5GZ8A

Crystal structure of catalytic domain of protein o-mannosyl kinase in ligand-free form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
284
structure length
272
Chain Sequence
CPPGYFRMGRMRQCSRWLSCEELRTEVRQLKRVGKRVFLSEWKEHKVALSRLTRLEMKEDFLHGLQMLKSLQSEHVVTLVGYCEEDGTILTEYHPLGSLSNLEETLQQDVNTWQHRLQLAMEYVSIINYLHHSPLGTRVMCDSNDLPKTLSQYLLTSNFSIVANDLDALPLVDVLIKCGHRELHGDFVAPEQLWPYGEDTPFQDDLMPSYNEKVDIWKIPDVSSFLLGHVEGSDMVRFHLFDIHKACKSQIPAERPTAQNVLDAYQRVFHSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein O-mannose kinase
publication title 3D structural analysis of protein O-mannosyl kinase, POMK, a causative gene product of dystroglycanopathy.
pubmed doi rcsb
source organism Mus musculus
total genus 78
structure length 272
sequence length 284
ec nomenclature ec 2.7.1.183: Glycoprotein-mannosyl O(6)-kinase.
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gz8A00
2RGPA 1RQQA 3QQFA 5H3QA 5HNBA 3OCTA 5HIDA 3UIMA 2AYPA 2HWPA 4L3PA 2VX1A 4XP2A 1LEWA 1YXVA 3BYOA 3QGWA 5IA0A 3QTQA 5BPYA 3F7WA 4E1ZA 4JRNA 3I1AA 3I0QA 2P2IA 3GQLA 3MVJA 2W9ZB 2W4KA 3ERKA 4D2TA 4HYUA 2QOBA 4F6UA 4RC3A 4HGTA 4QP6A 1OECA 4RZWA 3NW6A 2GFSA 3I81A 3LQ8A 3I7CA 4MF0A 4OTWA 4ENYA 4ITIA 3DKOA 4B7TA 5M53A 2J0KA 3HX4A 4GU6A 1OZ1A 5H8GA 5I3OA 4XG8A 3ZUUA 4EUTA 2QOIA 4FTMA 5KUPA 3OWLA 5D12A 2E9UA 4M13A 3QQLA 3ZZWA 3QRJA 1JLUE 2XKCA 2YABA 3HP5A 1OPJA 2B7AA 4RJ6A 4ZZMA 5E8ZA 2BRHA 3OY3A 5CU2A 3PYYA 3ITZA 3W16A 3LFSA 2C0IA 4TW9A 1YWRA 1KOBA 4EC9A 5A14A 1WZYA 1F3MC 3L9MA 4YJVA 3RBWA 5L6OA 4AG8A 4GIIA 4YNOA 3FL4A 4JQEA 3SOAA 3D4QA 3LJ2A 5EHOA 3FZTA 4JBQA 3SX9A 4A4LA 4S2ZA 4PV0A 4YZNA 2Q0BA 4L00A 2YIQA 2CGWA 4HGLA 4ZK5A 4AGDA 5DLSA 2CLQA 2QU5A 3EMGA 5FWKK 3SXFA 2XRWA 3PY1A 2XYUA 3L9LA 4QMQA 5F9EA 4H3PA 4ANMA 4LL0A 2E2BA 4XG2A 4JBOA 1JKTA 3VUKA 3PJ1A 1M2PA 3L8SA 4IE9A 5FG8A 3EWHA 3LMGA 4C57A 3JVRA 5D10A 2ITTA 4ZSLA 3WI6A 4EYJA 5BVFA 1Y91A 2A4LA 4O2PA 5ANEA 2PE0A 5EK7A 3WZKA 2R3PA 3HGKA 5HVKA 5BYYA 4H3QA 3GI3A 2ETMA 5ETAA 4ALVA 3VUHA 1RE8A 2ITXA 1ZOHA 3S0OA 4KSQA 4ENXA 4Z3VA 3FMEA 5EI8A 5LVMA 4RWIA 4FX3A 4NK9A 4RFMA 1PKDA 2VTMA 4E5AX 3QRTA 2PY3A 2OI4X 4XOYA 3ZFYA 2QQ7A 1A9UA 3U8WA 1GJOA 1Q3DA 2R3KA 3CCNA 3GFEA 3OP5A 3QL8A 5CYIA 5A54A 2XKDA 4OGRA 5IUIA 1W84A 4UXQA 3C4CA 5L2WA 5CI6A 3ZC6A 3SVVA 3TKIA 2IW8A 2ZV7A 2HCKA 4X6RA 3TTJA 4N6ZA 3VBWA 3G2FA 3C4EA 3WF6A 4HYIA 4I21A 4TPTA 2QO2A 5IPJA 2ZYBA 2WMXA 3R7YA 4FV3A 5AIKA 3GU8A 2FUMA 2OJIA 4L9IA 4IEBA 3R04A 4I24A 1V0BA 2UVXA 3AD4A 3DAJA 1YW2A 2XEYA 2XH5A 3KN6A 4TTHB 4X7QA 5TE0A 5AX3A 2BDWA 2QKWB 4Z7GA 3OFMA 2BAQA 4KBCA 4BB4A 2YCSA 4LV8A 3QHWA 4FV4A 1GIIA 3O8UA 3R7EA 5HO8A 5EI6A 4HOKA 4GIHA 4O0TA 4EKLA 2CCHA 2I0HA 4GVAA 3GOKA 3G90X 3KF4A 3IDPA 2O8YA 4X2GA 2UW4A 5BUEA 4BBEA 3QWKA 4ZSAA 5HQ0A 4AW2A 5IA2A 3DB6A 2GTNA 4IM0A 3EZRA 4IVCA 4PL4A 2J5EA 1Q99A 2ACXA 1MUOA 3LZBA 4NFMA 4Y46A 2CGXA 4YJNA 3VBQA 2HK5A 4TYHB 2JDOA 2REIA 2XA4A 2YM3A 4YBJA 3E63A 2X8DA 3FHIA 4S31A 5DGZA 3ENMA 4FSWA 1YI6A 4XCUA 1Q8TA 5B2MA 3IPHA 4ERKA 2PZYA 4WRSA 5T6KA 4XUFA 2C1BA 3FL5A 4FTUA 3V3VA 1FGIA 1ZZLA 4C58A 4K6ZA 4FIEA 2GS7A 5HG7A 3GENA 4R1VA 4KSPA 4QMLA 3W2RA 3CTJA 1ZY4A 4FGBA 5EM5A 3GC8A 3KXGA 4AAAA 4RX5A 2PUUA 4DEHA 2G2HA 4XOZA 4BCIA 4Q5HA 1UNGA 4LRJA 3EQGA 2I0YA 3LFDA 4BCFA 1W82A 3EFJA 4YHJA 5AP3A 1ZOGA 2PMIA 3E7VA 2R64A 4BDCA 5CS6A 4K1BA 3OUKA 4RVMA 4MNFA 3E8EA 3G5DA 1B38A 5J5TA 3OC1A 4TYIA 2XKFA 4XHKB 5J1VA 5CVGA 1XR1A 2F49A 3GU7A 4BWKA 5JFSA 3VNTA 5LJJA 5A4TA 4UMTA 5KHWA 3NUXA 4EH7A 5J5SA 3SOCA 5CAPA 3EL7A 4HVDA 1R0EA 4K77A 2GNFA 3COKA 5DG5A 4F1OA 4ACMA 1SZMA 3FI4A 4OBOA 3TT0A 2YDJA 4EZ5A 1OM1A 4QTDA 3BGPA 5AP5A 5AV0A 4RFZA 4O0WA 3ORKA 2ONLA 4IAYA 2C6KA 3OOMA 5DVRA 2BZKB 3EHAA 2VD5A 2XNOA 3QYWA 3QD0A 3MB6A 4MF1A 3TNPC 5L3AA 3EKNA 4FNZA 3MFSA 3FPQA 4FOCA 4XG9A 5B0XA 5IG1A 2B9FA 3UIBA 4J52A 4ACDA 2UW7A 4C4IA 3DS6A 4USEA 4BCJA 4OT5A 4EI4A 3OTUA 5EYDA 3R9HA 2XIZA 4MXOA 4FG7A 2QOKA 4GFGA 4IWDA 2CN5A 2Y4IB 3QD3A 4I3ZA 1QPEA 3PXYA 4FT0A 3AGLA 3ZOSA 5DT4A 3BIZA 3M11A 5IA3A 4UWBA 4IJ9A 3S95A 5L2SA 3N51A 3KULA 1P5EA 4FSRA 1MP8A 3IOPA 4FT7A 1CM8A 1XKKA 3H9RA 3PSDA 1CMKE 2FB8A 4KKHA 3GC0A 2BTSA 4R3PA 4DBNA 5FBOA 2C5VA 2HAKA 4GH2A 2CJMA 3DDPA 4Z9LA 4OTIA 3TZ7A 2VWBA 5CXHA 3VVHA 3EQDA 5K4JA 5IMXA 4F1MA 1IRKA 3MPAA 4IB1A 1BL6A 3EYHA 3R30A 3NUYA 3S1HA 4CYIA 2VTNA 4YJUA 3CS9A 2C3JA 3PXZA 4O27B 4CQEA 5IISA 3POZA 2XNBA 4B9DA 3U87A 4OLIA 3NZ0A 2WU6A 4F0GA 2XKEA 3VS1A 4GFOA 5E7RA 4IAKA 1Q24A 4HYSA 3CTQA 5H8EA 4LG4A 2PHKA 5AMNA 3KL8A 4FSUA 5FD2A 3MH0A 3RZBA 1V0OA 2GU8A 1J1CA 3Q53A 4IH8A 4C4GA 3LM5A 2O2UA 3HYHA 4M8TA 3E8DA 5ANDA 2QOCA 4I6BA 2GTMA 1H1SA 2G2IA 2R3LA 2YCRA 3EQIA 3A62A 1OB3A 3IECA 5CU3A 2VO0A 3A4OX 4RIOA 2B54A 2FYSA 2V7OA 2I0EA 4G6NA 4R3CA 3FPMA 4R7HA 5EOBA 4O21A 5CT0A 4C02A 5HLNA 5IEVA 3C4ZA 3SHEA 2XIXA 3ZEWA 2AC5A 3PVGA 5I9VA 1CKIA 2OH0E 1BI7A 3SXSA 5KMMA 2JKMA 4ACHA 5IA5A 4M0YA 1WAKA 3O8TA 5AX9A 4K11A 2YAKA 4DLIA 2GCDA 4FUXA 1E1XA 4HW7A 4RA5A 4O96A 4WSYA 2OK1A 4AA5A 3MJ2A 4MCVA 2YCQA 3EFWA 4E6AA 4FKRA 4M69A 2VTHA 3REPA 1PHKA 1KSWA 2QOOA 3DT1A 4FV8A 2WGJA 4AWIA 3BHYA 5BX0A 4C4FA 2EVAA 3GU4A 4J98A 