5GZ8A

Crystal structure of catalytic domain of protein o-mannosyl kinase in ligand-free form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
284
structure length
272
Chain Sequence
CPPGYFRMGRMRQCSRWLSCEELRTEVRQLKRVGKRVFLSEWKEHKVALSRLTRLEMKEDFLHGLQMLKSLQSEHVVTLVGYCEEDGTILTEYHPLGSLSNLEETLQQDVNTWQHRLQLAMEYVSIINYLHHSPLGTRVMCDSNDLPKTLSQYLLTSNFSIVANDLDALPLVDVLIKCGHRELHGDFVAPEQLWPYGEDTPFQDDLMPSYNEKVDIWKIPDVSSFLLGHVEGSDMVRFHLFDIHKACKSQIPAERPTAQNVLDAYQRVFHSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein O-mannose kinase
publication title 3D structural analysis of protein O-mannosyl kinase, POMK, a causative gene product of dystroglycanopathy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 78
structure length 272
sequence length 284
ec nomenclature ec 2.7.1.183: Glycoprotein-mannosyl O(6)-kinase.
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gz8A00
2YWPA 2GTNA 1GZNA 3ZO2A 1ZZLA 1UU7A 5DLSA 3GVUA 3T8OA 2V7AA 5CTPA 5KE0A 4RX9A 4BWPA 1KOAA 5CZHA 2C6MA 1VEBA 3VULA 3AD5A 2XIZA 2C6LA 5IU2A 1FVVA 2IVSA 2PZYA 2WEVA 2WO6A 3C1XA 1U54A 3DPKA 3HX4A 4HNIA 1W82A 2RIOA 3MFUA 2X4ZA 4U5JA 4S30A 3U4WA 2P55A 2ERKA 1CM8A 3R7EA 4FZDB 3HDMA 3PY0A 4BYIA 3KCKA 4BDHA 3HMIA 4QTCA 4EH9A 4BRXA 2YM7A 4AW0A 5CSHA 4MTAA 2C5VA 2JIIA 4RX5A 3COHA 4EOQA 2OJFE 2A2AA 3PRFA 4XP2A 4RX8A 3ZSGA 3QLGA 4NCTC 4QT1A 3NIEA 3G0EA 2WU6A 4RLKA 5LQFA 4FOCA 2QR7A 1E9HA 2C3IB 4RWJA 3UOKA 2EXMA 2GPHA 2QOFA 2VTTA 4FTNA 3VS2A 1WBPA 2JDRA 3ALOA 1T46A 4QYHA 3SRVB 3V01A 4YPDA 2CKEA 2SRCA 3OEFX 3W16A 3A7IA 4BCHA 3COKA 4USDA 4E8AA 4F9YA 4WG3A 4ACDA 4BF2A 3EQIA 1ZYLA 3KN6A 4FMQA 3CC6A 4KKHA 5I9UA 5HIEA 1Q8ZA 3BLHA 4BI0A 5TF9A 2GS6A 3ACKA 2JKKA 2ZMCA 4RIYA 3TZMA 1DI9A 3P4KA 1MRYA 2QHMA 3FPQA 3FLYA 4JG8A 3I79A 5FWKK 3GFWA 4FODA 1QCFA 3ORXA 3DAJA 1XR1A 4FG9A 4CTCA 4TL0A 3DAEA 1OIUA 2UZOA 2I1MA 3L9NA 2BZKB 1WBWA 3R2YA 5H9BA 4L6QA 2PSQA 5HORA 2XNNA 3TTJA 4GU6A 2FSTX 3FDNA 3MI9A 3DXNA 2JGZA 4MX9A 4PMPA 4QMMA 2ONLC 4FL2A 2VGOA 1UU9A 2XNMA 4KB8A 3UC3A 4FR4A 4EZ5A 3D7TA 3SXRA 4HGEA 3M11A 3FLSA 4R5SA 3CIKA 4NJ3A 5DT3A 4BIDA 4FV8A 5AM6A 4IX4A 3ELJA 4AS0A 5IA4A 3Q9WA 2IZRA 4CCUA 2IW8A 1ZLTA 2BAQA 3I6UA 3PXQA 3KXMA 2ITTA 5HIDA 4AE9A 4DEAA 2I40A 2IVTA 4M67A 3EZRA 2F9GA 1RW8A 4RGJA 4R1VA 3OTVA 2AYPA 3LFNA 5EM5A 3VS0A 3ZU7A 5LMKC 4KSPA 4WSQA 4RZVA 5L8KA 2E9VA 2ITNA 2ITPA 4MEDA 3TI1A 3AGLA 3PIYA 5IKWA 4AF3A 4DG2E 4H1MA 3BBTB 2JAMA 1UV5A 4NM0A 3R7OA 2J0JA 1JBPE 4FIIA 1HCKA 3W2SA 4NFMA 2WQEA 1YVJA 3P5KA 4I21A 3C51A 3OCBA 4KIKA 2C1AA 2WB8A 3SA0A 2DUVA 1FVTA 4BZDA 2XNPA 3B2TA 4GYIA 2PMOX 4PDPA 4YZBA 3O8TA 2VD5A 1GZ8A 1LPUA 2YEXA 3MA6A 1WBNA 3DLSA 4JBQA 2IVVA 2OF2A 2WMBA 3SXFA 3W33A 4L53A 4IAKA 2BR1A 1U5QA 5CEOA 3RWQA 1UU3A 3FMJA 4MD7E 3Q60A 3V6RA 1UVRA 5G6VA 4FKRA 5HU3A 3CY3A 2WZJA 2XKCA 4AU8A 3D15A 3DY7A 4UMUA 3G6GA 3GT8A 4YJQA 2UW6A 3C13A 4XMOA 5A14A 5LVOA 4QPSA 3IQ7A 5HLPA 2VX1A 2H96A 3DKCA 2BHHA 2UZVA 4EZ3A 3Q32A 4U40A 4EUUA 4K33A 5FGKA 2B7AA 4Q5HA 4E4NA 3F3WA 3QWJA 2X81A 2X7GA 5HTCA 3V5QA 5HGIA 4A9TA 5AUZA 2IW6A 1BI7A 3A61A 2FB8A 5ETAA 3UIBA 4YHJA 1Y91A 3PY3A 1ZYDA 4AT4A 2FSOX 3FQSA 4D2RA 4G16A 2YM5A 1OKZA 3BPRA 3OXZA 3QKLA 4FKSA 2H34A 3HECA 3HMOA 3KXNA 5CVGA 4IAAA 5KMLA 3A99A 4LGDA 3EFKA 3SW4A 3ETAA 5HHWA 2JKQA 2B9HA 5DN3A 1W83A 1RE8A 4OAVB 5H2UA 4DEHA 4EH7A 3R7YA 3ZO1A 5C1QB 1SNUA 2QO7A 4IVBA 3VBXA 3ORMA 2VZ6A 5DG5A 5CEKA 4FSMA 3ZMMA 4LQMA 3Q04A 4TWCA 2Z7SA 3NW5A 2YITA 3GNIB 3T3UA 2ZDUA 4BB4A 3QX4A 5E8ZA 2GHMA 4ID7A 3R1NA 4QP8A 5IMEA 3CQUA 1UKHA 4IH8A 1WVYA 3KU2A 3W55A 1YXSA 5EDRA 4X2NA 4FT3A 3C4WA 3TEIA 3UO5A 1YOMA 1F5QA 5HE3A 4AAAA 2I0HA 5CU3A 3I6WA 2PZPA 4AACA 3ZRMA 2BZHB 4G3GA 3R83A 3GP0A 3A62A 4UWBA 2X39A 4B8MA 2W06A 5EOBA 4FNWA 5CF5A 5GJFA 3TV6A 4I0TA 1YOLA 4M69A 3BQCA 5T6KA 2YM4A 4J98A 2W1IA 5AV1A 4X3FB 5ICPA 5JEBA 2C68A 3CE3A 4NT4A 3PPZA 4AZFA 4FZFB 3R8LA 4DTKA 4YNOA 4AA5A 4FZAB 2YCRA 3F9NA 3GCQA 3OOMA 1M17A 4EH6A 3DDPA 1IRKA 3VBTA 3AOXA 3OOGA 3F7ZA 4NSTA 3A60A 1PXLA 4YMJA 4O6LA 5M4IA 5HG7A 4O0SA 2IN6A 2UZUE 3OUKA 3P7CA 2PVHA 2VTPA 2J51A 2JFLA 4Y95A 4WOVA 1GIHA 5J9YA 4WIHA 3RPSA 2B9FA 4EHGA 1O9UA 2O3PA 2WTIA 1XKKA 4O0WA 4FT5A 4HPTE 4BDKA 3A7HA 4UN0C 3NAYA 3PXKA 2VNYA 4WA9A 4WBBB 3QLFA 2HK5A 4J95A 3H10A 2UW4A 4YTFA 3BKBA 4E6CA 3QYWA 3TJDA 3FZOA 2X7OA 3EHAA 5AV4A 4L46A 3MJ2A 2C69A 5EOLA 1ZY4A 2WQBA 2WMXA 3QUDA 3GC7A 4FX3A 4BTMA 3AT4A 3PP0A 5ACKA 4D4SA 3KN5A 3BEAA 2OICA 3QHWA 4PPBA 3TNHA 3C4XA 1R1WA 3E7VA 4IDTA 5KMKA 5DWRA 2ETMA 3GCUA 2QC6A 1TKIA 3AT2A 3CQEA 4U6RA 5AM7A 4PDOA 1R0PA 2EB2A 4N0SA 5TR6A 1YXVA 1O6YA 3NNWA 3UMXA 2AUHA 2QNJA 5J79A 1W8CA 4BCFA 4JQEA 1KOBA 2YM3A 3EQHA 4XBUA 5AP3A 2XIYA 4FKUA 4G5JA 3WARA 4C35A 3GENA 2ESMA 3QGWA 1JSTA 5J1VA 3EIDA 4YR8A 3P7AA 3EN5A 2J90A 3QD4A 5JMSA 4MF1A 2WNTA 5FTQA 1XBAA 2F7XE 2XJ2A 3SHEA 3P1AA 4C4IA 2R2PA 4PNKA 2G2HA 2RGPA 4BKZA 1SM2A 3S4QA 4MF0A 5CF4A 5DT0A 4I3ZA 4IAIA 1FGIA 3FLNC 4P90A 3IDPA 2WEIA 4RVKA 3TIYA 3EMGA 3KC3A 3QQHA 4ITHA 4AE6A 4RIWA 5E1SA 4F7LA 1M2QA 2YIWA 3ZUVA 4WSYA 4TYEA 3NUXA 1M7NA 5LOHA 4CV8A 3EZVA 4CEGA 4WNMA 4TXCA 1OKVA 4HPUE 3R73A 4YJPA 4E73A 4HVDA 5LCKA 3U6JA 