A7CA 2PG4A 5AV0A 1SFUA 4GKIA 4X2JA 4II5A 2XNNA 4Z7HA 2H6BA 3GU6A 4JRVA 1O6YA 3KCFA 2VGPA 3NNWA 4CZUA 5M53A 5TOZA 1LJ9A 3CTQA 3D5VA 3SZPA 3BZ3A 4PUZA 4CD0A 4PDYA 4C37A 3UODA 4F9YA 5HQ0A 5AP2A 4PMMA 3E6BA 4MF1A 4F9AA 4EC9A 3QD0A 4HGEA 3ZXZA 2IWIA 4HQMA 1LEZA 5EM5A 3DU8A 4O83A 4G3FA 4C4IA 3TO6A 2J5OA 2HOEA 3RMFA 2XUBA 3DP7A 3QRUA 2XKOA 4USEA 2J4ZA 2CO5A 2F2CB 3IKAA 3ABTA 3ZC6A 2H8HA 4QPMA 4O86A 4NK9A 3ZXTA 3GOPA 3NYVA 2R7IA 4HYHA 1KE7A 4ORKA 2QUFA 4ZYGA 1VR2A 4F99A 4JBVA 4LB5A 3PFIA 2CGPA 3R0AA 4E26A 4RIWB 5JFXA 1H26A 5KMIA 5KK1A 4G6NA 2GTNA 4R8QA 2UZOA 3E5QA 3K9TA 2X9FA 3KK8A 2Y4IB 3CY2A 3EOCA 2QZ8A 3II5A 2FQ3A 3FXWA 5AM7A 1U78A 1R0EA 2VT2A 5ANEA 3KL8A 2QURA 5AUUA 5KZ0A 4A0YA 2BE5F 2DQLA 3FZ1A 4C3FA 1DPRA 3BJOA 3DS6A 2BBYA 2PVRA 3HLLA 2ZMEA 2W24A 2CLQA 3H9RA 5B2LA 4BDGA 2PMLX 3UZPA 3EQDA 3MQ0A 4EK6A 2X8DA 3ZO3A 2VTNA 4A5NA 2Z2WA 4OMZA 5ICFA 5G6VA 5AR3A 4QO9A 3QD4A 3WG9A 4BGQA 4XRFA 2B9HA 4Q4ZF 1IN7A 4Z3VA 3J81Z 3DJ5A 3HMPA 1KE8A 4S2ZA 4F9CA 3ZBFA 5FP5A 3WTVC 3Q9WA 2X0LA 4P96A 2C0OA 2YPRA 3FM3A 3HOSA 3E3VA 1ZG5A 3HL7A 4K1BA 3P79A 4QMNA 1O57A 4F08A 5I3OA 3ZH8A 3F5GA 2ERKA 3PYYA 4MCVA 4PF4A 4FSNA 4C4HA 3BE2A 5AAEA 1F5QA 4E70A 5HIDA 3C13A 3G33A 1HKQA 4ZTNA 2H6CA 4AW5A 4WSQA 3JTHA 5HG9A 3D2KA 3VULA 1XO2B 1OKVA 2BIKB 5HKMA 3QCSA 2XP2A 4LRMA 4JQFA 3AC2A 4C4EA 3DB8A 2FRHA 5DYJA 2UZKA 4LK0F 4IB0A 4GW8A 2PMOX 4CDGA 3UOLA 2MBFA 4APPA 3RCDA 3QFVA 4B7TA 4CEGA 3QRIA 4G34A 3F3XA 4TYIA 3NVMB 1LEWA 4E5WA 4XLIA 4BDIA 3BLQA 2V55A 1FLIA 4OUCA 4MKCA 3KP3A 4G3CA 3ZCLA 4HPUE 4EH7A 2QOKA 3LFFA 4AUAA 3BHHA 1O7FA 2MA3A 1AOYA 3BU3A 3GU8A 1FMKA 5ICEA 3I1AA 2MC3A 2VO3A 3LQRA 5K0KA 4XV9A 1F0QA 5IEVA 3SQNA 2ONLA 2BHHA 2E9OA 2XS0A 1H8FA 4NZWB 4N0BA 2EK5A 4KIOA 2OJGA 3OT8A 4BBEA 4M6XA 1WVYA 4BR3A 2W25A 4CHUA 3UNZA 3NYNA 2UZLA 1OR7A 1SZMA 4HX8A 5FUTA 3Q6UA 4JQEA 3EWHA 4QMZA 1OYYA 4ARKA 4L3LA 4BC6A 3M42A 4N4SA 2G2FA 1KQ0A 1W7PB 2FMYA 3KEQA 5HE3A 4HVSA 4EJTA 2YZAA 5L3GA 2NO3A 4Q47A 4ZOGA 1FQ1B 4E6AA 2E7WA 4U0IA 2QBYB 3ZRMA 3NW6A 4EQUA 3HA8A 4QP9A 2R3MA 1GZ8A 3LVPA 4BGHA 4MHGA 3MPTA 4RVLA 3TO9A 3AQVA 2C6KA 3MJ2A 3NRMA 5E1SA 4USFA 3GU7A 3WF5A 5AUTA 4X6RA 4FEUA 2R7DA 4FSYA 2DW4A 5AR4A 3OG7A 2HQRA 4OTDA 3AG9A 4OIRF 2QOLA 3EN9A 5HS9A 3LLTA 2Y9QA 3TO7A 2X1NA 2P6SA 3DDPA 3V4GA 4QP7A 5CVIA 3BWGA 2BFYA 4EH2A 3S4QA 1K7AA 2QCSA 4RC4A 2DBBA 5ANJA 4J96A 5HI2A 2BRNA 1FVVA 3WODF 2ETHA 4RVKA 4NM0A 2EJRA 3KVXA 4XV1A 4DH3A 1SNXA 2ZDUA 5BS6A 2XAGA 3SAYA 5D1JA 2YDIA 2IJLA 1RDQE 5C03A 3HKOA 3VIDA 4G9RA 1JKTA 5E8SA 5C4LA 4JDJA 2AS5F 5CXZA 3SW4A 3S95A 4MQVA 2KRFA 4ENNA 4BDFA 4F9WA 5C1QB 4S31A 1G4DA 4CGAA 2UWMA 3A60A 2C6EA 3N4UA 4O6JA 3BU6A 4EUTA 3EFWA 1R5GA 5K5RA 4UMPA 2XRWA 3MH1A 4KAOA 1QZZA 4UWCA 2UZNA 3LQ3A 3RALA 3QTWA 4M12A 4CT1A 5L2IA 5AWMA 4EJUA 2L4AA 3CDHA 1U5RA 4FIIA 2OZAA 3DKFA 4ZH4F 1PXNA 2RL5A 4WA9A 1IRKA 3MH2A 4QNAA 3MY5A 3H9FA 3S3IA 3IOKA 3QTIA 5DV5A 3HV6A 1O6KA 3QUDA 1BL6A 2ISYA 3NUSA 4CICA 2C6DA 5EDPA 3SG8A 1CF7B 4IAFA 3G73A 4XG2A 3KN5A 3KFAA 1YI6A 3ELKA 2WPAA 4X21A 3W33A 4QRCA 4O21A 2WC2A 1U5TB 5AV4A 4R8HA 5DRDA 3D5UA 5GINE 4BKJA 3TZ8A 2QU5A 4MNEB 4M72A 1M2QA 3MY1A 1BI1A 4R1VA 2BZIB 4C33A 5DN3A 4QLCU 1OIQA 3TJCA 4HOKA 1I6XA 4ZLYA 3OWPA 1PXIA 3SKCA 2OG8A 1YIOA 3ZRKA 2VD5A 1ZZ2A 4IJAA 2K4JA 2WMAA 3C0IA 2Y6OA 4XG3A 3NNXA 3NRVA 3AXWA 4QYYA 3EYYA 4RX8A 2V0DA 2VO0A 3RZBA 5JFVA 3ATSA 4AA5A 3SV0A 3FL4A 2BRHA 4GT4A 4RGRA 4W8EA 5EK7A 