5CEIA 2WTIA 4XG4A 4E4XA 3G0FA 1Y6BA 3SQQA 3WZDA 4YJSA 4G1WA 4IAAA 3VBYA 4RG0A 5D7AA 3W10A 3FY0A 3FZRA 3LAUA 4XRJA 5KKRC 2W1HA 3VHKA 1ZYCA 3HRFA 4MBJA 5JSMA 2KULA 3UO4A 3MIAA 4EH5A 4JG7A 2R3NA 4JS8A 5M4UA 2XK7A 1SVEA 4LGGA 4P4CA 5DR2A 2WNTA 4W4VA 4AT4A 4TKSA 2GHGA 5TKDA 5I4NA 1VYZA 3MH2A 4AZVA 2VGOA 2X2LA 3DNEA 4NCTC 2CKEA 2C3LA 3QAME 4JL9A 4C0TA 1SYKA 4OTGA 5EI2A 4EH6A 4PP9A 4RLKA 3V51A 3TUBA 1SNUA 3SKCA 1VZOA 4AZTA 1O6KA 4FIFA 4NIFA 5CAOA 3VAPA 4O1OA 5J8IA 2DQ7X 4XG6A 3AC5A 3WBLA 4JXFA 1PXLA 1H00A 2XNPA 2VNYA 2XK3A 2XBAA 4M66A 5D7VA 4JX3A 4IZ7A 5A4CA 3QZGA 1OVEA 3UP7A 2WXVA 4A4OA 4C3PA 3HV3A 1K9AA 4DLJA 4UYNA 4V01A 2WAJA 3EH9A 4A07A 3D5XA 3L1SA 3CQUA 2HZNA 3KGAA 5DEYA 4RX7A 5DR6A 4DH5A 4PNKA 3TG1A 4AQCA 1FVRA 2OZOA 3A60A 3D2IA 3OMVA 3FMDA 4DG3E 2ZOQA 5AJQA 4TYGA 3TZ8A 5K4IA 3IG7A 5FRIA 4YMJA 4FIHA 3DFAA 3T9TA 5HG9A 2OO8X 3MS9A 4CFNA 2ITOA 4ASDA 3PXKA 4EONA 5EG3A 3ZDUA 5CENA 2JBOA 5D11A 4QYGA 3ORZA 1XBCA 2J0MB 3DLZA 4FIJA 2B55A 2J6MA 2G01A 1X8BA 3MYGA 1HCKA 5E90A 3DZQA 5C8NA 4L7FA 2VWYA 1VYWA 3BHUA 4FZAB 3W8QA 4HGSA 2QG5A 4NM7A 5CSVA 3VF9A 5J7BA 4U7ZA 4EQCA 1YHWA 2XYNA 3RM7A 3LXKA 1XH6A 3KMMA 3L8PA 4FYNA 5HZNA 4BBFA 2V22A 3CE3A 1H0VA 2YA9A 3COMA 3VBTA 3UO6A 5HI2A 1U5QA 4FVQA 4I5PA 1LEZA 3NYOA 2VUWA 4U5JA 5C8KA 4D4VA 5IKWA 5D1JA 3QKLA 4HYHA 4ANLA 5EKNA 4G34A 2CHLA 5DHJA 5BVDA 3DBQA 4MBLA 5M51A 3DNDA 5J9YA 3TV7A 4RVKA 2IW9A 1Q8YA 2B1PA 2VTQA 1WBWA 4LYNA 1Q8UA 3VIDA 1PKGA 3VS7A 2HXLA 3CP9A 3L8XA 1ZZ2A 3W33A 3DAKA 4YZDA 4Z16A 1L3RE 3DB8A 4ZSJA 4EOSA 2YLEA 4GFMA 4CFXA 5F4NA 3ZRKA 2I1MA 3UC3A 5AV3A 1KV2A 2HY0A 3F61A 4M68A 5EYCA 5K5XA 4ONAA 3UVPA 1RJBA 4U42A 2WTVA 4I5CA 3ZLYA 2YFXA 3OBGA 2XJ0A 3FV8A 3ORTA 2RKUA 4MKCA 4IDVA 1PXNA 4QQCA 3P7CA 3QTXA 2W1EA 3VRYA 3GT8A 5HD4A 2ITQA 4FK3A 3EB0A 2P55A 4IWOA 4YJRA 5HCZA 5C8MA 3CJGA 3Q9XA 3QUEA 3FI2A 4IB5A 3VBXA 5M55A 4FV0A 2OG8A 3VS3A 4FTKA 3TKUA 4FKUA 4FKJA 2WMQA 1SNXA 5HGIA 3RMFA 2B9JA 2XS0A 3R8MA 4FKPA 5KMOA 4DAWA 4IVDA 3C5UA 3JPVA 4RJ7A 1PMEA 5HBJA 2W96B 4CV9A 4H58A 4F9AA 4G17A 3W32A 4AACA 1YDRE 4L01A 1PXOA 1PXKA 3GCUA 3MDYA 4BYJA 2V62A 1Y6AA 4PRJA 4FT5A 4ZSEA 3FLQA 4HNIA 4YZMA 2YAAA 4QMPA 2RG5A 3PXQA 2RFEA 5AP6A 3E3BX 2JDTA 4MHAA 5HCXA 4CNHA 3D0EA 4XV3A 5HVYA 1Q8WA 3RPSA 3EFKA 3F66A 5JQ8A 4MAOA 3A61A 3O51A 4YHFA 4O91A 2YHVA 4ZP5A 5K5NA 2GHLA 1UNLA 3QA0A 2JIUA 1NY3A 3NNXA 4CFMA 2YZAA 3RNYA 3UMWA 5CF6A 2Y7JA 3GEQA 3W2PA 1YHVA 2BRBA 3NLBA 4L8MA 4DG2E 2DWBA 2X4FA 4OAVB 2UZEA 3QQUA 5CVHA 1H27A 2YLFA 3VUGA 1UA2A 3RPOA 4IAFA 1JWHA 4MWIA 4HVSA 3R9NA 4FIIA 3R8ZA 3C0GA 3F82A 3OZ6A 1WBOA 4FI1A 3BRBA 5HBHA 3ZFMA 2ETRA 2I0VA 2QONA 4L6QA 1E9HA 4H1MA 4P5ZA 5CZHA 3V5WA 3LVPA 4E26A 5A46A 4USFA 3TKHA 4MD8E 3AT4A 4M15A 3UVQA 2R3RA 2UVZA 1M17A 2WEVA 3PRFA 4GT5A 4UWCA 1Y8YA 2VN9A 3MTFA 4GCJA 3QTSA 4WA9A 3UNKA 5HG5A 5E1EA 3E92A 1GOLA 3VF8A 4MQ1A 2IVSA 4OW8A 3DJ7A 4EC8A 3FZPA 1WBNA 4Q9SA 3RJCA 2R7IA 3QU0A 2RG6A 3R7IA 3VO3A 5GZAA 1JKSA 4RZVA 4WUAA 3ZO3A 3MIYA 2QOLA 3MY5A 3IGOA 4I5HA 4EH4A 1H1QA 2HW6A 3ZTXA 4X2JA 5A4LA 3F6XA 3RAKA 1U46A 4FV6A 1AD5A 5J79A 4UWYA 3R8PA 4PPBA 1T45A 3QALE 4O0VA 3PVBA 4QMMA 2P3GX 2GQGA 3VS2A 4EK8A 2FSOX 2RFNA 3CKWA 4B0GA 4FSMA 4B6LA 4C3RA 2GNJA 4C38A 3D5WA 4X3JA 4NW5A 4OBPA 4GV1A 5KMJA 4IX3A 3ZXTA 4IDTA 4K2RA 4RRVA 1VEBA 2VWXA 5B2LA 2R0UA 3DKCA 3F88A 3HVCA 3MN3A 4FKLA 1OMWA 1YDTE 4QMWA 3DY7A 3Q9YA 4ERWA 4AZSA 3NX8A 2JFLA 4BTKA 4F7NA 4BWXA 1JOWB 4LRKA 5J87A 4EBVA 2W1ZA 4GU9A 3V8TA 3RK9A 4BDEA 3ZFXA 4Y83A 4YURA 4XS2A 2BUJA 4EHZA 3U9NA 5JRQA 3CY3A 5GHVA 5LVOA 4ASXA 2YN8A 3P9JA 5FGKA 3UE4A 5A4QA 1XH9A 4Q2AA 2EB3A 1VJYA 4UMRA 5EFQA 1IG1A 3DQWA 3BBWA 5HNGA 4PP7A 3AD6A 5CF4A 4GK2A 1OUYA 4MD9E 3NYXA 4I94A 3UPXA 3LPBA 5IEYA 3R8VA 1KWPA 5CXZA 2OW3A 2PVYA 3DCVA 4WKQA 5TT7A 4E6CA 5B7VA 1P4FA 5AP4A 5BMMA 3P5KA 5HCYA 3ZLSA 4I22A 4IZYA 2YERA 5BVNA 4R1YA 2PZ5A 3CQWA 1WFCA 4FC0A 4YUQA 2Z8CA 3B2TA 3NUSA 2F2UA 3QLGA 2WMRA 2ETKA 2W1IA 4FNYA 4EORA 3Q2MA 5CEMA 4L3LA 3TZMA 1YXTA 2WTDA 3GU5A 4I4EA 5HO6A 2OIBA 3UG1A 3AC1A 2OJJA 4HCUA 4YPDA 1R39A 3R21A 4LGDA 1ZMUA 5KCVA 3F7ZA 3H3CA 3I60A 4RA4A 4RMZA 5HIEA 4NTTA 3R8UA 4DH7A 4NM0A 4FA2A 3BEAA 2R7BA 3KULB 5JFXA 3LM0A 4EK4A 3W8LA 4J53A 3WARA 2NO3A 2HWOA 3A7HA 1OKWA 1ZMVA 2EB2A 4ANQA 1PJKA 4BCMA 5ETCA 3GGFA 2UZVA 4AE9A 4D4YA 3WYYA 3AC2A 3KVXA 4KIKA 3TNWA 2VTJA 3SD0A 3HMOA 3FMKA 3TI1A 4FL2A 4F0IA 3R28A 4D2RA 1NA7A 3QC9A 4FSZA 4NUSA 2VV9A 4TWPA 4YC3A 4I0TA 5C27A 3NS9A 4U3YA 1UKIA 3F5PA 1WBTA 1LPUA 3S3IA 4AXAA 2V7AA 3OTVA 4G16A 4UMPA 2ZB0A 4Y85A 3S4QA 4IM2A 1ZY5A 4FICA 2YIWA 4CRLA 3CKXA 4G3FA 4D2SA 3DBFA 4JG8A 4JNWA 4QP2A 4V05A 3ZBFA 4GJ2A 1ZMWA 5AR8A 4BWPA 4C59A 4FTQA 1SM2A 3PPZA 3C51A 3EIDA 2G1TA 2FSLX 3LXPA 4JIKA 2XJ2A 5AP7A 2ESMA 5BVWA 3T9IA 2CCIA 2JAVA 2W5BA 4G9CA 4F9WA 4RIYA 5DFPA 3UNZA 4E4NA 3MWUA 2YJRA 5KE0A 2XIYA 4WNOA 2ERKA 2XK9A 4OBQA 3KXMA 2BDJA 4H3BA 3GCVA 4BKYA 4CZTA 2X7GA 4B99A 3HZTA 4ZOGA 3IS5A 4YTHA 1QPDA 4BCGA 3SA0A 5I9ZA 1FQ1B 4P90A 4M69B 4ZS0A 3SAYA 3DK3A 1OIQA 5CU6A 3KK8A 3PA5A 4D1ZA 5DRDA 2BVAA 4ZLOA 1WMKA 1H1PA 4LMUA 3NUUA 4IZ5A 2WELA 5F94A 2R9SA 1XO2B 4GYGA 2C3IB 2YIXA 4F7LA 2F7XE 4D2PA 