3BLQA 4FK3A 4DH3A 3VF9A 3DU8A 4W4VA 2E9PA 2BMCA 3CP9A 2JITA 4TW9A 5M55A 2BROA 4U41A 5AUXA 4DITA 2OFVA 4ALVA 3BBWA 4GVAA 1W98A 1PW2A 3PIXA 3LFCA 3COIA 4FV5A 3E88A 4FSQA 2FYSA 4QP3A 3VRYA 5TE0A 5AR8A 4C02A 3H0ZA 5L6PA 4W8EA 4Q9SA 1NVRA 5HLWA 1PHKA 1XH8A 2WAJA 4J52A 4IVCA 5I3OA 4W4WA 5IUHA 3NCZA 4YJNA 1S9IA 4X3JA 5IF1A 4P7EA 2Y6OA 4X2KA 4FTAA 3QXOA 3EQBA 4YZCA 3EQPA 3HV4A 3IGOA 5IA5A 2ETRA 5FBOA 3MDYA 1H1RA 4XRJA 1YHVA 2EUFB 3F3UA 4MQ1A 5DGZA 4CQEA 4FNYA 4L68A 4AGCA 4YSMA 1OECA 3SRVA 4D55A 4TYIA 3E64A 4RVLA 1Y6AA 2RSVA 1M7QA 3AXWA 2JDTA 4FBXA 4FV3A 4RRVA 5EYDA 3FBVA 5EYKA 1REKA 2YJSA 3C0IA 1GZKA 3O23A 3PLSA 4IADA 4ZTSA 2W5HA 4ENYA 2ZV7A 2VTIA 3RINA 3KULA 3RAIA 2OZAA 3IOKA 3QKMA 3KXZA 3NYOA 4I5PA 4RMZA 2HYYA 4UMRA 4Q2AA 2FUMA 3BX5A 3NCGA 5CNNA 3ORZA 3NX8A 3CCNA 4YPSA 2R3RA 3DTWA 2H9VA 3UNZA 2OH0E 3UO6A 4EUTA 4AOTA 4BGHA 2V5QA 2V22A 4I6FA 4ACCA 3CD3A 1SVGA 1JVPP 1YRPA 2O63A 1VJYA 4FKLA 5FEEA 2YIYA 5M51A 4L3JA 4LMUA 3BHTA 4XUFA 1Y6BA 5F4NA 2GSFA 2WQMA 4D2WA 3HV6A 3SLSA 4YZNA 5L3AA 3COMA 4M15A 4CFWA 3U9CA 4KRCA 4H3BA 5DH3A 2RL5A 4QNAA 4XG9A 2R3IA 2WMSA 4XP0A 2B52A 4ANOA 4TY1A 2UW0A 3QL8A 4LI5A 5AX9A 1YW2A 5AEPA 4OTDA 1WZYA 4MXCA 3RTPA 1J1CA 3WZKA 4EH5A 3TUCA 3VHKA 2B4SB 3O7LB 2ZM3A 5CT0A 2V62A 5AUUA 4ZIMA 5BMMA 3K3JA 4DHFA 2WMTA 2R3NA 2WTWA 4L7FA 4JG6A 3OW4A 3NSZA 4CLIA 4F7SA 3CXWA 3CJGA 4ASDA 4FIHA 1JAMA 3BWJA 3OG7A 3DZQA 5JH6A 4Y85A 3AC4A 4FIFA 3WZEA 5KKRC 2YDKA 3ROYA 2HENA 3C4FA 2XBJA 4L45A 2BDFA 2YIQA 3QQLA 3CS9A 3MTFA 3EYHA 2PE1A 5JN2A 1B6CB 2QLUA 2VU3A 3G9LX 4F63A 3F5UA 1IA8A 2BKZA 5IA3A 4N6YA 5AAFA 4X2GA 4AP7A 4NCTA 2CHLA 1YXUA 2R3PA 1YXTA 3ALNA 5DFPA 4GRBA 5KBQA 3RPVA 4XYFA 3FZPA 1G5SA 3TWJA 3OMVA 4EBWA 3LAUA 3RKBA 4MBJA 4LRKA 3NYXA 3UJGA 3HUBA 4RVMA 4X6QC 5DR2A 4TT7A 3W8QA 5IH6A 4QQJA 2P2HA 2ITZA 3BU6A 3HDNA 4AOIA 2GHLA 2VX0A 1OKWA 4PMSA 2UVXA 3F7WA 3HRBA 5IH5A 3WOWA 2WQOA 4ZSJA 4G6LA 2RFSA 4ZJJA 3VQUA 3FQHA 4CMTA 4QP9A 2IWIA 3QYZA 3RJCA 2QKRA 3H9OA 2VNWA 3HRFA 2W5BA 3LXPA 5EM6A 4D4YA 3GC8A 1WVXA 3W18A 1H1SA 3FC2A 3LFQA 1RJBA 3WZDA 3ZEWA 3GCVA 2P3GX 2BALA 3LM0A 4TYJA 1H1QA 4J71A 2J2IB 3PXZA 3WYYA 4XLIA 3F66A 2GFCA 3OWLA 5DHJA 4DLJA 5IA1A 4DEDA 3Q52A 1PXJA 5JQ5A 3MVHA 4RIXB 3ENMA 4XX9A 4NM7A 4I41A 1JSVA 2YM8A 4EKKA 1Q8UA 1RDQE 4UB7A 4JI9A 1FMKA 4U9AA 4IM0A 3TNWA 5L6WL 4E93A 4F09A 2X8EA 4MYGA 2ZM4A 1BL7A 2ONLA 3VF8A 1GIIA 2YISA 2YN8A 3CTJA 4KINA 1KV2A 2BTSA 2XNOA 4W4YA 2VO6A 5BVOA 3V5JA 5HG5A 3EFWA 5DVRA 4OW8A 1DS5A 4Z16A 1J3HA 4BCPA 3V5LA 4IQ6A 1TQPA 4CD0A 2O64A 4ZTLA 5CU2A 4PTEA 4BIBA 4EH4A 2P2IA 2BCJA 3NRMA 3KRLA 1MQBA 4GG7A 5HTIA 4JR3A 5HCZA 4FC0A 4FV9A 4IMYA 5HEZA 5JZNA 2Z7LA 1NA7A 4JL9A 4UXQA 2BZJA 4HNFA 5LMKA 5D12A 3U87A 3ZDIA 5L2SA 1Q24A 4RJ5A 3NUSA 4FIGA 3UE4A 4ACHA 2XK3A 4CXAA 2VWYA 4Y5HA 4RC3A 3QZFA 4AZTA 2PE0A 3O50A 2UV2A 4EL9A 5K9IA 3BHUA 5BUIA 2JEDA 5BNJA 3SW7A 2OIDA 4NM3A 4KIPA 4RJ7A 4MXXA 2V0DA 4EK6A 2WPAA 4NJDA 3DNDA 5EG3A 5KZ0A 3R21A 2CGUA 4FYNA 2J9MA 4X7QA 5ANOA 3K2LA 4GH2A 2I0VA 3P7BA 4BL1A 4F1TA 2XMYA 4ALUA 3LOKA 5M4FA 4EOIA 2C47A 3ZM4A 4XLVA 3QA8A 5AMNA 2GNGA 4FT9A 4ZLYA 1TQMA 2W17A 2J0IA 4IACA 4IW0A 3UG2A 3ZLXA 2V55A 3A7GA 2VO0A 2WIPA 2XP2A 4RA4A 3U4UA 5C8NA 2QD9A 1YI3A 4QYEA 4ALWA 3D4QA 5EHOA 2PVMA 4A4LA 2W4OA 2C5YA 4WNOA 3HZTA 3HNGA 3PXYA 3I7BA 3BE2A 5ANIA 4QYGA 3QRKA 5ANEA 3ZRLA 4ITIA 4TNBA 3UQGA 4G9CA 2QKWB 4I6QA 3HEGA 4N4SA 1VR2A 2QHNA 2XNGA 5AR5A 4EORA 2Z7QA 3FLWA 4OBOA 3UIUA 4AZEA 2R3QA 3UGCA 1OB3A 3BHYA 4MQ2A 4GUBA 2YHVA 2HELA 4NM5A 4BHNA 4B7TA 1Q8YA 3E63A 4BIEA 3L1SA 5HE1A 4EK3A 3LCDA 4QQTA 5I9XA 4GU9A 5CXHA 3P78A 5F94A 5FBNC 4IZYA 3FWQA 3FYJX 4KBCA 2XK4A 2O8YA 4GIIA 3OF0A 4JJRA 4BKJA 4EHZA 4USFA 3MGYA 3FAAA 3Q5ZA 4CMUA 2W4KA 3K5VA 2C1BA 2ZB1A 3NPCA 5J5TA 2GNJA 3L8PA 3UVPA 3O17A 4ZSGA 4D2PA 1YWVA 2PL0A 3DJ6A 4FZ7A 4I4EA 4UALA 3DFAA 3W2PA 2BDWA 5B2KA 1MUOA 3UTOA 3VUKA 4L00A 4QMXA 3WE4A 2ZV9A 4LMNA 3PZHA 5EYMA 5JQ8A 5EW8A 2E9NA 4QO9A 3P79A 2HOGA 3VNTA 4BZOA 4C36A 2ZVAA 4I20A 4IWOA 1A9UA 2YLFA 3A2CA 2XA4A 3I7CA 5L6OA 3AQVA 5HNGA 2I0YA 3V51A 3FLZA 4KRDA 4DFNA 4M0ZA 4FL1A 4X2JA 3MH1A 1YXXA 3BYMA 5D10A 4H1JA 4NW6A 2WD1A 4BDBA 4F64A 4C59A 3PSBA 2XVDA 5HD4A 3TCPA 5EM8A 4BYJA 4FSTA 4ANMA 2UZBA 3PA5A 3MS9A 2E9UA 3R8VA 3QA0A 3VBWA 4JG7A 4R6VA 2YERA 3BYSA 2YIRA 5I9WA 2EU9A 2XK6A 1PJKA 3LCSA 4O0RA 1PXKA 4QPMA 4RVTA 4YZ9A 4XOYA 4YTIA 3VO3A 3ACJA 4EQMA 1KE9A 2H8HA 4OTIA 3PE1A 4JBOA 5JSMA 3S2PA 5A6NA 4C2WA 4AOJA 4QP1A 2FVDA 2QO2A 3QX2A 5HVYA 2GQGA 2R0UA 3JVSA 2W1HA 3UDBA 2J6MA 4GIHA 4J8NA 1OUKA 2OJGA 2HAKA 5F95A 3BYUA 1DM2A 4F4PA 5KMOA 4CQGA 3KB7A 4F65A 4JQ8A 2J50A 3C4CA 3UVRA 1R39A 3O8UA 2RFEA 3K54A 4D9UA 3THBA 2IVUA 4BGGA 2W9FB 5HKMA 4Z55A 4PL5A 4QMLA 3VBYA 2J0LA 1M14A 3UOLA 2Y4IB 3BYOA 2E2BA 4CCBA 3RM6A 5ANKA 3VAPA 3UZTA 1IG1A 5HOAA 4J7BA 4Q5EA 1ZMWA 3RZFA 2UZLA 4LG4A 3D2IA 4BKYA 3DBDA 3MWUA 4FSZA 4HW7A 4H3PA 1WBTA 2WMVA 4QMUA 4YO6A 4BFMA 1ZXEA 5L2IA 3LJ0A 3AMAA 2ITUA 5CAUA 3I0QA 3NUYA 2HXLA 4U44A 4QTDA 3WILA 3QTSA 4JVGA 1QL6A 3FI2A 2WQNA 5BUJA 3F5XA 1V1KA 1Q3WA 3ITZA 2RF9A 2XCHA 3DFCB 4J96A 4Y72A 4BBEA 1M2PA 5IEVA 2YIXA 3FHIA 4OBPA 4ZS0A 2BRHA 4F6SA 