3MBLA 1I27A 4BDKA 3F2RA 5CI6A 5DDGA 1XBCA 3BEGA 3IRRA 4E5AX 5LGTA 4A9SA 2CWEA 5AV1A 2IT0A 2Y48A 3FHRA 2NS0A 5BYYA 4AWIA 1JNKA 4BZDA 4YUQA 1ZHFA 5L3DA 2LGCA 5HVYA 2GQGA 4Y83A 1YI4A 4IVDA 1MJAA 4KUMA 5ED4A 5E8WA 4GKHA 3NVKI 2C6IA 3W2RA 4ZS0A 3KP7A 2VT3A 1YW9A 4XYFA 3EFLA 2PVHA 3ZZEA 1STZA 1A48A 3ZSHA 5EW8A 4LUDA 1DI9A 4GVAA 1CKJA 3PE1A 5FFZA 4DITA 4AW2A 2WU6A 2RV8A 4R79A 1YW7A 4QTDA 1B6AA 3HV5A 4PNIA 3JUHA 3G51A 2C6YA 3DXPA 1URWA 4O38A 3RINA 2IJMA 4U45A 5DNRA 5F4NA 3CXWA 5C8MA 1KUTA 5T68A 4X2GA 3ROYA 3F82A 4QOXA 4AQCA 2W84A 4PL3A 3VN9A 3EQBA 4OIPF 3NCZA 5LARA 2C1AA 3Q5ZA 2OZ6A 3QZGA 5K5XA 3SXSA 5CU3A 5KE0A 2RFSA 5E8IA 4CXAA 4IRIA 3MSSA 4UB7A 3UYSA 4L44A 4YFKF 4OMYA 3LXKA 1H01A 3DBEA 2KIMA 3QTRA 4EOJA 5A9UA 2PULA 1OUYA 3NCGA 3E5UA 1V0PA 1OPCA 4ZZDA 4KUJA 1WQ2A 4F9BA 3B8QA 3KQ7A 4EH9A 4GH2A 2XNOA 3FX3A 4Z7GA 2PI0A 4L43A 4GXOA 5BVKA 5FTQA 4MF0A 3KN6A 4FT7A 3VF8A 4DEDA 4AA0A 4O22A 4EWHA 2QQ9A 2GNHA 5HOOA 2V1XA 2XBJA 1GY3A 4L3PA 2PL0A 3WF7A 3PPZA 1R1UA 3FLSA 5G1XA 2BKKA 4N70A 3HTUA 3MVJA 1OL2A 1F9NA 1Z05A 3QQJA 5AP4A 2WKMA 2OFVA 2VBYA 4FIGA 2OJFE 4KIGA 3LWFA 3QRJA 3R1QA 4EHZA 3W2SA 1KQ9A 3W2QA 3PRIA 1VEBA 2W4KA 4FKWA 4ASZA 3F3VA 3O2MA 1M52A 2FYSA 3E6CC 3BBWA 4IC7A 4I6HA 3UOHA 2KKOA 3RPVA 4KD1A 2X4HA 5CAQA 4C38A 2X8EA 5DR6A 3MIYA 3U4UA 2VC1A 2XAQA 1FYMA 4AZTA 4YO6A 3JXWA 5E1EA 4L7SA 3OD6X 3ORXA 1LNWA 2J90A 5LMBA 3CUQC 4PY1A 4YSJA 3OFMA 3FHIA 3D5XA 3KRXA 2Y8OA 3V5QA 4ZYEA 4EOOA 2PE2A 2FA2A 4EQQA 3PA5A 1XGNA 1REPC 2ZVAA 5JFWA 4QMSA 5EHOA 4BI2A 3LFQA 3WTZA 1FBSA 2VZ6A 1QCFA 4WG4A 3OOMA 4CCBA 3BWJA 1G6NA 4YHFA 2BFXA 3C7QA 4QYEA 1OITA 1DDNA 3QU6A 1RW8A 4ACHA 2JIIA 3HYHA 4GK3A 3J81K 4WK8F 1EH6A 4DFNA 4ZTSA 1G5SA 5C26A 3MTLA 3AGLA 1IN4A 2XEYA 1BC8C 2M45A 4G6OA 5EI2A 5IMEA 5M55A 3E7VA 5HU3A 2NRUA 4BHPA 4YIIA 3NNUA 3D0SA 2JEDA 4I5PA 1OBGA 4USDA 4IB3A 3R60A 2W1FA 2YISA 3ZMZA 4DINA 3Q9VA 1GIIA 5M4IA 1K2PA 1BUHA 1P4FA 3PG1A 3AMBA 3V8KA 3U9CA 1F4KA 2FF4A 2LDUA 1GJOA 4LI5A 3RI1A 2DAOA 4YFXF 5EKOA 3P7AA 1CGPA 2O5KA 1OZ1A 4FV3A 5M4UA 3AC4A 1BI3A 1UNLA 3P0MA 1NA7A 3G15A 5IQBA 2YWPA 1J3HA 1K6OA 1JAMA 3BBTB 3KXXA 3K1NA 5CVVA 2HOGA 4ONAA 5HE2A 2HZNA 2CMWA 2XROA 5B0XA 2QG7A 2M5WA 4I23A 3QCXA 3COAC 3TG1A 3F9NA 1J7KA 3L9LA 1K78A 4RIXA 2H6DA 4V04A 3W18A 3A62A 1P92A 3MWMA 3HYIA 2R3KA 4WNOA 5HO6A 5DH3A 3HUCA 3HUBA 2CFXA 3G5DA 2YAAA 1J2XA 1YXSA 1JLUE 3LFAA 3OCBA 4XG4A 1W0XC 4U80A 5J6XA 3NNVA 4IM2A 3LMGA 3UO5A 3SRVA 5FWKK 2C5NA 4EGZA 2XJ1A 4CMUA 4D0PA 4S33A 4LGDA 1Z7UA 3DJ6A 3NLBA 4OAVB 4OTQA 4RAYA 3FQHA 1IN6A 2W5BA 3DFAA 3DKCA 3VFZA 3O0GA 3ZBXA 4I3ZA 2JPCA 4NM7A 1PXOA 1FOTA 2JITA 2W1IA 3D7TB 1P4WA 4K8AA 2QOIA 2UZUE 4BTFA 4HPTE 3BQRA 4FBXA 5L8LA 2A19B 4YR8A 1E9HA 2RG6A 4W4XA 3W1FA 4FGBA 1IW7F 1WVXA 5DR9A 2BR1A 4BCPA 4WO5A 1ZYCA 3NR9A 5C8KA 3BP8A 4KB8A 3DKGA 2WQEA 5FM3A 3V6RA 2X7FA 3K5UA 5AAGA 5EG3A 4GMYA 1XSXA 3L7WA 3IWFA 3S00A 1OL5A 4PTEA 2C1BA 4E6QA 5E92A 2AUHA 1O3RA 4YZDA 4N6YA 3UPXA 2YM8A 3MFTA 4M9SA 4S04A 3I71A 3RPOA 4XG6A 3FF5A 5FXQA 4LOPA 4EGYA 4H3BA 3QQKA 1FBNA 4O7RA 3UVPA 5L3BA 2PTKA 1JXSA 2KIFA 4WUAA 5F6FA 4RB1A 1IXSB 1BI8A 1KE5A 4FG9A 4S05A 2L54A 5H6RA 4NEUA 3C0GA 2YWVA 4FTRA 3UJGA 2XCKA 5CTPA 4IIRA 4O0VA 4FTTA 3I59A 3OW4A 2R9SA 2RFEA 3FY0A 1MKMA 3G6GA 4EKLA 5BVWA 3ET7A 3TKHA 1V3FA 3COMA 3F6VA 4Y46A 3Q3BA 2HWOA 3QZHA 3LXNA 1YXVA 5BUEA 2PYWA 4CFFA 4L9NA 2XAJA 1KGSA 3OEZA 3MI9A 4M0YA 4RIYA 4G6QA 4X3JA 