5GZ8A

Crystal structure of catalytic domain of protein o-mannosyl kinase in ligand-free form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
284
structure length
272
Chain Sequence
b'CPPGYFRMGRMRQCSRWLSCEELRTEVRQLKRVGKRVFLSEWKEHKVALSRLTRLEMKEDFLHGLQMLKSLQSEHVVTLVGYCEEDGTILTEYHPLGSLSNLEETLQQDVNTWQHRLQLAMEYVSIINYLHHSPLGTRVMCDSNDLPKTLSQYLLTSNFSIVANDLDALPLVDVLIKCGHRELHGDFVAPEQLWPYGEDTPFQDDLMPSYNEKVDIWKIPDVSSFLLGHVEGSDMVRFHLFDIHKACKSQIPAERPTAQNVLDAYQRVFHSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein O-mannose kinase
publication title 3D structural analysis of protein O-mannosyl kinase, POMK, a causative gene product of dystroglycanopathy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 78
structure length 272
sequence length 284
ec nomenclature ec 2.7.1.183: Glycoprotein-mannosyl O(6)-kinase.
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gz8A00
4UYAA 4GK4A 1PW2A 4BF2A 4DEIA 2WIHA 4CQEA 3W1FA 2C69A 3UVRA 4Y95A 3R7OA 3MVMA 4IEBA 5HGIA 4FV5A 4GT4A 4LGGA 1X8BA 5CU0A 3ROYA 1M2RA 5C27A 4AN3A 3FLYA 3IDCA 4L46A 3OVVA 4AW2A 3W2PA 4BN1A 4YP8A 5EI2A 2QOHA 2ZMDA 3BYUA 2JFMA 1UU9A 3A7HA 4FI1A 4DEAA 1SNXA 3E8DA 3QAME 2QLUA 3NLBA 5KKRB 3FZTA 5J1WA 3MVJA 4NW5A 5CLPA 4D1SA 3EQIA 3MJ1A 1NVQA 2GHMA 3HVCA 3KULA 3MVHA 2CDZA 5CT7A 4AE9A 5EYCA 4IMYA 4RRVA 5IA4A 3GCSA 4V01A 5L8KA 3WF7A 5AUXA 4ZK5A 5KNJA 5LARA 3QXOA 4P7EA 1BUHA 4CMOA 2JDOA 1YHVA 4BGHA 4EOJA 3BYVA 4J1RA 2JIUA 5DMZA 3OOMA 3ALNA 3QL8A 4AZVA 2W9ZB 3BU6A 2W1GA 4IB5A 4WG4A 4FKUA 4A9YA 1F5QA 5IF1A 4KRDA 4GJ2A 4DH7A 1P5EA 4PTGA 4PX6A 3S1HA 2OJIA 1QPEA 4LFIA 3PPKA 4P2KA 4WRSA 5K0XA 4WOVA 3Q2MA 1WBTA 3PSDA 3L1SA 2WGJA 1GNGA 4MXOA 4USDA 5CSHA 5AAFA 3RK5A 5AR8A 4EBWA 4EH3A 1TKIA 3R8LA 1XO2B 4FV3A 2PY3A 2XIKA 3QYZA 4YPSA 3PA3A 4FEQA 2WZJA 3PWDA 5EK7A 2XP2A 1MQ4A 3G51A 3EN4A 3HV5A 4JJRA 4DEHA 2VU3A 4YZCA 1E9HA 5ANEA 3HDMA 3COIA 4I6QA 2ERZE 1YDTE 4RJ8A 4FIHA 4U5JA 4HCVA 3AC8A 3OEZA 3WZJA 4JAJA 1LPUA 5FQDC 5JZNA 4UMRA 3TEIA 2WTDA 4FZ7A 4KSPA 4M12A 5BX0A 4FZ6A 3KCKA 4OTWA 4DFZE 4HVIA 1UWJA 2JDTA 2C3JA 3OWLA 2GNLA 2UW9A 3Q4UA 5FG8A 4D2PA 2B1PA 4QMQA 1JKLA 4IJPA 2R3IA 4YJTA 1W82A 5DH3A 3MA6A 4ZTMA 5DT3A 4YO4A 1ZWSA 3WYXA 4NEUA 4YJPA 3NUNA 5FBOA 3HMMA 4E6DA 2IZRA 1PXIA 3AD4A 5C1QB 3DOGA 3FI3A 2B54A 3ZEPA 4JQEA 1GZKA 2J7TA 4A9RA 2G1TA 3QD3A 4GFOA 4OBPA 3IGOA 3LFBA 3BLQA 4Y83A 3FE3A 3RAIA 3V8SA 3VS1A 1G5SA 3H30A 4B7TA 3FV8A 1KE6A 4FIJA 4YTHA 4CXAA 3WF6A 2B9FA 2R0UA 5FXQA 5EDQA 4OTGA 4BI1A 5JK3A 2B9IA 5HVKA 5HG7A 4CFVA 4CFFA 1U5QA 1H1PA 3COKA 4R7IA 3DA6A 4FODA 4YUQA 1OB3A 2NRYA 2B9JA 2UW3A 3MBLA 3K5VA 2V7OA 2IZTA 1H26A 3E92A 3MY0A 3UNKA 1U59A 2EXMA 4JS8A 4CV8A 3S3IA 1L3RE 4B8MA 3HGKA 5CEMA 4HVGA 5J9LA 1V0OA 3R73A 2R3PA 3EN5A 4AZSA 4HZRA 4EZ5A 3QQLA 3TZMA 3PTGA 4YZBA 2R3GA 4ZY6A 3A7JA 4BDCA 3FZPA 4MTAA 3BKBA 1Q3DA 3PVUA 3D0EA 1UA2A 4CLJA 5HIDA 2O8YA 2WMVA 1PMNA 4LMUA 2J5FA 1WVXA 2OIQA 3CJGA 4U80A 2PUUA 5JGAA 2W1HA 2OJGA 4AZTA 5KZIA 2V62A 3IPHA 5KMLA 4M14A 4YJVA 4ANLA 4ENXA 2XM8A 3SQQA 5DR9A 4EHZA 1H1WA 3HEGA 5CYIA 3NX8A 4C4GA 4FKRA 5I9YA 2UZTA 5L2QA 1URCA 4C2VA 2BDFA 5CAPA 3DV3A 2XVDA 5CY3A 3KN6A 4ZY4A 2C6EA 1RDQE 1ZAOA 4J8NA 5HI2A 4BDBA 4O96A 5HNIX 4UB7A 5KMJA 4QTCA 4YC3A 2ZDTA 4MF0A 5D10A 4C36A 5FXRA 1FQ1B 3K3JA 4RX5A 3UGCA 3ALOA 3AMBA 4L7SA 3OXZA 4QPSA 1I44A 3VW8A 2C68A 2X8DA 3F5XA 3ZBFA 2YITA 2C0OA 2R3MA 2REIA 2E9UA 5TT7A 3Q96A 3LCTA 4FNZA 2QURA 1H01A 4F1OA 3HNGA 4UY9A 4KAOA 4FIEA 5CQUA 4AOTA 2ZM3A 1YXSA 2C3LA 1H1SA 4IQ6A 5HCZA 2UZOA 2B9HA 5EHLA 3HRCA 3V04A 3TUBA 4FR4A 1ERKA 2WTIA 4NJ3A 3ZDIA 5K5NA 4DGOA 2QI8A 3NWWA 5M53A 4NK9A 3TG1A 5L6OA 3CEKA 4FA2A 3IS5A 5ETCA 3TACA 3WZKA 4EBVA 2CLQA 3QTRA 4LRKA 4Y5QA 2WQBA 1YWVA 2YFXA 2H8HA 4CZUA 5BMMA 1Y6BA 1APME 1O6YA 1A9UA 3V51A 4BCJA 4F4PA 5E91A 1Y57A 5EYKA 3BHYA 4USEA 4PDPA 3BCEA 4L9IA 3MS9A 3DQXA 4DH3A 1RE8A 3O0GA 3G5DA 2CCIA 4AW0A 4EUUA 4E3CA 2O64A 3BV2A 5DVRA 5HO8A 5IUIA 2NRUA 4USFA 3KXZA 2YDKA 2BRNA 4D4YA 5EDRA 3DJ7A 3WE8A 5EDPA 4BL1A 4CEGA 4OBQA 1V1KA 4UMPA 5ANOA 3EFJA 3KF7A 4BDDA 5KHWA 4E4XA 4W9XA 4J71A 2WNTA 5K9IA 2OGVA 5HTBA 4HGEA 3E93A 3UBDA 4EOQA 2WELA 2JLDA 3QCYA 4OAUC 2W1EA 3R8MA 4UWYA 3ULIA 3F3VA 4FVPA 3TWJA 3FQHA 3VUGA 4TL0A 2FSOX 5LVLA 3CIKA 1BI7A 3R30A 3QGYA 3QTQA 4RQKA 3RK7A 3RPYA 3MPTA 2IW8A 3M1SA 2WQEA 3ZH8A 4NH1A 3R02A 5FD2A 4OLIA 4D1ZA 4UMTA 3VWAA 3UIMA 5L2TA 3E8NA 4EYJA 5IUHA 2W4JA 5CU4A 2UZLA 5AP6A 5HLNA 5AUVA 1YDSE 2P2HA 5CVFA 3RHXA 5A14A 1O9UA 4U97A 5HICA 2YACA 3ET7A 3GCVA 4KINA 2Y4IC 4L01A 4YLLA 3D5WA 4JOAA 3G90X 5CTPA 5ETFA 3ZFXA 4HYIA 4GSBA 5JEBA 3GI3A 1JOWB 2VZ6A 5H8GA 4NT4A 5HBEA 4O21A 4HVSA 4G17A 3LFQA 3AC4A 3IECA 4EUTA 4PMSA 4K9YA 1EH4A 2W1ZA 4PMMA 4CVAA 2CKEA 4KRCA 4N6YA 5HVJA 5A6OA 5E8YA 4RIWB 2VTNA 3D15A 4O38A 2J9MA 1R78A 2VX1A 3EB0A 3SKCA 5GJFA 2ZV7A 3GEQA 3LFSA 5B2MA 2Q0BA 2G01A 3ROCA 4FTRA 1CKPA 4YJSA 2PVKA 3DTWA 2YIYA 1M7NA 3BBWA 2QR8A 3CY2A 4HPUE 2C6KA 4XG9A 2O3PA 2O65A 3UVPA 3VUHA 1H0WA 3PXRA 4U0IA 3HP5A 5JGBA 4EOPA 3FLSA 3FMDA 4F7SA 2XNPA 5KE0A 1W98A 3DZOA 4QMSA 3UMWA 3BEAA 3VW6A 5ICPA 4B8LA 1JSVA 3SC1A 5DLSA 4C58A 4D2WA 4BDHA 5BYYA 4JLCA 