4TRLA 4CFVA 1SNXA 3A7JA 3DBEA 3FQEA 3VUMA 5FQDC 1Q3DA 5CQUA 2X6DA 4YHFA 4Z9LA 4I6BA 4IZAA 3ZOSA 3ZBXA 5B0XA 2GTMA 3PWDA 3NYVA 5E90A 4OLIA 3T3VA 5AUTA 2HIWA 4NW5A 4UWYA 3O51A 4Z7HA 2JDVA 3F5GA 2NRUA 3OCTA 4A7CA 3QQFA 1PXMA 3QRIA 4RFYA 4OTGA 5JFVA 2BHEA 4B8LA 3NWWA 4W4XA 5A4CA 5HO7A 5EI8A 4APCA 3ORIA 4XNEA 4YO4A 4OBQA 2JIVA 2BFYA 3G0FA 2FGIA 3VS1A 4HCVA 2C0IA 5LXMA 1Q41A 4QMSA 3F82A 3AGMA 3EN7A 3QD0A 3A8XA 2UUEA 4JX3A 4UYAA 4V0GB 5HIBA 3PSCA 5JRSA 2V7OA 3IO7A 2BIKB 3OWKA 2GFSA 4CFNA 4IAFA 1F0QA 4YHTA 1BYGA 4X21A 4QMTA 3EJ1A 4MNEA 5CWZA 3V5PA 4IBMA 5IG1A 1FQ1B 4QMVA 2C6KA 2CJMA 4WO5A 4EJNA 5AIKA 3BCEA 3PVGA 3RHKA 3D83A 3VBVA 3W32A 3JUHA 3WZJA 4ZJVA 5BVWA 3SVVA 2FSMX 3PG3A 3ULIA 3QBNA 4ACGA 4AFJA 3MV5A 4QNYA 3QALE 4CT1A 4YJRA 2C3KA 5FM3A 3OXIA 1B39A 2Z2WA 2XIXA 2R3FA 4X3FC 4C34A 3HL7A 2YDJA 1TQIA 3NAXA 4QTAA 5C8MA 3H0YA 4ZK5A 2X6EA 5CVFA 1J91A 4OTPA 3UPXA 2VTMA 4RFMA 5BVDA 2I6LA 3DB6A 3H4JA 4IB1A 3B8RA 4FTUA 4RBLA 5F20A 3UIXA 4E6DA 5AUYA 3NR9A 3V5TA 4BDAA 3DNEA 3PE2A 2XS0A 3BGPA 1APME 5ETIA 4O0TA 3FY0A 4ZTNA 4P4CA 4IWQA 1Y57A 5CXZA 1JQHA 2RFNA 2QQ7A 5CF6A 1YDTE 4H39A 3ZS5A 2CLXA 2JIUA 3DOGA 3LFAA 2YACA 2WTCA 4MWIA 5HO8A 1QPCA 3L8XA 4IFGA 4U79A 4E5AX 1GJOA 2R3HA 2DS1A 4FL3A 4FV7A 3E8CA 5AP1A 3PTGA 2R4BA 4K18A 1UWHA 3RPYA 4FTJA 4E20A 5ACBC 2QOCA 3CKXA 4TYHB 4V05A 5GZ9A 2ZYBA 3R02A 2FH9A 3GBZA 4PF4A 3O7LD 4AGUA 2VTHA 2GNHA 3C4EA 2QOBA 2W1GA 2VO3A 2XB7A 2QURA 3ZZWA 4O0VA 4FTMA 1YWRA 2OKRA 4CKIA 1QPDA 2R3OA 3SOCA 5GJGA 5CU4A 3NNXA 3U9NA 5EW3A 3EL7A 3VVHA 4BDFA 4AN9A 2PVRA 4CKJA 5CAOA 4AWIA 5DNRA 2C6EA 2QG5A 2G2FA 3L8SA 3IW8A 5A46A 4XH6A 3U6IA 3IG7A 4XG4A 4EC9A 3ZFYA 1UA2A 2QOIA 4G3DA 3UBDA 4IAZA 4LGHA 3TZ7A 4IANA 5J7BA 3RGFA 2ITQA 4FTQA 3E92A 4EH8A 5IPJA 1WMKA 4MD9E 3V8SA 2HY0A 2XJ1A 1OIQA 2Y9QA 3C7QA 5LMAA 4PY1A 3R2BA 3HV3A 3DLZA 4GW8A 2J5EA 4K1BA 4OAUC 3VN9A 5GZAA 5EK7A 4RA5A 3OWPA 1H28A 1YQJA 5J87A 4GJ2A 5AP2A 1R3CA 5M53A 3E8NA 3WF9A 3QCXA 4NH1A 3NNUA 4M0YA 4JR7A 3MJ1A 3IS5A 3ZONA 1ERKA 3FZSA 4EH2A 4EYJA 4LL5A 3HV5A 1UNHA 3PY1A 4FSWA 3NEWA 5CI7A 4BCMA 2RG6A 4BICA 3DAKA 3E5AA 3GEQA 4BGQA 3ZYAA 3KMUA 5AA8A 2W99B 4DH8A 3TZ8A 4OTQA 3REPA 3LE6A 3ULZA 5A9UA 3BU5A 2YCQA 2CCHA 4NIFB 4XBRA 2HWOA 3C50A 4G3CA 4DGGA 3R9DA 3BHVA 4PMTA 3FE3A 3DTCA 4I0RA 5IA0A 3DK3A 3O96A 4JIKA 1H25A 2R64A 4V01A 5AIRA 2R3MA 4QPAA 4BCQA 3LFEA 2HZ0A 1I09A 3D5UA 5BVNA 4PV0A 5BQ0A 3ODZX 3C5UA 2HWPA 1JKTA 1H24A 4MXYA 3M2WA 4XV9A 2C0TA 4O2ZA 3VW8A 3QUPA 4CZYB 3NUUA 2XNEA 4NWMA 4QP7A 1CKJA 3IKAA 3LFBA 5DA3A 3QUEA 4XG7A 4B6LA 5BYYA 3CEKA 3DJ5A 2OZOA 3LFDA 2BAJA 2B55A 3MVMA 2WELA 1M2RA 4S34A 4JAIA 2Y4PA 4JDIA 4IJPA 2J4ZA 5HNBA 2XCKA 2VTSA 2WOUA 2WTVA 3P9JA 5B2LA 2OI4X 4DH5A 4C3FA 1XH5A 5EDQA 2GS7A 3WIGA 4PRJA 1SVHA 3UOHA 5L2TA 1WCCA 1P4FA 3PZEA 4FKVA 4BCJA 3BLRA 4ASZA 5FXRA 4I92A 4FF8A 4F7NA 5IDPA 1HOWA 3R63A 3TT0A 3R1YA 3SOAA 3EFJA 4ZOGA 3SV0A 1NVSA 4C57A 4W9XA 3Q5IA 4F1OA 2BIYA 2A1AB 3PP1A 4QMYA 1JKSA 5CI6A 4Z7GA 3HKOA 1L3RE 2YABA 5AR4A 2BILB 5AV0A 5HE0A 4LUDA 4ZTRA 3MH3A 3TV4A 5KNJA 1O6KA 3LCTA 5CSWA 4DEBA 4KIQA 5KMIA 4AN3A 3N9XA 1SVEA 2VTQA 3M1SA 4DGLC 2CLQA 5HCYA 4GT3A 2EVAA 4EH3A 2X8DA 2YAKA 1KWPA 5DBXA 1ZYSA 2C5XA 1E1VA 3II5A 4IM2A 4QP2A 4AGDA 4M3QA 3BRBA 5AADA 4O27B 3DT1A 4BHZA 2UZNA 5AJQA 4GV1A 5CX9A 4F9CA 2F49A 5K0XA 3F5PA 4G3EA 2JBPA 3RM7A 5K4JA 5E91A 3VUTA 3KMMA 3KKVA 3DGKA 4G2FA 3TKHA 4O0XA 3VWAA 2PMLX 3W1FA 4H3QA 3IW5A 3BHHA 2WIHA 2PMIA 4YC3A 2C6DA 2GHGA 1OL1A 1JLUE 3S3IA 3ZSHA 2VWXA 2HCKA 4UMTA 4C3PA 5B2MA 2ERZE 4BI1A 4XG6A 5BUEA 5ANJA 3UP2A 2PWLA 4MD8E 1CTPE 1JWHA 3ERKA 2OO8X 3V04A 3RI1A 4C38A 4YC8A 4HVIA 5FP6A 4JBPA 2X9EA 1URCA 3KGAA 1CMKE 4UX9A 1ZZ2A 4MVFA 3UNKA 4U8ZA 4WUNA 4DYMA 4QTEA 2PTKA 3KCFA 5AR7A 3LLTA 2Y7JA 2QOLA 4LV5A 3P0MA 1KE6A 3JYAA 4L9IA 2VAGA 3HA6A 4ZEGA 4FKIA 2GDOA 3UNJA 1AD5A 2W1DA 1JKKA 1Z9XA 3D9VA 3K3IA 3OCSA 4BBMA 2CPKE 4U45A 4CZUA 3NUPA 4FKTA 4G6OA 1ZYJA 3ZFMA 3UQCA 3EYGA 2G2IA 4HYHA 1YOJA 2JKOA 1OM1A 1ZRZA 3CD8A 2YAAA 3TTIA 4MXAA 4ASEA 2XH5A 2R7BA 3HVCA 4YLKA 2QOQA 4FUYA 3GUBA 4NTTA 5J95A 3MA3A 5E1EA 4FV4A 3CR0A 4XOZA 1MP8A 5FRIA 4GFMA 4C58A 3C9WA 3LFFA 5FXQA 4B99A 2REIA 4BTKA 3LM5A 4L3PA 2XKFA 3JPVA 3OBJA 3QTWA 3I1AA 2C5OA 4PUZA 5L8JA 3VS3A 2QI8A 4FVPA 2DWBA 3G9NA 4RIYB 4E6AA 4GEOA 4M8TA 3E62A 4CFXA 5FTOA 4ITJA 2QCSA 4XEYA 2F2UA 2G15A 3OCGA 5DR9A 4XRLA 2ETKA 3R28A 1U46A 2C3LA 3OD6X 3HP5A 3FZRA 3MYGA 2VUWA 4GUEA 5IDNA 4RT7A 4IWPA 3AC2A 4FSRA 3W2RA 1KE5A 2W5AA 1XQZA 1YWNA 3E3PA 4GVJA 4L67A 2PUUA 4O38A 4YNEA 4B9DA 2FA2A 4BCOA 1ZWSA 3E8EA 3W8LA 3KK8A 4FTRA 2OFUA 3LCOA 4FA2A 2YA9A 2ZAZA 3D7TB 2VTNA 3M42A 3R00A 1ATPE 4EK4A 3LHJA 4F0FA 5C9CA 3E87A 3OFMA 4LOOA 4OTRA 4D9TA 3TUBA 1PXPA 3DK6A 1H00A 5CT7A 2ZV2A 5CAVA 4LUEA 5J5SA 4CVAA 5JFWA 2CMWA 2W1CA 3LXKA 3MIYA 4EWQA 3GXLA 3QTIA 4LOPA 4KKEA 3KXHA 4CTBA 3FXXA 5FG8A 2UW3A 3EN4A 4XV1A 3ZZEA 5M57A 4CYIA 1J1BA 4EOPA 4GCJA 3IW7A 3QQGA 2P0CA 2ZV8A 3GU7A 3IPHA 5CANA 1SYKA 2VTOA 2B54A 1PKDA 3GB2A 3MY1A 3CTQA 2OU7A 4EOKA 2Z60A 4ZAUA 4DG0E 3CJFA 4D5KA 5DE2A 1OPJA 2RFDA 4FTOA 1I44A 4KIKB 4M7IA 5EI2A 1XH6A 4UMPA 3TG1A 2A4LA 5AP5A 3ZC5A 2QODA 