4FKIA 3R7UA 1XHAA 4QYYA 2C3KA 4E4MA 3WIKA 5ANJA 5FLFA 2JEDA 1Y8GA 4BIDA 4PPAA 1WVYA 5AM6A 3UQCA 2GFCA 3WF8A 4FYOA 5DWRA 4WG3A 3K3JA 1FVVA 1O9UA 3MVMA 4HCVA 4DH3A 3DJ5A 4YPSA 4BDKA 5F1ZA 4XP0A 4G3GA 1YOMA 2FH9A 4IMYA 2X2KA 4MTAA 3BLQA 1LR4A 4GK3A 5IH4A 5DPVA 5KX8A 4PWNA 2F57A 1U54A 3MA3A 3NAYA 3SV0A 5FDPA 4ZTMA 1PXJA 5AADA 4M3QA 4AA0A 3IDBA 5CASA 4NJDA 5DMZA 4BYIA 5FEQA 1NVQA 2C47A 2KTYA 3NNUA 3I4BA 5CQUA 4NIFB 4FNWA 5K3YA 4IADA 3R7VA 1JSTA 3CY2A 2WTKC 4FR4A 4E3CA 4OAUC 5AR5A 1KOAA 3Q04A 1WCCA 2UW6A 3LOKA 5HNIX 4RWLA 3QTIA 4U9AA 5KO1A 2G2FA 2OIDA 4OTHA 4U41A 2A2AA 2QO7A 3F2AA 2EUFB 4UX9A 3COIA 3THBA 3VQHA 2YACA 2EXMA 3GFWA 3ZC5A 2BZIB 4EWQA 2OF2A 3BV2A 3HUCA 2JITA 4QPSA 4QP1A 2XK4A 3DTCA 3O7LB 3OW4A 3PIXA 1U59A 3GVUA 3QQHA 4KA3A 5GJFA 4YO4A 3R7GA 5I9WA 2VWWA 4YTCA 3CXWA 2C6IA 4TWNA 4YHTA 3FLNC 4PY1A 3IW5A 3DJ6A 1BX6A 4F09A 3KKVA 4NH1A 3AMAA 3AOXA 3IO7A 4ZY5A 3ZM4A 4ZLZA 4EOOA 2BFXA 3D15A 3MFRA 4WO5A 2IVVA 4JOAA 4QTCA 5G6VA 5JKGA 4G3EA 1B6CB 2CMWA 4XP3A 4YTFA 2IWIA 3RVGA 3QZFA 4KRDA 3FMHA 2BFYA 3C0IA 3WE8A 5CLPA 3SW4A 2FO0A 2XJ1A 3GOPA 2WHBA 2Q0NA 4W4YA 4ITHA 4AP7A 5BVEA 4YJTA 4BDAA 2GNHA 4QP7A 2J7TA 5TF9A 2VX0A 4EOLA 2QOHA 4EUUA 4AW5A 2XK8A 1NVSA 2CN8A 4NZWB 3VQUA 3WOWA 4F7SA 5I9XA 3QX4A 4GG7A 1YXXA 5L6PA 3KMWA 4XLIA 5IH5A 4CCBA 2W1GA 2PVMA 1OL5A 1HOWA 5IH6A 1XH8A 4FVPA 1JPAA 3OUNB 2IZUA 4ID7A 4I92A 2C5NA 3BYMA 1QCFA 4OTPA 3IW4A 2ITYA 3E88A 3FMLA 3VUIA 5LVPA 3OWPA 4KWPA 4WBBB 1YVJA 2XP2A 4FIGA 3NIZA 4FL1A 3CGFA 1FMKA 3I5NA 4WG5A 3VS4A 2HIWA 3D5VA 3ZLXA 4BN1A 4CCUA 4GUBA 4O6EA 4L3JA 3UOHA 3B2WA 4D5HA 3FQEA 3MPTA 3TJCA 5HD7A 3ZSHA 2UW3A 2XNMA 1OIRA 2BROA 4LOOA 2UW9A 4O0RA 5I0BA 3D14A 2PVNA 2JC6A 4YC8A 2JBPA 5LMKC 4C62A 2PVKA 5LCKA 2O63A 3TXOA 3JYAA 4ARKA 2UZBA 4A06A 1ATPE 4NFNA 3DKGA 4UV0A 3PE1A 5CTPA 3K54A 4EH8A 4MEDA 4ZJJA 2C6EA 3H4JA 4AA4A 3ANQA 3MY0A 3UPZA 4OTRA 4WHZA 4E93A 4EH2A 5JK3A 1Q5KA 3CGOA 3TACA 3VUMA 1UWHA 4TN6A 4ZSGA 3LFAA 5EDRA 3M2WA 4IFCA 3IQ7A 3TEIA 4BICA 2DYLA 5E8UA 4YR8A 2ZDUA 4LOQA 3NSZA 3UGCA 4BZOA 5EM7A 3V01A 4CV8A 5D41A 3HV5A 4HZRA 4J99A 2R3MA 1A06A 2ITVA 3HA8A 3VN9A 4GMYA 3ORMA 4ZTQA 4QMZA 2OGVA 2PZPA 2ZM1A 3QLFA 4F9CA 3EQPA 5EW9A 4X3FA 3ODYX 3ACKA 3ZRMA 3RPYA 2XNGA 4AF3A 4WNMA 2A27A 4APPA 4BCQA 1QPJA 2XK6A 5CX9A 5EKOA 5LMAA 2V5QA 2GHMA 1XBBA 2WMBA 3MI9A 3GCPA 3ORLA 4JAIA 4I23A 4U8ZA 2E9OA 3WILA 4FODA 4UALA 3TNHA 1HCLA 3OCBA 2BALA 1OPKA 2J51A 2OSCA 4N4SA 4NWMA 1SMHA 2BIKB 4QMVA 3H0ZA 2C6LA 2ZV9A 1Q62A 4FTIA 4ITJA 1ZWSA 4R5YA 3BU3A 3UP2A 3UTOA 4I6HA 5AR2A 5HESA 4PUZA 4R6VA 3F3TA 3R1QA 4Y5QA 5L2QA 3VS6A 1BI8A 3LJ1A 3DFCB 3FHRA 4TYJA 5JFVA 2ZM4A 4FT3A 1DS5A 4OT6A 1BL7A 4QMYA 3TWJA 4AU8A 1H25A 4RBLA 3ZH8A 2C5XA 3CBLA 2WB8A 3ENHA 3TTIA 4MXYA 3FLSA 3NUPA 3R0TA 5AUTA 3M42A 1YI3A 4HPTE 3T3VA 2P0CA 1OPLA 3C4XA 5FQDC 2XF0A 1UU3A 3QFVA 3K2LA 3VBVA 1URWA 2UZUE 3TNIA 2VTIA 3QA8A 4FZ6A 4JAJA 4FKQA 3QWJA 4MXXA 4OTFA 5L2TA 3G51A 5JEBA 1BKXA 1JQHA 3OHTA 4L44A 4J1RA 3QHRA 1M2QA 3V5LA 4PDSA 4F1TA 3BGQA 3E8NA 3BYVA 2YM7A 3ELJA 3RCJA 4CZUA 4HVGA 5IU2A 2JDRA 2WQOA 2HY81 4HVHA 5HE3A 4GJ3A 2BRNA 5KBRA 3FYJX 2BPMA 4JQ7A 3EQBA 3UMXA 5KMLA 5HX8A 5CT7A 4EWHA 2PMOX 5JT2A 4IACA 4D2WA 4QQTA 4FVRA 4YLJA 3EZVA 5AUXA 2VTTA 2JKKA 5H8BA 3SLSA 3DQXA 2O0UA 2C4GA 2PE2A 1APME 2PWLA 1PMNA 3E64A 3DA6A 2PE1A 3F3ZA 4C2VA 4DINA 3DBEA 5AWMA 3NYVA 2R3JA 4IB0A 4U45A 1XH4A 5CU0A 4M14A 1STCE 2VAGA 4KKEA 4CRSA 4RPVA 3AC8A 3DU8A 3NUNA 4G6LA 1GZ8A 1PMVA 4BDBA 4DEIA 5EYKA 5AAEA 3D7TA 4YJOA 4BTFA 2C5OA 2PVFA 5M44A 2XZSA 4GG5A 5LARA 4DTKA 1ZOEA 2VWIA 2CSNA 3MJ1A 4AOJA 3UQGA 1LP4A 3Q6WA 5KZIA 3W2SA 2Y4IC 2VU3A 3HMMA 1IASA 3D94A 2CPKE 4DCEA 3VHEA 4ZY6A 5JZNA 2RIOA 3PY3A 1P14A 4QMXA 1JVPP 1EH4A 5C1QB 5CZIA 1M7NA 2YM6A 4EOIA 3U6IA 2YDIA 4QMUA 3RAHA 4NKAA 4C4EA 5AR3A 4HVIA 4XLVA 3KK9A 4AX8A 3MY1A 4I4FA 3ROYA 1UKHA 1ZYLA 1Z5MA 3Q5ZA 4B4LA 3DPKA 4WUNA 3VWAA 4K9YA 3G33A 3FQHA 3ZONA 3NNWA 3DBDA 3O17A 5FM3A 1H26A 3EQFA 4U43A 3GCQA 4GW8A 2QCSA 3BHVA 4QYHA 3QRKA 5FXQA 4CKRA 5E8TA 4MX9A 4XJ0A 1TQIA 2RF9A 2GNIA 4RX9A 4AUAA 5A3XA 2WIPA 4DH1A 5C01A 3HDNA 2DS1A 1YOLA 2PSQA 2C0OA 2PVLA 3O0GA 3BX5A 3CD8A 5ANGA 4BZNA 3UZPA 4ZIMA 2W7XA 5HTBA 4D1SA 3PPJA 2WPAA 4LFIA 1OGUA 3L9NA 4CT2A 3O7LD 1H24A 4DITA 4XG7A 4KKGA 3ORNA 4G5PA 4JG6A 4KIKB 4BF2A 3GU6A 4DG0E 2RSVA 3MTLA 4EK5A 2R0IA 4EZ3A 2C1AA 1FPUA 1H0WA 4IZAA 3Q96A 5T3QA 4C4HA 5AV1A 3NEWA 5HG8A 3TN8A 2B9IA 4O2ZA 2CLXA 2H6DA 5DH3A 3F3VA 3VW8A 2UZDA 3RALA 3OXTA 5K0KA 3R6XA 4L52A 2ZAZA 2F2CB 5JGDA 1GIJA 3PIYA 4PMMA 4YP8A 3DOGA 5BYZA 4FV7A 4K0YA 5G1XA 2XB7A 5DN3A 3W1FA 1OL2A 4DGOA 3SRVA 3O96A 3PZEA 3WZUA 2RFDA 2P4IA 4FK6A 3KFAA 4HCTA 4HGEA 4O0XA 3PSCA 3OEZA 1OKZA 2B52A 4DEEA 3TV6A 3ORPA 3NWWA 4AFEA 2B53A 2B9HA 1H28A 4TY1A 2QC6A 2VO6A 5DIAA 4Z55A 4I6QA 3AT2A 2CGVA 4KINA 3I7BA 5HLWA 5E91A 3W18A 1WVWA 4J8NA 4Q9ZA 3F5XA 2R3OA 4RIYB 4EKKA 1SVGA 4YLKA 3ALNA 2X0GA 3F5GA 3NGAA 4C4JA 4RLLA 4EOQA 5EW8A 2WMUA 1WBVA 4FTTA 1Q97A 3U6HA 1OI9A 2QLUA 3QD4A 4O38A 3QF9A 1WBSA 1P2AA 2SRCA 1KE9A 2H9VA 4RJ8A 4AN3A 3NCGA 5E8YA 2OBJA 5GZ8A 3G0EA 3GB2A 4QP3A 2PVHA 5CY3A 5GJGA 1GZNA 3POOA 3BWFA 4JX7A 5DR9A 