4MQ2A 5HKMA 5CF8A 5IG1A 3QFVA 1J1CA 5EKOA 5LVPA 3WF8A 3IK3A 3O96A 1YXTA 3TKIA 3PPJA 3D7TA 3G33A 3L9PA 2XJ2A 5HIEA 4G3DA 2XMYA 3AGMA 1BKXA 1Z5MA 2Y6MA 3PRFA 3QGWA 3NYNA 2C47A 1OL7A 3MH2A 5J9ZA 2W0JA 3I1AA 4JVGA 3I4BA 4EOIA 3UO6A 3COHA 4FTOA 3OW3A 3L9MA 4LL0A 3I6WA 2WOUA 3BLRA 3KF4A 2BTRA 5EM6A 2XA4A 3V6RA 1V0PA 5KX8A 3IKAA 3AT3A 1DAYA 1Q99A 4GL9A 1XH8A 2F7XE 2VX3A 3HUBA 1YRPA 4QMLA 4ALVA 3WIGA 4AWIA 3R7UA 1OPJA 3E8CA 5AIRA 5H8BA 3TNWA 4J7BA 1ZYJA 4FTKA 3LCOA 4JBOA 4PMPA 3RGFA 2EB3A 4JR3A 1OL1A 2YIXA 4MXZA 1Q8YA 3GNIB 1IR3A 2PMIA 5CSXA 4O0UA 2J0JA 4I5HA 1ZYDA 3C4XA 5K5XA 2OICA 2P2IA 2W4OA 3ZOSA 4L8MA 1KE9A 4AG8A 4UX9A 3RNIA 2VWVA 3AC5A 4J8MA 4ZTNA 3HV6A 3WF9A 1IG1A 5CS6A 3UZTA 3NEWA 4O91A 1KE5A 3WE4A 4BKYA 4YC6A 3EQDA 4FUYA 4F9BA 4Y73A 3EFKA 2R3NA 2W06A 3GC0A 3LFAA 3NNXA 3U51A 4NTSA 4AZEA 5L2SA 3U6HA 3DAEA 3VRZA 1M7QA 3FLZA 1Q97A 1T46A 3MIYA 3PG1A 1TQPA 2ITYA 3P9JA 5F1ZA 2UW7A 2PZIA 2GNIA 4FIGA 5AX9A 4MXYA 4C0TA 1ZY4A 3KB7A 1IEPA 5FEQA 2YERA 2ETKA 3P23A 5D11A 4UMUA 3L8PA 3NGAA 3MW1A 2B7AA 2BRBA 3FZSA 1MRUA 1HOWA 2RFDA 4I92A 5CWZA 5IH4A 3UOLA 3C4EA 1WBOA 3ZSIA 4IFCA 5HU3A 2OKRA 1STCE 3GT8A 4L43A 5DRBA 2RKUA 2Y4IB 4CYJA 5AR4A 3FLNC 5EI8A 5CXZA 2VWUA 2ITZA 1G3NA 4U45A 4X6RA 1ZOEA 1UU7A 4RZVA 3MFUA 2C3IB 3OHTA 4WBOA 4R3RA 2I6LA 4YC8A 3BQRA 2WMWA 4M67A 3VN9A 4HJOA 4QRCA 3RWPA 4A9TA 5HD7A 4FKOA 3MB6A 4HYHA 4XS2A 4JIKA 5AV0A 5FP5A 3TN8A 4CCBA 4DFNA 4FBXA 3OXTA 3V5JA 2XKFA 3FPQA 2WMUA 1MRVA 3D5XA 3NIEA 1TQIA 2C1BA 1B38A 3F69A 3PY3A 4GFMA 4WG5A 4K11A 5T3QA 5KBRA 1Q41A 2C6MA 3KN5A 3HZTA 3R28A 4AGCA 5K4JA 2X6DA 2W9FB 3MSSA 4WRGA 3PP0A 3TNQB 1H24A 4N6ZA 4C3FA 5HO7A 3TIYA 5CZIA 4P5QA 3FY0A 3TKHA 3GU6A 2H6DA 3C0HA 3LCDA 2X7GA 3R2YA 4B9DA 4FTCA 2YZAA 4ANSA 4PP9A 2FSTX 5DT0A 3BX5A 2X4ZA 3TZ9A 2PE2A 3FQEA 2G2IA 3HV4A 1SVGA 3RWQA 4DCEA 2UZNA 2HZ0A 1BL7A 3EH9A 4L53A 5J79A 2QKWB 3JVSA 2AYPA 5HIBA 3P4KA 5JFSA 4FK3A 5HX8A 4XCUA 2BAQA 5DGZA 3OY1A 3P1AA 4ITHA 3EQBA 4IAKA 4YHTA 4IAYA 2P33A 3BGZA 2J4ZA 3R9OA 4RWKA 4JG7A 4M0ZA 4BBEA 2IN6A 2GTMA 1R3CA 1FGIA 1PXPA 4DH5A 1WBVA 5E8TA 4BWKA 4QP3A 4WT6A 3RHKA 2ZV2A 3V3VA 3VUKA 4HNIA 2XRUA 4W8EA 2E9NA 4U7ZA 3SXSA 4OTIA 4QMUA 4QTBA 5J95A 2H34A 4EL9A 2NPQA 1U46A 2C5OA 3GU7A 3PP1A 3WI6A 3PWYA 4MD7E 5AM7A 2VGPA 1B39A 3GC8A 5D7AA 5DPVA 2GCDA 2YISA 1GJOA 3CQWA 3KFAA 4FSWA 3O23A 3F3TA 3UOKA 2YLEA 4BC6A 4P4CA 2Z7QA 3C7QA 3ZLXA 2ZB0A 3OEFX 4W8DA 4AZFA 1IASA 4QMTA 4WO5A 4MNEB 3S95A 5EKNA 3TNHA 3HV3A 3L8SA 4I0SA 2WQNA 3HMNA 2VTLA 2IVSA 3QHRA 2QOFA 2XZSA 3RPVA 2VTMA 3FHIA 2JDSA 3QC9A 4C37A 4EI4A 3ZSGA 4MEDA 4CV9A 5CEKA 4MXAA 3BHHA 1XHAA 4QP8A 4YBJA 3UDBA 4BHNA 1U54B 2QO9A 4H3QA 4TPTA 4GRBA 1REJA 3W2QA 4OT6A 2OF2A 2XM9A 3CR0A 4C59A 3QZGA 5L8JA 2Y0AA 3CKWA 3EFWA 4AGUA 3QA8A 3GQLA 4IC7A 2HW7A 4XG4A 4IM2A 3RAHA 2ONLC 3LJ2A 1XKKA 4XNEA 3UYSA 3P7AA 4TTHB 2A4LA 3ORZA 3P86A 1JBPE 4IE9A 2YM6A 1PMVA 4Y46A 3WZDA 4FKSA 3FMLA 4Q5EA 2F9GA 4WG3A 2JIIA 4PMTA 5HTCA 5CENA 2QHMA 2EB2A 3DB6A 3R1SA 5DFPA 3QKMA 3DK3A 3O50A 4PL3A 2FGIA 3FL4A 4FZAB 4YJRA 3VBWA 1ZMUA 3SOAA 4EHGA 5IA1A 2LGCA 5M57A 1UU3A 1CKJA 3MH1A 3PA5A 2PMOX 5HVYA 2PE1A 3UIBA 4X7QA 4PV0A 4C3PA 1QL6A 1CTPE 1K2PA 2BDWA 4J99A 2OH4A 5EW8A 1WVWA 2OH0E 5DR6A 3V5QA 2PZ5A 2WQOA 1LP4A 4EYMA 5J5SA 5KKRC 2IVUA 2PVFA 2B52A 2Q0NA 5I9ZA 1NY3A 1NVSA 2E9PA 4K1BA 4D58A 5I9XA 3ZC6A 4MH7A 4BGGA 1R1WA 2UZVA 2QO2A 3EOCA 1XH4A 3OBJA 4A07A 4BZOA 3BZ3A 3GUBA 3MIAA 4CKJA 3FLWA 3LVPA 3QQHA 4DEEA 3JY0A 4OT5A 5JRSA 3MVLA 2VX0A 3C4ZA 3D7ZA 1XH6A 1M2PA 3DKOA 3IG7A 1YWRA 4IWOA 4K2RA 4BBFA 4YU2A 4JNWA 2WU7A 2QC6A 4IVBA 4YTCA 3KGAA 2CMWA 2GS7A 5JT2A 5ANDA 4BGQA 1ZYCA 3VUMA 4KB8A 2CJMA 1JKTA 4BDGA 4EZ7A 1YQJA 4M69B 2FVDA 4F65A 5ITAA 3GC9A 4RWJA 2GFSA 3QTZA 4FT9A 4MNFA 5HLWA 5D1JA 3ZC5A 2GNGA 4QP9A 2IZUA 4UN0C 4X6QC 1H27A 1OKVA 2C3KA 3PXFA 4ZTSA 1PKDA 1OKYA 4V0GB 5AIKA 3S4QA 1OECA 4KD1A 3G9LX 5LWNA 3VIDA 3ORKA 1PXLA 3MTLA 3T3VA 2WMQA 3EKKA 3O8PA 3LXLA 3QD2B 2BIYA 3NUPA 2RG5A 3QRKA 3WARA 5CAOA 4X3FB 4BKZA 4R8QA 3NUSA 5AR5A 3CXWA 3U87A 5HZNA 5L2IA 4BBMA 4QP6A 1GIHA 1OL5A 2OSCA 4YLJA 3ZTXA 3PJ3A 3UP2A 3ZO3A 2X9FA 1GAGA 1VYWA 3EQHA 3QUDA 4OW8A 1K9AA 2R3FA 4M0YA 1H1QA 5I3OA 4LOPA 4CRLA 4MK0A 4PTCA 4MQ1A 3JPVA 2VAGA 1OUKA 4RJ5A 4O6EA 3BWJA 4NFNA 5FXSA 4L6QA 4FG7A 3QF9A 2R7BA 4QMNA 1O6LA 1Q4LA 4QMYA 3AQVA 3SRVA 3A4OX 3Q9ZA 4O27B 5AM6A 2CN5A 2F49A 2WIPA 4BTMA 5HEZA 3FJQE 2G2FA 2Y7JA 3PVWA 3QTSA 3CP9A 4FTLA 5DEYA 4QOXA 4C61A 3RAWA 4EH4A 3CQUA 4I94A 3CTQA 3V8WA 4IH8A 4M84A 2VTOA 2QU5A 3PXZA 3OT8A 3CD3A 5BUIA 2BR1A 3NAYA 5DRDA 2X0GA 4NIFA 3FPMA 4YMJA 4LI5A 3CTJA 3OUNB 3KMUA 4C4IA 3W2CA 4EWHA 3EMGA 5LCKA 4IAIA 4ASEA 3UE4A 1BYGA 3FC2A 5CAVA 4MKCA 3KRRA 1CKIA 4G31A 3ZS5A 4WNKA 4XP0A 1O6KA 4FSTA 1Q3WA 3H9FA 5KCVA 4KIQA 4LRMA 2OF4A 3VS2A 4BCMA 4XOZA 5GJGA 2XJ1A 3FYJX 4I1ZA 4V05A 4AW5A 2XNBA 4CNHA 3JVRA 5CSVA 5B2KA 2R3HA 2ZM4A 2BHEA 3UG2A 4RIYA 3L9LA 2C30A 2WAJA 2WO6A 5K3YA 3U4WA 2C4GA 2DUVA 4XEYA 4KIKB 5FDPA 2FUMA 2V55A 2Y6OA 2Y8OA 2WQMA 3AOXA 5FEEA 2H96A 2VD5A 3HLLA 5ANIA 3JUHA 4O0WA 1Q8ZA 5AUZA 3ZO1A 2XNMA 1PMEA 2ZB1A 3UIXA 1H25A 4L3PA 4U8ZA 1IRKA 3DPKA 4FV6A 5AA8A 5M4UA 