3SXRA

Crystal structure of bmx non-receptor tyrosine kinase complex with dasatinib
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
260
Chain Sequence
GHMELKREEITLLKELGSVVKLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKMPYDLYTNSEVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Cytoplasmic tyrosine-protein kinase BMX
publication title X-ray crystal structure of bone marrow kinase in the x chromosome: a Tec family kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sxrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sxrA01
2BAKA 3C7QA 2GU8A 3E92A 1YWVA 2OU7A 3BBWA 4FKSA 2Y8OA 3BKBA 1YDSE 4M97A 4DYMA 2HZIA 3LFCA 1Y8YA 5IH5A 3ZTXA 5IZFA 2ITNA 1OKZA 1HCLA 2CGUA 4JDIA 4FTOA 4FT9A 5KBQA 4GFGA 4TN6A 4FR4A 1PY5A 2FGIA 3MVHA 4LL0A 2DYLA 4MXXA 4S32A 4L3JA 5CSWA 3VJNA 3ZDUA 2C6LA 2VWVA 2CN5A 1ZARA 3O23A 4FKJA 4FSUA 3F66A 4QPAA 5AX9A 5AX3A 5FXRA 2C3IB 3UTOA 3QGWA 3G33A 4I4FA 1Q62A 1JKKA 3EYHA 5IH6A 1Y6BA 5CVHA 2X7OA 4Y5QA 4KUJA 2R3QA 3R9NA 3S1HA 5IMEA 1PXMA 4DFUA 4B6LA 5J7HA 3JVSA 1WMKA 4M69A 4NEUA 1MP8A 4XG2A 1R78A 5AFVA 4AW0A 4IM0A 3FXXA 5E8SA 1XH7A 3KY2A 4EHEA 4LQMA 2H6DA 5AP1A 4YZMA 3LKMA 3QZFA 4GYIA 4Z55A 2LGCA 2OJFE 4U79A 1H07A 4MXAA 4Y85A 5H2UA 2IW9A 4D4YA 4YC3A 3UZPA 1Y91A 3DAKA 3MWUA 1H28A 5EHOA 4ZP5A 4UXQA 2JIIA 3SXFA 4EOPA 4M66A 3HNGA 5HU3A 3VUGA 4D5KA 4QMWA 1M7QA 4K33A 4IZ7A 3CD8A 4FKGA 4QYEA 3PVWA 5JQ5A 3DXQA 1YXVA 2OJ9A 2R64A 3A61A 3T8OA 2VWYA 3TUCA 3SAYA 4R77A 1ZLTA 1OKVA 2W5BA 4WO5A 3QBNA 3KXZA 3QD3A 3MFRA 1TQPA 3VBTA 3LFFA 3A60A 4KB8A 3NS9A 3KULA 4C0TA 3ENMA 4E5AX 4YTFA 4OUCA 3FYKX 4FIGA 4GK4A 1Z5MA 4S33A 4XH6A 4AZTA 1NA7A 4NIFA 5E90A 5CEIA 3LMGA 5IQEA 4UMTA 3ZZWA 4EH2A 5CU0A 2VZ6A 2J2IB 3DPKA 1VEBA 3H9OA 1QPDA 2QU6A 3CQWA 4BIDA 1GAGA 3MY0A 3PPJA 4TT7A 4WNOA 1PMVA 3Q04A 4IW0A 3SRVB 3UP7A 4CMOA 4F63A 3JY0A 3QRKA 2FO0A 3SLSA 5F9EA 2XA4A 3A7JA 3PA5A 4XBRA 2EU9A 