3V5PA 5A9UA 5BUJA 4UBAA 1XQZA 3C4FA 3UIXA 2PMNX 4E20A 3OY1A 4Z7HA 5BQ0A 2F7ZE 3QKKA 1JKLA 2JIVA 3QC4A 4XNEA 1MRYA 3G6HA 3QRIA 5CF8A 2J0JA 1YQJA 3GC7A 4YBKA 4UB7A 2W99B 2XMYA 3BHTA 3F3WA 3HKOA 3Q32A 1P4OA 3FMNA 3ZLWA 4NSTA 1JNKA 3LFBA 1U54B 4QMTA 3UIUA 4I41A 4QTAA 4F99A 3NAXA 2GS2A 4TNDA 4GL9A 4RJ3A 3V6SA 1RW8A 4AN9A 2JFMA 4CMOA 3MFTA 3E93A 3UDBA 4H39A 5FBNC 3TIZA 2JAMA 3FC2A 3KXZA 4PL3A 4DEGA 4AZEA 3I5ZA 3SC1A 3UG2A 3FJQE 1PW2A 3DK7A 5J9ZA 2AC3A 4L53A 5AUYA 4AGWA 2WD1A 2QOQA 3A4PA 3ZYAA 4LGHA 4QTEA 4D4RA 3PG1A 2Y8OA 4G5JA 4QO9A 1I44A 3FAAA 3ZO1A 4XMOA 4PMTA 3QZIA 4NCTA 2GNGA 3PSBA 2OKRA 4G31A 3S00A 4JI9A 4O0SA 3BU6A 1H1WA 3UC4A 1S9IA 1UU7A 3G9NA 5E8VA 2GDOA 4I0RA 4MNEA 3BI6A 3EN5A 5HE1A 4BCKA 3UO5A 4D9UA 2JGZA 3KRXA 4GRBA 4DN5A 2VTSA 3MGYA 4FSQA 4CFFA 4BGGA 4N70A 5HE2A 5I3RA 3MVHA 5HKMA 4KS7A 4NU1A 5B2KA 3CIKA 3FKOA 5IA4A 3EQCA 3HP2A 3QXPA 4FKGA 2PVJA 4RVTA 3V04A 4BIBA 3P1AA 4PX6A 3AGMA 3R7OA 3V6RA 3C4WA 4WSQA 4X6QC 4CLJA 4C3FA 3HNGA 3ODZX 4AE6A 4C2WA 5L4QA 2CDZA 4QYEA 5K9IA 2XM8A 3VJOA 1Q3WA 4AT3A 3OXZA 1BMKA 4KBAA 4A9YA 2OFUA 1PXPA 1R1WA 1Y57A 4S34A 4ZTSA 1IA8A 1WVXA 2E9PA 4U81A 3KRJA 1JSUA 1UNHA 1OL7A 2UW5A 4U3ZA 4YO6A 4CTCA 3RWQA 2UZTA 2X4ZA 2YITA 4BRXA 5JH6A 1J1BA 2EWAA 4YNEA 3QCSA 2FGIA 4OTDA 4G3CA 4II5A 4I0SA 1MQBA 2X8EA 4BDFA 4JIAA 4M97A 3T3UA 4FZ7A 5M56A 2C6OA 4IJPA 5AAFA 2BAJA 4IX4A 4ZJIA 4PF4A 2G9XA 4D0WA 3IOKA 2HELA 5J9LA 1F0QA 5CNNA 4DFXE 3HMNA 2W5HA 3W2CA 4JDKA 2PMLX 2UZWE 3AT3A 3B8RA 2J2IB 4ANNA 3ETAA 3P7BA 5HORA 1DAWA 4EOMA 2ZB1A 3AC3A 5CEOA 4D5KA 4TL0A 5JFWA 3KEXA 3KC3A 5GJDA 2QU6A 2YEXA 3H0YA 3HMIA 3KCKA 5CSXA 4BDIA 4O0UA 4GSBA 4QNYA 4F64A 4BCOA 2NRUA 3JXWA 3GNIB 3GXLA 3N9XA 4FL3A 3L9PA 2PK9A 5ANOA 4LQMA 3I0OA 4JR3A 4A9SA 4RVLA 4QOXA 4W4XA 5JN2A 4N6YA 3O23A 1YRPA 3R2YA 4HJOA 2C6DA 1ERKA 1Z57A 3AQVA 3QCXA 3BEGA 3RKBA 5CAUA 2IJMA 3FKLA 3AD5A 3GQIA 3SDJA 2NPQA 4BHZA 3BPRA 3KN5A 3LW0A 1Z9XA 3EOCA 3V8WA 4X2FA 2Z7SA 2J0IA 2OFVA 2X6EA 3CPCA 1UU8A 3KXNA 4WBOA 3PXFA 4CFVA 3DKFA 3GC9A 3OT3A 4FTOA 4IVBA 3D2KA 5AUWA 1Q4LA 2BHEA 4TRLA 5J95A 4C34A 4F63A 5AAGA 1LUFA 4XV9A 3V5TA 4G9RA 2GNLA 1TQPA 4S33A 4ZEGA 3UOLA 3PZHA 3WF9A 3R9DA 2QKRA 2QO9A 3R00A 5H9BA 4X3FB 4R7IA 2R2PA 4C33A 1RDQE 2BDFA 3C0HA 3H10A 4S32A 3I6WA 1KE5A 3EYGA 3FLWA 2ZVAA 3H9OA 3P78A 4DC2A 4CKJA 5DNRA 4YZBA 2WO6A 2WMVA 3A8XA 5HEZA 2XVDA 3ACJA 2IO6A 3ZXZA 2IZTA 1FOTA 3NR9A 3CEKA 3A8WA 5AEPA 3UOJA 3P23A 3ZMMA 3AMYA 3R1SA 4KIOA 4BTJA 4EOJA 3QCQA 4ZLYA 4DHFA 1YXSA 1G3NA 1I09A 3DDQA 3S2PA 1TVOA 3L8VA 3OXIA 4QQ5A 4RGJA 4BFMA 3RTPA 5AP2A 4PMPA 5JGAA 4IWPA 2WFYA 4E8AA 5ANKA 3FMJA 3ZSGA 3BV3A 2P2HA 4TNBA 4LMNA 3QD2B 2VTAA 4F70A 3KRLA 3RP9A 2C6TA 2I6LA 3TIYA 4FSTA 3MW1A 2ZV2A 1MQ4A 3TL8A 5CAVA 4X2NA 4EHVA 4H1JA 3RAIA 4ACCA 3ZS5A 2YJSA 5HIBA 5IUGA 4IC8A 4L42A 4ALWA 1W7HA 3FMMA 4QQJA 4UXLA 3FI3A 4EH3A 2O3PA 3R1YA 4LL5A 4IQ6A 4W4WA 4IFGA 5DT0A 2WMAA 4DGLC 3OROA 3WIGA 4AZFA 4V0GA 1PY5A 4PDPA 1MRVA 1OIUA 2QVSE 3PA3A 5I5ZA 5DT3A 3E62A 4J97A 1CDKA 5KZ0A 5AP1A 2EXCX 4FBXA 2W1FA 3EN7A 2Z60A 3LFFA 3PE2A 4FTNA 4TXCA 3C9WA 4J95A 4AW1A 4EHEA 3FDNA 3R71A 3UOKA 3MPMA 3PA4A 2HZIA 3ET7A 4U44A 4KNBA 4EBWA 2ERZE 3CLYA 2ZDTA 4MWHA 4JT3A 4QRCA 4FKSA 4PDOA 4F65A 4XEYA 5AV2A 2OJ9A 3ROCA 2OICA 2XCHA 4KIQA 1H4LA 3MH3A 4WNPA 4LUEA 4X2KA 4FSYA 3TCPA 3QTZA 3HV4A 1WBPA 2VX3A 2FVDA 3AG9A 3ZRLA 3UYSA 3HUBA 4YSJA 1R3CA 3EKKA 3U4UA 3LXNA 4KD1A 3DLSA 4ALUA 1DI8A 2HYYA 2ONLC 4O1PA 4C36A 1JSVA 3IDCA 3O71A 5EYMA 5IDNA 3ZEPA 2OXDA 3P79A 1AQ1A 3I79A 4YGAA 1ZAOA 2UZLA 2WTJA 2HZ0A 1REJA 2FA2A 4DYMA 3RPVA 2NP8A 2VTLA 5ICPA 4OR5A 3D7TB 2XIKA 1OL1A 2C68A 2X7OA 4V04A 3CR0A 2WQMA 3RK7A 3UQFA 5L8KA 1PXMA 4BDGA 3W2QA 3F5UA 3F9NA 2UVYA 4J96A 4BC6A 3A7IA 4FF8A 5LOHA 5AR7A 2H34A 2WMSA 3BU5A 5M57A 4Y73A 3RZFA 4ZZNA 1XH7A 4CZYB 2C6MA 2O65A 4UZDA 2J0LA 4FTLA 4X3FC 2X39A 4P7EA 3UYTA 5A6OA 5HX6A 3MB7A 4G6OA 5AA9A 3GBZA 3E7OA 4FNXA 4YLLA 3FQSA 4QMOA 4BTMA 3HEGA 3PJ3A 4RIXA 1GNGA 5JGBA 3H30A 2ITZA 2J50A 3E8CA 4D4SA 3PRIA 1O6LA 3R01A 3C50A 4IVAA 5AUUA 4L45A 3Q4UA 4JVGA 3OWJA 5EDPA 3QUPA 4E73A 3OEFX 5I9YA 3FSFA 2OIQA 2WOUA 3F69A 3PY0A 1CSNA 3FZ1A 3GCSA 4DFLA 4C61A 2XM9A 3TZ9A 4E7WA 2BCJA 5IA1A 3D83A 1TKIA 2OJGA 5FP6A 5CI7A 3A99A 3LHJA 3ANRA 4QP4A 2QD9A 4K8AA 3PLSA 1G5SA 3AC4A 4BHNA 3I6UA 2VO7A 4U6RA 2IN6A 3LJ0A 3LIJA 4S30A 2OZAA 3UZTA 3LQ5A 4QNAA 3ZBXA 5LVLA 4CLIA 4D9TA 2LAVA 1YKRA 4R5SA 4JLCA 4YJQA 3CD3A 1FMOE 4YSMA 5IDPA 4U97A 4UZHA 3CPBA 2IZRA 5CQWA 3C7QA 4IW0A 4LM5A 2BIYA 2YIYA 4G2FA 4P5QA 5DBXA 5EM6A 4KRCA 4C37A 2X1NA 3LE6A 4GUEA 5AP0A 2VWUA 2W0JA 3H9FA 4IBMA 4QP9A 4E6QA 3LFEA 5ACKA 4M67A 1GIHA 4FKWA 3D9VA 3SRVB 4LI5A 4UN0C 3P0MA 3Q6UA 5FTOA 4IX5A 3PJ2A 4CQGA 3Q4CA 3BHHA 2VTOA 2OH4A 3VS0A 3UJGA 3HECA 3LCDA 1OL6A 4E4LA 3BYUA 1QPCA 3R9OA 4AGUA 3NPCA 3U51A 2VTPA 2W1CA 4CEGA 5JRSA 3DGKA 4X21A 2H96A 4F6WA 5HTIA 1QMZA 3UBDA 3LCKA 3LFCA 3V5QA 3BLRA 3D7ZA 2WU7A 3F3UA 5HLPA 2QURA 5C9CA 1J3HA 2YCFA 2XCKA 4M0ZA 5AUZA 4JBPA 3TV4A 4WG4A 5LWNA 1JAMA 2XNNA 2ZV8A 3BLHA 4PNIA 3O8PA 4BL1A 3RPRA 4BCHA 4B8LA 2ITWA 3KXHA 5FEEA 1ZARA 3TUCA 1UV5A 5IF1A 4GS6A 2YM5A 4W9WA 1B39A 3Q9ZA 4AW0A 