2VNYA 3C4FA 5C8MA 4A4XA 4XP2A 1ZMVA 1M17A 3DKGA 3DLZA 4IVCA 4ASDA 4HGTA 5E7RA 3LXNA 4JL9A 2JEDA 5HHWA 4IX6A 3UO5A 3IW7A 4JX7A 4ZSGA 3U4UA 2JAVA 3TUCA 3LQ8A 4TN6A 1H4LA 5HBHA 3C0GA 3ANQA 4RIXB 3IW5A 4ANOA 3CC6A 2OI4X 3OY3A 5CAQA 1AQ1A 4P90A 3D5VA 4I4EA 3R1YA 2OW3A 4J52A 4A4LA 3CQEA 3LQ5A 2Z7SA 3WZEA 2J0IA 4EQCA 3P79A 4U3YA 4F08A 5KMKA 1UWHA 2QOIA 4FNXA 1F3MC 3R00A 2CGUA 3FL5A 3I0QA 3RPRA 4FNYA 3ZRMA 5HD4A 3GU5A 1M52A 4O22A 5KMMA 3RJCA 5JFXA 3UO4A 3ORNA 2BILB 4S34A 5IMXA 1XJDA 4XG8A 2R3RA 1YXUA 4QO9A 1KSWA 1W7HA 4EH9A 3W2SA 4M97A 3ZFYA 3KMWA 4X2NA 3LFNA 1W84A 1YI3A 4GU9A 1W0XC 2R3QA 5FWKK 3A7FA 2HENA 5L4QA 4YNEA 4QMMA 2R7IA 1PXJA 5D7VA 4MBIA 5CEOA 4YSMA 4FYOA 5DI1A 3GENA 2X8IA 3KU2A 3SD0A 3E3PA 5CZHA 4XJ0A 4EOSA 4LYNA 5CALA 3DDQA 2OJJA 2YIRA 2G15A 2YAKA 3DDPA 4BCPA 3ZFMA 4FKGA 5HE0A 1MP8A 3FMNA 3NNWA 4PNKA 5K4IA 3MPMA 4UZHA 4IJ9A 4IFGA 3OS3A 3I60A 5AP1A 4CFUA 2W96B 3EQFA 5HOAA 4DLIA 5HG9A 3NR9A 4NZWB 5CXHA 2QODA 1WZYA 5CF5A 2X81A 5M55A 3DQWA 3W8QA 4TWOA 3KCFA 4XV2A 3UNJA 2EWAA 2X7OA 1E1VA 3PYYA 5DHJA 4BDFA 1JKSA 3EYHA 1YDRE 3BHTA 2FYSA 4IANA 5CVHA 3OROA 4G1WA 4R5YA 4ZJJA 4J97A 3PJCA 4JBQA 4M7IA 2A27A 2LAVA 3KXHA 5F95A 4IHPA 1F0QA 2IJMA 4EH8A 3HMOA 1WCCA 4EK6A 3T9TA 4AAAA 4WA9A 1XBBA 3EIDA 4FT5A 2BCJA 3H3CA 2I0YA 4OTDA 4EH7A 3BE9A 3CKXA 4RWLA 1QMZA 4YZNA 1Z57A 2ITNA 2JKKA 4QTAA 4QMVA 5DT4A 3B2WA 4F9AA 4C2WA 3KVWA 3GBZA 3VJOA 4MWIA 3S0OA 3AMAA 4M15A 5CVGA 3PSCA 4DEBA 3RI1A 5I0BA 3E5AA 5CANA 1XBAA 4JRNA 4L3LA 3DBDA 3A62A 4I5CA 4LMNA 3WIKA 4X0MA 4ZTRA 2WKMA 3R7YA 3PXYA 3EJ1A 1XQZA 2YEXA 2E2BA 3HRFA 4N70A 4RVLA 5FM3A 3V8TA 2XIXA 4F7LA 5H9BA 3QRUA 2CSNA 2VTRA 4FT7A 3VF9A 5C8KA 5DN3A 2C0IA 5LCJA 1YOMA 2KTYA 2XUUA 4S30A 5AX3A 4ZY5A 4YZDA 3W33A 4OAVB 4XX9A 1OM1A 3D2KA 1PF8A 5JN2A 4PF4A 2XIYA 4Q9ZA 1OVEA 4BCOA 4C33A 4JQ8A 4FIIA 2QO7A 2WMAA 2GS2A 5DG5A 4QMPA 4GU6A 4L44A 3RBWA 1Q24A 3I0OA 4GW8A 1H00A 4Z55A 4WD5A 5F9EA 4ZLZA 4BCQA 5EG3A 4AUAA 5T68A 2AC5A 4EH5A 3OWJA 3R2BA 3WBLA 1GY3A 5JSMA 4NUSA 5LWMA 1SYKA 1PHKA 2XNNA 3BGPA 4PDOA 4FNWA 3VRYA 3TV4A 3R6XA 4MVFA 2XCKA 1S9JA 2WTCA 3DXNA 4KKGA 3ZLWA 4BICA 3PLSA 4I21A 4UALA 1KV2A 5D9HA 3FXWA 4NM3A 4JBPA 4BWPA 4CT2A 5HCYA 1JKKA 4FTNA 2JDVA 2VWYA 4C4FA 3OUKA 3BHUA 4I93A 5HE2A 5BPYA 3W8LA 2ERKA 2JKMA 1PXOA 2QG5A 4GMYA 4PPBA 1SMHA 2YCRA 4DFLA 2YDJA 3TNPC 3UQCA 3HECA 1OIYA 5JRQA 4FT3A 5AP5A 2QOBA 2XCHA 2VO6A 1M2QA 2HCKA 3KXNA 3FI4A 2F2CB 5HE3A 3U6JA 4ZS0A 3OD6X 2IVVA 1YI6A 4Q5HA 3W2OA 2CLXA 2ITVA 2HK5A 2JITA 1DI8A 4AOJA 4TNBA 5JZJA 2GQGA 2A19B 1QCFA 3JYAA 3KK8A 4FGBA 4QNAA 4RJ4A 4EOMA 4Z9LA 3FBVA 1PMUA 2QR7A 4TWCA 5LMBA 2I0HA 5LJJA 1YOJA 4CZYB 4NJDA 3CGOA 3R7VA 4B4LA 3OCTA 3VHKA 3IDPA 2GS6A 3LE6A 3ZYAA 4FMQA 3OP5A 4Z16A 2P3GX 4I5PA 3WILA 3W18A 4QT1A 4DGMA 1ZYSA 3R21A 5C9CA 4ZLOA 3B2TA 3KULB 1H1RA 2A0CX 3W16A 5I5ZA 4OGRA 4TRLA 3D94A 2W1DA 4ID7A 4MNEA 3PPZA 1LUFA 1ZMWA 2YIWA 3OCBA 3QRJA 2VO0A 3D4QA 3QQKA 3VS0A 3IOPA 3QLFA 5ANKA 3KA0A 4TXCA 3ERKA 3RZFA 2XNOA 4FC0A 3BRBA 1R0PA 3CPBA 5EI6A 2QOKA 3TZ7A 4C4JA 2XEZA 4IX5A 2WMXA 2WMSA 1KOBA 2C5YA 5E8ZA 2YM8A 3CGFA 3PFQA 3P0MA 4R5SA 4BHZA 3T3UA 2JBOA 2O63A 4A06A 4F70A 2XKDA 3F3ZA 4F0GA 1FVRA 3H0ZA 1VJYA 3JXWA 5CI7A 2WU6A 1IA8A 4ZSAA 3D5UA 5CEPA 3LLTA 2AUHA 2PL0A 5IKWA 3E63A 4XUFA 4AQCA 4EK8A 3CJFA 3Q53A 1Z9XA 3EN9A 5ETIA 4D9UA 1ZXEA 2HZ4A 1RQQA 2YIQA 4J96A 4UWCA 4MHAA 4K33A 3G0FA 4M66A 2R3OA 3VBXA 4E6QA 3F5GA 1CM8A 2BAJA 2PVYA 4HVHA 1W8CA 4QMWA 5TE0A 1UKIA 1JSUA 4H1MA 4UBAA 3LFFA 5FBNC 5DEWA 1WMKA 3R83A 2OWBA 3OG7A 4BTFA 5E8UA 2RL5A 3LZBA 5AV3A 4C34A 4M68A 1UKHA 4FSQA 2GNHA 5AV2A 2Z60A 4H3BA 4RX7A 4F09A 4KABA 4A7CA 4BIDA 3R7GA 2XJ0A 4RMZA 2VGOA 3QXPA 4YZMA 4ERWA 4OR5A 3HV7A 2HZIA 4YJUA 1YXXA 3BGQA 4C7TA 3OC1A 5AWMA 4E93A 4DH1A 5M4FA 5AUWA 3SLSA 3LFEA 3UZPA 3E8EA 4IX4A 4W4VA 1FPUA 3ODZX 2J0MB 3Q32A 4RGJA 3AC2A 4ZSJA 1SZMA 4DG0E 1H07A 2BZKB 2GDOA 5J5TA 3DBEA 2YM3A 3HUCA 5E1SA 2CHLA 4F9YA 4YURA 4S31A 2ITPA 3IW6A 1H8FA 3LOKA 3PIYA 3DS6A 3H9OA 2UVYA 3H4JA 5AV1A 4BB4A 4IDTA 5AMNA 4IVAA 3TXOA 4DTKA 4Z7HA 5A6NA 2C6OA 5I9UA 1FOTA 5EM8A 3V5LA 4EK4A 1M14A 1T45A 4HVDA 3F3UA 1Q8WA 5E92A 3TL8A 3V5TA 3F5UA 3QLGA 4IAFA 4BKJA 3CE3A 4C35A 4FUXA 2VRXA 3HL7A 3F2NA 4QQJA 2OU7A 3KL8A 4YTIA 1K3AA 2FSMX 4NSTA 3A8WA 1AD5A 2Z7LA 5E8VA 4V0GA 2QOQA 5L6PA 1MRYA 3T8OA 3UPXA 3PXKA 4GK3A 3C9WA 3DBQA 4E5WA 5HU9A 3Q4ZA 4LUDA 3BELA 1FMOE 2UW4A 3TT0A 1JLUE 3F61A 5DA3A 5I9WA 3AC3A 1ZZLA 1H0VA 2JIVA 2PWLA 3EN6A 4QPMA 4R3PA 4BFMA 3AGLA 1LR4A 4CKIA 5A4CA 3QA0A 3UTOA 3ULZA 4A9UA 1JNKA 5LMAA 4H3PA 2WXVA 3QUPA 5KZ0A 2JFLA 2PZPA 2UV2A 4XG6A 1GIJA 1GIIA 3O8UA 3ORTA 1UNGA 1P4OA 3IGGA 4IACA 4IDVA 4EC9A 3AT2A 2W99B 3ZDUA 4ITIA 3NRMA 4IB3A 2CGWA 3G6GA 3OFMA 3Q6WA 4BTJA 2J50A 1DM2A 3ORMA 3QTIA 4TT7A 4IZYA 3NAXA 4FKIA 2PMLX 4YTFA 3GVUA 4RJ6A 4TWPA 2ONLA 2FO0A 4BZDA 3QTWA 4QQ5A 2YLFA 3VS4A 2IVTA 1OL6A 3GP0A 2X2MA 4L7FA 4AOIA 1RJBA 4UZDA 5GZ8A 3LFDA 3ORPA 4GEOA 2VV9A 5CSWA 4FTAA 1YHWA 5J1VA 2YA9A 4F6UA 2Y4PA 2A1AB 3LHJA 5IEYA 4AU8A 4QYYA 5E8WA 2XYUA 4TW9A 5BNJA 5DOSA 4D4SA 4FTJA 3AD5A 4ACGA 3QWJA 3R71A 4E73A 4X2GA 3FZRA 3KXXA 4FL3A 4CMTA 4LL5A 2XIZA 5AV4A 