4U7DA 3NUAA 4YP8A 4AD9A 2QKRA 2VBWA 5JRQA 2R4BA 2VXZA 3FWEA 4DEGA 2CYYA 4G9YA 2C30A 3HMIA 1JKKA 4BNCA 1YLFA 4DG0E 4E5BA 4MTAA 4FKLA 1OM1A 3QCYA 2VX3A 4O7YA 3F88A 3TNWA 4CFNA 2FXAA 3P78A 4GG7A 4RZWA 4ZSLA 3M8FA 5EQYA 1Z6TA 4WXCA 3AD4A 3OUKA 4I6FA 3KULA 3RAKA 4F7LA 3Q2MA 4GV1A 4J99A 4WNMA 3ZEWA 2JIVA 5LXMA 3QUPA 1FWZA 1HXDA 5BNJA 3DGKA 5CU4A 4PRJA 3R8MA 3R8LA 3MW1A 4WCGA 3L00A 3BE9A 3OW3A 2ZM4A 3BY6A 2J6MA 4DE4A 4NTTA 3NW7A 1ND4A 3P1AA 5HDKA 4ALWA 2W1ZA 4EVIA 2C0IA 4O0RA 5JGAA 4RFMA 3GNIB 1F1ZA 4ALVA 4JLCA 3RNIA 2FSMX 2Q83A 4ACGA 5AJQA 2G7UA 3RI4A 5HIEA 1ZLKA 5IA0A 4FV7A 4W4YA 4F4PA 3E7OA 4FVPA 5EI6A 4ENJA 4DCEA 5AUVA 3B73A 2HFHA 4FEQA 1Z9XA 2PZPA 3V8LA 3MY0A 4M15A 4L0YB 1ZLJA 3VJNA 3Q2JA 1E1VA 3BHYA 4FT0A 5DCMB 4YO4A 2H9VA 4DFXE 3LIJA 3RPUA 4XBUA 1TVOA 3GCUA 4F6UA 1TQMA 3R71A 5J95A 3EQHA 1OKRA 4ZY4A 3Q4TA 1XWSA 4U44A 2ONLC 5IDPA 4MXCA 4Q48A 4RJ7A 4TYHB 3FKLA 5GJGA 4NM5A 4LMNA 3AT3A 5HICA 2JD5A 3HSRA 5HNBA 4QMXA 4L01A 4KMUX 3L8XA 3RHXA 5J1VA 3KZZA 2J5PA 1GOLA 2PVLA 4O0TA 3DJ7A 1SVHA 5BVFA 4FKJA 2CGUA 4DA5A 4L18B 2XAFA 5LWNA 4LFUA 2ZM1A 3DCVA 1WKMA 4IVCA 2VTOA 5HLGA 3NW5A 4G3EA 2OIBA 4AZVA 2QLQA 3UQCA 4DEBA 4BAYA 1UHWA 2PUNA 2O2UA 3UOJA 2P33A 2WEIA 3WTYC 4RIOA 1ZYDA 3L8PA 1QO0D 4BYIA 3H3ZA 4FKPA 5LJJA 1H0WA 4KKGA 3QTUA 5LEJA 3P08A 3LFBA 3QQHA 4YSMA 5ETIA 1YOLA 3I0TA 1C0WA 4AS0A 2LKPA 4HZRA 5HORA 4XG8A 2VTHA 5FLXZ 4E3CA 4CNHA 4LLNA 5I9XA 3VS6A 3RPQA 3PJCA 1XB4A 3F23A 3MB6A 4CKIA 3PJ1A 5DUKA 4I0RA 3SG9A 1EH7A 3DFCB 2G9WA 3D83A 4LLGF 4RLLA 1UWJA 1PMVA 4TWCA 1EV7A 4HV5A 2BRMA 4C4JA 2AYPA 4ANOA 1M2RA 3VBXA 2ITOA 3AGMA 2JKMA 2PZRA 2YERA 1XDSA 2WOTA 3R1YA 2B53A 2HZ4A 4TWOA 5LCJA 4AE6A 5HGIA 4F65A 5LVNA 4OTGA 4OT5A 4I02A 2XGXA 3CTHA 1V0BA 3MJ1A 3CSVA 5DGZA 2A68F 4JR3A 3BELA 1WRJA 4RA5A 1Q41A 5HO7A 2R7FA 3O6BB 2YABA 3CKXA 2OD5A 1GVJA 1H00A 2STWA 3C50A 4GK4A 4GFGA 5ETAA 3UZRA 4Y15A 4AN2A 1HBXG 4OTFA 3JTGA 4AX8A 1PJKA 3C0HA 3DKOA 3BOQA 4CKRA 5B2KA 5M57A 3F72A 3FI2A 4UMQA 4ENKA 2QYOA 4BYYA 4FV4A 3HSEA 4R5SA 2FSWA 1J59A 5DI1A 4BBFA 2DWBA 4R3PA 1U8RA 4WUNA 3FYJX 1ON1A 5J9LA 3H30A 3BHTA 5E7RA 4XSZF 3ZYAA 4F7ZA 4K2RA 2R3FA 3F8BA 5CZIA 4KIPA 5C4KA 3S0OA 3OOPA 3NQOA 4EM1A 5K5OA 1H1QA 2X2LA 3CBLA 2YM3A 4JL9A 2PLYA 2XKDA 2RGVA 1WBVA 5EYDA 4JG8A 2KTYA 4I6BA 4MQ9F 1XCBA 1MDMB 3S2WA 4O0YA 4U41A 3RYPA 1X3UA 3V04A 3PTGA 5E18F 4RVTA 3R7EA 2VTRA 2XKPA 4LV5A 4KDPA 3NSZA 4FVRA 2OF4A 1BIBA 4BHCA 3DK6A 2CNVA 1FGKA 5AV2A 5AR2A 4QP6A 3HZTA 3BGPA 4QMPA 1ZXEA 1X8BA 3ACKA 3OT3A 3ZFXA 3KETA 5FEQA 2W99B 3IONA 1FBUA 1S7AA 1P4AA 3Q5FA 3UYTA 1Y57A 5J7BA 3EN5A 4ZY6A 1BYGA 2ITVA 4LOQA 4ZTMA 4P9UA 4IJPA 4BZOA 1P14A 2R3OA 2YCFA 4GEOA 1B9MA 3OOGA 4LLLA 4P5QA 4AOIA 4R3RA 3FPMA 3KEOA 3PA3A 3MFKA 4C7TA 3WYXA 3IC7A 3UPZA 3QRTA 5AIPA 1ZLTA 4D28A 5CF6A 1L3RE 3ZOSA 3T8TA 3FMKA 3TCPA 4N57A 5EM6A 1I1SA 1DM2A 5HOAA 4BWPA 4A4OA 4X2NA 1TW3A 5E8XA 3R7OA 1Y0UA 4X2FA 2QOQA 4NL0A 2XK4A 1WSUA 2IPXA 3E5AA 5FGKA 4I2OA 5LMKA 4O6EA 4PMPA 2G2IA 2V62A 3DDQA 2UW7A 2QLUA 4MTDA 2ITQA 4C62A 4O0XA 2XB7A 4FTOA 2BMCA 3Q9SA 2HY0A 1TBXA 4JQ7A 4BCIA 4QTEA 3ZQ7A 1MRUA 4D1SA 3O96A 4ZY5A 2W5AA 4M3QA 4ASXA 2L02A 3VBVA 5KHWA 5HESA 3SFZA 4UMUA 5AUXA 3RP9A 5JZJA 2DLLA 3F5PA 2QO7A 5LVOA 5AUWA 2YEXA 1IAHA 4I5HA 4AVPA 4P4CA 5EOBA 4LM5A 3T3UA 1JHFA 3FMJA 4J52A 4KNYA 2QOOA 2VX1A 4M14A 4QMTA 2WMXA 4TL0A 4XHKB 2X4ZA 4TWNA 5A4EA 4IF4A 2LAVA 3CCNA 4TY1A 5HD7A 3ZSGA 4IX6A 3NDMA 