2BHHA 2BMCA 3O50A 5L8JA 4UY9A 5TOZA 2YM4A 4CFWA 3C13A 1W8CA 4FMQA 4A9TA 5CALA 4FEQA 4BIEA 4AOTA 3FLYA 4XV2A 2W4OA 3QTUA 3ZHPC 5AIRA 3HRCA 3VC4A 2C30A 3KF7A 4CFUA 4D1XA 5ANIA 1R78A 4CTBA 3EFLA 5CSPA 2GS6A 3WF7A 3DV3A 2EXEA 3RNIA 3IONA 3R73A 3OBJA 4CXAA 1S9JA 4IHPA 5TO8A 1J91A 4IANA 2XIRA 4NEUA 4PQNA 3O2MA 3R83A 3HRBA 5T68A 4LV5A 3RWPA 4DGNA 5LMBA 4M7IA 3II5A 4XH6A 2BRGA 4RJ4A 4RIWA 2W06A 2X81A 3OD6X 3OCGA 2GMXA 4QPMA 4WD5A 4MYGA 4MXCA 4RFYA 2JKOA 4EK3A 1CKJA 5KKRB 5LWMA 1XWSA 4CKIA 2X7FA 3PWDA 2EU9A 4ACGA 5DE2A 4EYMA 3RGFA 4RX8A 4XG3A 5CF5A 2PZIA 4CSVA 1URCA 1YWVA 3RINA 1FVTA 4D2VA 4KB8A 3IW8A 2X2MA 4FSNA 4ASEA 2ITUA 4ZTRA 5HTCA 2X9EA 4WRGA 5KMNA 1PYXA 4QP8A 1UU9A 2QLQA 4BKZA 3PP1A 4Q5EA 2O64A 4JBVA 5JQ5A 1UVRA 3OOGA 5F95A 5KHXA 1BYGA 5E8XA 4BCNA 4R8QA 4FV2A 3MA6A 4MNEB 4ZJVA 1GY3A 2UW8A 3E87A 4TT7A 4W9XA 1OKYA 5M4CA 1V0PA 1H8FA 3ZDIA 5LCJA 2B4SB 2QHMA 4CYJA 2BR1A 4WOVA 2C69A 2BTRA 2J5FA 2Y9QA 4KIPA 3OW3A 4FTAA 4J8MA 3E3PA 5HICA 4Y95A 4BGHA 5HU3A 3BGZA 4FKTA 2WOTA 3IW6A 4A9UA 3KRRA 4FKOA 3FY2A 4I20A 2W4JA 2W17A 2E9NA 2X6DA 4WT6A 2XUUA 3R1NA 5CSWA 4DGGA 3KY2A 1UWJA 4EH9A 2YWPA 4FG9A 1H08A 4FT9A 4TZRA 2Y0AA 3P4KA 5C03A 4R3RA 4A9RA 3BBTB 5KMIA 4KABA 2JDVA 4U0IA 2ITPA 3MBLA 4UEUA 5GNKA 4MH7A 4IWQA 4RJ5A 3Q9WA 1CTPE 2FSMX 4NKSA 3QBNA 2BRMA 2BZHB 3DZOA 2QHNA 3P7AA 4L7SA 2QR7A 4O22A 4C8BA 2AUHA 3BQCA 5KBQA 2PVRA 4I6FA 3A7JA 3BZ3A 5CANA 4Y8DA 3LFQA 3W55A 3NRMA 4AZWA 2RL5A 3LCOA 1AGWA 2WTCA 1U4DA 3PP0A 4ZY4A 2C5YA 3KB7A 4XV1A 3MV5A 4L67A 3CJFA 3FWQA 5EW3A 1XJDA 1XH5A 2VWVA 2JIIA 4HNFA 4L68A 4AS0A 3KXXA 5AR4A 4BZDA 4PPCA 2V55A 5LQFA 3EQHA 3RAWA 4B8MA 3ORIA 3RM6A 2R5TA 4NM5A 3R8LA 1IR3A 4MBIA 5EM8A 2ZM3A 4IAZA 5CWZA 3JUHA 3VULA 2WIHA 4PTCA 5EHLA 2WZJA 4ZTLA 3IW7A 2PTKA 4DEBA 4E6DA 2VRXA 3QQKA 4LOPA 3BELA 3KRWA 3UODA 5ITAA 2J4ZA 4RWJA 4AGCA 3NW5A 1KE8A 3QKMA 3DBCA 3MFUA 5CAQA 5FP5A 3QTRA 2UW0A 5CVFA 4F9YA 4TWCA 5LMKA 3MSSA 5J1WA 1PF8A 1GAGA 3OWKA 2A1AB 4FUYA 4AOIA 3QQJA 1IEPA 2F7EE 2JD5A 1KE7A 2J9MA 3F2NA 1Q61A 2HW7A 4FTJA 4Y5HA 5CEPA 1PXIA 5L2IA 1ZLTA 2H8HA 3PJCA 4KBKA 4EQUA 2WMTA 3FUPA 4BGQA 2E9VA 3WE4A 4APCA 2HENA 2PL0A 4MD7E 5EH0A 4YTIA 1YWNA 3SW7A 1ZYSA 4K18A 3PWYA 4PTEA 5ETFA 5I9UA 4BDDA 1W98A 3D5UA 4O0YA 3JY0A 1ZYJA 3MH1A 2FSTX 4USDA 3P08A 3PVUA 1BLXA 3QX2A 5CNOA 3KMUA 4BDHA 4YC6A 1DAYA 5ACBC 4CVAA 1DM2A 4IAIA 3ZO2A 4I93A 4F9BA 1M2RA 4MQ2A 4JDJA 4FKVA 3OCSA 4AFJA 2HOGA 3EL8A 4RQKA 3U4WA 2I40A 1REKA 3PG3A 1H01A 3QRUA 3LFNA 4GK4A 3V5JA 5JZJA 4ZTHA 5L6WL 5E92A 1CKPA 3DTWA 4EOPA 5L8LA 3RI1A 3OT8A 3EQRA 4D28A 4OUCA 4OTQA 4U40A 4ZZOA 2VGPA 2R3QA 3EJ1A 4TYHA 3GP0A 5J7HA 1O6YA 1SVHA 3KU2A 3PPKA 3R63A 4IM3A 2W9FB 2P33A 5HO7A 5DEWA 3LCTA 2IW6A 2Y6MA 4V0GB 4X0MA 3Q4ZA 3WYXA 4GYIA 1YHSA 2YM8A 2JDSA 4D58A 3IK3A 4QMNA 5AA8A 2WKMA 3M1SA 3NCZA 5H2UA 4WNKA 5ETIA 5LVNA 2YDKA 4DEAA 1F5QA 1DI9A 5IMEA 4EQMA 1BUHA 4AN2A 1M14A 4FTRA 4BCPA 5EHYA 5FXSA 2GPHA 4EK6A 1XBAA 5KMKA 5HVJA 1YOJA 5DRBA 2CGUA 3VJNA 1Q8ZA 3FLZA 3T8OA 3ZSIA 4MK0A 2GSFA 2QODA 3HL7A 4TWOA 5CU4A 3R22A 4F0FA 2ZMCA 3PVWA 3WZJA 4PMSA 1ZYDA 1GZOA 4IX6A 3U6JA 5C26A 3LXLA 2VZ6A 3OS3A 4U79A 3KCFA 2NRYA 3FKNA 4JDIA 4FZDB 1Q41A 2XNEA 3CC6A 4W8EA 5AUVA 1R0PA 3ZUVA 2JKQA 1V1KA 3A7FA 3HA6A 3U9CA 4NM3A 2OJFE 2OF4A 2UZNA 4PL5A 3JVSA 5E8SA 2OXYA 3NDMA 4J7BA 2Z7RA 3NIEA 2XBJA 1ZXEA 4UMUA 3JS2A 3FYKX 3HMPA 5FDXA 5CEKA 4RC4A 4CT1A 3CTHA 3FZSA 4QMSA 5DA3A 1U5RA 4P2KA 3KQ7A 5EDQA 3UNJA 5FEDA 4C35A 5BVKA 1OIYA 3PTGA 2X8IA 4IXPA 3K5VA 2Y6OA 4EL9A 4Y72A 3QUDA 4RWKA 1JBPE 3EN9A 3NYNA 1YI4A 5E8WA 4C7TA 1GZKA 2R3FA 4RIXB 4XBRA 2BKZA 4RSSA 4MVFA 4ZXTA 3VS5A 2BILB 4YU2A 2OXXA 2A19B 5F20A 3SXRA 3ZUTA 3WF5A 2VTRA 3FE3A 2YISA 3WZEA 4D55A 2RFSA 4DH8A 4GEOA 3BWJA 3TJDA 5IZFA 2ITNA 4FTCA 4XBUA 4JRVA 2Z7LA 4FV9A 5A4EA 4NJ3A 2WMWA 2QI8A 4F7JA 3E5AA 3NNVA 3IKAA 2W1DA 4QYFA 3VW6A 2XRUA 3A7GA 4DEDA 1FINA 4EJNA 3QQGA 5HBEA 2OU7A 3R2BA 3UVRA 3FXWA 4EEVA 4QTBA 5CEQA 2F4JA 1YDSE 5IEXA 4RT7A 2UZOA 4H36A 5AM7A 2OZAB 5D9HA 3DXNA 2X9FA 4N0SA 3PUPA 1OKVA 1H1RA 4EHGA 2R3HA 5CSHA 5M4FA 5A6NA 3AXWA 3LLTA 4EZ7A 3PXRA 1NVRA 4IB3A 3RCDA 5FXRA 2VNWA 2O5KA 3B8QA 3CQEA 3G9LX 4QPAA 4UYAA 4BDJA 5BVOA 4GT4A 2ZMDA 2WTWA 3JY9A 2PZRA 2QR8A 1PMUA 2UUEA 4JQ8A 3GUBA 3G6GA 4QT1A 4ANSA 4UMQA 2A0CX 1FGKA 2R3GA 5HE0A 3K5UA 3Q5IA 3QYZA 2G15A 1JKKA 4F4PA 3QCYA 4L43A 3Q4TA 4D0XA 1W0XC 3FXZA 2VO3A 4J71A 3PFQA 1K2PA 1NXKA 4WIHA 4XRLA 4CMTA 2QOFA 4ANOA 2R4BA 3C1XA 3W2OA 4FV1A 4BKJA 2LGCA 2F9GA 5BMSA 3FC1X 4JR7A 5DI1A 2JLDA 2HZ4A 4ZAUA 4CD0A 5HHWA 3TNQB 3NW7A 3FBVA 1M52A 3ZU7A 4NTSA 2W5AA 3RHXA 3MVLA 4E5BA 2IVUA 3TUDA 3VRZA 1E1VA 3OG7A 4CMUA 4DFZE 3RHKA 5E1SA 4BVUA 3K3IA 4ZTNA 2OWBA 3ZZEA 2Z7QA 2VWZA 1ZRZA 5FTQA 1OUKA 3BE2A 3QZHA 1K3AA 4JDHA 2BZJA 4L46A 3OVVA 3AMBA 2J90A 4W8DA 2WQEA 3QXOA 2QNJA 2UV2A 1OITA 3HV7A 4K33A 4MXZA 3FXXA 4HPUE 1M7QA 1VR2A 4U80A 4GT3A 4FOBA 2V0DA 2R3IA 3VUDA 3Q52A 4E5WA 3R02A 4F08A 1T46A 3OF0A 3PJ8A 2DUVA 4M12A 5HOAA 4BBMA 4F6SA 3DK6A 5EOLA 4FV5A 3ULIA 4KAOA 4IIRA 2IZSA 2HXQA 4TYEA 3IGGA 3HV6A 4DFNA 3P86A 1H07A 2BAKA 3Q60A 5K0XA 2YIRA 4RQVA 4AT5A 4RIWB 5BUIA 3RK5A 3Q3BA 3LCSA 4PTGA 3EN6A 4NT4A 3V8SA 4I5MA 4YZ9A 1TQMA 3QTWA 4MXAA 4O6LA 5FM2A 3ZCLA 4DGMA 4M84A 4YJPA 4QD6A 1KE6A 1MRUA 3BKBA 4BI1A 3COHA 4ANBA 5BNJA 3EN4A 4XX9A 4FZFB 3DAEA 2Z2WA 3BYSA 4YZCA 1YXUA 2Y4PA 4FG8A 4I1ZA 1PYEA 2WQBA 3PIZA 4IC7A 4JJRA 4BI0A 5GZ9A 5JMSA 4A7CA 3KA0A 1W83A 5DOSA 3HLLA 4BI2A 3HDMA 4EOKA 2ZJWA 4HZSA 4NW6A 4DFYA 2C0TA 5KNJA 3VUTA 5M4IA 5IUHA 2W05A 3BQRA 3ZO4A 3FZOA 4GVJA 3BE9A 5HU9A 2WEIA 3ORXA 4G3DA 5LXMA 3KVWA 4A4XA 4ASZA 3BCEA 5AV4A 2WQNA 3ALOA 1KV1A 4XYFA 4LUDA 3A2CA 4RC2A 2WTKB 3ULZA 3FSKA 2XEZA 3QGYA 5TR6A 4LRMA 1QL6A 2IVTA 4KS8A