1VEBA 4RVMA 3PIXA 5IMEA 3GGFA 3NCZA 4FV4A 2RF9A 4I6BA 4FZFB 2OBJA 2VUWA 1VR2A 2J2IB 4X21A 5J7HA 1XH7A 3UC4A 3RKBA 2R3KA 3WYYA 4G34A 3SXRA 3ZMMA 5IA3A 5ACBC 3E7VA 4APCA 1REKA 4D9TA 4Q9SA 5JQ5A 2WHBA 4IM0A 3SAYA 4ZJVA 3PA4A 1J91A 4FSYA 5EFQA 2X9EA 4FT0A 5LOHA 4M13A 1BX6A 3DAKA 3ZLSA 3Q9YA 4M3QA 4L45A 3R9NA 4D1XA 4DHFA 3NCGA 2W1CA 2ITXA 2UVZA 1BMKA 4R6VA 3CS9A 4X3FC 1GZ8A 3PE1A 1UV5A 4JBVA 3R22A 4MBLA 4BCNA 4ACHA 3BHVA 1CSNA 2HIWA 1P4FA 3SOCA 2W5HA 2OFVA 4W4WA 4MBJA 3V5WA 3QCQA 3VS6A 4I4FA 4WKQA 4MAOA 1FGKA 4HOKA 4RFZA 3TNIA 4BYIA 4B0GA 2C6LA 4MXXA 4DEDA 3FKNA 3LW0A 3OBGA 4M8TA 3BE2A 5CF6A 3OW4A 3SXFA 3QU0A 3I7CA 3VULA 4EWQA 5BUEA 2YM7A 2YWPA 3F7WA 5AP3A 1S9IA 3LXPA 4OTQA 2Z2WA 2YABA 1PXNA 3GFWA 3GCPA 3ZBXA 4D5HA 3M42A 2BZIB 3FXZA 3TZ8A 3H9RA 4FSRA 5LMKC 4F0FA 5A54A 2XBAA 4FIFA 3DGKA 3R8PA 3JY9A 3PXQA 4CMUA 3E88A 3K54A 1HCKA 5EHOA 2B55A 5IPJA 4W4YA 3Q9XA 4NCTC 3SDJA 4RJ7A 3LAUA 4FSUA 3NZ0A 3R8UA 2C6IA 2X4FA 2Y9QA 3MYGA 4GIHA 4UEUA 1OL2A 4JXFA 2ETRA 4D55A 4XP3A 4X2JA 4BCHA 4KIPA 5IA0A 4FL2A 4FYNA 2QONA 2WEIA 5J87A 3TV6A 4F7NA 4G6OA 4AA0A 4LV5A 4MD9E 5GHVA 3WF5A 4IAAA 4TWNA 4LV8A 2VTQA 4UXLA 2X8EA 4WBBB 3U9NA 5L3AA 3FY2A 1U4DA 1PXKA 2B53A 2HXLA 4GUBA 3VC4A 4BDIA 5AJQA 3C0IA 4CZTA 3ZONA 4ACDA 5A9UA 4HCTA 5D12A 4ALUA 5CU6A 4D4VA 1Y6AA 5HBJA 4JAIA 2BALA 3THBA 4MWHA 5H8EA 2B4SB 2ZOQA 5IDPA 2ZAZA 4ZTQA 4P5ZA 4QP2A 4F7JA 3BYMA 3FDNA 4NM0A 4GYGA 3H0YA 3VUDA 4BDKA 4QYGA 3D7TB 2VTHA 2BKZA 3NDMA 4D2TA 5EOLA 2ZM1A 3GFEA 3UC3A 4DAWA 4PUZA 4QMZA 3DNEA 2C1AA 3Q4CA 4FKLA 3GCQA 4II5A 4G3FA 4BCIA 2OIDA 4OTPA 4GG5A 5A4QA 4MF1A 3OCSA 3R63A 1OPKA 4Y72A 2BFYA 1ZY5A 2W7XA 4FV2A 2W4KA 3KRLA 4G3EA 4U41A 2GFCA 2VTTA 3VBYA 3F9NA 2PVLA 5BVEA 3KRWA 5AP7A 4AFEA 2BRGA 4DG2E 3T9IA 3VHEA 3B8QA 4C4EA 2BTSA 3DBCA 2EU9A 3G0EA 5JKGA 4I23A 2H9VA 2WTJA 3FMJA 3Q5IA 2VTJA 5I9VA 1Q62A 4K77A 4TYHB 3Q6UA 5BVDA 4ACCA 2R9SA 5CQWA 4GT3A 4HNFA 5IUGA 4X2KA 5M4IA 4GK2A 4E5BA 4U81A 3NYVA 2WMBA 3TI1A 2OO8X 4MYGA 4YPDA 4ALWA 4DGGA 2P4IA 4RBLA 2PVJA 4WSQA 1ZZ2A 4YJOA 4XBUA 3HDNA 3DBFA 3VBQA 2FH9A 4S33A 4IXPA 2WD1A 5DR2A 4KBAA 3RM6A 4AFJA 4XV9A 4GIIA 2HY81 2GMXA 5BVWA 3RK9A 2ZV9A 4YGAA 1BI8A 2CPKE 3L9NA 4NWMA 3V01A 3ZSHA 4XRLA 4I41A 2ITOA 2YM5A 2ZJWA 5AR3A 2C5XA 3PZEA 4XG3A 3MFSA 4KNBA 2C6DA 3RPSA 4HPTE 3ANRA 3MWUA 2BVAA 2OXYA 2NO3A 3A7GA 4QMOA 1OITA 2EUFB 4FK6A 1U5RA 3UMXA 3LM0A 2VTAA 4K0YA 5CASA 3VBTA 4AT3A 2JKOA 4IC8A 2VN9A 2BDJA 4KKEA 3CTHA 4C57A 2NP8A 1A06A 5GZ9A 2WTKB 3EQCA 5KUPA 1AGWA 2BRMA 2C0TA 4F99A 3ZUTA 4CT1A 1YI4A 5HTIA 5EW9A 2KULA 4FG8A 3O51A 4RWIA 4F6SA 3WZUA 1Y8GA 3LIJA 2JAMA 4IWPA 5J7BA 4A4OA 2V7AA 2YHVA 4GUEA 4MX9A 4XLVA 4Q2AA 3FLQA 4OBOA 5G1XA 4PRJA 4ZLYA 4R7HA 3FKLA 2YN8A 4NTTA 4L3JA 4DC2A 3UQFA 4L67A 4D5KA 3NUXA 4ENYA 1E1XA 4U43A 3EYGA 1JVPP 3VQUA 3SA0A 1Y91A 3QCSA 4FSZA 4XBRA 2OXDA 4AN2A 3KVXA 3LJ0A 5EOBA 4X3JA 3ZLYA 4B99A 4CFNA 3PG3A 4CTBA 3DK7A 2YM4A 3O71A 4IM3A 4CLIA 3HRBA 3K5UA 1OMWA 3F5PA 4BIEA 2RSVA 5DE2A 2P0CA 5C8NA 4JIAA 4RZWA 2E9OA 4JDIA 3BYOA 3RP9A 2YDIA 4E6CA 2X6EA 1XWSA 2QHNA 2ITUA 2ITTA 3ZO4A 4U44A 2R4BA 4CFWA 2QVSE 4TY1A 3SX9A 3FXXA 4AN9A 4BIBA 4H39A 3JS2A 2UZEA 3MPAA 4GT5A 5ANGA 3G2FA 2JGZA 3VAPA 2UZUE 2XK4A 1VZOA 1WAKA 1QPDA 3HA6A 3BEGA 4XHKB 1OKZA 5E90A 4EZ3A 4XG2A 4TYIA 4WUNA 4XYFA 4IWQA 3UYTA 3A4PA 1NXKA 2PSQA 5EM7A 2XBJA 4DEGA 4O0XA 5CEQA 4EH2A 2ITQA 5AP4A 3RTPA 2CN8A 4BI0A 3PY0A 5A4LA 1XBCA 4RIWA 2RFEA 4LG4A 4I6FA 4DLJA 3HKOA 4OTRA 4ANQA 3FMKA 4XOYA 4A9SA 3RM7A 4AT5A 1GOLA 1PKGA 2QCSA 3U6IA 3AD6A 3GXLA 4FTQA 3C1XA 2R0IA 1YOLA 5ETAA 4CQGA 4YHJA 3QZIA 4FSNA 3VS7A 3I81A 3A60A 4DGLC 4O0SA 3ZXZA 5LVOA 3QRIA 1OUYA 1W83A 3KQ7A 4RJ3A 4N0SA 1SVHA 5CU3A 4RA4A 3ORLA 3ZXTA 3OXIA 3OWPA 4K6ZA 4RVTA 3DKFA 2JBPA 1GZNA 4O2PA 4BCGA 3UOJA 2OK1A 2QD9A 2ZVAA 2PMNX 2XKEA 3OTVA 4FTTA 4ANBA 1PY5A 3BYSA 5IA2A 2EVAA 5TKDA 3Q5ZA 4NW6A 3KKVA 3FQSA 5CT0A 2RFSA 3QUEA 2QQ7A 4G16A 1J1BA 4E8AA 3MA3A 3MJ2A 4RFYA 1LEWA 4RC2A 4FF8A 4BI2A 1LEZA 4ZP5A 2GHGA 4RFMA 5AR2A 5H3QA 2F7ZE 2X7FA 4K18A 3ETAA 4IBMA 3E64A 3KC3A 3FSKA 4LM5A 3LCKA 3UJGA 4AT4A 1MUOA 2BZHB 5AADA 4I0RA 3I7BA 3PUPA 4BTKA 3A61A 3EKNA 3VUIA 5HORA 1QPJA 3COMA 5BVKA 3QHWA 3QTUA 3NS9A 3D2IA 2BAKA 3DU8A 4LQMA 4RA5A 3UIUA 2WPAA 3R9HA 2CGVA 2HAKA 5GNKA 3SV0A 4AE6A 3BIZA 4ANMA 4QPAA 1TVOA 4E7WA 2VTSA 5JH6A 2J5EA 3SW4A 2GSFA 3Q3BA 5A3XA 4F64A 4F1TA 2VWWA 3UG1A 4ZSLA 5AP0A 4FL1A 4YR8A 3MI9A 5HX6A 4QTEA 4HGLA 4RC4A 4XLIA 2F4JA 3ZUVA 2OZAB 4J98A 2HYYA 3P7CA 3F82A 1WBPA 4ZZNA 2R64A 4O1OA 2UW0A 4D28A 4JX3A 4GCJA 3VS5A 1OI9A 5L2WA 5KBQA 1B6CB 4U79A 4S2ZA 2YCSA 4U3ZA 4D0XA 3Q9WA 1JSTA 4I20A 3LCSA 2X2LA 5CSPA 4FV9A 4KS8A 1NVRA 2HZNA 5CI6A 4ZJIA 3CLYA 2WEVA 5IISA 3OWKA 4MXCA 4CCUA 2PVHA 3MFRA 4ITJA 4BVUA 5EYMA 4QNYA 5BVNA 5LVMA 4FVQA 4AXAA 5FEDA 4OTHA 2V0DA 4O1PA 5A46A 2J6MA 1Y8YA 4KKHA 5AAEA 2XS0A 2QOLA 4KSQA 3D14A 3VJNA 1URWA 2ZDUA 1J3HA 2HY0A 4LGDA 5L8LA 2J0KA 4IW0A 3AC1A 4GJ3A 5HQ0A 2X2KA 4YJNA 3Q52A 3RINA 3U8WA 4FKJA 4IVDA 2R5TA 2YCFA 4EOLA 3DT1A 4TZRA 5TOZA 3UQGA 4JDJA 4QQTA 3RCJA 2VTIA 4KA3A 4EK5A 2BRHA 4EHVA 2RFNA 5H2UA 5JFVA 4GV1A 1PYXA 4RLLA 3W10A 3CY3A 4IB0A 4KBKA 