4KIFA 4IPAA 3OHTA 5JQ5A 3CS9A 4XRLA 3HV3A 3N97A 2GNIA 4RJ3A 5EFQA 4NKSA 3VUHA 2XNGA 4FNZA 2XIXA 2UUEA 4R1YA 3GOKA 3F3WA 3DPLC 3WBLA 3GGFA 2HKXA 4UZHA 1NT2A 4D1ZA 2W9ZB 5JK3A 1E1XA 3EQRA 4L9IA 2BVAA 1H1RA 2Z3YA 1S7OA 2BZKB 2EWAA 5E4HA 4LMYA 5ICGA 1Q97A 1RJBA 4UMTA 3MPAA 2DK5A 1CF7A 4PP9A 3K69A 3AD5A 2L3DA 3E97A 5E8ZA 4FI1A 3HX4A 1U5TA 4HA8A 4EKKA 4FEVA 5TKDA 4RA4A 4A07A 3TTIA 4LOOA 2QR7A 2YLEA 4F63A 4O0SA 2H27A 4G6LA 5IPJA 4YU2A 3ZUVA 5I4NA 4GYIA 2VWUA 4LQMA 4KBAA 2Q0NA 1RUNA 4RVMA 4RWLA 2YHVA 2QONA 1Q99A 5H6QA 5TR6A 2R3PA 2RC4A 2QHMA 1RZ4A 2VU3A 3FC2A 5C01A 2R64A 1B9NA 5KBQA 4F6SA 3HRMA 3ORLA 3GYHX 1IUYA 4TPTA 2H09A 4PZJA 2GS7A 5D5UB 2YIQA 4NB5A 3RVGA 5T6KA 4GGGA 3FMDA 3E5XA 4WXDA 2IZRA 3EMGA 3WU1B 3R4KA 4F64A 4S30A 4H05A 3GFMA 2GMXA 3AC3A 4JG6A 4L3JA 1HKSA 2WTIA 1M7QA 4A9TA 3W8QA 2R3GA 2C5VA 1KU3A 3GCVA 2ITTA 3CUQB 1R23A 4K18A 2JFMA 4EH3A 1B6CB 3JW4A 3BWFA 3TXOA 4YMJA 4BI0A 5J8IA 3QQLA 3SXRA 1BI0A 4ZZOA 1PDNC 4LG0B 3W16A 4ZYDA 2VN2A 4FKSA 3BPVA 3QYZA 3BV2A 4R1HA 3F6XA 4HYUA 1FNNA 5HTBA 5J9YA 3U9NA 4IACA 4MD8E 5A4LA 3KVWA 3ZFYA 5A4TA 3R1NA 3P7NA 4I7HA 3NPCA 1YXUA 2REIA 2B1PA 4Z55A 1Q3WA 3L9NA 2WTJA 1A06A 4G17A 2Q8KA 1TLHB 4E4MA 4IFCA 1JKLA 3FXZA 4D58A 4BN1A 3U2RA 3O8TA 4U3ZA 3TN8A 4EL9A 5AR5A 3R8PA 4S32A 3DT1A 3DV3A 1TQIA 3R30A 3CE3A 5EYKA 2JIUA 2R3NA 2EB3A 2IW9A 4YZNA 1AWCA 4E6DA 1Q8WA 4O7ZA 3DBCA 2IZSA 4L6QA 5JEBA 4P5ZA 5A3XA 2XKCA 4YJVA 4E1ZA 3LFDA 3QD2B 1BN5A 3RAHA 2K86A 4YC3A 5IQDA 2O6GE 4BIEA 2UW4A 3EL7A 5AIRA 3IDBA 5DT3A 4B4LA 4D1XA 1MD0A 3LM0A 5GJFA 4NM3A 2PQ8A 3GW2A 5FLFA 2JDTA 3PIXA 3NS9A 2YA9A 1S8NA 1JKSA 3KLOA 3UIUA 3SOAA 3DV8A 3KF4A 3C1XA 4EI4A 3L9MA 5M08A 4GS6A 2B9FA 4UNOA 1H24A 4UUVA 5DEWA 4FOBA 3RTPA 2BAQA 1ZRZA 3IK3A 1T6SA 5FLXK 4AP7A 2J0IA 4KABA 5KVRA 4ACDA 5BPIA 1PY5A 3QTXA 3LXPA 3IW6A 4A0XA 5TE0A 5JN2A 3C1DA 3A61A 5ERIA 3QXOA 4U0WA 4D5KA 4IBMA 3ELJA 5EW9A 3ODYX 3ZN0A 3QPHA 2VE9A 4WT6A 4M84A 2QNJA 2HWVA 1GXQA 1U46A 2VV9A 4YZBA 3G90X 3V5JA 5DUIA 3IW7A 3UQGA 1SVEA 2C6TA 4IHTA 4ESBA 3LLAA 4FT8A 4ERWA 3ZRLA 5HZNA 1IR3A 3A7JA 2C0TA 3O8PA 3GU5A 1XMKA 2UZTA 4IRHA 3MFSA 2OQRA 3MVHA 4D2WA 4JRNA 3KFWX 3I54A 1IEPA 5CY3A 4IB5A 3BGZA 4IWOA 3DQWA 5D41A 3QHRA 4AW1A 1OUKA 2I7QA 3BROA 3NUPA 4GUBA 2GXGA 5ANDA 5LLQA 3PA4A 5CVGA 3LPBA 4RPVA 3WOWA 1PUEE 1E17A 5CLSA 2MH2A 5JGDA 2F5CA 5BYLA 1D8KA 2VNYA 2Z02A 1B59A 3WGGA 4A12A 3MH0A 1T2KA 5ACBC 4ZTHA 4PL5A 3DXQA 4MXOA 5L6OA 1SFEA 4EH4A 3E3PA 2YAKA 4WD5A 1G3SA 2VTPA 5EQEA 4DEIA 4KT5C 2PZ5A 1FYKA 3DXNA 1XD7A 4ZYHA 3KA0A 5D9HA 3CPBA 5LVLA 3I0QA 2GFCA 3CD8A 1BI2A 3FXXA 2YX4A 1IAJA 1YVJA 2FMLA 1P2AA 4WKQA 2EFNA 1QL6A 2C5OA 1H28A 3RAWA 2PVYA 3QF9A 1XH7A 2BAKA 2OGVA 1XKKA 4EH5A 3D5WA 4F0GA 5AM6A 3CD3A 5JT2A 2ZMEB 3HP5A 1I1GA 4MYGA 3IQ7A 1KWPA 3C4XA 3MVLA 1XQZA 4ITJA 2OH4A 2E9PA 2BAJA 3HRUA 5ILUA 3COIA 3ULZA 4HLXA 2J0LA 1APME 3CJNA 2A6HF 1KU2A 4FL3A 4RGSA 2PUUA 3F61A 3QLGA 5GIPE 2WMWA 4FIJA 5D8KB 2EU9A 3ENHA 2IO6A 5CYVA 4W4WA 5CEIA 2JGZA 1HW2A 4NFNA 1KU7A 3MGYA 1ZREA 3SHFA 4K2EA 4OW8A 5L3EA 4O7WA 1JHHA 4ZSEA 4TNBA 3MAJA 5DVRA 2F9GA 3R8VA 1D3YA 1MP8A 1ULYA 5D7AA 2ESMA 3CO7C 5HX6A 4IAKA 1JSVA 2D45A 4AIKA 5M07A 4D0WA 4M71A 4XV3A 4RB0A 3FI8A 2YLFA 2QR8A 3UIMA 2E1NA 3I6WA 2CHLA 4S34A 1A9UA 4D4VA 3TNIA 1TQPA 4XNEA 1R22A 4Z9LA 5HVKA 2OU2A 3FV8A 4HYEA 4ZIMA 3B8RA 5H9BA 3ANQA 2C68A 3BJ6A 4AA4A 2XZSA 1KU9A 4QP1A 3W55A 5LGNA 3FQEA 4KSQA 4WNPA 4EK4A 