3BEGA 3MFSA 3MFTA 5K5XA 4YZMA 4ZZMA 4EOJA 2FO0A 3PFQA 1H4LA 4JDJA 4GG5A 3O2MA 3OWJA 5HQ0A 4KSQA 1PYEA 5EDPA 4USEA 5HNIX 4EHVA 3AC1A 4W9WA 4BBFA 4DN5A 3FL5A 4FZ6A 3PA3A 3VS7A 4A4OA 4Y5QA 3SAYA 3I81A 2OIBA 2VN9A 2XEZA 3O0GA 4RWLA 5JKGA 2BVAA 4DG3E 2YJRA 3DK7A 2Z7RA 5CENA 3KQ7A 1YI4A 2VX3A 5C03A 3WYXA 3R04A 4BN1A 3U6HA 1TVOA 5EYCA 2VV9A 3KEXA 4XG3A 5JFSA 5HU9A 5J1WA 1REJA 1ZMVA 5EHLA 1F3MC 3CBLA 4RQKA 5ETFA 4C4GA 5DRBA 3KRWA 3CGFA 1LUFA 2ZJWA 3CPBA 3PYYA 2HXQA 3QQUA 2WTKC 3OBGA 2FSLX 1K3AA 5HX6A 5JGBA 4ZZNA 4MKCA 4RJ4A 4EK5A 1S9JA 1XH7A 3DA6A 4ONAA 3PA4A 1XWSA 3OTUA 4HCUA 4FTKA 3TKUA 3ZCLA 5HVJA 5KMJA 3MTLA 3OUNB 4GYGA 1DAWA 2CSNA 4RJ3A 3WE8A 4JDKA 5JK3A 4D2TA 4O22A 1WBSA 5AR3A 3OS3A 2OW3A 4FSYA 4OT5A 1ZARA 5AR2A 4AA4A 3KMWA 3E7OA 4F0GA 3GQIA 4DGNA 2NPQA 2DYLA 4DFXE 2PE2A 4ERKA 4AW5A 4OUCA 3C0HA 3VIDA 3VW6A 4FV2A 4IVDA 4ZLOA 3P86A 5CQWA 5E8XA 2X4FA 4QMOA 1EH4A 4TN6A 2G9XA 4U43A 4IE9A 5EH0A 3GOKA 4FVRA 1OKYA 2J0KA 3OT3A 2WTDA 4F9WA 5HZNA 4B4LA 5DT4A 5G1XA 2HY81 4R8QA 5CEPA 5KZIA 2KULA 1W7HA 2A0CX 3QTRA 4X3FA 1H07A 3SC1A 4M14A 4FG7A 4DC2A 5CSPA 5AP4A 4M69B 5DOSA 3MW1A 2BZIB 4QRCA 3VUGA 4E7WA 2XYUA 4R3RA 5LVNA 4BDJA 3VJOA 2PVYA 4UZDA 3IW4A 1H26A 4XP3A 3EQRA 3ZSIA 4B0GA 2QVSE 3RCDA 3NS9A 2UW8A 3Q9YA 4EOMA 2GU8A 4IB3A 4RPVA 1FINA 3WZUA 3KRJA 4K0YA 4LM5A 4G31A 2R3KA 2VTAA 3ANQA 5C01A 4LL0A 3W2OA 2XRWA 5HG8A 3Q96A 5CAQA 4C7TA 5IZFA 2UVZA 4IB0A 3TIZA 2GNFA 4JS8A 5C26A 5K5NA 4X6RA 5I4NA 4U3YA 3QC9A 4F0IA 2W0JA 4YTCA 4WRSA 3DS6A 3C4ZA 3DBCA 4QP4A 4CFFA 3WBLA 2Y4IC 3MN3A 4CZTA 3F3VA 5I9VA 3PXRA 2ITXA 3R30A 4RJ8A 4MHAA 3IGGA 3T9IA 4E5WA 5H8GA 4QMZA 4DGOA 1YHWA 2OJ9A 2AC5A 2XBAA 3OXTA 3HMMA 3TKIA 5K4IA 3L9PA 4C4FA 2R5TA 2VWVA 4KIOA 2B53A 2XEYA 3D5VA 3PJ3A 3LZBA 2WTKB 4UXLA 1Q97A 4QQCA 2ZDTA 3K5UA 2IW9A 2C30A 4L43A 5I9ZA 5J7HA 2WMRA 2ZB0A 5J9LA 2RKUA 3IONA 4RSSA 3QTZA 4FV6A 3RNIA 3P08A 5EHYA 1W0XC 4IXPA 5L2QA 4O96A 2WU7A 4D2VA 3BZ3A 2XRUA 3S95A 4FKPA 1XBCA 4WBOA 4QMQA 4O6EA 3Q4TA 4CMOA 3QQKA 3BGQA 4BCNA 1BI8A 4C33A 5I5ZA 5CEMA 3O8PA 4O0UA 5CASA 4A9SA 4D5HA 5DEYA 4BWXA 4IHPA 4AW2A 4GJ3A 3CQWA 4GK4A 3JS2A 3DBQA 1BMKA 3UQFA 4ERWA 3WI6A 5HE2A 2CN8A 1QPEA 1XBBA 4RQVA 4DCEA 4JBVA 3PJCA 3FXWA 2CGWA 4IJ9A 4C4JA 5ETCA 1OL7A 3EKNA 5CALA 5KBRA 3NGAA 4RLLA 3QKKA 2VTRA 3GCSA 3IDCA 4ANSA 3MBLA 4AXAA 4LRJA 3WIKA 4DH7A 3LMGA 3G6HA 3N51A 5GNKA 5TO8A 4IAYA 4YSJA 5JT2A 3R8ZA 2XNBA 4ZJIA 4QMWA 2W1FA 4RWIA 1H27A 4S2ZA 4QOXA 4U3ZA 5L2WA 4IX6A 4RIWB 1UU8A 2JD5A 1JSUA 3FKOA 2F7EE 4D0XA 4F7JA 4EWHA 2O0UA 3RNYA 3KA0A 5LJJA 1OUYA 4FVQA 1JNKA 3BQRA 1W84A 4EEVA 5GZ8A 1OITA 2VGPA 2ITWA 3VJNA 2X2LA 3POOA 3QU0A 3DZOA 2IZUA 2KTYA 4FT0A 4PL3A 5A4EA 4EBVA 3KXGA 3NLBA 1R0EA 4HCTA 4LYNA 5AV3A 3BWFA 2Y0AA 5D1JA 3TNQB 1K9AA 2GS2A 1URWA 3QTXA 2X2KA 4W8DA 4Y8DA 3S00A 3RWPA 2BRMA 5ITAA 4PNIA 4IX5A 2XKEA 4XV2A 3KRRA 1YDRE 3R7UA 1PXNA 3Q4ZA 2G1TA 5FP5A 2R3JA 3DB8A 2BDJA 2UVYA 3QRTA 4II5A 4WG4A 1YKRA 1PMNA 2B9JA 2ITOA 4PPAA 4P5ZA 3WF6A 4KS7A 5AAGA 2LAVA 3IOPA 5M4UA 1U4DA 4FTTA 2CDZA 4ZLZA 3H9FA 3DDQA 1OIYA 4TKSA 2YFXA 3FYKX 4LV8A 4D0WA 3ZUTA 2PVKA 3TNPC 5AV2A 2W1ZA 3R7VA 2JAVA 4PDSA 3KRXA 5E8UA 4A9RA 3E8DA 5E8TA 2YZAA 4RWKA 4FSNA 3P23A 4Q9ZA 3V8WA 4C37A 5CAPA 2JFMA 4OTHA 4R7HA 4TWPA 4EC8A 4F99A 3DQXA 4CSVA 5A4LA 5T3QA 5LWNA 4IC7A 5BX0A 5FLFA 3LIJA 3VC4A 3D2KA 4QD6A 3UIMA 3EQGA 4FKGA 4YLLA 1PYXA 5H3QA 3RK5A 4NK9A 2XZSA 3IECA 5TOZA 3QZGA 1JOWB 3PG1A 3KULB 4JT3A 2OZAB 3DJ7A 4MXZA 1P14A 2C3JA 5H8BA 3R9OA 2R7IA 4A9YA 2G01A 2Q0NA 3BU3A 3D94A 4C8BA 3LJ1A 4WG5A 4HGLA 4I93A 4K8AA 3MH2A 4FKOA 3GC0A 3PPKA 3JY0A 2JBOA 1MRVA 4FYOA 4P2KA 3VS6A 1OL2A 3RP9A 2NO3A 4G3FA 4BCKA 3AC5A 4J99A 3TV7A 2R3GA 4AA0A 4PL4A 3TXOA 3UMWA 1QMZA 2W96B 4WT6A 3FI3A 4N70A 1WBVA 1ZY5A 3EWHA 5E8SA 1T45A 4PP9A 3JXWA 5I9YA 1OPLA 2PVNA 4ANLA 5EI6A 4D2SA 4WD5A 4DLIA 3QD3A 4OGRA 1UWJA 4GT5A 1XH4A 3PJ8A 4QQ5A 2EXEA 5JGAA 3V8TA 4DEGA 4F6WA 4LOQA 4JNWA 3MPAA 4WRGA 5CYIA 2PZRA 3R0TA 1PMVA 3E93A 3JVRA 4H58A 5LARA 4YJTA 4BCIA 4TWNA 2UW7A 3AD4A 4TNDA 4XV3A 4Y46A 4C2VA 5IUIA 3RZBA 4D58A 3FC1X 3IW6A 5D9HA 3RPRA 3QFVA 4UMQA 4RFZA 3R8PA 3VUIA 2PMNX 4ENXA 2VWUA 4NKSA 4G5PA 5KX8A 4KBKA 4IDVA 1SMHA 4HVSA 3VRZA 4AX8A 1KE7A 4U0IA 1BUHA 3CGOA 4I5MA 4D4VA 2VWZA 3LPBA 3LVPA 3OVVA 4I4FA 4MAOA 2F7ZE 4G9RA 4EONA 3TUDA 1SZMA 3MB7A 3D0EA 5FDPA 4D1SA 2BPMA 3DKOA 2HZIA 1KV1A 3D7ZA 3I60A 3R71A 5A4TA 5EKNA 3ORLA 3BGZA 4BZNA 5HX8A 1YDSE 3U51A 3Q4CA 3GC9A 2X0GA 4HOKA 4JAJA 4DFYA 2WMAA 4EQCA 1NY3A 1QPJA 3OY3A 4HGTA 4FNXA 4BDDA 2Z8CA 2B1PA 3D5XA 2UZTA 4O1OA 4PTGA 4EZ7A 1R78A 4AFEA 3PUPA 4I24A 2JLDA 3ORTA 3BELA 2OXXA 2YDIA 5C27A 3QCQA 2X2MA 3OW3A 3POZA 3PPJA 1Z5MA 4RG0A 5EW9A 4N6ZA 2PVJA 4ANNA 5L8LA 4G17A 4ANBA 2GMXA 3F61A 1PMUA 5KUPA 1RQQA 3SKCA 4I22A 2VWBA 4L01A 5IH4A 4RIXA 1FVRA 3OROA 5IEXA 4A07A 3AD6A 3Q6UA 2GCDA 4M84A 4FEQA 4I5HA 4YZDA 4M66A 3ZBFA 1H1PA 2ZMDA 3G51A 3ZDUA 3HMPA 3EN6A 3G33A 2X7FA 3G5DA 3I0OA 4TPTA 4C3RA 3H30A 2BRNA 1KE8A 3GU4A 4JLCA 4CKRA 1CSNA 3FKLA 3R7IA 4G34A 4PWNA 1ZYCA 3PWYA 4E4MA 4F1MA 1AGWA 2QU5A 1H08A 2CGXA 4R3PA 2QOHA 2P4IA 5FDXA 4F70A 4GMYA 5CU0A 3KVWA 4DFLA 2QR8A 3ZC6A 3ZXZA 