4AF3A 3CCNA 1PJKA 2OJ9A 4JDKA 4EC8A 5IZFA 4Z3VA 4AS0A 4LOQA 5DBXA 3RNYA 4FV8A 3SRVB 2ZV8A 3MY1A 4IZ5A 3RPOA 4EQUA 3F7ZA 4G2FA 2UZBA 3ITZA 4HW7A 4H36A 2F2UA 5FTQA 5M51A 3FZOA 4FX3A 3NW7A 4GH2A 1P14A 3TTJA 2OXXA 1FMKA 2CGXA 5GZAA 2W1FA 2DYLA 4NM5A 4G9RA 4XG7A 1QPCA 2CCHA 3BWFA 1WBSA 4I0TA 1H28A 3ODYX 4Y85A 3DNDA 4AA5A 3V6SA 3MV5A 4UXQA 2PVMA 4E20A 4NIFB 3BBTB 5C01A 2VWBA 4KWPA 4MCVA 4AP7A 4BDEA 5M44A 5IEVA 3PE2A 3MN3A 2DS1A 3O17A 3ZRKA 3BLHA 2FA2A 4GYIA 1XH9A 5TR6A 3VVHA 2R3LA 3DTCA 3NNVA 2QOCA 3R0TA 4JG6A 4O2ZA 5ANJA 1OIQA 4D2RA 3G9NA 4YHFA 5F20A 2G9XA 5HG5A 2XK3A 4EH6A 3PZHA 5BYZA 3S2PA 3P5KA 2R2PA 3FSFA 4BZNA 5AA9A 4G6LA 3POZA 5FP6A 4WNOA 3TKUA 3LXKA 4AGDA 4O0RA 3ZCLA 4CTCA 4RIYB 1DI9A 5EYDA 3ZZEA 3IW4A 3MTFA 4FV7A 3OTUA 4ZTLA 1H08A 3NSZA 2I0EA 5I4NA 3NNUA 4JRVA 4DBNA 3ENMA 3D83A 2VO3A 1BL6A 3BQCA 3CD8A 2HXQA 2ZYBA 4F63A 4RIOA 5LVNA 1U54A 2XF0A 3GQIA 4APPA 2JD5A 3NUUA 3E87A 4IX3A 3ORIA 3RAKA 4JDHA 2IW6A 3NW5A 3RALA 3C5UA 4HZSA 2RIOA 2Z7RA 5F94A 3TV7A 2OJFE 4O6LA 3KY2A 1WBNA 4IZAA 4FKTA 5BMSA 4RQVA 4WUAA 3GB2A 5K0KA 1OIUA 2RG6A 4XMOA 4F9CA 2VTPA 3A7IA 3DK6A 3UNZA 3IDBA 3PVGA 1ZARA 5HLPA 4G3GA 4GFGA 5JMSA 4FV0A 3F6XA 4I6HA 4KS7A 1GZOA 1ZYLA 3R1QA 2FB8A 2ITWA 2IO6A 4I5MA 3KMMA 4TYGA 4QP7A 4AW1A 3LPBA 4EOOA 3W32A 3PRIA 4FKVA 4DINA 4BYJA 4BWXA 1FVTA 2Z8CA 4EOKA 2PVNA 3DY7A 3ENHA 3EQGA 2F57A 3IOKA 3MH3A 4X2FA 3C4CA 5EH0A 4ACMA 5M56A 3S00A 2XRWA 3RVGA 5AP2A 3KK9A 4PY1A 2HW6A 4AGWA 3ACKA 3UPZA 4C4HA 5JFWA 3HYHA 3AMYA 5IH5A 4XV3A 3R9DA 1SM2A 3EL7A 4L68A 4ONAA 3ZHPC 4L52A 3D9VA 3EN7A 4XRJA 2BMCA 3G6HA 3TJDA 2GPHA 3AG9A 4ZXTA 4G5JA 3PJ2A 2C5NA 1YWNA 3BV3A 3QX2A 4G9CA 4BCKA 5LXMA 3QTXA 3QQJA 3QKLA 3TCPA 4CFXA 4QP1A 3MFTA 3QQGA 5DIAA 3TIZA 2BIKB 3SVVA 3SW7A 3K3IA 4FZDB 3KRJA 5E8SA 4ZSEA 1Q8UA 2PTKA 3Q4TA 2C5VA 4E5AX 3HP2A 3Q60A 3R8VA 1FINA 4NU1A 5ACKA 4M69A 5FM2A 2V5QA 1WFCA 3MY5A 3DLSA 5CU2A 3W55A 4PNIA 5BUJA 4FOBA 3VUTA 3BI6A 4N4SA 3O8TA 4FICA 2BHHA 3FMEA 4FVRA 3U9CA 2WFYA 2RGPA 2XNEA 5E8XA 2O0UA 2OFUA 3KEXA 2WOTA 4B6LA 4WHZA 3N9XA 4AX8A 3C50A 4WSYA 2OIBA 4TYHA 4X3FA 3FYKX 3QD0A 2UZWE 4AZWA 1WVYA 4Z7GA 5A4TA 4UYNA 2XK9A 3NYXA 3RZBA 5AEPA 2XEYA 2XK8A 4GVAA 3SHEA 3DFAA 4DG3E 2XNGA 3PJ1A 3VS3A 3ACJA 4F0IA 4QYEA 4G5PA 4JG8A 2BUJA 2VNWA 3HA8A 3QC4A 3ZRLA 2JC6A 5B7VA 4R1YA 3QD4A 5EHYA 3TUDA 3I5NA 2VWIA 2QNJA 3OCGA 5KMOA 3OOGA 3PSBA 3BPRA 3DCVA 3MGYA 4TNDA 5CF4A 4FOCA 3M2WA 3QWKA 2X1NA 3FZ1A 4NKAA 3H10A 2X39A 3R7IA 3DJ6A 4C38A 3UP7A 2W17A 5IU2A 2PZRA 5AAGA 5LMKA 1JWHA 3R04A 4DGNA 3AT4A 4FKWA 4QD6A 5HO6A 3PJ8A 4XV1A 2PK9A 3TTIA 3C13A 3VQHA 3EWHA 3Q04A 2GNJA 4JQ7A 4PL5A 4C8BA 2I1MA 3HMIA 4NCTA 2WB8A 4LUEA 3O7LD 2C6TA 2UW6A 2QOOA 4EORA 4PL4A 2BROA 2WMRA 5FRIA 3PVBA 4E4NA 2HWOA 4ZTHA 4IADA 4E4LA 4EEVA 2F7EE 2FSLX 4DN5A 5C03A 4CRSA 4FTIA 1OKWA 4CSVA 5BVOA 2ETMA 4W9WA 5DWRA 4CYIA 3B8RA 4OUCA 3O7LB 3QKKA 2EXEA 3ZU7A 4BDAA 2JDRA 1OIRA 3R01A 1P2AA 2E9VA 4FTMA 4PQNA 1ZRZA 4YLKA 5FDXA 4E26A 3A8XA 3N51A 1KE8A 2J51A 3QALE 4EK3A 1PXMA 3NUYA 3OF0A 3HMPA 3I79A 1OZ1A 4FV1A 4EJNA 4ASXA 1V0BA 4PWNA 2VWXA 3QBNA 3FUPA 5AUYA 2HOGA 3REPA 2YCQA 3EQPA 3NYOA 4H58A 5AUTA 4E1ZA 3EL8A 2WTWA 1UU8A 1TQMA 1JAMA 3DFCB 3QRTA 1YKRA 3C51A 3DKCA 2I0VA 3UOHA 4C3RA 2ESMA 4ZIMA 3E62A 3QZHA 4U42A 4ZZMA 1MQBA 1RW8A 2JKQA 4QTDA 4TYEA 4CD0A 4HCUA 4ERKA 4LRJA 4F1MA 3GCUA 5KHXA 4KIKA 4MD8E 3FI2A 5CNOA 3RMFA 4JT3A 4O0VA 4WNMA 3QX4A 3LM5A 4G6NA 2GTNA 4ZAUA 4U40A 1SVEA 3R8ZA 5B0XA 3VNTA 3FMHA 3F3WA 4BRXA 1I09A 1KE7A 2UW5A 4LGHA 4RT7A 4L00A 4QYHA 3L8VA 2IWIA 3DJ5A 4W4XA 3DAJA 5KMIA 2YJSA 1FVVA 3IONA 1KOAA 2WTVA 1KV1A 4U6RA 1ATPE 5EM5A 4YZ9A 2WMTA 3RCDA 4AACA 4E4MA 4WIHA 4EONA 4PTEA 4J53A 4ZOGA 3FAAA 3FMMA 1DAWA 4RG0A 4RX8A 2XK6A 3QQUA 3LMGA 5HG8A 3EZVA 4RIXA 1ZLTA 3O2MA 4ZEGA 5AUUA 2OG8A 3VF8A 3LFCA 2BFXA 4TYJA 4PPCA 2J90A 2YAAA 2XK7A 5CNNA 4ASZA 4I3ZA 1ZOHA 3OMVA 4EKKA 1OGUA 4CKRA 4J95A 5EW3A 3I5ZA 3K2LA 5B2LA 5GJDA 5T6KA 2HELA 2QLQA 2UZDA 5FGKA 2BZJA 3GOKA 2BPMA 4DH8A 3ZZWA 2W5AA 4KBCA 4F9WA 2A2AA 3EHAA 5TF9A 2W1IA 4QYFA 4ARKA 3BU3A 5JQ8A 4IB1A 4RLKA 4I22A 1CMKE 2EXCX 3HX4A 1R39A 3II5A 4BCFA 4RSSA 5CAUA 1BLXA 1YW2A 4HYSA 2WTKC 4ANNA 2XKCA 2PZYA 3PIZA 4Y5HA 2O5KA 3VBVA 3BU5A 3NIZA 5HNBA 4PP7A 5KO1A 4FKQA 4DYMA 4D2SA 2SRCA 1NA7A 1SNUA 4U9AA 4UWBA 2XIRA 3IW8A 4FG9A 1HCLA 2DWBA 1R0EA 3LJ1A 4HYUA 4YBKA 4GS6A 3ZEWA 4D0WA 2XH5A 3F88A 4D2VA 4DITA 2I40A 2J0LA 1XR1A 1YXVA 3EFLA 2PE0A 2DQ7X 2VWZA 3EZRA 3M11A 3FWQA 4JR7A 4R3CA 1UNHA 1Q5KA 4I24A 5I3RA 3OT3A 5FTOA 3FHRA 4HGSA 4NM7A 3PY1A 4NKSA 5D41A 4YJQA 3CBLA 3MDYA 4YSJA 3MH0A 5HNGA 4O0TA 5JGDA 3C4WA 2XB7A 3QYWA 1OPLA 2UVXA 4FTUA 3I6UA 1KWPA 5F4NA 4LOOA 4RPVA 3R7EA 4C62A 2QU6A 2GHLA 5LQFA 4JI9A 3W2RA 3TJCA 3WOWA 2GNFA 2GU8A 2YJRA 4TKSA 3KRXA 3A2CA 5IDNA 4K8AA 4EHEA 5J8IA 3FC1X 1PYEA 4AA4A 2W5BA 3E3BX 5HCXA 2OZAA 2VO7A 4XH6A 5IH6A 5L6WL 3OZ6A 2W05A 2ACXA 2O2UA 4H1JA 3P7BA 3P08A 4E6AA 4EKLA 3IQ7A 2XYNA 5AR7A 1UVRA 3NW6A 4DFXE 4L42A 4PPAA 4OTFA 3FKOA 4IZ7A 4S32A 3DZQA 3P78A 4IAZA 4PDSA 5IEXA 1ZOGA 5CX9A 4GVJA 4UMQA 1YHSA 3EQRA 4DFYA 4YNOA 3F66A 4FSMA 5KMNA 3CPCA 2AC3A 3DB8A 1VYZA 4RVKA 2IW9A 4NFMA 3POOA 5DNRA 3A99A 5E1EA 3VO3A 3KXGA 3GC7A 4QMXA 4YO6A 1WBWA 3ELJA 1JQHA 3UODA 1Q61A 2PVRA 4QQCA 4RX9A 3ZO2A 4F6WA 2UW8A 2PHKA 1XH5A 2UUEA 3ZUUA 5A4EA 4WNPA 1UNLA 4RC3A 3GOPA 3MB7A 4EQMA 4BDJA 3QCXA 4V04A 5CEIA 3V5PA 4C02A 2HWPA 3QQFA 3KXMA 4Y8DA 5G6VA 4KIOA 4IWDA 4ZZOA 2OZOA 4GG7A 5BQ0A 5C26A 1Q8TA 4R1VA 2QKRA 3NPCA 3R1NA 4D4RA 4O0YA 3E7OA 4FKPA 5HESA 2ZMCA 3ORXA 2P55A 5FLFA 1DS5A 3AXWA 4G3CA 3F2AA 4UV0A 5TO8A 3ZM4A 5M4CA 1YVJA 3QZFA 1CDKA 4IIRA 3UVQA 5J9YA 2G2HA 4CFMA 3GU4A 2R3JA 5HE1A 4QP4A 3GU8A 5IA5A 2IZSA 1JPAA 2V22A 3L8XA 5BVFA 3IO7A