4QMUA 2ZYBA 2OXXA 3I4BA 4FV6A 4QPSA 4TYEA 4G7HF 4D55A 3VWAA 3NAYA 3IOPA 2B0LA 4FC0A 3GUBA 4HJOA 3MZHA 1T46A 2XA4A 4CCUA 4BICA 1Q3DA 4UVCA 3E93A 3FBVA 5A4CA 4M69A 4N6ZA 3VBTA 4KIKA 4KA4A 3QD3A 1TNSA 3DXJF 3ZMUA 2W4JA 4E4NA 3LXLA 1R5HA 2WMVA 5E8UA 5HLNA 2OA4A 1B39A 2BGCA 3O7LB 3PXYA 3UC3A 5EKNA 3ZUUA 1ZGJA 4A0ZA 1OL1A 1HSJA 4YIFA 2BHEA 2HTSA 1UKHA 2O8YA 4YLKA 1UHMA 2ZXJA 4R7BA 2R7BA 2BKZA 3R63A 4TKSA 1M7NA 4I5CA 3FDNA 2BROA 2EXCX 5BVOA 2VGOA 4JBOA 1KV2A 2LSOA 5D7VA 3H4JA 3TIZA 3RAIA 3LQQA 3TKUA 5IA4A 2ZV8A 3OBJA 1ZMUA 1JOWB 3O50A 1GXPA 2CNUA 4D9TA 1H9GA 2W7XA 2JPBA 4LJZF 4E8AA 1W7PD 4DAWA 3GXLA 2WMTA 2G1TA 2VTMA 2NNYA 3DQXA 3C5UA 4IVNA 4DGGA 3W2OA 3WZDA 4FSUA 5ETFA 4APCA 4O84A 5HO8A 2X6EA 2YCQA 2CQKA 2UVYA 1NVRA 2OJ9A 4D4RA 3R61A 1U3EM 2DUVA 3VO3A 2EB2A 3F3TA 5IA5A 4DLIA 5K4JA 3F3ZA 4ACCA 2Q0OA 1RI7A 3UQFA 3KRWA 4I24A 4QMLA 4BDAA 4NHJA 4FV1A 5HTCA 2A1AB 4RWKA 4G3GA 1YHWA 2VWWA 2OQGA 4I09A 4FMQA 4DCAA 4RWJA 3EQPA 3GFJA 3C4ZA 4FK3A 4F1MA 1ZYSA 4NWMA 3CO6C 3U6IA 1DUXC 3P9IA 2IW6A 2YDJA 4MEDA 2R3JA 4CV9A 1KOAA 3ZMMA 1J7IA 4A2UA 5TF9A 2JAVA 2PVJA 4QTAA 4DH7A 3R22A 4DGLC 4FOCA 5L6WL 5FDXA 2YDKA 5A2QZ 1J91A 2WU7A 4DH1A 4CTBA 2Z60A 4QQ5A 4FX0A 5JSMA 4M73A 3V6SA 4AZSA 1G8AA 4J1RA 1USTA 2QOCA 2OH0E 5IISA 4X3FA 4GRBA 5FDPA 4HQEA 2CG4A 4P9FA 4DEHA 3W2PA 5DCMA 2C6OA 4RFZA 2P4IA 5AV3A 3VBWA 3PUPA 4YJPA 4UV0A 2GQRA 4OBQA 1P4OA 4LGGA 3ORTA 2CSOA 2PSQA 1FYLA 1OPKA 2AC5A 2PUPA 2RKHA 1JBPE 1H0VA 4MXXA 5IT3A 1SM2A 4Y5HA 4HDUA 4TYHA 1PMEA 4XOZA 3K3JA 5HBHA 3FZOA 4KSPA 4PGGA 5A6OA 4B8XA 2P0CA 4YGAA 5GZAA 4NIFA 4R78A 5HCXA 3ZSIA 5AEPA 5IH4A 4O1OA 1Z91A 4C8BA 2OBPA 4YFNF 3JR1A 3HHHA 4ANQA 3QRFF 3NYOA 4J97A 2I1MA 2D1VA 2JKQA 5DBXA 1YI3A 3KE2A 4EORA 3EYIA 5FFXA 5BYZA 4BCMA 3KXGA 4UVAA 3MVMA 4EZ7A 4FUXA 5CAUA 1JE8A 5GIOE 4HCUA 4I20A 2EFPA 4XSXF 3QUEA 2JKOA 4O7SA 3HGKA 3VJOA 2W0JA 4BDCA 5L4QA 5HU9A 5LMKC 3PRFA 3KC3A 4FIHA 4D4SA 5AP3A 2XYNA 3ORMA 4M6YA 5HVJA 4BDDA 4BCHA 3Q6WA 2FEZA 3HRTA 3WTTC 1YDSE 4FKVA 4ANLA 1WBTA 3CY3A 4CGZA 5KMLA 2JT1A 1UWHA 3ZP5A 3I81A 3BCEA 1JPAA 3TDZC 4QYFA 4FF8A 4EM0B 3RJPA 4RG0A 1SD4A 4TYJA 3ZZWA 3RM6A 4LG4A 3IW5A 2VUWA 3KEXA 4XH6A 4MD9E 5IEXA 3ORPA 1WBWA 5KMJA 2IRFG 3WTSC 5L2QA 3LJ0A 2XAHA 3P4KA 2VONA 4IEBA 4HX7A 4Y95A 4YNOA 5DCFA 4I0AA 3E8EA 3UP7A 2EFOA 1LVAA 3MWUA 5AP5A 2G01A 1YDRE 3Q53A 3R8UA 4IXPA 3VAPA 3W10A 5FEEA 4EQCA 4IZ5A 1OKWA 3U54A 3GC9A 3QTZA 3WIKA 4OU0A 3KGAA 5HE1A 1ZMVA 5DLSA 1ZG3A 1ATPE 3FL5A 3UVRA 3CJGA 1TNTA 1SD6A 5BUJA 2Z5UA 3TJDA 4HX4A 5CAOA 3QKMA 3QQUA 2PPQA 2FE3A 1R7JA 2GCDA 3I79A 2YACA 4CFWA 3OWKA 4BVUA 3T9IA 4JX3A 5H3QA 2FGIA 4KINA 4UYNA 1LDJA 3OXZA 4U7BA 5LVPA 2CCIA 5FBOA 3ZC5A 3IKVA 1GAGA 1JGSA 4IDVA 3LZBA 4H1MA 2XJ0A 4YG2F 1SD5A 1W83A 3LMHA 4KN7X 3R7YA 5B7VA 4NJ3A 1U5TC 3CQUA 4IE9A 4V05A 3OZ6A 1KQ8A 4R3CA 1XSDA 2HELA 2OF2A 2VE8A 2XK7A 2WFYA 4I21A 2A27A 3EZRA 3UNKA 3PSCA 2I0HA 4XCUA 2WMUA 3FPQA 1FGIA 3RGFA 3K5VA 4A5MA 4YJOA 1R39A 3QGWA 4FNWA 3R9RA 2XK6A 1V1KA 5J5TA 1XSVA 2YU3A 1MDMA 5BVEA 3V01A 1YHVA 3ULIA 1WBOA 1GZKA 4CKJA 5E17F 1CSNA 4DFUA 2B0QA 3E62A 4ZJVA 1BC7C 4WF2A 2XK3A 3RK5A 3I6UA 2F49A 4FKRA 2OICA 4O6LA 5CVFA 1IAWA 2B7AA 1S9JA 2ZO4A 1FMOE 4KBCA 3VQUA 1SMTA 4F7NA 3HUGA 2FBKA 1ZOGA 3CEKA 4EH8A 2RKUA 2WHBA 1OL7A 3QQGA 2WMBA 5FD2A 4TTHB 2ZOQA 5FEDA 5I0BA 2ESNA 1J5YA 3O71A 2VOPA 5KMOA 1WAKA 2GTMA 3HECA 3A4PA 3E64A 3PXFA 2M87A 4CG9A 3N4TA 3PLAE 2HXQA 3AC8A 