chains in the Genus database with same CATH superfamily
2RGPA 1RQQA 3QQFA 5H3QA 5HNBA 3OCTA 5HIDA 3UIMA 2AYPA 2HWPA 4L3PA 2VX1A 4XP2A 1LEWA 1YXVA 3BYOA 3QGWA 5IA0A 3QTQA 5BPYA 3F7WA 4E1ZA 4JRNA 3I1AA 3I0QA 2P2IA 3GQLA 3MVJA 2W9ZB 2W4KA 3ERKA 4D2TA 4HYUA 2QOBA 4F6UA 4RC3A 4HGTA 4QP6A 1OECA 4RZWA 3NW6A 2GFSA 3I81A 3LQ8A 3I7CA 4MF0A 4OTWA 4ENYA 4ITIA 3DKOA 4B7TA 5M53A 2J0KA 3HX4A 4GU6A 1OZ1A 5H8GA 5I3OA 4XG8A 3ZUUA 4EUTA 2QOIA 4FTMA 5KUPA 3OWLA 5D12A 2E9UA 4M13A 3QQLA 3ZZWA 3QRJA 1JLUE 2XKCA 2YABA 3HP5A 1OPJA 2B7AA 4RJ6A 4ZZMA 5E8ZA 2BRHA 3OY3A 5CU2A 3PYYA 3ITZA 3W16A 3LFSA 2C0IA 4TW9A 1YWRA 1KOBA 4EC9A 5A14A 1WZYA 1F3MC 3L9MA 4YJVA 3RBWA 5L6OA 4AG8A 4GIIA 4YNOA 3FL4A 4JQEA 3SOAA 3D4QA 3LJ2A 5EHOA 3FZTA 4JBQA 3SX9A 4A4LA 4S2ZA 4PV0A 4YZNA 2Q0BA 4L00A 2YIQA 2CGWA 4HGLA 4ZK5A 4AGDA 5DLSA 2CLQA 2QU5A 3EMGA 5FWKK 3SXFA 2XRWA 3PY1A 2XYUA 3L9LA 4QMQA 5F9EA 4H3PA 4ANMA 4LL0A 2E2BA 4XG2A 4JBOA 1JKTA 3VUKA 3PJ1A 1M2PA 3L8SA 4IE9A 5FG8A 3EWHA 3LMGA 4C57A 3JVRA 5D10A 2ITTA 4ZSLA 3WI6A 4EYJA 5BVFA 1Y91A 2A4LA 4O2PA 5ANEA 2PE0A 5EK7A 3WZKA 2R3PA 3HGKA 5HVKA 5BYYA 4H3QA 3GI3A 2ETMA 5ETAA 4ALVA 3VUHA 1RE8A 2ITXA 1ZOHA 3S0OA 4KSQA 4ENXA 4Z3VA 3FMEA 5EI8A 5LVMA 4RWIA 4FX3A 4NK9A 4RFMA 1PKDA 2VTMA 4E5AX 3QRTA 2PY3A 2OI4X 4XOYA 3ZFYA 2QQ7A 1A9UA 3U8WA 1GJOA 1Q3DA 2R3KA 3CCNA 3GFEA 3OP5A 3QL8A 5CYIA 5A54A 2XKDA 4OGRA 5IUIA 1W84A 4UXQA 3C4CA 5L2WA 5CI6A 3ZC6A 3SVVA 3TKIA 2IW8A 2ZV7A 2HCKA 4X6RA 3TTJA 4N6ZA 3VBWA 3G2FA 2IF8A 3C4EA 3WF6A 4HYIA 4I21A 4TPTA 2QO2A 5IPJA 2ZYBA 2WMXA 3R7YA 4FV3A 5AIKA 3GU8A 2FUMA 2OJIA 4L9IA 4IEBA 3R04A 4I24A 1V0BA 2UVXA 3AD4A 3DAJA 1YW2A 2XEYA 2XH5A 3KN6A 4TTHB 4X7QA 5TE0A 5AX3A 2BDWA 2QKWB 4Z7GA 3OFMA 2BAQA 4KBCA 4FRFA 4BB4A 2YCSA 4LV8A 3QHWA 4FV4A 1GIIA 3O8UA 4O4BB 5HO8A 3R7EA 5EI6A 4HOKA 4GIHA 4O0TA 4EKLA 2CCHA 2I0HA 4GVAA 3GOKA 3G90X 3KF4A 3IDPA 2O8YA 4X2GA 2UW4A 5BUEA 4BBEA 3QWKA 4ZSAA 5HQ0A 4AW2A 5IA2A 3DB6A 2GTNA 4IM0A 3EZRA 4IVCA 4PL4A 2J5EA 1Q99A 2ACXA 1MUOA 3LZBA 4NFMA 4Y46A 2CGXA 4YJNA 3VBQA 2HK5A 4TYHB 2JDOA 2REIA 2XA4A 2YM3A 4YBJA 3E63A 2X8DA 3FHIA 4S31A 5DGZA 3ENMA 4FSWA 1YI6A 4XCUA 1Q8TA 5B2MA 3IPHA 4ERKA 2PZYA 4WRSA 5T6KA 4XUFA 2C1BA 3FL5A 4FTUA 3V3VA 1FGIA 1ZZLA 4C58A 4K6ZA 4FIEA 2GS7A 5HG7A 3GENA 4R1VA 4KSPA 4QMLA 3W2RA 3CTJA 1ZY4A 4FGBA 5EM5A 3GC8A 3KXGA 4AAAA 4RX5A 2PUUA 4DEHA 2G2HA 4XOZA 4BCIA 4Q5HA 1UNGA 4LRJA 3EQGA 2I0YA 3LFDA 4BCFA 1W82A 3EFJA 1TZDA 4YHJA 5AP3A 1ZOGA 2PMIA 3E7VA 2R64A 4BDCA 5CS6A 4K1BA 3OUKA 4RVMA 4MNFA 3E8EA 3G5DA 1B38A 5J5TA 3OC1A 4TYIA 2XKFA 4XHKB 5J1VA 5CVGA 1XR1A 2F49A 3GU7A 4BWKA 5JFSA 3UG1A 3VNTA 5LJJA 5A4TA 4UMTA 5KHWA 3NUXA 4EH7A 5J5SA 3SOCA 5CAPA 3EL7A 4HVDA 1R0EA 4K77A 2GNFA 3COKA 5DG5A 4F1OA 4ACMA 1SZMA 3FI4A 4OBOA 3TT0A 2YDJA 4EZ5A 1OM1A 4QTDA 3BGPA 5AP5A 5AV0A 4RFZA 4O0WA 3ORKA 2ONLA 4IAYA 2C6KA 3OOMA 5DVRA 2BZKB 3EHAA 2VD5A 2XNOA 3QYWA 3QD0A 3MB6A 4MF1A 3TNPC 5L3AA 3EKNA 4FNZA 3MFSA 3FPQA 4FOCA 4XG9A 5B0XA 5IG1A 4O4DA 2B9FA 3UIBA 4J52A 4ACDA 2UW7A 4C4IA 3DS6A 4USEA 4BCJA 4OT5A 4EI4A 3OTUA 5EYDA 3R9HA 2XIZA 4MXOA 4FG7A 2QOKA 4GFGA 4IWDA 2CN5A 2Y4IB 3QD3A 4I3ZA 1QPEA 3PXYA 4FT0A 3AGLA 3ZOSA 5DT4A 3BIZA 3M11A 5IA3A 4UWBA 4IJ9A 3S95A 5L2SA 3N51A 3KULA 1P5EA 4FSRA 1MP8A 3IOPA 4FT7A 1CM8A 1XKKA 3H9RA 3PSDA 1CMKE 2FB8A 4KKHA 3GC0A 2BTSA 4R3PA 4DBNA 5FBOA 2C5VA 2HAKA 4GH2A 2CJMA 3DDPA 4Z9LA 4OTIA 3TZ7A 2VWBA 5CXHA 3VVHA 3EQDA 5K4JA 5IMXA 4F1MA 1IRKA 3MPAA 4IB1A 1BL6A 3EYHA 3R30A 3NUYA 3S1HA 4CYIA 2VTNA 4YJUA 3CS9A 2C3JA 3PXZA 4O27B 4CQEA 5IISA 3POZA 2XNBA 4B9DA 3U87A 4OLIA 3NZ0A 2WU6A 4F0GA 2XKEA 3VS1A 4GFOA 5E7RA 4IAKA 1Q24A 4HYSA 3CTQA 5H8EA 4LG4A 2PHKA 5AMNA 3KL8A 4FSUA 5FD2A 3MH0A 3RZBA 1V0OA 2GU8A 1J1CA 3Q53A 4IH8A 4C4GA 3LM5A 2O2UA 3HYHA 4M8TA 3E8DA 5ANDA 2QOCA 4I6BA 2GTMA 1H1SA 2G2IA 2R3LA 2YCRA 3EQIA 3A62A 1OB3A 3IECA 5CU3A 2VO0A 3A4OX 4RIOA 2B54A 2FYSA 2V7OA 2I0EA 4G6NA 4R3CA 3FPMA 4R7HA 5EOBA 4O21A 5CT0A 4C02A 5HLNA 5IEVA 3C4ZA 3SHEA 2XIXA 3ZEWA 2AC5A 3PVGA 5I9VA 1CKIA 2OH0E 1BI7A 3SXSA 5KMMA 2JKMA 4ACHA 5IA5A 4M0YA 1WAKA 3O8TA 5AX9A 4K11A 2YAKA 4DLIA 2GCDA 4FUXA 1E1XA 4HW7A 4RA5A 4O96A 4WSYA 2OK1A 4AA5A 3MJ2A 4MCVA 2YCQA 3EFWA 4E6AA 4FKRA 4M69A 2VTHA 3REPA 1PHKA 1KSWA 2QOOA 3DT1A 4FV8A 2WGJA 4AWIA 3BHYA 5BX0A 4C4FA 2EVAA 3GU4A 4J98A 5CEIA 2WTIA 4XG4A 4E4XA 3G0FA 1Y6BA 3SQQA 3WZDA 4YJSA 4G1WA 4IAAA 3VBYA 4RG0A 5D7AA 3W10A 3FY0A 3FZRA 3LAUA 4XRJA 5KKRC 2W1HA 3VHKA 1ZYCA 3HRFA 4MBJA 5JSMA 2KULA 3UO4A 3MIAA 4EH5A 4JG7A 2R3NA 4JS8A 5M4UA 2XK7A 1SVEA 4LGGA 4P4CA 5DR2A 2WNTA 4W4VA 