chains in the Genus database with same CATH superfamily
4UYAA 4GK4A 1PW2A 4BF2A 4DEIA 2WIHA 4CQEA 3W1FA 2C69A 3UVRA 4Y95A 3R7OA 3MVMA 4IEBA 5HGIA 4FV5A 4GT4A 4LGGA 1X8BA 5CU0A 3ROYA 1M2RA 5C27A 4AN3A 3FLYA 3IDCA 4L46A 3OVVA 4AW2A 3W2PA 4BN1A 4YP8A 5EI2A 2QOHA 2ZMDA 3BYUA 2JFMA 1UU9A 3A7HA 4FI1A 4DEAA 1SNXA 3E8DA 3QAME 2QLUA 3NLBA 5KKRB 3FZTA 5J1WA 3MVJA 4NW5A 5CLPA 4D1SA 3EQIA 3MJ1A 1NVQA 2GHMA 3HVCA 3KULA 3MVHA 2CDZA 5CT7A 4AE9A 5EYCA 4IMYA 4RRVA 5IA4A 3GCSA 4V01A 5L8KA 3WF7A 5AUXA 4ZK5A 5KNJA 5LARA 3QXOA 4P7EA 1BUHA 4CMOA 2JDOA 1YHVA 4BGHA 4EOJA 3BYVA 4J1RA 2JIUA 5DMZA 3OOMA 3ALNA 3QL8A 4AZVA 2W9ZB 3BU6A 2W1GA 4IB5A 4WG4A 4FKUA 4A9YA 1F5QA 5IF1A 4KRDA 4GJ2A 4DH7A 1P5EA 4PTGA 4PX6A 3S1HA 2OJIA 1QPEA 4LFIA 3PPKA 4P2KA 4WRSA 5K0XA 4WOVA 3Q2MA 1WBTA 3PSDA 3L1SA 2WGJA 1GNGA 4MXOA 4USDA 5CSHA 5AAFA 3RK5A 5AR8A 4EBWA 4EH3A 1TKIA 3R8LA 1XO2B 4FV3A 2PY3A 2XIKA 3QYZA 4YPSA 3PA3A 4FEQA 2WZJA 3PWDA 5EK7A 2XP2A 1MQ4A 3G51A 3EN4A 3HV5A 4JJRA 4DEHA 2VU3A 4YZCA 1E9HA 5ANEA 3HDMA 3COIA 4I6QA 2ERZE 1YDTE 4RJ8A 4FIHA 4U5JA 4HCVA 3AC8A 3OEZA 3WZJA 4JAJA 1LPUA 5FQDC 5JZNA 4UMRA 3TEIA 2WTDA 4FZ7A 4KSPA 4M12A 5BX0A 4FZ6A 3KCKA 4OTWA 4DFZE 4HVIA 1UWJA 2JDTA 2C3JA 3OWLA 2GNLA 2UW9A 3Q4UA 5FG8A 4D2PA 2B1PA 4QMQA 1JKLA 4IJPA 2R3IA 4YJTA 1W82A 5DH3A 3MA6A 4ZTMA 5DT3A 4YO4A 1ZWSA 3WYXA 4NEUA 4YJPA 3NUNA 5FBOA 3HMMA 4E6DA 2IZRA 1PXIA 3AD4A 5C1QB 3DOGA 3FI3A 2B54A 3ZEPA 4JQEA 1GZKA 2J7TA 4A9RA 2G1TA 3QD3A 4GFOA 4OBPA 3IGOA 3LFBA 3BLQA 4Y83A 3FE3A 3RAIA 3V8SA 3VS1A 1G5SA 3H30A 4B7TA 3FV8A 1KE6A 4FIJA 4YTHA 4CXAA 3WF6A 2B9FA 2R0UA 5FXQA 5EDQA 4OTGA 4BI1A 5JK3A 2B9IA 5HVKA 5HG7A 4CFVA 4CFFA 1U5QA 1H1PA 3COKA 4R7IA 3DA6A 4FODA 4YUQA 1OB3A 2NRYA 2B9JA 2UW3A 3MBLA 3K5VA 2V7OA 2IZTA 1H26A 3E92A 3MY0A 3UNKA 1U59A 2EXMA 4JS8A 4CV8A 3S3IA 1L3RE 4B8MA 3HGKA 5CEMA 4HVGA 5J9LA 1V0OA 3R73A 2R3PA 3EN5A 4AZSA 4HZRA 4EZ5A 3QQLA 3TZMA 3PTGA 4YZBA 2R3GA 4ZY6A 3A7JA 4BDCA 3FZPA 4MTAA 3BKBA 1Q3DA 3PVUA 3D0EA 1UA2A 4CLJA 5HIDA 2O8YA 2WMVA 1PMNA 4LMUA 2J5FA 1WVXA 2OIQA 3CJGA 4U80A 2PUUA 5JGAA 2W1HA 2OJGA 4AZTA 5KZIA 2V62A 3IPHA 5KMLA 4M14A 4YJVA 4ANLA 4ENXA 2XM8A 3SQQA 5DR9A 4EHZA 1H1WA 3HEGA 5CYIA 3NX8A 4C4GA 4FKRA 5I9YA 2UZTA 5L2QA 1URCA 4C2VA 2BDFA 5CAPA 3DV3A 2XVDA 5CY3A 3KN6A 4ZY4A 2C6EA 1RDQE 1ZAOA 4J8NA 5HI2A 4BDBA 4O96A 5HNIX 4UB7A 5KMJA 4QTCA 4YC3A 2ZDTA 4MF0A 5D10A 4C36A 5FXRA 1FQ1B 3K3JA 4RX5A 3UGCA 3ALOA 3AMBA 4L7SA 3OXZA 4QPSA 1I44A 3VW8A 2C68A 2X8DA 3F5XA 3ZBFA 2YITA 2C0OA 2R3MA 2REIA 2E9UA 5TT7A 3Q96A 3LCTA 4FNZA 2QURA 1H01A 4F1OA 3HNGA 4UY9A 4KAOA 4FIEA 5CQUA 4AOTA 2ZM3A 1YXSA 2C3LA 1H1SA 4O4FA 4IQ6A 5HCZA 2UZOA 2B9HA 5EHLA 3HRCA 3V04A 3TUBA 4FR4A 1ERKA 2WTIA 4NJ3A 3ZDIA 5K5NA 4DGOA 2QI8A 3NWWA 5M53A 4NK9A 3TG1A 5L6OA 3CEKA 4FA2A 3IS5A 5ETCA 3TACA 3WZKA 4EBVA 2CLQA 3QTRA 4LRKA 4Y5QA 2WQBA 1YWVA 2YFXA 2H8HA 4CZUA 5BMMA 1Y6BA 1APME 1O6YA 1A9UA 3V51A 4BCJA 4F4PA 5E91A 1Y57A 5EYKA 3BHYA 4USEA 4PDPA 3BCEA 4L9IA 3MS9A 3DQXA 4DH3A 1RE8A 3O0GA 3G5DA 2CCIA 4AW0A 4EUUA 4E3CA 2O64A 3BV2A 5DVRA 5HO8A 5IUIA 2NRUA 4USFA 3KXZA 2YDKA 2BRNA 4D4YA 5EDRA 3DJ7A 3WE8A 5EDPA 4BL1A 4CEGA 4OBQA 1V1KA 4UMPA 5ANOA 3EFJA 3KF7A 4BDDA 5KHWA 4E4XA 4W9XA 4J71A 2WNTA 5K9IA 2OGVA 5HTBA 4HGEA 3E93A 3UBDA 4EOQA 2WELA 2JLDA 3QCYA 4OAUC 2W1EA 3R8MA 4UWYA 3ULIA 3F3VA 4FVPA 3TWJA 3FQHA 3VUGA 4TL0A 2FSOX 5LVLA 3CIKA 1BI7A 3R30A 3QGYA 3QTQA 4RQKA 3RK7A 3RPYA 3MPTA 2IW8A 3M1SA 2WQEA 3ZH8A 4NH1A 3R02A 5FD2A 4OLIA 4D1ZA 4UMTA 3VWAA 3UIMA 5L2TA 3E8NA 4EYJA 5IUHA 2W4JA 5CU4A 2UZLA 5AP6A 5HLNA 5AUVA 1YDSE 2P2HA 5CVFA 3RHXA 5A14A 1O9UA 4U97A 5HICA 2YACA 3ET7A 3GCVA 4KINA 2Y4IC 4L01A 4FRFA 4YLLA 3D5WA 4JOAA 3G90X 5CTPA 5ETFA 3ZFXA 4HYIA 4GSBA 5JEBA 3GI3A 1JOWB 2VZ6A 5H8GA 4NT4A 5HBEA 4O21A 4HVSA 4G17A 3LFQA 3AC4A 3IECA 4EUTA 4PMSA 4K9YA 1EH4A 2W1ZA 4PMMA 4CVAA 2CKEA 4KRCA 4N6YA 5HVJA 5A6OA 5E8YA 4RIWB 2VTNA 3D15A 4O38A 2J9MA 1R78A 2VX1A 3EB0A 3SKCA 5GJFA 2ZV7A 3GEQA 3LFSA 5B2MA 2Q0BA 2G01A 3ROCA 4FTRA 1CKPA 4YJSA 2PVKA 3DTWA 2YIYA 1M7NA 3BBWA 2QR8A 3CY2A 4HPUE 2C6KA 4XG9A 2O3PA 2O65A 3UVPA 3VUHA 1H0WA 3PXRA 4U0IA 3HP5A 5JGBA 4EOPA 3FLSA 3FMDA 4F7SA 2XNPA 5KE0A 1W98A 3DZOA 4QMSA 3UMWA 3BEAA 3VW6A 5ICPA 4B8LA 1JSVA 3SC1A 5DLSA 4C58A 4D2WA 4BDHA 5BYYA 4JLCA 4MQ2A 5HKMA 5CF8A 5IG1A 3QFVA 1J1CA 5EKOA 5LVPA 3WF8A 3IK3A 3O96A 1YXTA 3TKIA 3PPJA 3D7TA 3G33A 3L9PA 2XJ2A 5HIEA 4G3DA 2XMYA 3AGMA 1BKXA 1Z5MA 2Y6MA 3PRFA 3QGWA 3NYNA 2C47A 1OL7A 3MH2A 5J9ZA 2W0JA 3I1AA 4JVGA 3I4BA 4EOIA 3UO6A 3COHA 4FTOA 3OW3A 3L9MA 4LL0A 3I6WA 2WOUA 