4APPA 3LJ2A 1OPKA 3V5WA 3EQCA 3F3ZA 4L52A 2ITVA 4PTCA 3AC8A 4FT7A 2VWWA 2OGVA 3BIZA 4CYJA 4UWCA 1GOLA 2VO7A 2YLEA 1WFCA 3EQDA 4O0YA 4BDCA 3F69A 3OC1A 4QTBA 5DEWA 4E26A 5HG9A 4I1ZA 2UZWE 4L3LA 3MY5A 4TZRA 2HW6A 4GS6A 5CU6A 5IA2A 4HZSA 5BVKA 2JC6A 3PJ2A 3Q2MA 4JDHA 3V6SA 4CLJA 5AP7A 4K77A 4XHKB 2OG8A 3VHEA 3HGKA 2X8IA 3CLYA 3L9LA 1H0WA 4YGAA 4ANQA 1H01A 1V0PA 3O71A 4J8MA 4OT6A 2XIRA 4UZHA 2O5KA 3FHRA 4FTLA 4PPCA 2HZNA 4YBJA 3F3TA 3NNVA 5BYZA 3RK9A 3VBQA 5CY3A 5IEYA 4BI2A 4LRMA 2IJMA 1IR3A 3HRCA 1WBOA 2WXVA 4ZSEA 3WF7A 1LEWA 4YTHA 3TNIA 3GFEA 4NFNA 3S0OA 3R9HA 1ZOEA 1PXOA 4FKQA 3SQQA 4ZTMA 3QHRA 5C8KA 3UOJA 3DV3A 3MY0A 2PHKA 5FD2A 5HCXA 3UC4A 3UZPA 4AT3A 3NUNA 3LXNA 3F2AA 4U7ZA 4E1ZA 3WF8A 2RG5A 4AGWA 1ZMUA 4J1RA 5HD7A 5JRQA 3R7GA 5LVPA 4OR5A 4I5CA 5K0KA 4EI4A 5HBJA 1OGUA 2WHBA 1CKIA 3PXFA 3V3VA 4A06A 4K11A 4M68A 3UYTA 4C4HA 4ZY4A 5KHXA 2F57A 4HVHA 1Q99A 5FEDA 5HTBA 4NZWB 3DKFA 3G2FA 2AC3A 3PJ1A 4IVAA 4RX7A 3G90X 4WNKA 4KAOA 5ANGA 1DI8A 2PY3A 3LXLA 4HYSA 4R5YA 3PVWA 2OJJA 2DQ7X 4BDEA 3IDBA 3PVBA 2XYNA 3QQJA 1Q61A 3QC4A 4R3CA 4S31A 1JPAA 2XK9A 2BFXA 2P33A 4HGSA 5HICA 4NEUA 3OY1A 5TT7A 4OTFA 3D14A 1Y8GA 3PSDA 4BWKA 2C6OA 3FMHA 2OXDA 3NIZA 4KA3A 4CFMA 1GY3A 4JQ7A 2YM6A 4JX7A 3RALA 3W2CA 3NYNA 4AN2A 4JRNA 1H0VA 4IC8A 4Y73A 3MFRA 4EHEA 3SD0A 3H3CA 3BYVA 4FKJA 4IM3A 4S32A 3TZ9A 4D4RA 3KVXA 4E5BA 4I6HA 4UEUA 3A7FA 5DPVA 1Q8TA 5HO6A 1FOTA 4AW1A 4KWPA 2QONA 3AG9A 1BX6A 5JFXA 3QZHA 1BLXA 4ZZOA 2EB3A 3SXSA 1UNGA 3DQWA 5EKOA 3ORKA 3FUPA 4ZP5A 4K9YA 4M97A 4DEEA 4FGBA 2XM8A 3CKWA 4BDIA 3LFSA 3QAME 4ZSLA 4AZWA 3PRIA 2YCSA 4BVUA 3FJQE 3Q9ZA 2CCIA 3OEZA 3FMEA 5D41A 4RZWA 2W9ZB 1H1WA 3NDMA 3EB0A 4PMMA 1MQ4A 4QMPA 3L9MA 2XUUA 1GZOA 2QLQA 2JDOA 3ENHA 2QU6A 4PP7A 4F9AA 5BVFA 5HBHA 3KFAA 2W05A 1U54B 2XIKA 1P4OA 2WOTA 4QYYA 3RBWA 4E6QA 3AT3A 4EKLA 5A54A 5LWMA 1IASA 2PVFA 4GK3A 4UYNA 5DIAA 5DRDA 4F9BA 3CPCA 4X2FA 5I0BA 5HLNA 3FMMA 4I94A 3ZFXA 5BMSA 4GL9A 3CTHA 5L4QA 4YJUA 1PKGA 4O21A 4YJOA 1CDKA 3EQFA 1GAGA 5DR6A 3ODYX 4GT4A 3HMNA 3Q6WA 3NW7A 4G6NA 2QOKA 5F1ZA 1PXIA 4XJ0A 5JGDA 4RJ6A 3BI6A 5K3YA 3VQHA 3ZEPA 4MBIA 4MXOA 5IISA 3BV2A 2EWAA 5TKDA 4R7IA 5KO1A 3KK9A 4ZXTA 4GFGA 2WKMA 4EQUA 4FTIA 4ACMA 3FPMA 4KKGA 2YCFA 4L7SA 1Q8WA 5E8WA 1VZOA 3RVGA 1Y8YA 2PK9A 3GU5A 3H9RA 5LVLA 5CVHA 2UZEA 3F2NA 5IMXA 3GOPA 4AQCA 2EXCX 5B7VA 1HCLA 3Q9XA 1VYWA 4FG8A 5KMNA 5LCJA 1OL6A 1CKPA 4R1YA 2J0MB 3NW6A 4YLJA 4CRSA 3LCKA 3F88A 2E9OA 1X8BA 4HYIA 1P2AA 5AUVA 3I5NA 4C0TA 3EH9A 5HESA 3ZO4A 4BTJA 4IB5A 4L44A 2F2CB 4DBNA 3RAHA 3ORPA 4DFZE 4EK8A 2A19B 4IIRA 5E8VA 2ACXA 3LQ5A 4JIAA 4H36A 3ZLYA 3MB6A 4BTFA 4D1ZA 4IX3A 3WF5A 2W4JA 1ZOHA 1ZOGA 3Q4UA 3LQ8A 5LMBA 1V0OA 3FSKA 2BRGA 3BE9A 3FSFA 3FKNA 2WMWA 3R1SA 5CNOA 4FNZA 1XO2B 5AUWA 5J8IA 4I0SA 5AAEA 1OI9A 5D7VA 3RAWA 1UKIA 2WFYA 3ANRA 5AP0A 4NTSA 5M44A 4V0GA 2X9FA 1PMEA 4RC2A 4O2PA 4E3CA 4Z3VA 3ZUUA 4C4EA 3HYHA 2R9SA 2XK8A 2HZ4A 4IFCA 2C4GA 3QCSA 2BRBA 3ZLSA 2IZSA 2NRYA 4XCUA 4MNEB 4A9UA 3L8VA 4WUAA 3RPOA 3KL8A 3GU6A 4ARKA 2PZ5A 4FSUA 4O1PA 5A6OA 5HVKA 3GGFA 3FLQA 5CSXA 4AUAA 1V0BA 2XKDA 1E1XA 3KY2A 4C61A 1XHAA 1B38A 2C0OA 1FGKA 1YHSA 4CNHA 1GIJA 2BAKA 3R01A 4KS8A 4BC6A 4XG8A 3I5ZA 2OJIA 2OIQA 4FIEA 4FV0A 3HP2A 4RIOA 5AX3A 2WTJA 4Y83A 2CN5A 4MWHA 4PQNA 3B2WA 1BKXA 1WAKA 4J97A 4YJVA 5F9EA 5CLPA 5BVEA 3SX9A 4HZRA 4I23A 2OBJA 4EOOA 2OSCA 2OK1A 2BUJA 2HW7A 1ZAOA 4NUSA 2UZDA 3R6XA 4F6UA 3QWKA 4QMNA 2W1EA 5H8EA 5M4CA 4KABA 4FIJA 3ZXTA 3AMYA 4L42A 3OHTA 3EKKA 4ZY5A 3OT8A 4F08A 1LR4A 2Y6MA 3ZTXA 3GQLA 4TYHA 3ET7A 1O6LA 3MPMA 3Q3BA 3KF4A 1Z57A 3U8WA 4EOSA 1VYZA 2WMUA 4IEBA 3GU8A 4NKAA 5GJDA 5D7AA 2OF4A 3ORNA 5E92A 1Q4LA 4UY9A 5KCVA 2ITYA 4KD1A 3B8QA 2BTRA 4UBAA 5E7RA 4K2RA 3EOCA 5CSVA 2XJ0A 5CS6A 3QTUA 3FV8A 3FZTA 3HA8A 3TACA 5AP6A 4KBAA 3MVJA 1GNGA 4JXFA 4D1XA 2XK7A 2O2UA 4ZTQA 4DGMA 4EOLA 3W10A 1OZ1A 5BPYA 3I4BA 5ANDA 2PVLA 3TJCA 4MK0A 4DEIA 3GI3A 4QP6A 3HV7A 4IWDA 2O65A 3FMKA 5DMZA 5J9ZA 5A4QA 4E4LA 4BDGA 3UYSA 3EL8A 1MRUA 4LGGA 4YU2A 3BV3A 3GCPA 3FMDA 2Q0BA 3AC3A 5FXSA 2ZM1A 1AQ1A 4HYUA 5AWMA 3DKGA 4P5QA 5FEQA 4U42A 4AZSA 3UO4A 3DCVA 1P5EA 3C0GA 3E3BX 3MIAA 4ZTHA 5E8YA 2OXYA 3R8UA 3RK7A 3TN8A 3UG1A 3VUDA 3MH0A 4X0MA 3ZH8A 2J7TA 4CT2A 3UPZA 4AZVA 2C6IA 4FUXA 3QXPA 1WVWA 3QD2B 5AA9A 2R3LA 4TYGA 1JKLA 3QRUA 3FY2A 2LGCA 4K6ZA 4PX6A 3TL8A 4BCGA 3KF7A 2QOOA 3PVUA 1NXKA 1XH9A 1PY5A 3FMNA 3RHXA 3LW0A 5KKRB 3DBFA 2GNLA 3ZHPC 1BL6A 2PZIA 3JY9A 4FK6A 2VTLA 4FICA 4NIFA 3A4PA 4U81A 1A06A 2Y8OA 3VS5A 4RC4A 3FI4A 4UV0A 3SDJA 3VUHA 4IZ7A 4GSBA 4YUQA 4HJOA 3VS4A 4S33A 3A4OX 4A4XA 1Q62A 5EM7A 5HBEA 2NP8A 4NU1A 5T68A 3RCJA 3ZO3A 4DH1A 2VWIA 5CF8A 1LP4A 3OZ6A 4EYMA 3MPTA 2GNIA 2JDSA 4U80A 3PIZA 3UODA 4YP8A 3R9NA 3QZIA 3IK3A 2VTJA 4IZ5A 4V04A 5HI2A 1OVEA 4WNPA 5D11A 1Q5KA 1DAYA 1PF8A 3CY2A 1FMOE 3QRJA 4YC6A 4MBLA 4G1WA 3RAKA 2IO6A 3KXXA 4TWOA 2I0EA 3UP7A 4CV9A 5IUGA 5CZIA 3FXZA 4FOBA 5JZJA 1K2PA 5EFQA 3QTQA 1U5RA 3Q53A 3AMBA 4WKQA 3S1HA 2C6TA 4D28A 2A27A 2W7XA 4FKWA 2VRXA 2B9IA 2IZTA 3QF9A 2WGJA 1U59A 2UW5A 4FI1A 3ZLWA 2XF0A 4U97A 4ASXA 4ZY6A 5LVMA 2C5NA 4FTCA 5CEQA 3HLLA 1H8FA 4O91A 3HUCA 4OTWA 3QCYA 4M12A 2CGVA 3T9TA 5KHWA 5KMMA 1IEPA 1NVQA 1STCE 4M13A 4QYFA 4HVGA 4LFIA 3OP5A 5A3XA 2X1NA 1FPUA 3MSSA 1G3NA 1XJDA 4MNFA 4CRLA 4DAWA 4YURA 1OMWA 4XS2A 3QGYA 1UNLA 2OH4A 4GFOA 4MH7A 3W2QA 2WMQA 3NZ0A 4FV1A 4GK2A 4KNBA 4AT5A 4TTHB 4XG2A 5CEIA 1KSWA 3RMFA 5GHVA 4J53A 2ZOQA 3ZRKA 1OIRA 4ZSAA 4DINA 3F6XA 3ROCA 3A8WA 4CFUA 3FL4A 1LEZA 3FMLA 3R1QA 2R0IA 4E4XA 5I3RA 3UVQA 2UW9A 3EFLA 4JOAA 3EN9A 4L8MA 5FM2A 5DI1A 1OL5A 5M56A 2J5FA 4MCVA 4YBKA 2JKMA 2F4JA 3R22A 4WHZA 2XM9A 2QO9A 1YI6A 4YJSA 3D5WA 2H6DA 3R8MA 1M52A 2OWBA 4C62A 4JRVA 3MVLA 4AG8A 3FZ1A