4HZSA 2FBHA 5B2MA 3P9KA 1Y91A 4CYDA 1U54A 4DN5A 1FPQA 3SLSA 2CCHA 3MCZA 4JS8A 4BHBA 2X2MA 1AD5A 5L3AA 2EV0A 3DZOA 5HDGA 1H25A 3U6HA 3HMNA 3O23A 3NEWA 1I5ZA 4I98B 5ICPA 2B54A 3VUMA 3PP0A 2VN9A 2X4FA 1WI9A 3W2CA 4FGRA 4PPBA 4OTIA 2XBAA 4RX5A 3LFEA 4Y8DA 3SA0A 3P9CA 4RS8A 2HGCA 4TV7A 5I3RA 3PY3A 2NYXA 2QM3A 3KLNA 3WZJA 4IWPA 3DTWA 3HOTA 1UU7A 4U7ZA 3U4WA 3CLYA 3EN6A 2HYYA 3WZKA 5CNOA 4DFBA 3Q5IA 2GHLA 4U81A 4UWBA 4A06A 4NJDA 5HLPA 4BRXA 4P5OA 4FK6A 1M17A 5AX3A 5H2UA 4O3MA 4BDHA 1LDDA 3FMQA 4AIJA 4XRJA 1O3SA 3FMRA 2YCRA 5M09A 1O3QA 3ZMSA 4O96A 3MA3A 4FZAB 5LGUA 1HQCA 4L68A 5AFVA 1IA8A 4O5VA 5ANIA 1LEAA 2HYFA 2IA1A 3N51A 1JQHA 5ACKA 2DYLA 2C6MA 3TDVA 5CEQA 1R36A 3V8WA 3ISPA 3PIZA 3TZMA 4EWQA 2OU7A 2UW5A 4HNIA 4MD7E 3SD0A 2FSTX 3KP4A 1KYZA 4L7FA 4N0SA 4OBPA 4U8ZA 2J0MB 3K1MA 5KHXA 1HW5A 1HSTA 2ITYA 1IXCA 1QNTA 4FX4A 2L01A 5JI6A 3A4OX 4ASEA 3C4EA 2PUIA 2F7XE 1K78B 4RIXB 3D7ZA 3LHJA 3NUYA 2YIRA 4FV5A 4LYNA 2OXDA 3F8NA 4DH5A 5CF4A 2JC6A 5IMXA 1IN5A 5AAFA 3OMVA 3GXOA 3A2CA 4RX9A 1R1TA 2DTRA 3QOPA 2VWVA 1D8JA 3SRVB 3R7IA 4EQMA 4YLLA 5DD8A 5TJJA 5D10A 3RWQA 3KRLA 3UIXA 2BILB 5GJDA 5KMKA 1ZGAA 4AG8A 4RGXA 2F7ZE 3PJ2A 3KRRA 2ZCWA 2WTWA 3BPXA 3RCJA 4V0GB 3V51A 2DK8A 4BZNA 5I9VA 2PJPA 4UYAA 4O91A 4CZYB 2HXLA 4BCQA 4ZP5A 5DR2A 3G2FA 3KB7A 3ULQB 3OROA 5C9CA 3ZLSA 2J0KA 3NUUA 5CZHA 4R7HA 4YZ9A 4OTWA 1T39A 2EA2A 4RT7A 5DPVA 3BIZA 3PVBA 4FODA 4RFYA 4EJNA 5EYCA 3KXMA 3PVGA 2V6CA 5CLPA 5CT7A 4JAIA 1IF1A 3PIYA 4GO1A 2Z33A 4X2KA 3TEIA 3SVVA 4DBXA 4G9CA 4FTUA 3V8JA 1UU9A 5AA8A 3QC9A 3NGAA 4U88A 2A4LA 3VS7A 3UE4A 1YDTE 5CEKA 3R7UA 4WNKA 1J1CA 2XRUA 3PVWA 3R6XA 1QGPA 2DO7A 1ZRFA 4H3PA 4EHGA 3QQFA 2QQAA 2PY3A 1PKGA 4L53A 2XVDA 2B9JA 3FYKX 4KBKA 4D4YA 1OECA 1KE9A 5E9EA 2RG5A 4ENYA 3EH9A 1OPLA 2VODA 4BWXA 5IT9Z 3VF9A 4EYJA 4TZRA 4HVIA 3I59B 3WF9A 2VWYA 2XHKA 2ETRA 1WZYA 2GPHA 4PQNA 1VYWA 3NZ0A 3DQVC 2O3FA 3UC4A 4JBAA 1LUFA 2A3SA 3QC4A 3PSBA 3E8NA 3FEGA 5LEKA 4XLVA 3H3CA 3AC1A 2DPUA 5BQTA 3K2ZA 1I09A 4FT5A 1YTYA 3C4WA 2Y75A 3U8WA 1OMIA 2HWPA 3EQFA 2IVVA 2NAZA 4IZAA 4NCTA 4U42A 2ISZA 4IANA 3R6SA 4RIYB 5CAPA 4Q5SF 4OAUC 2DQRA 1CKIA 4RC3A 5KCVA 2XCHA 3L8VA 3HSFA 4BGGA 2IW5A 3F8FA 1ZOEA 2X81A 3SXFA 4CTCA 5DYMA 3KP2A 1HW1A 4DTBA 4C61A 4M68A 3ETAA 1PXMA 4C02A 3UP2A 1J1BA 3ZO2A 4M67A 5FO5A 2UVXA 4F7SA 3C18A 5DFPA 1RNLA 2F5FA 3VS3A 4BFMA 5FRIA 1ZAOA 3S2PA 5AP1A 5CAVA 3GBZA 4TW9A 3IHUA 2ZMDA 4XUFA 1IASA 2Y0MA 3OUNB 3FMLA 2ITPA 2P7VB 3IKTA 2Z7LA 2W06A 4M97A 3KULB 2R0IA 5CEPA 1FY7A 1UCRA 1R58A 4FT3A 4EYMA 4LGWA 4JAJA 4RGUA 4PDOA 5BMZA 1BLXA 1CTPE 1NHAA 4FTAA 5HG7A 4JIKA 4AZWA 1Z9CA 4B09A 2O0UA 2TDXA 4J7BA 3EQIA 3IL2A 3JS2A 3DFGA 2ITZA 5FB2A 2WMQA 3BYMA 5L6PA 4AZEA 5E8YA 1HCKA 2BALA 2M30A 1U2WA 3EYHA 1FVRA 2YZLA 1MZBA 4I0SA 4FSZA 3E92A 3VC4A 2XM8A 3R0TA 3EIDA 2XRNA 3FMHA 1WWXA 5ANKA 4HYSA 3DBDA 1YFHA 4YZMA 3NAXA 2V22A 3EUHA 2H34A 3REOA 4DQ2A 4ESJA 2YIWA 3SHEA 3P5KA 2F5EA 2YIXA 4QYGA 3LAJA 1Y6AA 4RMZA 3OWLA 2WTVA 1R1VA 5KMMA 1OMWA 3COHA 2O63A 1JSUA 4RRVA 5FD6A 4F1OA 4IDTA 5HNGA 3I4PA 2UW8A 2HYGD 3R04A 5GZ9A 1OIRA 4OOIA 4GVJA 4RJ4A 4RB3C 2VTJA 3ZLYA 4F7JA 3KCKA 5BQ0A 4JX7A 3JPVA 2RNJA 2A6EF 1XH8A 3LE6A 5GHVA 2R3LA 3E8DA 3BHUA 3PJ3A 4AOTA 4BI1A 5BX0A 4FUYA 4K77A 5BPYA 1XCVA 4CMTA 3F2AA 3MTFA 2YN8A 3RKYA 5HG8A 4C4FA 3NUXA 4CYIA 3F6OA 5FGMA 4I92A 2WWYA 5AONA 3MN3A 3KP5A 2F2EA 2DI3A 3DLSA 4YBJA 1W5SA 1QQIA 2EXMA 4GSBA 1MQ4A 