3BLRA 3KF4A 2BTRA 5EM6A 2XA4A 3V6RA 1V0PA 5KX8A 3IKAA 3AT3A 1DAYA 1Q99A 4GL9A 1XH8A 2F7XE 2VX3A 3HUBA 1YRPA 4QMLA 4ALVA 3WIGA 4AWIA 3R7UA 1OPJA 3E8CA 5AIRA 5H8BA 3TNWA 4J7BA 1ZYJA 4FTKA 3LCOA 4JBOA 4PMPA 3RGFA 2EB3A 4JR3A 1OL1A 2YIXA 4MXZA 1Q8YA 3GNIB 1IR3A 2PMIA 5CSXA 4O0UA 2J0JA 4I5HA 1ZYDA 3C4XA 5K5XA 2OICA 2P2IA 2W4OA 3ZOSA 4L8MA 1KE9A 4AG8A 4UX9A 3RNIA 2VWVA 3AC5A 4J8MA 4ZTNA 3HV6A 3WF9A 1IG1A 5CS6A 3UZTA 3NEWA 4O91A 1KE5A 3WE4A 4BKYA 4YC6A 3EQDA 4FUYA 4F9BA 4Y73A 3EFKA 2R3NA 2W06A 3GC0A 3LFAA 3NNXA 3U51A 4NTSA 4AZEA 5L2SA 3U6HA 3DAEA 3VRZA 1M7QA 3FLZA 1Q97A 1T46A 3MIYA 3PG1A 1TQPA 2ITYA 3P9JA 5F1ZA 2UW7A 2PZIA 2GNIA 4FIGA 5AX9A 4MXYA 4C0TA 1ZY4A 3KB7A 1IEPA 5FEQA 2YERA 2ETKA 3P23A 5D11A 4UMUA 3L8PA 3NGAA 3MW1A 2B7AA 2BRBA 3FZSA 1MRUA 1HOWA 2RFDA 4I92A 5CWZA 5IH4A 3UOLA 3C4EA 1WBOA 3ZSIA 4IFCA 5HU3A 2OKRA 1STCE 3GT8A 4L43A 5DRBA 2RKUA 2Y4IB 4CYJA 5AR4A 3FLNC 5EI8A 5CXZA 2VWUA 2ITZA 1G3NA 4U45A 4X6RA 1ZOEA 1UU7A 4RZVA 3MFUA 2C3IB 3OHTA 4WBOA 4R3RA 2I6LA 4YC8A 3BQRA 2WMWA 4M67A 3VN9A 4HJOA 4QRCA 3RWPA 4A9TA 5HD7A 4FKOA 3MB6A 4HYHA 4XS2A 4JIKA 5AV0A 5FP5A 3TN8A 4CCBA 4DFNA 4FBXA 3OXTA 3V5JA 2XKFA 3FPQA 2WMUA 1MRVA 3D5XA 3NIEA 1TQIA 2C1BA 1B38A 3F69A 3PY3A 4GFMA 4WG5A 4K11A 5T3QA 5KBRA 1Q41A 2C6MA 3KN5A 3HZTA 3R28A 4AGCA 5K4JA 2X6DA 2W9FB 3MSSA 4WRGA 3PP0A 3TNQB 1H24A 4N6ZA 4C3FA 5HO7A 3TIYA 5CZIA 4P5QA 3FY0A 3TKHA 3GU6A 2H6DA 3C0HA 3LCDA 2X7GA 3R2YA 4B9DA 4FTCA 2YZAA 4ANSA 4PP9A 2FSTX 5DT0A 3BX5A 2X4ZA 3TZ9A 2PE2A 3FQEA 2G2IA 3HV4A 1SVGA 3RWQA 4DCEA 2UZNA 2HZ0A 1BL7A 3EH9A 4L53A 5J79A 2QKWB 3JVSA 2AYPA 5HIBA 3P4KA 5JFSA 4FK3A 5HX8A 4XCUA 2BAQA 5DGZA 3OY1A 3P1AA 4ITHA 3EQBA 4IAKA 4YHTA 4IAYA 2P33A 3BGZA 2J4ZA 3R9OA 4RWKA 4JG7A 4M0ZA 4BBEA 2IN6A 2GTMA 1R3CA 1FGIA 1PXPA 4DH5A 1WBVA 5E8TA 4BWKA 4QP3A 4WT6A 3RHKA 2ZV2A 3V3VA 3VUKA 4HNIA 2XRUA 4W8EA 2E9NA 4U7ZA 3SXSA 4OTIA 4QMUA 4QTBA 5J95A 2H34A 4EL9A 2NPQA 1U46A 2C5OA 3GU7A 3PP1A 3WI6A 3PWYA 4MD7E 5AM7A 2VGPA 1B39A 3GC8A 5D7AA 5DPVA 2GCDA 2YISA 1GJOA 3CQWA 3KFAA 4FSWA 3O23A 3F3TA 3UOKA 2YLEA 4BC6A 4P4CA 2Z7QA 3C7QA 3ZLXA 2ZB0A 3OEFX 4W8DA 4AZFA 1IASA 4QMTA 4WO5A 4MNEB 3S95A 5EKNA 3TNHA 3HV3A 3L8SA 4I0SA 2WQNA 3HMNA 2VTLA 2IVSA 3QHRA 2QOFA 2XZSA 3RPVA 2VTMA 3FHIA 2JDSA 3QC9A 4C37A 4EI4A 3ZSGA 4MEDA 4CV9A 5CEKA 4MXAA 3BHHA 1XHAA 4QP8A 4YBJA 3UDBA 4BHNA 1U54B 2QO9A 4H3QA 4TPTA 4GRBA 1REJA 3W2QA 4OT6A 2OF2A 2XM9A 3CR0A 4C59A 3QZGA 5L8JA 2Y0AA 3CKWA 3EFWA 4AGUA 3QA8A 3GQLA 4IC7A 2HW7A 4XG4A 4IM2A 3RAHA 2ONLC 3LJ2A 1XKKA 4XNEA 3UYSA 3P7AA 4TTHB 2A4LA 3ORZA 3P86A 1JBPE 4IE9A 2YM6A 1PMVA 4Y46A 3WZDA 4FKSA 3FMLA 4Q5EA 2F9GA 4WG3A 2JIIA 4PMTA 5HTCA 5CENA 2QHMA 2EB2A 3DB6A 3R1SA 5DFPA 3QKMA 3DK3A 3O50A 4PL3A 2FGIA 3FL4A 4FZAB 4YJRA 3VBWA 1ZMUA 3SOAA 4EHGA 5IA1A 2LGCA 5M57A 1UU3A 1CKJA 3MH1A 3PA5A 2PMOX 5HVYA 2PE1A 3UIBA 4X7QA 4PV0A 4C3PA 1QL6A 1CTPE 1K2PA 2BDWA 4J99A 2OH4A 5EW8A 1WVWA 2OH0E 5DR6A 3V5QA 2PZ5A 2WQOA 1LP4A 4EYMA 5J5SA 5KKRC 2IVUA 2PVFA 2B52A 2Q0NA 5I9ZA 1NY3A 1NVSA 2E9PA 4K1BA 4D58A 5I9XA 3ZC6A 4MH7A 4BGGA 1R1WA 2UZVA 2QO2A 3EOCA 1XH4A 3OBJA 4A07A 4BZOA 3BZ3A 3GUBA 3MIAA 4CKJA 3FLWA 3LVPA 3QQHA 4DEEA 3JY0A 4OT5A 5JRSA 3MVLA 2VX0A 3C4ZA 3D7ZA 1XH6A 1M2PA 3DKOA 3IG7A 1YWRA 4IWOA 4K2RA 4BBFA 4YU2A 4JNWA 2WU7A 2QC6A 4IVBA 4YTCA 3KGAA 2CMWA 2GS7A 5JT2A 5ANDA 4BGQA 1ZYCA 3VUMA 4KB8A 2CJMA 1JKTA 4BDGA 4EZ7A 1YQJA 4M69B 2FVDA 4F65A 5ITAA 3GC9A 4RWJA 2GFSA 3QTZA 4FT9A 4MNFA 5HLWA 5D1JA 3ZC5A 2GNGA 4QP9A 2IZUA 4UN0C 4X6QC 1H27A 1OKVA 2C3KA 3PXFA 4ZTSA 1PKDA 1OKYA 4V0GB 5AIKA 3S4QA 1OECA 4KD1A 3G9LX 5LWNA 3VIDA 3ORKA 1PXLA 3MTLA 3T3VA 2WMQA 3EKKA 3O8PA 3LXLA 3QD2B 2BIYA 3NUPA 2RG5A 3QRKA 3WARA 5CAOA 4X3FB 4BKZA 4R8QA 3NUSA 5AR5A 3CXWA 3U87A 5HZNA 5L2IA 4BBMA 4QP6A 1GIHA 1OL5A 2OSCA 4YLJA 3ZTXA 3PJ3A 3UP2A 3ZO3A 2X9FA 1GAGA 1VYWA 3EQHA 3QUDA 4OW8A 1K9AA 2R3FA 4M0YA 1H1QA 5I3OA 4LOPA 4CRLA 4MK0A 4PTCA 4MQ1A 3JPVA 2VAGA 1OUKA 4RJ5A 4O6EA 3BWJA 4NFNA 5FXSA 4L6QA 4FG7A 3QF9A 2R7BA 4QMNA 1O6LA 1Q4LA 4QMYA 3AQVA 3SRVA 3A4OX 3Q9ZA 4O27B 5AM6A 2CN5A 2F49A 2WIPA 4BTMA 5HEZA 3FJQE 2G2FA 2Y7JA 3PVWA 3QTSA 3CP9A 4FTLA 5DEYA 4QOXA 4C61A 3RAWA 4EH4A 3CQUA 4I94A 3CTQA 3V8WA 4IH8A 4M84A 2VTOA 2QU5A 3PXZA 3OT8A 3CD3A 5BUIA 2BR1A 3NAYA 5DRDA 2X0GA 4NIFA 3FPMA 4YMJA 4LI5A 3CTJA 3OUNB 3KMUA 4C4IA 3W2CA 4EWHA 3EMGA 5LCKA 4IAIA 4ASEA 3UE4A 1BYGA 3FC2A 5CAVA 4MKCA 3KRRA 1CKIA 4G31A 3ZS5A 4WNKA 4XP0A 1O6KA 4FSTA 1Q3WA 3H9FA 5KCVA 4KIQA 4LRMA 2OF4A 3VS2A 4BCMA 4XOZA 5GJGA 2XJ1A 3FYJX 4I1ZA 4V05A 4AW5A 2XNBA 4CNHA 3JVRA 5CSVA 5B2KA 2R3HA 2ZM4A 2BHEA 3UG2A 4RIYA 3L9LA 2C30A 2WAJA 2WO6A 5K3YA 3U4WA 2C4GA 2DUVA 4XEYA 4KIKB 5FDPA 2FUMA 2V55A 2Y6OA 2Y8OA 2WQMA 3AOXA 5FEEA 2H96A 2VD5A 3HLLA 5ANIA 3JUHA 4O0WA 1Q8ZA 5AUZA 3ZO1A 2XNMA 1PMEA 2ZB1A 3UIXA 1H25A 4L3PA 4U8ZA 1IRKA 3DPKA 4FV6A 5AA8A 5M4UA 2VNYA 3C4FA 5C8MA 4A4XA 4XP2A 1ZMVA 1M17A 3DKGA 3DLZA 4IVCA 4ASDA 4HGTA 5E7RA 3LXNA 4JL9A 2JEDA 5HHWA 4IX6A 3UO5A 3IW7A 4JX7A 4ZSGA 3U4UA 2JAVA 3TUCA 3LQ8A 4TN6A 1H4LA 5HBHA 3C0GA 3ANQA 4RIXB 3IW5A 4ANOA 3CC6A 2OI4X 3OY3A 5CAQA 1AQ1A 4P90A 3D5VA 4I4EA 3R1YA 2OW3A 4J52A 