chains in the Genus database with same CATH superfamily
2YWPA 2GTNA 1GZNA 3ZO2A 1ZZLA 1UU7A 5DLSA 3GVUA 3T8OA 2V7AA 5CTPA 5KE0A 4RX9A 4BWPA 1KOAA 5CZHA 2C6MA 1VEBA 3VULA 3AD5A 2XIZA 2C6LA 5IU2A 1FVVA 2IVSA 2PZYA 2WEVA 2WO6A 3C1XA 1U54A 3DPKA 3HX4A 4HNIA 1W82A 2RIOA 3MFUA 2X4ZA 4U5JA 4S30A 3U4WA 2P55A 2ERKA 1CM8A 3R7EA 4FZDB 3HDMA 3PY0A 4BYIA 3KCKA 4BDHA 3HMIA 4QTCA 4EH9A 4BRXA 2YM7A 4AW0A 5CSHA 4MTAA 2C5VA 2JIIA 4RX5A 3COHA 4EOQA 2OJFE 2A2AA 3PRFA 4XP2A 4RX8A 3ZSGA 3QLGA 4NCTC 4QT1A 3NIEA 3G0EA 2WU6A 4RLKA 5LQFA 4FOCA 2QR7A 1E9HA 2C3IB 4RWJA 3UOKA 2EXMA 2GPHA 2QOFA 2VTTA 4FTNA 3VS2A 1WBPA 2JDRA 3ALOA 1T46A 4QYHA 3SRVB 3V01A 4YPDA 2CKEA 2SRCA 3OEFX 3W16A 3A7IA 4BCHA 3COKA 4USDA 4E8AA 4F9YA 4WG3A 4ACDA 4BF2A 3EQIA 1ZYLA 3KN6A 4FMQA 3CC6A 4KKHA 5I9UA 5HIEA 1Q8ZA 3BLHA 4BI0A 5TF9A 2GS6A 3ACKA 2JKKA 2ZMCA 4RIYA 3TZMA 1DI9A 3P4KA 1MRYA 2QHMA 3FPQA 3FLYA 4JG8A 3I79A 5FWKK 3GFWA 4FODA 1QCFA 3ORXA 3DAJA 1XR1A 4FG9A 4CTCA 4TL0A 3DAEA 1OIUA 2UZOA 2I1MA 3L9NA 2BZKB 1WBWA 3R2YA 5H9BA 4L6QA 2PSQA 5HORA 2XNNA 3TTJA 4GU6A 2FSTX 3FDNA 3MI9A 3DXNA 2JGZA 4MX9A 4PMPA 4QMMA 2ONLC 4FL2A 2VGOA 1UU9A 2XNMA 4KB8A 3UC3A 4FR4A 4EZ5A 3D7TA 3SXRA 4HGEA 3M11A 3FLSA 4R5SA 3CIKA 4NJ3A 5DT3A 4BIDA 4FV8A 5AM6A 4IX4A 3ELJA 4AS0A 5IA4A 3Q9WA 2IZRA 4CCUA 2IW8A 1ZLTA 2BAQA 3I6UA 3PXQA 3KXMA 2ITTA 5HIDA 4AE9A 4DEAA 2I40A 2IVTA 4M67A 3EZRA 2F9GA 1RW8A 4RGJA 4R1VA 3OTVA 2AYPA 3LFNA 5EM5A 3VS0A 3ZU7A 5LMKC 4KSPA 4WSQA 4RZVA 5L8KA 2E9VA 2ITNA 2ITPA 4MEDA 3TI1A 3AGLA 3PIYA 5IKWA 4AF3A 4DG2E 4H1MA 3BBTB 2JAMA 1UV5A 4NM0A 3R7OA 2J0JA 1JBPE 4FIIA 1HCKA 3W2SA 4NFMA 2WQEA 1YVJA 3P5KA 4I21A 3C51A 3OCBA 4KIKA 2C1AA 2WB8A 3SA0A 2DUVA 1FVTA 4BZDA 2XNPA 3B2TA 4GYIA 2PMOX 4PDPA 4YZBA 3O8TA 2VD5A 1GZ8A 1LPUA 2YEXA 3MA6A 1WBNA 3DLSA 4JBQA 2IVVA 2OF2A 2WMBA 3SXFA 3W33A 4L53A 4IAKA 2BR1A 1U5QA 5CEOA 3RWQA 1UU3A 3FMJA 4MD7E 3Q60A 3V6RA 1UVRA 5G6VA 4FKRA 5HU3A 3CY3A 2WZJA 2XKCA 4AU8A 3D15A 3DY7A 4UMUA 3G6GA 3GT8A 4YJQA 2UW6A 3C13A 4XMOA 5A14A 5LVOA 4QPSA 3IQ7A 5HLPA 2VX1A 2H96A 3DKCA 2BHHA 2UZVA 4EZ3A 3Q32A 4U40A 4EUUA 4K33A 5FGKA 2B7AA 4Q5HA 4E4NA 3F3WA 3QWJA 2X81A 2X7GA 5HTCA 3V5QA 5HGIA 4A9TA 5AUZA 2IW6A 1BI7A 3A61A 2FB8A 5ETAA 3UIBA 4YHJA 1Y91A 3PY3A 1ZYDA 4AT4A 2FSOX 3FQSA 4D2RA 4G16A 2YM5A 1OKZA 3BPRA 3OXZA 3QKLA 4FKSA 4O4DA 2H34A 3HECA 3HMOA 3KXNA 5CVGA 4IAAA 5KMLA 3A99A 4LGDA 3EFKA 3SW4A 3ETAA 5HHWA 2JKQA 2B9HA 5DN3A 1W83A 1RE8A 4OAVB 5H2UA 4DEHA 4EH7A 3R7YA 3ZO1A 5C1QB 1SNUA 2QO7A 4IVBA 3VBXA 3ORMA 2VZ6A 5DG5A 5CEKA 4FSMA 3ZMMA 4LQMA 3Q04A 4TWCA 2Z7SA 3NW5A 2YITA 3GNIB 3T3UA 2ZDUA 4BB4A 3QX4A 5E8ZA 2GHMA 4ID7A 3R1NA 4QP8A 5IMEA 3CQUA 1UKHA 4IH8A 1WVYA 3KU2A 3W55A 1YXSA 5EDRA 4X2NA 4FT3A 3C4WA 3TEIA 3UO5A 1YOMA 1F5QA 5HE3A 4AAAA 2I0HA 5CU3A 3I6WA 2PZPA 4AACA 3ZRMA 2BZHB 4G3GA 3R83A 3GP0A 3A62A 4UWBA 2X39A 4B8MA 2W06A 5EOBA 4FNWA 5CF5A 5GJFA 3TV6A 4I0TA 1YOLA 4M69A 3BQCA 5T6KA 2YM4A 4J98A 2W1IA 5AV1A 4X3FB 5ICPA 5JEBA 2C68A 3CE3A 4NT4A 3PPZA 4AZFA 4FZFB 3R8LA 4DTKA 4YNOA 4AA5A 4FZAB 2YCRA 3F9NA 3GCQA 3OOMA 1M17A 4EH6A 3DDPA 1IRKA 3VBTA 3AOXA 3OOGA 3F7ZA 4NSTA 3A60A 1PXLA 4YMJA 4O6LA 5M4IA 5HG7A 4O0SA 2IN6A 2UZUE 3OUKA 3P7CA 2PVHA 2VTPA 2J51A 2JFLA 4Y95A 4WOVA 1GIHA 5J9YA 4WIHA 3RPSA 2B9FA 4EHGA 1O9UA 2O3PA 2WTIA 1XKKA 4O0WA 4FT5A 4HPTE 4BDKA 3A7HA 4UN0C 3NAYA 3PXKA 2VNYA 4WA9A 4WBBB 3QLFA 2HK5A 4J95A 3H10A 2UW4A 4YTFA 3BKBA 4E6CA 3QYWA 3TJDA 3FZOA 2X7OA 3EHAA 5AV4A 4L46A 3MJ2A 2C69A 5EOLA 1ZY4A 2WQBA 2WMXA 3QUDA 3GC7A 4FX3A 4BTMA 3AT4A 3PP0A 5ACKA 4D4SA 3KN5A 3BEAA 2OICA 3QHWA 4PPBA 3TNHA 3C4XA 1R1WA 3E7VA 4IDTA 5KMKA 5DWRA 2ETMA 3GCUA 2QC6A 1TKIA 3AT2A 3CQEA 4U6RA 5AM7A 4PDOA 1R0PA 2EB2A 4N0SA 5TR6A 1YXVA 1O6YA 3NNWA 3UMXA 2AUHA 2QNJA 5J79A 1W8CA 4BCFA 4JQEA 1KOBA 2YM3A 3EQHA 4XBUA 5AP3A 2XIYA 4FKUA 4G5JA 3WARA 4C35A 3GENA 2ESMA 3QGWA 1JSTA 5J1VA 3EIDA 4YR8A 3P7AA 3EN5A 2J90A 3QD4A 5JMSA 4MF1A 2WNTA 5FTQA 1XBAA 2F7XE 2XJ2A 3SHEA 3P1AA 4C4IA 2R2PA 4PNKA 2G2HA 2RGPA 4BKZA 1SM2A 3S4QA 4MF0A 5CF4A 5DT0A 4I3ZA 4IAIA 1FGIA 3FLNC 4P90A 3IDPA 2WEIA 4RVKA 3TIYA 3EMGA 3KC3A 3QQHA 4ITHA 4AE6A 4RIWA 5E1SA 4F7LA 1M2QA 2YIWA 3ZUVA 4WSYA 4TYEA 3NUXA 1M7NA 4O4CA 5LOHA 4CV8A 3EZVA 4CEGA 4WNMA 4TXCA 1OKVA 4HPUE 3R73A 4YJPA 4E73A 4HVDA 5LCKA 3U6JA 3BLQA 4FK3A 4DH3A 3VF9A 3DU8A 4W4VA 2E9PA 2BMCA 3CP9A 2JITA 4TW9A 5M55A 2BROA 4U41A 5AUXA 4DITA 2OFVA 4ALVA 3BBWA 4GVAA 1W98A 1PW2A 3PIXA 3LFCA 3COIA 4FV5A 3E88A 4FSQA 2FYSA 4QP3A 3VRYA 5TE0A 5AR8A 4C02A 3H0ZA 5L6PA 4W8EA 4Q9SA 1NVRA 5HLWA 1PHKA 1XH8A 2WAJA 4J52A 