1BMKA 1YW2A 4BDEA 1W98A 3GFWA 4PMTA 3ZDUA 4FIFA 4HBLA 3W6KB 3D2IA 4FZFB 3LOKA 1WBSA 2BIYA 2R3RA 4HVHA 4D0XA 5D5WB 1PKDA 1LR4A 1KA8A 4K33A 2E9UA 2CKEA 2K4BA 3JAMZ 3QU0A 1MJBA 1LPUA 3CUOA 2WB8A 3FSFA 4MX9A 4FV8A 2YM4A 4UWYA 3POZA 4XP2A 3HVCA 1ZRDA 3SW7A 3MS9A 1KSWA 1OI9A 4B99A 1W7HA 4MK0A 3PDTA 2HDCA 1ZN2A 2BEOA 5IUGA 4W8DA 1WMKA 1SFXA 3CC6A 4EOSA 4F0FA 4FTKA 5FXSA 5IQFA 2EWNA 4FSTA 4LK1F 5HLWA 3EQCA 2EVAA 3WIGA 3TV4A 4M0ZA 2PN6A 3TOBA 3HV4A 4EONA 2UZEA 3VUTA 5JHUA 3Q52A 3U51A 5KBRA 5JKGA 3OTVA 5HVQC 2V79A 5DRBA 2PMNX 5CT0A 4A4LA 4KKHA 4M13A 5DWRA 5ANOA 3I7BA 1OIUA 2PK9A 5IA1A 3V5WA 3TNPC 4UBAA 4GIIA 5FP6A 3EQGA 1SVGA 3S1HA 2O64A 3A8WA 1OGUA 4DT9A 2FB8A 4FNXA 2W1DA 3LAPA 3QHWA 4QMMA 5A14A 4C4GA 1P5EA 1XBAA 1U6GA 3AC5A 5HCYA 2V1UA 4X3FC 4FZ6A 3CR0A 4YJUA 3U87A 5F1ZA 3JVSA 4CZZA 4MXAA 5K0XA 2UW3A 2QOFA 4BCOA 3PE2A 1DAWA 2RGPA 3VHEA 4FTMA 3EHAA 4MBJA 4XBFA 3WYYA 2ZBKA 2OI4X 4TN6A 4UN0C 4NH1A 4EHVA 4HZFA 3R00A 3G6HA 4FV0A 2QI8A 4Y5QA 4ZXTA 4C36A 4FX3A 3TZ9A 5D4SA 4EHEA 4EJ7A 1T45A 3E8CA 3T9TA 5AX9A 5IUIA 3QZFA 4ZZMA 3QL8A 2ZM3A 1USSA 2WQNA 2XIYA 2BV6A 2R3HA 5D5VB 5IDNA 3E3BX 4YZCA 4JI9A 4FG8A 1XMAA 5ICCA 2OAZA 1O6LA 4E4LA 3ERKA 2FSOX 2W1GA 3QAME 2QU6A 3R9OA 1PXPA 4U5JA 4PWNA 1YHSA 3DAEA 3PZEA 4DTKA 2NNNA 3F69A 1RUOA 2R0UA 4MWIA 4DG3E 1WBNA 5D6EA 4I41A 1L3LA 1FC3A 4PMSA 3NWWA 2E1CA 5CF5A 3QPTA 4FTQA 3R28A 4HCVA 3R7GA 4I94A 1H0MA 2ZB0A 4PGHA 5EW3A 2OXYA 4IADA 3BI6A 3KU2A 2Z9OA 3GT8A 1T98A 2IVTA 3FLYA 2FBIA 3K1PA 3DPTA 2XVCA 3ZO4A 4ZJIA 4U0YA 1ZYJA 2EV6A 4H58A 2O3PA 3VODA 4O2PA 5KKRC 3F7ZA 4HCTA 2IG7A 3EKNA 4D9UA 4KFCA 2WV0A 4NUSA 3ORIA 2WELA 1YOJA 3CJFA 3ANRA 4PTCA 4UX9A 4DFYA 3QA0A 3B2WA 2B52A 3FZPA 3NEUA 2JKKA 4R7IA 4MNFA 4LRKA 5ANGA 1SMHA 3FXQA 5L2SA 3QA8A 3AD6A 3DPKA 4IC8A 2ERZE 4QTCA 4MBLA 3WARA 4PDPA 4LFIA 2NP8A 4K9YA 4G31A 1F5TA 1FP1D 4D2SA 3VB2A 3GWZA 3J80Z 5K3YA 2MLKA 4HF1A 1ZOHA 3FZSA 3TT0A 3CTAA 2ZAZA 3QP5A 4GU9A
chains in the Genus database with same CATH superfamily
1G3WA 2CSNA 2GNLA 2X1DA 4FEXA 4H39A 4HW7A 1DS5A 3FQSA 3WE4A 4X7QA 5E8VA 4QT1A 5IA3A 1U9OA 4QNYA 2LKSA 3TIYA 2KPMA 1UNHA 2C47A 1V54H 3O2PE 2EILH 3GQLA 4G2FA 4FYNA 3L1SA 4FSMA 2VJJA 3ROUA 5D5XB 3BG6A 2CGVA 4F6WA 4IZ7A 3QWJA 3RDIA 4I01A 4ZJJA 2IN6A 2XC7A 2WB1A 3LA2A 4BKXA 3RQ4A 3R8ZA 4IQ6A 4F3QA 4G8XA 4E4HA 2XIKA 2X85A 1YXTA 3W6JB 3DZQA 1AGWA 2VTAA 2ZV2A 5L2WA 5HE0A 4IEJA 4QD6A 2JLDA 4XOYA 4JMQA 4FIEA 4HRIA 2WTKC 3OY1A 5IUHA 2O8XA 4LV8A 2BHYA 2QKWB 4O7LA 3FC1X 4DBNA 2WNTA 3U6JA 4BCKA 3T8RA 5HLIA 2KJCA 4XX9A 4GFMA 4LD5A 1PP7U 1E0EA 4FISA 2CUFA 5JH6A 3LCOA 3BG3A 5DD4A 1XDUA 3DTIA 4BHNA 1HKTA 5BUIA 5EEHA 1VQ4I 3IDCA 3I5NA 2R2PA 4O2ZA 3HIFA 4BACA 2JZYA 4EOIA 3BEAA 3F7WA 3AOXA 2HZTA 4RIWA 4NSTA 1OVEA 2FOWA 3BKBA 2XK8A 3VS5A 3DBFA 1WFXA 2XUUA 1FBQA 2O65A 1Y8QB 3BYUA 2BHZA 4M8TA 4JBPA 5AP7A 2XGCA 2OSCA 1LB2A 4CFVA 4FL1A 5ITAA 5DT0A 3D15A 4FL2A 4OTPA 1KONA 2OJJA 4DZPA 2BUJA 4L45A 3RK9A 2UW6A 4JT3A 5IT9K 3BYSA 3GEQA 2MH9A 3PY0A 4B0GA 3ALNA 1L8TA 2BZJA 3MH3A 4FKOA 4LIUA 3LFCA 1H08A 2J5FA 3BR5A 2VBXA 3M2WA 1R1WA 1T95A 5JFSA 2J50A 4BB4A 2WQMA 3RWPA 2OIQA 3CZ6A 3W8LA 3PWYA 1J9IA 4HDVA 4XLPF 1GLNA 3LSKA 4CSVA 5E1ZB 2VWZA 4RDUA 4EZ3A 1RR7A 1VYZA 2DA4A 3EFKA 3TUDA 4YJQA 3J7AO 4DT8A 2ZXHA 4J71A 4FTNA 1NY3A 2W5HA 3BC8A 4KIBA 3QGYA 2OK1A 4M9ZA 4XMOA 5HBEA 1Q8UA 3GTQJ 3G0FA 5E91A 5CWZA 4MH7A 4XBRA 3PFQA 3D9VA 2QQ7A 2XARA 4WBOA 2PHKA 