4A4LA 3CQEA 3LQ5A 2Z7SA 3WZEA 2J0IA 4DTKA 4EQCA 3P79A 4U3YA 4F08A 5KMKA 1UWHA 2QOIA 4FNXA 1F3MC 3R00A 2CGUA 3FL5A 3I0QA 3RPRA 4FNYA 3ZRMA 5HD4A 3GU5A 1M52A 4O22A 5KMMA 3RJCA 5JFXA 3UO4A 3ORNA 2BILB 4S34A 5IMXA 1XJDA 4XG8A 2R3RA 1YXUA 4QO9A 1KSWA 1W7HA 4EH9A 3W2SA 4M97A 3ZFYA 3KMWA 4X2NA 3LFNA 1W84A 1YI3A 4GU9A 1W0XC 2R3QA 5FWKK 3A7FA 2HENA 5L4QA 4YNEA 4QMMA 2R7IA 1PXJA 5D7VA 4MBIA 5CEOA 4YSMA 4FYOA 5DI1A 3GENA 2X8IA 3KU2A 3SD0A 3E3PA 5CZHA 4XJ0A 4EOSA 4LYNA 5CALA 3DDQA 2OJJA 2YIRA 2G15A 2YAKA 3DDPA 4BCPA 3ZFMA 4FKGA 5HE0A 1MP8A 3FMNA 3NNWA 4PNKA 5K4IA 3MPMA 4UZHA 4IJ9A 4IFGA 3OS3A 3I60A 5AP1A 4CFUA 2W96B 3EQFA 5HOAA 4DLIA 5HG9A 3NR9A 4NZWB 5CXHA 2QODA 1WZYA 5CF5A 2X81A 5M55A 3DQWA 3W8QA 4TWOA 3KCFA 4XV2A 3UNJA 2EWAA 2X7OA 1E1VA 3PYYA 5DHJA 4BDFA 1JKSA 3EYHA 1YDRE 3BHTA 2FYSA 4IANA 5CVHA 3OROA 4G1WA 4R5YA 4ZJJA 4J97A 3PJCA 4JBQA 4M7IA 2A27A 2LAVA 3KXHA 5F95A 4IHPA 1F0QA 2IJMA 4EH8A 3HMOA 1WCCA 4EK6A 3T9TA 4AAAA 4WA9A 1XBBA 3EIDA 4FT5A 2BCJA 3H3CA 2I0YA 4OTDA 4EH7A 3BE9A 3CKXA 4RWLA 1QMZA 4YZNA 1Z57A 2ITNA 2JKKA 4QTAA 4QMVA 5DT4A 3B2WA 4F9AA 4C2WA 3KVWA 3GBZA 3VJOA 4MWIA 3S0OA 3AMAA 4M15A 5CVGA 3PSCA 4DEBA 3RI1A 5I0BA 3E5AA 5CANA 1XBAA 4JRNA 4L3LA 3DBDA 3A62A 4I5CA 4LMNA 3WIKA 4X0MA 4ZTRA 2WKMA 3R7YA 3PXYA 3EJ1A 1XQZA 2YEXA 2E2BA 3HRFA 4N70A 4RVLA 5FM3A 3V8TA 2XIXA 4F7LA 5H9BA 3QRUA 2CSNA 2VTRA 4FT7A 3VF9A 5C8KA 5DN3A 2C0IA 5LCJA 1YOMA 2KTYA 2XUUA 4S30A 5AX3A 4ZY5A 4YZDA 3W33A 4OAVB 4XX9A 1OM1A 3D2KA 1PF8A 5JN2A 4PF4A 2XIYA 4Q9ZA 1OVEA 4BCOA 4C33A 4JQ8A 4FIIA 2QO7A 2WMAA 2GS2A 5DG5A 4QMPA 4GU6A 4L44A 3RBWA 1Q24A 3I0OA 4GW8A 1H00A 4Z55A 4WD5A 5F9EA 4ZLZA 4BCQA 5EG3A 4AUAA 5T68A 2AC5A 4EH5A 3OWJA 3R2BA 3WBLA 1GY3A 5JSMA 4NUSA 5LWMA 1SYKA 1PHKA 2XNNA 3BGPA 4PDOA 4FNWA 3VRYA 3TV4A 3R6XA 4MVFA 2XCKA 1S9JA 2WTCA 3DXNA 4KKGA 3ZLWA 4BICA 3PLSA 4I21A 4UALA 1KV2A 5D9HA 3FXWA 4NM3A 4JBPA 4BWPA 4CT2A 5HCYA 1JKKA 4FTNA 2JDVA 2VWYA 4C4FA 3OUKA 3BHUA 4I93A 5HE2A 5BPYA 3W8LA 2ERKA 2JKMA 1PXOA 2QG5A 4GMYA 4PPBA 1SMHA 2YCRA 4DFLA 2YDJA 3TNPC 3UQCA 3HECA 1OIYA 5JRQA 4FT3A 5AP5A 2QOBA 2XCHA 2VO6A 1M2QA 2HCKA 3KXNA 3FI4A 2F2CB 5HE3A 3U6JA 4ZS0A 3OD6X 2IVVA 1YI6A 4Q5HA 3W2OA 2CLXA 2ITVA 2HK5A 2JITA 1W2CA 1DI8A 4AOJA 4TNBA 5JZJA 2GQGA 2A19B 1QCFA 3JYAA 3KK8A 4FGBA 4QNAA 4RJ4A 4EOMA 4Z9LA 3FBVA 1PMUA 2QR7A 4TWCA 5LMBA 2I0HA 5LJJA 1YOJA 4CZYB 4NJDA 3CGOA 3R7VA 4B4LA 3OCTA 3VHKA 3IDPA 2GS6A 3LE6A 3ZYAA 4FMQA 3OP5A 4Z16A 2P3GX 4I5PA 3WILA 3W18A 4QT1A 4DGMA 1ZYSA 3R21A 5C9CA 4ZLOA 3B2TA 3KULB 1H1RA 2A0CX 3W16A 5I5ZA 4OGRA 4TRLA 3D94A 2W1DA 4ID7A 4MNEA 3PPZA 1LUFA 1ZMWA 2YIWA 3OCBA 3QRJA 2VO0A 3D4QA 3QQKA 3VS0A 3IOPA 3QLFA 5ANKA 3KA0A 4TXCA 3ERKA 3RZFA 2XNOA 4FC0A 3BRBA 1R0PA 3CPBA 5EI6A 2QOKA 3TZ7A 4C4JA 2XEZA 4IX5A 2WMXA 2WMSA 1KOBA 2C5YA 5E8ZA 2YM8A 3CGFA 3PFQA 3P0MA 4R5SA 4BHZA 3T3UA 2JBOA 2O63A 4A06A 4F70A 2XKDA 3F3ZA 4F0GA 1FVRA 3H0ZA 1VJYA 3JXWA 5CI7A 2WU6A 1IA8A 4ZSAA 3D5UA 5CEPA 3LLTA 2AUHA 2PL0A 5IKWA 3E63A 4XUFA 4AQCA 4EK8A 3CJFA 3Q53A 1Z9XA 3EN9A 5ETIA 4D9UA 1ZXEA 2HZ4A 1RQQA 2YIQA 4J96A 4UWCA 4MHAA 4K33A 3G0FA 4M66A 2R3OA 3VBXA 4E6QA 3F5GA 1CM8A 2BAJA 2PVYA 4HVHA 1W8CA 4QMWA 5TE0A 1UKIA 1JSUA 4H1MA 4UBAA 3LFFA 5FBNC 5DEWA 1WMKA 3R83A 2OWBA 3OG7A 4BTFA 5E8UA 2RL5A 3LZBA 5AV3A 4C34A 4M68A 1UKHA 4FSQA 2GNHA 5AV2A 1W2DA 2Z60A 4H3BA 4RX7A 4F09A 4KABA 4A7CA 4BIDA 3R7GA 2XJ0A 4RMZA 2VGOA 3QXPA 4YZMA 4ERWA 4OR5A 3HV7A 2HZIA 4YJUA 1YXXA 3BGQA 4C7TA 3OC1A 5AWMA 4E93A 4DH1A 5M4FA 5AUWA 3SLSA 3LFEA 3UZPA 3E8EA 4IX4A 4W4VA 1FPUA 3ODZX 2J0MB 3Q32A 4RGJA 3AC2A 4ZSJA 1SZMA 4DG0E 1H07A 2BZKB 2GDOA 5J5TA 3DBEA 2YM3A 3HUCA 5E1SA 2CHLA 4F9YA 4YURA 4S31A 2ITPA 3IW6A 1H8FA 3LOKA 3PIYA 3DS6A 3H9OA 2UVYA 3H4JA 5AV1A 4BB4A 2AQXA 4IDTA 4IVAA 5AMNA 3TXOA 4Z7HA 5A6NA 2C6OA 5I9UA 1FOTA 5EM8A 3V5LA 4EK4A 1M14A 1T45A 4HVDA 3F3UA 1Q8WA 5E92A 3TL8A 3V5TA 3F5UA 3QLGA 4IAFA 4BKJA 3CE3A 4C35A 4FUXA 2VRXA 3HL7A 3F2NA 4QQJA 2OU7A 3KL8A 4YTIA 1K3AA 2FSMX 4NSTA 3A8WA 1AD5A 2Z7LA 5E8VA 4V0GA 2QOQA 5L6PA 1MRYA 3T8OA 3UPXA 3PXKA 4GK3A 3C9WA 3DBQA 4E5WA 5HU9A 3Q4ZA 4LUDA 3BELA 1FMOE 2UW4A 3TT0A 1JLUE 3F61A 5DA3A 5I9WA 3AC3A 1ZZLA 1H0VA 2JIVA 2PWLA 3EN6A 4QPMA 4R3PA 4BFMA 3AGLA 1LR4A 4CKIA 5A4CA 3QA0A 3UTOA 3ULZA 4A9UA 1JNKA 5LMAA 4H3PA 2WXVA 3QUPA 5KZ0A 2JFLA 2PZPA 2UV2A 4XG6A 1GIJA 1GIIA 3O8UA 3ORTA 1UNGA 1P4OA 3IGGA 4IACA 4IDVA 4EC9A 3AT2A 2W99B 3ZDUA 2X0PA 4ITIA 3NRMA 4IB3A 2CGWA 3G6GA 3OFMA 3Q6WA 4BTJA 2J50A 1DM2A 3ORMA 3QTIA 4TT7A 4IZYA 1TZDA 3NAXA 4FKIA 2PMLX 4YTFA 3GVUA 4RJ6A 4TWPA 2ONLA 2FO0A 4BZDA 3QTWA 4QQ5A 2YLFA 3VS4A 2IVTA 1OL6A 3GP0A 2X2MA 4L7FA 4AOIA 1RJBA 4UZDA 5GZ8A 3LFDA 3ORPA 4GEOA 2VV9A 5CSWA 4FTAA 1YHWA 5J1VA 2YA9A 4F6UA 2Y4PA 2A1AB 3LHJA 5IEYA 4AU8A 4QYYA 5E8WA 2XYUA 4TW9A 5BNJA 5DOSA 4D4SA 4FTJA 3AD5A 4ACGA 3QWJA 3R71A 4E73A 4X2GA 3FZRA 3KXXA 4FL3A 4CMTA 4LL5A 2XIZA 5AV4A 1VEBA 4RVMA 3PIXA 5IMEA 3GGFA 3NCZA 4FV4A 2RF9A 4I6BA 4FZFB 2OBJA 2VUWA 1VR2A 2J2IB 4X21A 5J7HA 1XH7A 3UC4A 3RKBA 2R3KA 3WYYA 4G34A 3SXRA 3ZMMA 5IA3A 5ACBC 3E7VA 4APCA 1REKA 4D9TA 4Q9SA 5JQ5A 2WHBA 4IM0A 3SAYA 4ZJVA 3PA4A 1J91A 4FSYA 5EFQA