4IVCA 5I3OA 4W4WA 5IUHA 3NCZA 4YJNA 1S9IA 4X3JA 5IF1A 4P7EA 2Y6OA 4X2KA 4FTAA 3QXOA 3EQBA 4YZCA 3EQPA 3HV4A 3IGOA 5IA5A 2ETRA 5FBOA 3MDYA 1H1RA 4XRJA 1YHVA 2EUFB 3F3UA 4MQ1A 5DGZA 4CQEA 4FNYA 4L68A 4AGCA 4YSMA 1OECA 3SRVA 4D55A 4TYIA 3E64A 4RVLA 1Y6AA 2RSVA 1M7QA 3AXWA 2JDTA 4FBXA 4FV3A 4RRVA 5EYDA 3FBVA 5EYKA 1REKA 2YJSA 3C0IA 1GZKA 3O23A 3PLSA 4IADA 4ZTSA 2W5HA 4ENYA 2ZV7A 2VTIA 3RINA 3KULA 3RAIA 2OZAA 3IOKA 3QKMA 3KXZA 3NYOA 4I5PA 4RMZA 2HYYA 4UMRA 4Q2AA 2FUMA 3BX5A 3NCGA 5CNNA 3ORZA 3NX8A 3CCNA 4YPSA 2R3RA 3DTWA 2H9VA 3UNZA 2OH0E 3UO6A 4EUTA 4AOTA 4BGHA 2V5QA 2V22A 4I6FA 4ACCA 3CD3A 1SVGA 1JVPP 1YRPA 2O63A 1VJYA 4FKLA 5FEEA 2YIYA 5M51A 4L3JA 4LMUA 3BHTA 4XUFA 1Y6BA 5F4NA 2GSFA 2WQMA 4D2WA 3HV6A 3SLSA 4YZNA 5L3AA 3COMA 4M15A 4CFWA 3U9CA 4KRCA 4H3BA 5DH3A 2RL5A 4QNAA 4XG9A 2R3IA 2WMSA 4XP0A 2B52A 4ANOA 4TY1A 2UW0A 3QL8A 4LI5A 5AX9A 1YW2A 5AEPA 4OTDA 1WZYA 4MXCA 3RTPA 1J1CA 3WZKA 4EH5A 3TUCA 3VHKA 2B4SB 3O7LB 2ZM3A 5CT0A 2V62A 5AUUA 4ZIMA 5BMMA 3K3JA 4DHFA 2WMTA 2R3NA 2WTWA 4L7FA 4JG6A 3OW4A 3NSZA 4CLIA 4F7SA 3CXWA 3CJGA 4ASDA 4FIHA 1JAMA 3BWJA 3OG7A 3DZQA 5JH6A 4Y85A 3AC4A 4FIFA 3WZEA 5KKRC 2YDKA 3ROYA 2HENA 3C4FA 2XBJA 4L45A 2BDFA 2YIQA 3QQLA 3CS9A 3MTFA 3EYHA 2PE1A 5JN2A 1B6CB 2QLUA 2VU3A 3G9LX 4F63A 3F5UA 1IA8A 2BKZA 5IA3A 4N6YA 5AAFA 4X2GA 4AP7A 4NCTA 2CHLA 1YXUA 2R3PA 1YXTA 3ALNA 5DFPA 4GRBA 5KBQA 3RPVA 4XYFA 3FZPA 1G5SA 3TWJA 2X0PA 3OMVA 4EBWA 3LAUA 3RKBA 4MBJA 4LRKA 3NYXA 3UJGA 3HUBA 4RVMA 4X6QC 5DR2A 4TT7A 3W8QA 5IH6A 4QQJA 2P2HA 2ITZA 3BU6A 3HDNA 4AOIA 2GHLA 2VX0A 1OKWA 4PMSA 2UVXA 3F7WA 3HRBA 5IH5A 3WOWA 2WQOA 4ZSJA 4G6LA 2RFSA 4ZJJA 3VQUA 3FQHA 4CMTA 4QP9A 2IWIA 3QYZA 3RJCA 2QKRA 3H9OA 2VNWA 3HRFA 2W5BA 3LXPA 5EM6A 4D4YA 3GC8A 1WVXA 3W18A 1H1SA 3FC2A 3LFQA 1RJBA 3WZDA 3ZEWA 3GCVA 2P3GX 2BALA 3LM0A 4TYJA 1H1QA 4J71A 2J2IB 3PXZA 3WYYA 4XLIA 3F66A 2GFCA 3OWLA 5DHJA 4DLJA 5IA1A 4DEDA 3Q52A 1PXJA 5JQ5A 3MVHA 4RIXB 3ENMA 4XX9A 4NM7A 4I41A 1JSVA 2YM8A 4EKKA 1Q8UA 1RDQE 4UB7A 4JI9A 1FMKA 4U9AA 4IM0A 3TNWA 5L6WL 4E93A 4F09A 2X8EA 4MYGA 2ZM4A 1BL7A 2ONLA 3VF8A 1GIIA 2YISA 2YN8A 3CTJA 4KINA 1KV2A 2BTSA 2XNOA 4W4YA 2VO6A 5BVOA 3V5JA 5HG5A 3EFWA 5DVRA 4OW8A 1DS5A 4Z16A 1J3HA 4BCPA 3V5LA 4IQ6A 1TQPA 4CD0A 2O64A 4ZTLA 5CU2A 4PTEA 4BIBA 4EH4A 2P2IA 2BCJA 3NRMA 3KRLA 1MQBA 4GG7A 5HTIA 4JR3A 5HCZA 4FC0A 4FV9A 4IMYA 5HEZA 5JZNA 2Z7LA 1NA7A 4JL9A 4UXQA 2BZJA 4HNFA 5LMKA 5D12A 3U87A 3ZDIA 5L2SA 1Q24A 4RJ5A 3NUSA 4FIGA 3UE4A 2X0QA 4ACHA 2XK3A 4CXAA 2VWYA 4Y5HA 4RC3A 3QZFA 4AZTA 2PE0A 3O50A 2UV2A 4EL9A 5K9IA 3BHUA 5BUIA 2JEDA 5BNJA 3SW7A 2OIDA 4NM3A 4KIPA 4RJ7A 4MXXA 2V0DA 4EK6A 2WPAA 4NJDA 3DNDA 5EG3A 5KZ0A 3R21A 2CGUA 4FYNA 2J9MA 4X7QA 5ANOA 3K2LA 4GH2A 2I0VA 3P7BA 4BL1A 4F1TA 2XMYA 4ALUA 3LOKA 5M4FA 4EOIA 2C47A 3ZM4A 4XLVA 3QA8A 5AMNA 2GNGA 4FT9A 4ZLYA 1TQMA 2W17A 2J0IA 4IACA 4IW0A 3UG2A 3ZLXA 2V55A 3A7GA 2VO0A 2WIPA 2XP2A 4RA4A 3U4UA 5C8NA 2QD9A 1YI3A 4QYEA 4ALWA 3D4QA 5EHOA 2PVMA 4A4LA 2W4OA 2C5YA 4WNOA 3HZTA 3HNGA 3PXYA 3I7BA 3BE2A 5ANIA 4QYGA 3QRKA 5ANEA 3ZRLA 2AQXA 4ITIA 4TNBA 3UQGA 4G9CA 2QKWB 4I6QA 3HEGA 4N4SA 1VR2A 2QHNA 2XNGA 5AR5A 4EORA 2Z7QA 3FLWA 4OBOA 3UIUA 4AZEA 2R3QA 3UGCA 1OB3A 3BHYA 4MQ2A 4GUBA 2YHVA 2HELA 4NM5A 4BHNA 4B7TA 1Q8YA 1W2DA 3E63A 3L1SA 5HE1A 4BIEA 3LCDA 4EK3A 4QQTA 4GU9A 5I9XA 5CXHA 3P78A 5F94A 5FBNC 4IZYA 3FWQA 3FYJX 4KBCA 2XK4A 2O8YA 4GIIA 3OF0A 4JJRA 4BKJA 4EHZA 4USFA 3MGYA 3FAAA 3Q5ZA 4CMUA 2W4KA 3K5VA 2C1BA 2ZB1A 3NPCA 5J5TA 2GNJA 3L8PA 3UVPA 3O17A 4ZSGA 4D2PA 1YWVA 2PL0A 3DJ6A 4FZ7A 4I4EA 4UALA 3DFAA 3W2PA 2BDWA 5B2KA 1MUOA 3UTOA 3VUKA 4L00A 4QMXA 3WE4A 2ZV9A 4LMNA 3PZHA 5EYMA 5JQ8A 5EW8A 2E9NA 4QO9A 3P79A 2HOGA 3VNTA 4BZOA 4C36A 2ZVAA 4I20A 4IWOA 1A9UA 2YLFA 3A2CA 2XA4A 3I7CA 5L6OA 3AQVA 5HNGA 2I0YA 3V51A 3FLZA 4KRDA 4DFNA 4M0ZA 4FL1A 4X2JA 3MH1A 1YXXA 3BYMA 5D10A 4H1JA 4NW6A 2WD1A 4BDBA 4F64A 4C59A 3PSBA 2XVDA 5HD4A 3TCPA 5EM8A 4BYJA 4FSTA 4ANMA 2UZBA 3PA5A 3MS9A 2E9UA 3R8VA 3QA0A 3VBWA 4JG7A 4R6VA 2YERA 3BYSA 2YIRA 5I9WA 2EU9A 2XK6A 1TZDA 1PJKA 3LCSA 4O0RA 1PXKA 4QPMA 4RVTA 4YZ9A 4XOYA 4YTIA 3VO3A 3ACJA 4EQMA 1KE9A 2H8HA 4OTIA 3PE1A 4JBOA 5JSMA 3S2PA 5A6NA 4C2WA 4AOJA 4QP1A 2FVDA 2QO2A 3QX2A 5HVYA 2GQGA 2R0UA 3JVSA 2W1HA 3UDBA 2J6MA 4GIHA 4J8NA 1OUKA 2OJGA 2HAKA 5F95A 3BYUA 1DM2A 4F4PA 5KMOA 4CQGA 3KB7A 4F65A 4JQ8A 2J50A 3C4CA 3UVRA 1R39A 3O8UA 2RFEA 3K54A 4D9UA 3THBA 2IVUA 4BGGA 2W9FB 5HKMA 4Z55A 4PL5A 4QMLA 3VBYA 2J0LA 1M14A 3UOLA 2Y4IB 3BYOA 2E2BA 4CCBA 3RM6A 5ANKA 3VAPA 3UZTA 1IG1A 5HOAA 4J7BA 4Q5EA 1ZMWA 3RZFA 2UZLA 4LG4A 3D2IA 4BKYA 3DBDA 3MWUA 4FSZA 4HW7A 4H3PA 1WBTA 2WMVA 4QMUA 4YO6A 4BFMA 1ZXEA 5L2IA 3LJ0A 3AMAA 2ITUA 5CAUA 3I0QA 3NUYA 2HXLA 4U44A 4QTDA 3WILA 3QTSA 4JVGA 1QL6A 3FI2A 2WQNA 5BUJA 3F5XA 1V1KA 1Q3WA 3ITZA 2RF9A 2XCHA 3DFCB 4J96A 4Y72A 4BBEA 1M2PA 5IEVA 2YIXA 3FHIA 4OBPA 4ZS0A 2BRHA 4F6SA 4TRLA 4CFVA 1SNXA 3A7JA 3DBEA 3FQEA 3VUMA 5FQDC 1Q3DA 5CQUA 2X6DA 4YHFA 4Z9LA 4I6BA 4IZAA 3ZOSA 3ZBXA 1W2FA 5B0XA 2GTMA 3PWDA 3NYVA 5E90A 4OLIA 3T3VA 5AUTA 2HIWA 4NW5A 4UWYA 3O51A 4Z7HA 2JDVA 3F5GA 2NRUA 3OCTA 4A7CA 3QQFA 1PXMA 3QRIA 