5KMKA 1S9JA 1WBWA 3DQWA 1UU9A 4IBMA 2JD5A 1J1BA 3QQJA 3Q3BA 4F70A 4RX9A 4PPAA 2HCKA 2UVYA 4WUNA 3QTXA 4JRNA 4N4SA 3AT4A 2YZLA 2B54A 2Y4IB 2JIVA 4QOXA 2QG5A 5CYIA 3HV3A 3QLFA 4E4XA 3KL8A 2BKKA 1REKA 3DV3A 1PRYA 1P4FA 5HBEA 3U51A 3PLSA 1ZAOA 5AUVA 4AU8A 2YM8A 2I40A 1T46A 3O17A 3LFBA 4EH7A 2YEXA 3FI3A 2VWZA 2XRUA 3FXZA 3OCBA 4KINA 3QQFA 3F88A 3QF9A 3BLHA 4BCFA 3NEWA 1WVYA 3ACJA 4BDFA 4BDBA 4P7EA 5EHYA 2Z02A 3WOWA 3QTRA 4FL2A 4F4PA 4H3QA 3SDJA 2REIA 2A2AA 4W4VA 1FINA 3U6IA 4HPUE 1ZOHA 4P2KA 3M42A 1V1KA 3EMGA 4ZXTA 4OTPA 4EOQA 5I9ZA 4I93A 3Q4UA 2JDVA 4C4JA 4JI9A 4I0RA 3ZBXA 3GCSA 5CX9A 5LCJA 2P55A 4X6RA 3FMEA 4AW2A 5LVOA 2YWPA 5KKRC 4F6UA 3U9CA 2XCKA 4IX6A 1TVOA 3I60A 4FX3A 4ZEGA 5BMSA 5CT7A 5F94A 3ATSA 2JDTA 3NUAA 3UC3A 5AP5A 3QCQA 3C51A 3GU8A 3UJGA 4ARKA 5AR2A 1JSTA 5M55A 3ZRKA 2XK6A 4BTMA 2WMUA 1BLXA 4FTMA 1A48A 4O81A 3U87A 4IAIA 5M09A 3OT3A 4FV1A 1YI4A 4K11A 5I3RA 1O9UA 4RLKA 3FKLA 4FF8A 1B39A 2FSTX 5HOAA 3HRFA 4IX4A 5ANEA 3OBJA 3R04A 3EQBA 2ITTA 4RVTA 3LFSA 1WBOA 3U4UA 2QU5A 2XJ0A 2VTRA 3O8TA 1PYEA 2YLEA 3I0OA 4M0ZA 4X3JA 4DEHA 4QNYA 4F0IA 2F7ZE 4RX5A 4NWMA 3A8XA 3IONA 3FL5A 3G90X 1Q99A 2CCHA 2CPKE 4FGBA 4LFIA 4LM5A 3ORXA 3GOKA 4E1ZA 2GQRA 4L01A 3CJGA 2W05A 4I0SA 3QUPA 2E9NA 4I24A 4IFGA 4R3PA 5AUZA 5KCVA 2XEYA 3RAKA 4KABA 5JFWA 5DRDA 4YTIA 1WCCA 4GMYA 4GJ2A 4M12A 3MV5A 1RJBA 3G6GA 2WEIA 1A06A 3OXIA 3SQQA 3VBXA 1CMKE 2CN8A 3NCGA 2CKOA 3F5GA 5HVYA 5E8WA 2P3GX 3FQSA 4IAAA 4NYEA 3BEAA 3B8QA 5HX6A 5CU4A 3PIXA 2RFDA 4F7JA 4G6LA 4F65A 2RFNA 3RZFA 4DBNA 3CXWA 4U80A 4AZEA 4G5PA 2V5QA 2VTJA 2HW6A 5EI6A 2PUUA 2BIYA 5LWNA 4CEGA 3MGYA 4FOCA 2BZIB 2GNGA 3R0TA 3CGFA 4LL5A 1GZKA 5AUWA 4AQCA 4BTFA 2AC5A 1LP4A 3IW7A 4EK4A 4RIYA 4CNHA 5JN2A 4MBLA 4FZ7A 2HZ4A 5IDPA 2G1TA 2J50A 2X4FA 4LOQA 3ALNA 1CDKA 3TUBA 4H58A 3C5UA 5H9BA 2VTMA 3EN9A 3GQLA 3VW8A 2PE1A 4BWXA 4AOJA 4EZ7A 4OTHA 2F57A 4D2WA 3O2MA 3PJ2A 4D4VA 