4AT4A 4TKSA 2GHGA 5TKDA 5I4NA 1VYZA 3MH2A 4AZVA 2VGOA 2X2LA 3DNEA 4NCTC 2CKEA 2C3LA 3QAME 4JL9A 4C0TA 1SYKA 4OTGA 5EI2A 4EH6A 4PP9A 4RLKA 3V51A 3TUBA 1SNUA 3SKCA 1VZOA 4AZTA 1O6KA 4FIFA 4NIFA 5CAOA 3VAPA 4O1OA 5J8IA 2DQ7X 4XG6A 3AC5A 3WBLA 4JXFA 1PXLA 1H00A 2XNPA 2VNYA 2XK3A 2XBAA 4M66A 5D7VA 4JX3A 4IZ7A 5A4CA 3QZGA 1OVEA 3UP7A 2WXVA 4A4OA 4C3PA 3HV3A 1K9AA 4DLJA 4UYNA 4V01A 2WAJA 3EH9A 4A07A 3D5XA 3L1SA 3CQUA 2HZNA 3KGAA 5DEYA 4RX7A 5DR6A 4DH5A 4PNKA 3TG1A 4AQCA 1FVRA 2OZOA 3A60A 3D2IA 3OMVA 3FMDA 4DG3E 2ZOQA 5AJQA 4TYGA 3TZ8A 5K4IA 3IG7A 5FRIA 4YMJA 4FIHA 3DFAA 3T9TA 5HG9A 2OO8X 3MS9A 4CFNA 2ITOA 4ASDA 3PXKA 4EONA 5EG3A 3ZDUA 5CENA 2JBOA 5D11A 4QYGA 3ORZA 1XBCA 2J0MB 3DLZA 4FIJA 2B55A 2J6MA 2G01A 1X8BA 3MYGA 1HCKA 5E90A 3DZQA 5C8NA 4L7FA 2VWYA 1VYWA 3BHUA 4FZAB 3W8QA 4HGSA 2QG5A 4NM7A 5CSVA 3VF9A 5J7BA 4U7ZA 4EQCA 1YHWA 2XYNA 3RM7A 3LXKA 1XH6A 3KMMA 3L8PA 4FYNA 5HZNA 4O4EA 2V22A 3CE3A 4BBFA 1H0VA 2YA9A 3COMA 3VBTA 3UO6A 5HI2A 1U5QA 4FVQA 4I5PA 1LEZA 3NYOA 2VUWA 4U5JA 5C8KA 4D4VA 5IKWA 5D1JA 3QKLA 4HYHA 4ANLA 5EKNA 4G34A 2CHLA 5DHJA 5BVDA 3DBQA 4MBLA 5M51A 3DNDA 5J9YA 3TV7A 4RVKA 2IW9A 1Q8YA 2B1PA 2VTQA 1WBWA 4LYNA 1Q8UA 3VIDA 1PKGA 3VS7A 2HXLA 3CP9A 3L8XA 1ZZ2A 3W33A 3DAKA 4YZDA 4Z16A 1L3RE 3DB8A 4ZSJA 4EOSA 2YLEA 4GFMA 4CFXA 5F4NA 3ZRKA 2I1MA 3UC3A 5AV3A 1KV2A 2HY0A 3F61A 4M68A 5EYCA 5K5XA 4ONAA 3UVPA 1RJBA 4U42A 2WTVA 4I5CA 3ZLYA 2YFXA 3OBGA 2XJ0A 3FV8A 3ORTA 2RKUA 4MKCA 4IDVA 1PXNA 4QQCA 3P7CA 3QTXA 2W1EA 3VRYA 3GT8A 5HD4A 2ITQA 4FK3A 3EB0A 2P55A 4IWOA 4YJRA 5HCZA 5C8MA 3CJGA 3Q9XA 3QUEA 3FI2A 4IB5A 3VBXA 5M55A 4FV0A 2OG8A 3VS3A 4FTKA 3TKUA 4FKUA 4FKJA 2WMQA 1SNXA 5HGIA 3RMFA 2B9JA 2XS0A 3R8MA 4FKPA 5KMOA 4DAWA 4IVDA 3C5UA 3JPVA 4RJ7A 1PMEA 5HBJA 2W96B 4CV9A 4H58A 4F9AA 4G17A 3W32A 4AACA 1YDRE 4L01A 1PXOA 1PXKA 3GCUA 3MDYA 4BYJA 2V62A 1Y6AA 4PRJA 4FT5A 4ZSEA 3FLQA 4HNIA 4YZMA 2YAAA 4QMPA 2RG5A 3PXQA 2RFEA 5AP6A 3E3BX 2JDTA 4MHAA 5HCXA 4CNHA 3D0EA 4XV3A 5HVYA 1Q8WA 3RPSA 3EFKA 3F66A 5JQ8A 4MAOA 3A61A 3O51A 4YHFA 4O91A 2YHVA 4ZP5A 5K5NA 2GHLA 1UNLA 3QA0A 2JIUA 1NY3A 3NNXA 4CFMA 2YZAA 3RNYA 3UMWA 5CF6A 2Y7JA 3GEQA 3W2PA 1YHVA 2BRBA 2X0QA 3NLBA 4L8MA 4DG2E 2DWBA 2X4FA 4OAVB 2UZEA 3QQUA 5CVHA 1H27A 2YLFA 3VUGA 1UA2A 3RPOA 4IAFA 1JWHA 4MWIA 4HVSA 3R9NA 4FIIA 3R8ZA 3C0GA 3F82A 3OZ6A 1WBOA 4FI1A 3BRBA 5HBHA 3ZFMA 2ETRA 2I0VA 2QONA 4L6QA 1E9HA 4H1MA 4P5ZA 5CZHA 3V5WA 3LVPA 4E26A 5A46A 4USFA 3TKHA 4MD8E 3AT4A 4M15A 3UVQA 2R3RA 2UVZA 1M17A 2WEVA 3PRFA 4GT5A 4UWCA 1Y8YA 2VN9A 3MTFA 4GCJA 3QTSA 4WA9A 3UNKA 5HG5A 5E1EA 3E92A 1GOLA 3VF8A 4MQ1A 2IVSA 4OW8A 3DJ7A 4EC8A 3FZPA 1WBNA 4Q9SA 3RJCA 2R7IA 3QU0A 2RG6A 3R7IA 3VO3A 5GZAA 1JKSA 4RZVA 4WUAA 3ZO3A 3MIYA 2QOLA 3MY5A 3IGOA 4I5HA 4EH4A 1H1QA 2HW6A 3ZTXA 4X2JA 5A4LA 3F6XA 3RAKA 1U46A 4FV6A 1AD5A 5J79A 4UWYA 3R8PA 4PPBA 1T45A 3QALE 4O0VA 3PVBA 4QMMA 2P3GX 2GQGA 3VS2A 4EK8A 2FSOX 2RFNA 3CKWA 4B0GA 4FSMA 4B6LA 4C3RA 2GNJA 4C38A 3D5WA 4X3JA 4NW5A 4OBPA 4GV1A 5KMJA 4IX3A 3ZXTA 4IDTA 4K2RA 4RRVA 1VEBA 2VWXA 5B2LA 2R0UA 3DKCA 3F88A 3HVCA 3MN3A 4FKLA 1OMWA 1YDTE 4QMWA 3DY7A 3Q9YA 4ERWA 4AZSA 3NX8A 2JFLA 4BTKA 4F7NA 4BWXA 1JOWB 4LRKA 5J87A 4EBVA 2W1ZA 4GU9A 3V8TA 3RK9A 4BDEA 3ZFXA 4Y83A 4YURA 4XS2A 2BUJA 4EHZA 3U9NA 5JRQA 3CY3A 5GHVA 5LVOA 4ASXA 2YN8A 3P9JA 5FGKA 3UE4A 5A4QA 1XH9A 4Q2AA 2EB3A 1VJYA 2AQXA 4UMRA 5EFQA 1IG1A 3DQWA 3BBWA 5HNGA 4PP7A 3AD6A 5CF4A 4GK2A 1OUYA 4MD9E 3NYXA 4I94A 3UPXA 3LPBA 5IEYA 3R8VA 1KWPA 5CXZA 2OW3A 2PVYA 3DCVA 4WKQA 5TT7A 4E6CA 5B7VA 1P4FA 5AP4A 5BMMA 3P5KA 5HCYA 3ZLSA 4I22A 4IZYA 2YERA 5BVNA 4R1YA 2PZ5A 3CQWA 1WFCA 4FC0A 4YUQA 2Z8CA 3B2TA 3NUSA 2F2UA 3QLGA 2WMRA 2ETKA 2W1IA 4FNYA 4EORA 3Q2MA 5CEMA 4L3LA 1W2CA 1YXTA 2WTDA 3GU5A 4I4EA 5HO6A 2OIBA 3TZMA 3AC1A 2OJJA 4HCUA 4YPDA 1R39A 3R21A 4LGDA 1ZMUA 5KCVA 3F7ZA 3H3CA 3I60A 4RA4A 4RMZA 5HIEA 4NTTA 3R8UA 4DH7A 4NM0A 4FA2A 3BEAA 2R7BA 3KULB 5JFXA 3LM0A 4EK4A 3W8LA 4J53A 3WARA 2NO3A 2HWOA 3A7HA 1OKWA 1ZMVA 2EB2A 4ANQA 1PJKA 4BCMA 5ETCA 3GGFA 2UZVA 4AE9A 4D4YA 3WYYA 3AC2A 3KVXA 4KIKA 3TNWA 2VTJA 3SD0A 3HMOA 3FMKA 3TI1A 4FL2A 4F0IA 3R28A 4D2RA 1NA7A 3QC9A 4FSZA 4NUSA 2VV9A 4TWPA 4YC3A 4I0TA 5C27A 3NS9A 4U3YA 1UKIA 3F5PA 1WBTA 1LPUA 3S3IA 4AXAA 2V7AA 3OTVA 4G16A 4UMPA 2ZB0A 4Y85A 3S4QA 4IM2A 1ZY5A 4FICA 2YIWA 4CRLA 3CKXA 4G3FA 4D2SA 3DBFA 4JG8A 4JNWA 4QP2A 4V05A 3ZBFA 4GJ2A 1ZMWA 5AR8A 4BWPA 4C59A 4FTQA 1SM2A 3PPZA 3C51A 3EIDA 2G1TA 2FSLX 3LXPA 4JIKA 2XJ2A 5AP7A 2ESMA 5BVWA 3T9IA 2CCIA 2JAVA 2W5BA 4G9CA 4F9WA 4RIYA 5DFPA 3UNZA 4E4NA 3MWUA 2YJRA 5KE0A 2XIYA 4WNOA 2ERKA 2XK9A 4OBQA 3KXMA 2BDJA 4H3BA 3GCVA 4BKYA 4CZTA 2X7GA 4B99A 3HZTA 4ZOGA 3IS5A 4YTHA 1QPDA 4BCGA 3SA0A 5I9ZA 1FQ1B 4P90A 4M69B 4ZS0A 3SAYA 3DK3A 1OIQA 5CU6A 3KK8A 3PA5A 4D1ZA 5DRDA 2BVAA 4ZLOA 1WMKA 1H1PA 4LMUA 3NUUA 4IZ5A 2WELA 5F94A 2R9SA 1XO2B 4GYGA 2IEWA 2C3IB 2YIXA 4F7LA 2F7XE 4D2PA 4FKIA 3R7UA 1XHAA 4QYYA 2C3KA 4E4MA 3WIKA 5ANJA 5FLFA 2JEDA 1Y8GA 4BIDA 4PPAA 1WVYA 5AM6A 3UQCA 2GFCA 3WF8A 4FYOA 5DWRA 4WG3A 3K3JA 1FVVA 1O9UA 3MVMA 4HCVA 4DH3A 3DJ5A 4YPSA 4BDKA 5F1ZA 4XP0A 4G3GA 1YOMA 2FH9A 4IMYA 2X2KA 