4RFYA 4OTGA 5JFVA 2BHEA 4B8LA 3NWWA 4W4XA 5A4CA 5HO7A 5EI8A 4APCA 3ORIA 4XNEA 4YO4A 4OBQA 2JIVA 2BFYA 3G0FA 2FGIA 3VS1A 4HCVA 2C0IA 5LXMA 1Q41A 4QMSA 3F82A 3AGMA 3EN7A 3QD0A 3A8XA 2UUEA 4JX3A 4UYAA 4V0GB 5HIBA 3PSCA 5JRSA 2V7OA 3IO7A 2BIKB 3OWKA 2GFSA 4CFNA 4IAFA 1F0QA 4YHTA 1BYGA 4X21A 4QMTA 3EJ1A 4MNEA 5CWZA 3V5PA 4IBMA 5IG1A 1FQ1B 4QMVA 2C6KA 2CJMA 4WO5A 4EJNA 5AIKA 3BCEA 3PVGA 3RHKA 3D83A 3VBVA 3W32A 3JUHA 3WZJA 4ZJVA 5BVWA 3SVVA 2FSMX 3PG3A 3ULIA 3QBNA 4ACGA 4AFJA 3MV5A 4QNYA 3QALE 4CT1A 4YJRA 2C3KA 5FM3A 3OXIA 1B39A 2Z2WA 2XIXA 2R3FA 4X3FC 4C34A 3HL7A 2YDJA 1TQIA 2A98A 3NAXA 4QTAA 3H0YA 5C8MA 4ZK5A 4FRFA 2X6EA 5CVFA 1J91A 4OTPA 3UPXA 2VTMA 4RFMA 5BVDA 2I6LA 3DB6A 3H4JA 4IB1A 3B8RA 4FTUA 4RBLA 5F20A 3UIXA 4E6DA 5AUYA 3NR9A 3V5TA 4BDAA 3DNEA 3PE2A 2XS0A 3BGPA 1APME 5ETIA 4O0TA 3FY0A 4ZTNA 4P4CA 4IWQA 1Y57A 5CXZA 1JQHA 2RFNA 2QQ7A 5CF6A 1YDTE 4H39A 3ZS5A 2CLXA 2JIUA 3DOGA 3LFAA 2YACA 2WTCA 4MWIA 5HO8A 1QPCA 3L8XA 4IFGA 4U79A 4E5AX 1GJOA 2R3HA 2DS1A 4FL3A 4FV7A 3E8CA 5AP1A 3PTGA 2R4BA 4K18A 1UWHA 3RPYA 4FTJA 4E20A 5ACBC 2QOCA 3CKXA 4TYHB 4V05A 5GZ9A 2ZYBA 3R02A 2FH9A 3GBZA 4PF4A 3O7LD 4AGUA 2VTHA 2GNHA 3C4EA 2QOBA 2W1GA 2VO3A 2XB7A 2QURA 3ZZWA 4O0VA 4FTMA 1YWRA 2OKRA 4CKIA 1QPDA 2R3OA 3SOCA 5GJGA 5CU4A 3NNXA 3U9NA 5EW3A 3EL7A 3VVHA 4BDFA 4AN9A 2PVRA 4CKJA 5CAOA 4AWIA 5DNRA 2C6EA 2QG5A 2G2FA 3L8SA 3IW8A 5A46A 4XH6A 3U6IA 3IG7A 4XG4A 4EC9A 3ZFYA 1UA2A 2QOIA 4G3DA 3UBDA 4IAZA 4LGHA 3TZ7A 4IANA 5J7BA 3RGFA 2ITQA 4FTQA 3E92A 4EH8A 5IPJA 1WMKA 4MD9E 3V8SA 2HY0A 2XJ1A 1OIQA 2Y9QA 3C7QA 5LMAA 4PY1A 3R2BA 3HV3A 3DLZA 4GW8A 2J5EA 4K1BA 4OAUC 3VN9A 5GZAA 5EK7A 4RA5A 3OWPA 1H28A 1YQJA 5J87A 4GJ2A 5AP2A 1R3CA 5M53A 3E8NA 3WF9A 3QCXA 4NH1A 3NNUA 4M0YA 4JR7A 3MJ1A 3IS5A 3ZONA 1ERKA 3FZSA 4EH2A 4EYJA 4LL5A 3HV5A 1UNHA 3PY1A 4FSWA 3NEWA 5CI7A 4BCMA 2RG6A 4BICA 3DAKA 3E5AA 3GEQA 4BGQA 3ZYAA 3KMUA 5AA8A 2W99B 4DH8A 3TZ8A 4OTQA 3REPA 3LE6A 3ULZA 5A9UA 3BU5A 2YCQA 2CCHA 4NIFB 4XBRA 2HWOA 3C50A 4G3CA 4DGGA 3R9DA 3BHVA 4PMTA 3FE3A 3DTCA 4I0RA 5IA0A 3DK3A 3O96A 4JIKA 1H25A 2R64A 4V01A 5AIRA 2R3MA 4QPAA 4BCQA 3LFEA 2HZ0A 1I09A 3D5UA 5BVNA 4PV0A 5BQ0A 3ODZX 3C5UA 2HWPA 1JKTA 1H24A 4MXYA 3M2WA 4XV9A 4O4EA 2C0TA 4O2ZA 3VW8A 3QUPA 4CZYB 3NUUA 2XNEA 4NWMA 4QP7A 1CKJA 3IKAA 3LFBA 5DA3A 3QUEA 4XG7A 4B6LA 5BYYA 3CEKA 3DJ5A 2OZOA 3LFDA 2BAJA 2B55A 3MVMA 2WELA 1M2RA 4S34A 4JAIA 2Y4PA 4JDIA 4IJPA 2J4ZA 5HNBA 2XCKA 2VTSA 2WOUA 2WTVA 3P9JA 5B2LA 2OI4X 4DH5A 4C3FA 1XH5A 5EDQA 2GS7A 3WIGA 4PRJA 1SVHA 3UOHA 5L2TA 1WCCA 1P4FA 3PZEA 4FKVA 4BCJA 3BLRA 4ASZA 5FXRA 4I92A 4FF8A 4F7NA 5IDPA 1HOWA 3R63A 3TT0A 3R1YA 3SOAA 3EFJA 4ZOGA 3SV0A 1NVSA 4C57A 4W9XA 3Q5IA 4F1OA 2BIYA 2A1AB 3PP1A 4QMYA 1JKSA 5CI6A 4Z7GA 3HKOA 1L3RE 2YABA 5AR4A 2BILB 5AV0A 5HE0A 4LUDA 4ZTRA 3MH3A 3TV4A 5KNJA 1O6KA 3LCTA 5CSWA 4DEBA 4KIQA 5KMIA 4AN3A 3N9XA 1SVEA 2VTQA 3M1SA 4DGLC 2CLQA 5HCYA 4GT3A 2EVAA 4EH3A 2X8DA 2YAKA 1KWPA 5DBXA 1ZYSA 2C5XA 1E1VA 3II5A 4IM2A 4QP2A 4AGDA 4M3QA 3BRBA 5AADA 4O27B 3DT1A 4BHZA 2UZNA 5AJQA 4GV1A 5CX9A 4F9CA 2F49A 5K0XA 3F5PA 4G3EA 2JBPA 3RM7A 5K4JA 5E91A 3VUTA 3KMMA 3KKVA 3DGKA 4G2FA 3TKHA 4O0XA 3VWAA 2PMLX 3W1FA 4H3QA 3IW5A 3BHHA 2WIHA 2PMIA 4YC3A 2C6DA 2GHGA 1OL1A 1JLUE 3S3IA 3ZSHA 2VWXA 2HCKA 4UMTA 4C3PA 5B2MA 2ERZE 4BI1A 4XG6A 5BUEA 5ANJA 3UP2A 2PWLA 4MD8E 1CTPE 1JWHA 3ERKA 2OO8X 3V04A 3RI1A 4C38A 4YC8A 1W2CA 4HVIA 5FP6A 4JBPA 2X9EA 1URCA 3KGAA 1CMKE 4UX9A 1ZZ2A 4MVFA 3UNKA 4U8ZA 4WUNA 4DYMA 4QTEA 2PTKA 3KCFA 5AR7A 3LLTA 2Y7JA 2QOLA 4LV5A 3P0MA 1KE6A 3JYAA 4L9IA 2VAGA 3HA6A 4ZEGA 4FKIA 2GDOA 3UNJA 1AD5A 2W1DA 1JKKA 1Z9XA 3D9VA 3K3IA 3OCSA 4BBMA 2CPKE 4U45A 4CZUA 3NUPA 4FKTA 4G6OA 1ZYJA 3ZFMA 3UQCA 3EYGA 2G2IA 4HYHA 1YOJA 2JKOA 1OM1A 1ZRZA 3CD8A 2YAAA 3TTIA 4MXAA 4ASEA 2XH5A 2R7BA 3HVCA 4YLKA 2QOQA 4FUYA 3GUBA 4NTTA 5J95A 3MA3A 5E1EA 4FV4A 3CR0A 4XOZA 1MP8A 5FRIA 4GFMA 4C58A 3C9WA 3LFFA 5FXQA 4B99A 2REIA 4BTKA 3LM5A 4L3PA 2XKFA 3JPVA 3OBJA 3QTWA 3I1AA 2C5OA 4PUZA 5L8JA 3VS3A 2QI8A 4FVPA 2DWBA 3G9NA 4RIYB 4E6AA 4GEOA 4M8TA 3E62A 4CFXA 5FTOA 4ITJA 2QCSA 4XEYA 2F2UA 2G15A 3OCGA 5DR9A 4XRLA 2ETKA 3R28A 1U46A 2C3LA 3OD6X 3HP5A 3FZRA 3MYGA 2VUWA 4GUEA 5IDNA 4RT7A 4IWPA 3AC2A 4FSRA 3W2RA 1KE5A 2W5AA 1XQZA 1YWNA 3E3PA 4GVJA 4L67A 2PUUA 4O38A 4YNEA 4B9DA 2FA2A 4BCOA 1ZWSA 3E8EA 3W8LA 3KK8A 4FTRA 2OFUA 3LCOA 4FA2A 2YA9A 2ZAZA 3D7TB 2VTNA 3M42A 3R00A 1ATPE 4EK4A 3LHJA 4F0FA 5C9CA 3E87A 3OFMA 4LOOA 4OTRA 4D9TA 3TUBA 1PXPA 3DK6A 1H00A 5CT7A 2ZV2A 5CAVA 4LUEA 5J5SA 4CVAA 5JFWA 2CMWA 2W1CA 3LXKA 3MIYA 4EWQA 3GXLA 3QTIA 4LOPA 4KKEA 3KXHA 4CTBA 3FXXA 5FG8A 2UW3A 3EN4A 4XV1A 3ZZEA 5M57A 4CYIA 1J1BA 4EOPA 4GCJA 3IW7A 3QQGA 2P0CA 2ZV8A 3GU7A 3IPHA 5CANA 1SYKA 2VTOA 2B54A 1PKDA 3GB2A 3MY1A 3CTQA 2OU7A 4EOKA 2Z60A 4ZAUA 4DG0E 3CJFA 4D5KA 5DE2A 1OPJA 2RFDA 4FTOA 1I44A 4KIKB 4M7IA 5EI2A 1XH6A 4UMPA 3TG1A 2A4LA 5AP5A 3ZC5A 2QODA 3BEGA 3MFSA 3MFTA 5K5XA 4YZMA 4ZZMA 4EOJA 2FO0A 3PFQA 1H4LA 4JDJA 4GG5A 3O2MA 3OWJA 5HQ0A 4KSQA 1PYEA 5EDPA 4USEA 5HNIX 4EHVA 3AC1A 4W9WA 4BBFA 4DN5A 3FL5A 4FZ6A 3PA3A 3VS7A 4A4OA 4Y5QA 3SAYA 3I81A 2OIBA 2VN9A