3UO4A 2RG6A 4PF4A 2UW3A 3CD3A 2OG8A 3OCSA 5FM2A 5E8XA 4EORA 1NXKA 2OBJA 2OXXA 2Y4IC 2Y0AA 3VS7A 3D9VA 3R9RA 1BI8A 2OIDA 5EOLA 1PMEA 1X8BA 3BCEA 3O7LD 3BWJA 3KRRA 3R30A 5A14A 4A4XA 3VUMA 4W4WA 2ZYBA 4IZYA 3IGOA 5CT0A 3CTHA 1GNGA 4MEDA 3ZXTA 3EQPA 3GUBA 2UZWE 5KKRB 2QG7A 4O7VA 2QOCA 2WMSA 3LXLA 3SKCA 4YZBA 3CIKA 2GTNA 4IB3A 4RBLA 5FBNC 3CTQA 2X2KA 4YSMA 3O7LB 4OAUC 4RIXB 3QCYA 3GCPA 4JG6A 5IEXA 4NU1A 4FT3A 3QD0A 2J0LA 2QOOA 4YJRA 5BUEA 2W1FA 4AGWA 4B8MA 4I92A 3ZO3A 5JSMA 2YACA 2G01A 5JFSA 5I4NA 3FY0A 4XG8A 5FEQA 3N4VA 3HMMA 3N9XA 4GT5A 1QPCA 2QO7A 2X8EA 3PG1A 4M67A 2ZV8A 4XV9A 3ZLSA 3LQ8A 2AC3A 4BDEA 4EK8A 4XRLA 4AN9A 4EOLA 1YOJA 3IDCA 2WQBA 3F5PA 4PL5A 3ZZEA 5KMOA 2UW9A 2VWWA 5KHWA 4BDIA 3LW0A 3ZCLA 4DEIA 4ASZA 3TL8A 3MA3A 3LXPA 3NIZA 5CTPA 3P4KA 3EL7A 4FG9A 3I5NA 2R3JA 3Q9YA 3REPA 5LOHA 3Q2JA 4UBAA 4Z9LA 4R78A 4PX6A 4H1JA 4NW6A 3PJ3A 3MH1A 1Q41A 2C4GA 3BGQA 4FTRA 5TOZA 4TWOA 3ZC5A 4F1MA 5JK3A 3G0FA 3M11A 4I23A 4JXFA 3P7CA 2PMNX 2ZV2A 4I5PA 4W8EA 3MPAA 3R1QA 3CPCA 5CVGA 4BGHA 2XJ1A 4FKUA 4L43A 4ITJA 4O0SA 4U81A 4ZMFA 1OIQA 3OW3A 2HK5A 3UYSA 4O7NA 2XEZA 1F5QA 1M14A 4YP8A 4O27B 3W2QA 4GKIA 4QP8A 3PP1A 2JDSA 4X2GA 4RVLA 4MNEA 4O84A 2CSNA 3I79A 5D1JA 3QU0A 3R01A 4F9WA 1IA8A 3R2YA 4AZFA 5IMXA 3C4XA 4BICA 4CLIA 3U6HA 5FTQA 3R63A 2FB8A 4NM5A 2VWBA 2W17A 3V5JA 3NMUF 3F69A 4FVQA 4FIIA 5KUPA 3FL4A 5C03A 3U54A 2WAJA 2QOFA 3N51A 2HWPA 5ACKA 3NLBA 1OBGA 4L68A 2B9FA 4NM7A 2EWAA 3VIDA 3DA6A 4MF0A 1JPAA 4UZHA 1XKKA 2GNJA 4FZ6A 5HKMA 3POOA 2OIQA 4FTLA 4UMUA 4DEDA 5F1ZA 1ZRZA 2PVRA 4C35A 4ZLYA 3HYHA 3V5LA 2EVAA 2O0UA 3ORMA 4ACMA 4EK5A 4MQ2A 5HESA 2R2PA 2W9FB 5AP0A 2GHGA 3AC5A 3EN4A 1Q3DA 1KSWA 4ENYA 1SZMA 3Q6UA 5C9CA 4PP7A 3L9LA 3AC3A 4D1XA 4IDVA 4MKCA 4PMMA 4DCAA 1JSVA 3NAYA 3VVHA 4ZY4A 1BI7A 5DR9A 4D1ZA 3PRFA 3R7UA 4E4MA 5A4TA 2ZM3A 4W9XA 4BB4A 2X6DA 3NGAA 4ZS0A 1WAKA 1U5RA 5L2QA 3KXNA 5ANIA 4L3LA 4A9UA 