2EQRA 1Y8YA 3WTWC 3FLWA 5I9YA 2MABA 2IZTA 4DG2E 3JSOA 2OKRA 2RQPA 2VQGA 1LVKA 4BCGA 1PRYA 3ONQA 4D1QA 4XLFA 3IO7A 2H1KA 3R1SA 2UW0A 3D94A 3G3ZA 4UUTA 4QMOA 5FG8A 2GNJA 3DB6A 5IP9J 1LUJB 4B47A 3SGCA 3TUCA 2ZC2A 3MMYB 4FRFA 2XPVA 2JN6A 2XEZA 4P2KA 1UFMA 1BBYA 2YX7A 2V1NA 2GA1A 3PXQA 2QO2A 4IZYA 2VXDA 5F1JA 3DAJA 2GA2A 4Q9SA 5AADA 5IQGA 2GLOA 3LFKA 4IX5A 4BXFA 5C3EJ 4QMYA 2K27A 1ZMWA 5M3MJ 4TWPA 5BVDA 5EM7A 1QPJA 4UHTA 5IQAA 5JMSA 3I5UA 4AXFA 4B48A 3I5ZA 1R3CA 4BTKA 2W96B 1X2NA 3JRDA 1H1SA 4CLJA 4OGRA 3WE3A 1SMYF 2QOHA 3PQJA 4FHTA 3SXYA 2HR3A 5LRRA 4UV9A 3FE3A 2BY1A 1B1BA 2VWBA 1ETVA 3BZKA 4KRCA 2JDVA 2WMRA 1Z6RA 4BU2A 3FHZA 1CDKA 3CESA 1QZYA 4KWPA 3GFIA 4L00A 3RZFA 4ANNA 3DLLF 4AXEA 5BOXA 1OIYA 3VS1A 4GJ3A 1D0ZA 1YYVA 4ZDPA 1KV1A 2V7AA 1TWHJ 4BS9A 1I44A 5EDQA 4JVGA 5CYIA 1ZWSA 5F94A 1ZY4A 4CZTA 5JR3A 3JYAA 3S8PA 3BLRA 3V5PA 4XS2A 2VWXA 4AIHA 1BX6A 1WBPA 2QHNA 3QQAA 5JRSA 3VW8A 3C4FA 2LMDA 1STCE 2A69F 2GXBA 1TKIA 3WTUC 4L52A 1W7PA 2GIVA 3PJ8A 1X1BA 1LEBA 1JVPP 4IHYA 4H0EA 4CFUA 1Q8TA 2UZDA 1ZKGA 1U8BA 3DLZA 2E2BA 4AAYA 1UHSA 5D4RA 2OFUA 2DT5A 1K9AA 2I0VA 3HOUJ 1G3NA 5BPDA 2PX9A 4YJTA 1ZK8A 4WRSA 3DK7A 4C59A 2QBYA 1MIJA 2DFIA 2YITA 3D14A 4FNYA 5EDRA 1XR1A 4FKIA 2ECCA 5DOSA 1MRVA 4MXZA 3CJRB 2GNFA 1PXKA 5C8NA 4BYJA 3AL0C 2V9VA 3RHKA 4QDVA 2ZMCA 1XN7A 1JT6A 2PZIA 3JY9A 4ZTQA 2XNPA 3HNGA 2QODA 4AIDA 2E1MB 3P7CA 3SC1A 1UU8A 3GX4X 2W4SA 3QU3A 4QQJA 1GHCA 4PTGA 5M51A 3VW6A 3GTJJ 4DC2A 4HV6A 3BLHA 2HKOA 3O3KA 4OWRB 1OYWA 4L42A 3AAFA 3BQYA 3F66A 4FV2A 4JG7A 1NXKA 1R0PA 3GC7A 3HM5A 3ERED 3B6CA 4C2UA 3JAMK 2V7OA 4ON0A 1JTXA 3ALOA 3W2AA 4TT7A 3NWTA 4OINF 1KE6A 4MAOA 5AR7A 3V8TA 3I7CA 3WZUA 2WD1A 2NPQA 4D2TA 5CQEA 3M1EA 3QWLA 4CH7A 1A04A 3F5XA 1Z1DA 4Y85A 4YTHA 3MYGA 3CGFA 4YBKA 1UV5A 3DAKA 1EKEA 5E8GA 4CYJA 2HIWA 3ZU7A 3MZYA 4DFLA 2D1HA 4B8MA 2R5ZB 5M44A 1FOKA 1XH5A 5J1RA 2M34A 3FK7A 3GTGJ 4JOAA 4CUGA 4AZFA 4Q2AA 3VYRB 3PL8A 1TL8A 4JJRA 1YG2A 2J51A 2IPQX 1SYKA 4X0MA 3TZ7A 4JNWA 2BPMA 3R83A 1ZYRF 2H94A 5CEOA 1LDKB 1TW2A 2BRBA 4RQVA 4E6CA 2ZB1A 3ZR8X 2PE0A 2GAUA 2F7EE 2YM7A 3NMUF 4CT2A 1V5FA 1ZG1A 1PYXA 4WHZA 1MRYA 5GADJ 3Q4CA 2DYSH 4XEYA 5B1AH 5KAIC 4XL9A 4Q5EA 2COBA 4WXHA 5LRSA 3MFRA 4U87A 4UV8A 2ITWA 1SFKA 5IPAA 5I5ZA 4ZLZA 4NCTC 5E1WA 2R7VA 1QPDA 2ESHA 1OCCH 2Y69H 2ITUA 2QENA 3UGCA 2GU8A 5TRDA 1PF8A 4RM2A 4DF3A 3HMMA 2Y6MA 3VDXA 2ZFYA 4EOPA 4G6DA 3I64A 2VWIA 4AGCA 4C35A 4DHFA 5KUPA 1UVRA 1YRPA 3GVAA 2TRTA 3E0JB 2Z99A 1F43A 4ANMA 3KZIC 1UA2A 4BIBA 2P4WA 3BJAA 2LLKA 4PP7A 2R3QA 2RNGA 2ETKA 2P55A 5HHWA 4G7ZF 3TDWA 3OYLA 4MNEA 3M07A 2QD9A 4QYHA 4ENXA 3GP0A 3R9DA 2VJ5A 4PJNA 5M06A 3JSPA 3Q96A 1IA9A 5CSXA 3HRFA 2KIUA 5KMNA 5IYCJ 2Y2ZA 3T0YA 3QZIA 4DGNA 5M3FJ 2OWBA 1WJBA 5CX9A 4RMNA 4XG9A 3ODZX 2ZJWA 3QYWA 2A98A 4FTIA 3GFEA 4ZMFA 1UNGA 1Z67A 3UBDA 4L9TA 5EM8A 2G15A 2JRTA 4EOQA 3MFUA 3FMSA 1XGOA 3A7GA 4D5HA 2HY81 1W2FA 2STTA 2GXAA 2XYUA 3UMXA 4KMFA 5IQEA 3ZXSA 3IPHA 2C5XA 4YTFA 2CGXA 4F1TA 2XALA 5M5YJ 3OC1A 3KCCA 4IW0A 3WTXC 1YQAA 2WIPA 2VAGA 2EUFB 2WIHA 4CRSA 1X3ZB 3K4MA 1Z57A 2QC6A 3VBQA 2P5VA 5KCMA 1SNUA 2HOSA 4L67A 3KMWA 1MMSA 5AUZA 4AW0A 3TUBA 3QX4A 3P5JA 3QKLA 9ANTA 4ZS4A 4IXAA 1BL7A 2QSFX 4N9IA 1GIHA 3FLNC 3UOKA 4QQTA 2OF7A 1BR4A 2ZKZA 4PDKA 2FSLX 4GCJA 3ZLXA 3FY2A 3CJQB 2W17A 4CCNA 1YJWI 2DOAA 1P7IA 3EUHC 2V7FA 4BKYA 1IGNA 2C4GA 4IB1A 5CVJA 5H8GA 4C57A 2GS6A 1ZARA 2CLXA 2IW8A 2JDRA 3F2NA 1QPCA