4MTAA 3BLQA 1LR4A 4GK3A 5IH4A 5DPVA 5KX8A 4PWNA 2F57A 1U54A 3MA3A 3NAYA 3SV0A 5FDPA 4ZTMA 1PXJA 5AADA 4M3QA 4AA0A 3IDBA 5CASA 4NJDA 5DMZA 4BYIA 5FEQA 1NVQA 2C47A 2KTYA 3NNUA 3I4BA 5CQUA 4NIFB 4FNWA 5K3YA 4IADA 3R7VA 1JSTA 3CY2A 2WTKC 4FR4A 4E3CA 4OAUC 5AR5A 1KOAA 3Q04A 1WCCA 2UW6A 3LOKA 5HNIX 4RWLA 3QTIA 4U9AA 5KO1A 2G2FA 2OIDA 4OTHA 4U41A 2A2AA 2QO7A 3F2AA 2EUFB 4UX9A 3COIA 3THBA 3VQHA 2YACA 2EXMA 3GFWA 3ZC5A 2BZIB 4EWQA 2OF2A 3BV2A 3HUCA 2JITA 4QPSA 4QP1A 2XK4A 3DTCA 3O7LB 3OW4A 3PIXA 1U59A 3GVUA 3QQHA 4KA3A 5GJFA 4YO4A 3R7GA 5I9WA 2VWWA 4YTCA 3CXWA 2C6IA 4TWNA 4YHTA 3FLNC 4PY1A 3IW5A 3DJ6A 1BX6A 4F09A 3KKVA 4NH1A 3AMAA 3AOXA 3IO7A 4ZY5A 3ZM4A 4ZLZA 4EOOA 2BFXA 3D15A 3MFRA 4WO5A 2IVVA 4JOAA 4QTCA 5G6VA 5JKGA 4G3EA 1B6CB 2CMWA 4XP3A 4YTFA 2IWIA 3RVGA 3QZFA 4KRDA 3FMHA 2BFYA 3C0IA 3WE8A 5CLPA 3SW4A 2FO0A 2XJ1A 3GOPA 2WHBA 2Q0NA 4W4YA 4ITHA 4AP7A 5BVEA 4YJTA 4BDAA 2GNHA 4QP7A 2J7TA 5TF9A 2VX0A 4EOLA 2QOHA 4EUUA 4AW5A 2XK8A 1NVSA 2CN8A 4NZWB 3VQUA 3WOWA 4F7SA 5I9XA 3QX4A 4GG7A 1YXXA 5L6PA 3KMWA 4XLIA 5IH5A 4CCBA 2W1GA 2PVMA 1OL5A 1HOWA 5IH6A 1XH8A 4FVPA 1JPAA 3OUNB 2IZUA 4ID7A 4I92A 2C5NA 3BYMA 1QCFA 4OTPA 3IW4A 2ITYA 3E88A 3FMLA 3VUIA 5LVPA 3OWPA 4KWPA 4WBBB 1YVJA 2XP2A 4FIGA 3NIZA 4FL1A 3CGFA 1FMKA 3I5NA 4WG5A 3VS4A 2HIWA 3D5VA 3ZLXA 4BN1A 4CCUA 4GUBA 4O6EA 4L3JA 3UOHA 3B2WA 4D5HA 3FQEA 3MPTA 3TJCA 5HD7A 3ZSHA 2UW3A 2XNMA 1OIRA 2BROA 4LOOA 2UW9A 4O0RA 5I0BA 3D14A 2PVNA 2JC6A 4YC8A 2JBPA 5LMKC 4C62A 2PVKA 5LCKA 2O63A 3TXOA 3JYAA 4ARKA 2UZBA 4A06A 1ATPE 4NFNA 3DKGA 4UV0A 3PE1A 5CTPA 3K54A 4EH8A 4MEDA 4ZJJA 2C6EA 3H4JA 4AA4A 3ANQA 3MY0A 3UPZA 4OTRA 4WHZA 4E93A 4EH2A 4O4FA 1Q5KA 5JK3A 3CGOA 3TACA 3VUMA 1UWHA 4TN6A 4ZSGA 3LFAA 5EDRA 3M2WA 4IFCA 3IQ7A 3TEIA 4BICA 2DYLA 5E8UA 4YR8A 2ZDUA 4LOQA 3NSZA 3UGCA 4BZOA 5EM7A 3V01A 4CV8A 5D41A 3HV5A 4HZRA 4J99A 2R3MA 1A06A 2ITVA 3HA8A 3VN9A 4GMYA 3ORMA 4ZTQA 4QMZA 2OGVA 2PZPA 2ZM1A 3QLFA 4F9CA 3EQPA 5EW9A 4X3FA 3ODYX 3ACKA 3ZRMA 3RPYA 2XNGA 4AF3A 4WNMA 2A27A 4APPA 4BCQA 1QPJA 2XK6A 5CX9A 5EKOA 5LMAA 2V5QA 2GHMA 1XBBA 2WMBA 3MI9A 3GCPA 3ORLA 4JAIA 4I23A 4U8ZA 2E9OA 3WILA 4FODA 4UALA 3TNHA 1HCLA 3OCBA 2BALA 1OPKA 2J51A 2OSCA 4N4SA 4NWMA 1SMHA 2BIKB 4QMVA 3H0ZA 2C6LA 2ZV9A 1Q62A 4FTIA 4ITJA 1ZWSA 4R5YA 3BU3A 3UP2A 3UTOA 4I6HA 5AR2A 5HESA 4PUZA 4R6VA 3F3TA 3R1QA 4Y5QA 5L2QA 3VS6A 1BI8A 3LJ1A 3DFCB 3FHRA 4TYJA 5JFVA 2ZM4A 4FT3A 1DS5A 4OT6A 1BL7A 4QMYA 3TWJA 4AU8A 1H25A 4RBLA 3ZH8A 2C5XA 3CBLA 2WB8A 3ENHA 3TTIA 4MXYA 3FLSA 3NUPA 3R0TA 5AUTA 2X0OA 3M42A 1YI3A 4HPTE 3T3VA 2P0CA 1OPLA 3C4XA 5FQDC 2XF0A 1UU3A 3QFVA 3K2LA 3VBVA 1URWA 2UZUE 3TNIA 2VTIA 3QA8A 4FZ6A 4JAJA 4FKQA 3QWJA 4MXXA 4OTFA 5L2TA 3G51A 5JEBA 1BKXA 1JQHA 3OHTA 4L44A 4J1RA 3QHRA 1M2QA 3V5LA 4PDSA 4F1TA 3BGQA 3E8NA 3BYVA 2YM7A 3ELJA 3RCJA 4CZUA 4HVGA 5IU2A 2JDRA 2WQOA 2HY81 4HVHA 5HE3A 4GJ3A 2BRNA 5KBRA 3FYJX 2BPMA 4JQ7A 3EQBA 3UMXA 5KMLA 5HX8A 5CT7A 4EWHA 2PMOX 5JT2A 4IACA 4D2WA 4QQTA 4FVRA 4YLJA 3EZVA 5AUXA 2VTTA 2JKKA 5H8BA 3SLSA 3DQXA 2O0UA 2C4GA 2PE2A 1APME 2PWLA 1PMNA 3E64A 3DA6A 2PE1A 3F3ZA 4C2VA 4DINA 3DBEA 5AWMA 3NYVA 2R3JA 4IB0A 4U45A 1XH4A 5CU0A 4M14A 1STCE 2VAGA 4KKEA 4CRSA 4RPVA 3AC8A 3DU8A 3NUNA 4G6LA 1GZ8A 1PMVA 4BDBA 4DEIA 5EYKA 5AAEA 3D7TA 4YJOA 4BTFA 2C5OA 2PVFA 5M44A 2XZSA 4GG5A 5LARA 4DTKA 1ZOEA 2VWIA 2CSNA 3MJ1A 4AOJA 3UQGA 1LP4A 3Q6WA 5KZIA 3W2SA 2Y4IC 2VU3A 3HMMA 1IASA 3D94A 2CPKE 4DCEA 3VHEA 4ZY6A 5JZNA 2RIOA 3PY3A 1P14A 4QMXA 1JVPP 1EH4A 5C1QB 5CZIA 1M7NA 2YM6A 4EOIA 3U6IA 2YDIA 4QMUA 3RAHA 4NKAA 4C4EA 5AR3A 4HVIA 4XLVA 3KK9A 4AX8A 3MY1A 4I4FA 3ROYA 1UKHA 1ZYLA 1Z5MA 3Q5ZA 4B4LA 3DPKA 4WUNA 3VWAA 4K9YA 3G33A 3FQHA 3ZONA 3NNWA 3DBDA 3O17A 5FM3A 1H26A 3EQFA 4U43A 3GCQA 4GW8A 2QCSA 3BHVA 4QYHA 3QRKA 5FXQA 4CKRA 5E8TA 4MX9A 4XJ0A 1TQIA 2RF9A 2GNIA 4RX9A 4AUAA 5A3XA 2WIPA 4DH1A 5C01A 3HDNA 2DS1A 1YOLA 2PSQA 2C0OA 2PVLA 3O0GA 3BX5A 3CD8A 5ANGA 4BZNA 3UZPA 4ZIMA 2W7XA 5HTBA 4D1SA 3PPJA 2WPAA 4LFIA 1OGUA 3L9NA 4CT2A 3O7LD 1H24A 4DITA 4XG7A 4KKGA 3ORNA 4G5PA 4JG6A 4KIKB 4BF2A 3GU6A 4DG0E 2RSVA 3MTLA 4EK5A 2R0IA 4EZ3A 2C1AA 1FPUA 1H0WA 4IZAA 3Q96A 5T3QA 4C4HA 5AV1A 3NEWA 5HG8A 3TN8A 2B9IA 4O2ZA 2CLXA 2H6DA 5DH3A 3F3VA 3VW8A 2UZDA 3RALA 3OXTA 5K0KA 3R6XA 4L52A 2ZAZA 2F2CB 5JGDA 1GIJA 3PIYA 4PMMA 4YP8A 3DOGA 5BYZA 4FV7A 4K0YA 5G1XA 2XB7A 5DN3A 3W1FA 1OL2A 4DGOA 3SRVA 3O96A 3PZEA 3WZUA 2RFDA 2P4IA 4FK6A 3KFAA 4HCTA 4HGEA 4O0XA 3PSCA 3OEZA 1OKZA 2B52A 4DEEA 3TV6A 3ORPA 3NWWA 4AFEA 2B53A 2B9HA 1H28A 4TY1A 2QC6A 2VO6A 5DIAA 4Z55A 4I6QA 3AT2A 2CGVA 4KINA 3I7BA 5HLWA 5E91A 3W18A 1WVWA 4J8NA 4Q9ZA 3F5XA 2R3OA 4RIYB 4EKKA 1SVGA 4YLKA 3ALNA 2X0GA 3F5GA 3NGAA 4C4JA 4RLLA 4EOQA 5EW8A 2WMUA 1WBVA 4FTTA 1Q97A 3U6HA 1OI9A 2QLUA 3QD4A 4O38A 3QF9A 1WBSA 1P2AA 2SRCA 1KE9A 2H9VA 4RJ8A 4AN3A 3NCGA 5E8YA 2OBJA 5GZ8A 3G0EA 3GB2A 4QP3A 2PVHA 5CY3A 5GJGA 1GZNA 3POOA 3BWFA 4JX7A 5DR9A 3V5PA 5A9UA 5BUJA 4UBAA 1XQZA 3C4FA 3UIXA 2PMNX 4E20A 3OY1A 4Z7HA 5BQ0A 2F7ZE 3QKKA 1JKLA 2JIVA 3QC4A 4XNEA 1MRYA 3G6HA 3QRIA 5CF8A 2J0JA 1YQJA 3GC7A 4YBKA 4UB7A 2W99B 2XMYA 3BHTA 3F3WA 3HKOA 3Q32A 1P4OA 3FMNA