5JGAA 4JAIA 4FTKA 4J8MA 2W99B 2ZOQA 2QLUA 2F49A 3GOPA 4NKSA 3QQUA 4QP2A 2VAGA 1MRUA 3PJCA 4LGHA 5DN3A 4J1RA 2WTDA 4O91A 5BVEA 3VUDA 4RLLA 4DGMA 3OOGA 5AV0A 4AGUA 3KEXA 4C2VA 3FMJA 2CNVA 4ANMA 4GG7A 5M07A 3EKKA 5DBXA 1M2RA 2QC6A 4DLIA 4GUEA 2PZRA 4H39A 3Q4CA 4K0YA 1DS5A 1GIHA 5IEVA 1ZYCA 5CS6A 4QTEA 4W8DA 1GOLA 3RMFA 4GIHA 4BDJA 3WIGA 3QTQA 4IVDA 3R1YA 5C4LA 1WVWA 1LEWA 2Z7LA 4XLIA 1Y57A 1V0BA 5CSPA 5IQFA 4FTJA 4FVPA 4B9DA 3U6JA 3PPZA 2C47A 3AD5A 3H30A 3UNZA 4BIBA 4ERWA 4DG3E 4EH4A 4IWPA 4L6QA 3FPMA 4RG0A 5DYJA 5HE1A 4C7TA 3MN3A 1ZZ2A 2RFEA 2RF9A 1K2PA 4BCHA 3KF4A 3VF9A 4PL3A 2BDFA 2UW6A 4X6QC 5JZJA 4JQ8A 3DB6A 4AFEA 5L4QA 5KMLA 2X2LA 3R9HA 1DI8A 1JKSA 4IB1A 4FV6A 3WE4A 1UA2A 3VRZA 4CFVA 1ZOGA 2HXQA 1M52A 1XH6A 4GRBA 3FLYA 5AUUA 4EJNA 3OY1A 4MCVA 3KMWA 4UMQA 4FSQA 5CXHA 1LPUA 4BBFA 4X0MA 2VO6A 4AP7A 4WBOA 4EH6A 4NW5A 4O22A 1FQ1B 4ZIMA 5KO1A 3FEGA 1PXKA 4AE9A 5IA3A 4WRGA 4L42A 3TNQB 5H8GA 3AGLA 4FKRA 1E9HA 5C8KA 3HGKA 4G1WA 2O65A 5GZ8A 3VF8A 3P0MA 4C62A 5J1VA 4LMUA 1H4LA 2XYUA 5HBJA 5BNJA 2I1MA 4D0WA 4FTIA 4Y72A 2A1AB 5EYDA 5HU9A 1YW2A 3QZGA 5CASA 1NVRA 2GDOA 2PMOX 3RHKA 1RQQA 3BU5A 3LCTA 4PL4A 5EQPA 4IDTA 4DH3A 4FA2A 4M15A 3VN9A 2JDRA 2ZDTA 4CD0A 1S9IA 3E62A 3OROA 3MIAA 1URWA 3UG2A 3QZIA 5BYYA 2R3IA 3EQGA 3QWKA 4LRKA 4O0UA 3L1SA 4DFNA 3QA8A 3EOCA 3OHTA 3MY5A 4R3RA 4TNDA 5E8VA 5EK7A 4IVBA 3FMKA 3TNWA 4IB0A 4QMYA 2I0EA 2J4ZA 3GCVA 3GU5A 1FOTA 4Q5EA 3Q6WA 4FG7A 3NR9A 5TE0A 3R83A 5CEOA 3MB6A 1TKIA 4YTCA 3ORNA 2YIQA 2B4SB 2GHMA 2XNPA 2PZPA 3PXKA 1H01A 4E6AA 3UZRA 4FTNA 4FKPA 5IA1A 5AIKA 3Q5ZA 3IOKA 3E7VA 3ORPA 4ITIA 4DN5A 5E4HA 1CKJA 4BCPA 3RAIA 1JWHA 1JKTA 2GNFA 1OL7A 4PQNA 3CKXA 3WBLA 4XG9A 3OTVA 4BL1A 2FYSA 3LLAA 1UNGA 4N70A 3TXOA 1ZOEA 4MK0A 3WZEA 2C6DA 4JBQA 4FEVA 1WBNA 3IW5A 4CFXA 5DFPA 3R8PA 5GNKA 4C36A 5M4FA 2CNQA 5FP6A 5A3XA 2BTSA 2HXLA 3BRBA 4YJTA 4G34A 1QL6A 3ZEPA 2PE2A 2QNJA 4O0TA 4CQEA 2OJJA 1JBPE 2IG7A 1XBCA 4AOTA 4GYGA 4FOBA 3F7ZA 4XV2A 3DAJA 3L8VA 2WB8A 1NY3A 1G5SA 5EHLA 4NFNA 2EXCX 3KB7A 4GFMA 4JG7A 3G15A 3FHIA 5KBRA 3ZH8A 2V0DA 3MSSA 3OBGA 3QHWA 1ZYJA 2PL0A 5HNBA 3VJOA 3PYYA 3AT3A 3BQCA 4V05A 3PJ8A 4U42A 3R7VA 5CXZA 5DGZA 4DAWA 3WZJA 4WHZA 5HCXA 1CKPA 4IAFA 4PNIA 4KAOA 1GY3A 4HZSA 2E9UA 3BHUA 4TYHA 3LQ3A 2C5NA 4O83A 2BZKB 4KWPA 2EXMA 2QOHA 4R1VA 3I7BA 1G3NA 3RK5A 3TM0A 3F82A 3V5TA 4FG8A 1M17A 5KNJA 2W96B 2UW0A 3BU3A 3A7IA 5FEDA 4HVHA 5HVKA 3AMBA 2WIPA 3HMIA 5ANGA 3ZC6A 3BI6A 2JFLA 4FKWA 4BI0A 2HY0A 4E4LA 1YWRA 4FSYA 4TZRA 1XBBA 3O71A 3S4QA 4EOOA 4QMZA 1OUYA 2YCSA 3QTZA 1SYKA 4B8LA 4O86A 4CMUA 4BKJA 1OIUA 1OGUA 4DFZE 3E8DA 2QOIA 4RZVA 3NVKI 1SM2A 4NTSA 4FTCA 2B7AA 2QR7A 4ZS4A 2W1CA 4PMSA 5D7AA 3WILA 4BDDA 5A9UA 3MH2A 3E3BX 4Q5HA 5DOSA 2Y6OA 3SVVA 2OH0E 4PMTA 5B0XA 5AA9A 5ETCA 3UZTA 5EM5A 2X6EA 4M3QA 3WZDA 4E26A 5DVRA 3H0YA 3ORIA 2XKFA 3SXRA 3AC2A 2EB3A 4NTTA 4ENXA 5EQEA 3LXKA 4K2RA 3EB0A 2XYNA 4PWNA 4W4YA 3R6XA 2GQGA 4K1BA 2V22A 4QP1A 1NVQA 3TN8A 1UU3A 3DDPA 3NIEA 3I4BA 5DLSA 4ZTRA 2XNNA 2PZ5A 4V0GB 3AMYA 2WTVA 2Z7RA 4YHTA 3RNYA 4U8ZA 1U5QA 2W1IA 4QMQA 5HI2A 2Q83A 3BZ3A 3FQEA 4U6RA 4YLKA 3EQRA 3RPRA 4TYEA 4XP3A 1Y8GA 3FZTA 4X2KA 3WF7A 3WYYA 1GZOA 5AM6A 5JZNA 1MQ4A 4FIJA 4WG4A 3PY1A 3GXLA 3ERKA 3NCZA 4GCJA 3EWHA 2V7OA 2XIRA 3IO7A 5AV2A 2BILB 3A4PA 3HP5A 3RPVA 4C4HA 2JAMA 2JAVA 3DTWA 3MVLA 2E2BA 3V5QA 4ORKA 5JEBA 2B9JA 2XIYA 3LCOA 3ZDIA 4N0SA 1ZMVA 3FYJX 4L53A 3VS1A 2YAKA 3UMWA 4O7ZA 4FSNA 4R3CA 5DR6A 2YJRA 4NJDA 1YQJA 2GFCA 3WE8A 5EW8A 5JFXA 4RPVA 4XOYA 2J0IA 3OXTA 4EOSA 5BVDA 4XG6A 4HJOA 3PIZA 3R8UA 3QX4A 4AFJA 2OLCA 5CSXA 1H1PA 3HV7A 3R28A 4QMPA 2C1AA 4AGDA 3LCSA 4FEQA 2WTWA 4UMRA 2VWUA 2ZMDA 4EYJA 1PHKA 5BUIA 1VR2A 3Q9XA 2ITZA 4G17A 2XIZA 2BFXA 4IWQA 3L8XA 3EN6A 5IUGA 3ORTA 2B52A 3QZHA 5ANJA 3BYMA 5G6VA 4E7WA 1OKYA 1XBAA 3EN7A 3T9IA 1Q61A 2OZAA 3MS9A 4ONAA 5AP3A 3OW4A 4EH5A 2YIYA 3K2LA 2IZUA 5M44A 4Y8DA 3F2RA 1FPUA 3R7GA 2C5OA 4ZOGA 1WBTA 5HO7A 3FE3A 5HIDA 4FV7A 5E7RA 2CJMA 4OAVB 2ZMCA 5AR3A 5E1SA 3NNVA 4GIIA 3BBTB 2XVDA 3UP2A 4C33A 1IASA 3HDMA 4YJUA 4GKHA 3EN5A 4IMYA 4LYNA 5AMNA 3G5DA 3ZS5A 2QO9A 3HAMA 4RFYA 3CY2A 2O8YA 2OJGA 5CU6A 2HENA 1W84A 5IUHA 3VHEA 3V8SA 4AZSA 3HV4A 3PZHA 1DM2A 1WVXA 3G0EA 3MI9A 1FGIA 2SRCA 1PXJA 1Q8YA 4BCOA 4S34A 2VTTA 4I21A 4CQGA 1JAMA 3BQRA 2RKUA 4RC3A 1XO2B 4E3CA 3C4CA 4L52A 2C68A 5AJQA 4N6YA 4KSQA 2XM8A 4R5SA 4E5WA 3R00A 4TWPA 4MD8E 3W2PA 3UVRA 3E8CA 4FMQA 5C4KA 2VWIA 3Q53A 2YCQA 4X7QA 5IUIA 4ACHA 4O6LA 2WQEA 3F3VA 5AADA 3EQIA 5BVOA 1YWNA 3FV8A 3OF0A 3TJCA 1E1XA 5AEPA 2QONA 3O8UA 4I4EA 4QQ5A 4FUXA 1GZNA 1KWPA 4KRDA 5EM7A 4QQCA 3VUKA 3GC9A 4P90A 3BPRA 4F08A 2C6KA 3FZPA 3GU7A 3O0GA 2X1NA 3FLWA 5D11A 3VNTA 4DTAA 3PXQA 4CFNA 4CVAA 3R1SA 4DGLC 4LUEA 5G1XA 3FUPA 3FLZA 3UO5A 4KD1A 4E4NA 2XRWA 1H1SA 2CLQA 2UZDA 3DK6A 4FICA 4RJ5A 4ZSEA 5H8BA 3GFEA 4EKLA 3V51A 2P4IA 4ZK5A 4F6WA 2WU6A 2Q0BA 4BFMA 5L8JA 4HYUA 4BI2A 3V5WA 4EC8A 1OBDA 1PXNA 3ZYAA 2JEDA 1BUHA 2W4JA 4R7HA 3L8SA 4JR7A 4ZSLA 3FMDA 4EQCA 5IKWA 4J7BA 2NPQA 4L67A 1R0EA 3RGFA 4OT5A 4OTQA 4EBWA 1Z57A 2GSFA 3OOMA 3P7BA 4KIKA 4CG8A 1IRKA 3QTWA 4G16A 2WQOA 2J0KA 3TV7A 2VN9A 4D9TA 5M06A 5KE0A 5L2IA 4C37A 4CRLA 3LPBA 4QPMA 3D7TB 4QMVA 5FGKA 5C01A 2PZYA 4PV0A 3V8TA 5JQ8A 4DFYA 4KBCA 1BL7A 4A4OA 3QGYA 2PY3A 5CAQA 3QL8A 2DS1A 4FV4A 5EI2A 2C30A 4A9YA 5BX0A 2H8HA 3KRLA 4TTHB 4WKQA 5EDRA 1SVEA 4USEA 4NH1A 2HW7A 4RQKA 3P86A 1VJYA 4AW1A 2G2IA 3TNIA 4HCVA 5BVNA 2C0OA 2QKWB 4I6QA 3H4JA 2HZ0A 3VBVA 4E6DA 2WO6A 2HOGA 4EHVA 3KQ7A 2ITVA 4IEBA 5J5SA 4FV0A 4CLJA 2UZTA 3UDBA 2RGPA 4CV8A 1OZ1A 5CAPA 3P78A 4FNWA 1BKXA 4TY1A 4YURA 2DWBA 4F0FA 5I9VA 5IH4A 4U3YA 2NO3A 2A4LA 2WQMA 4IJPA 4JDHA 4YZNA 2GPHA 4LUDA 3SOCA 3ZSIA 2BHEA 3OXZA 3DQXA 3E63A 4AT4A 5A46A 2R3PA 4QNAA 3E3PA 3FQHA 4U97A 4J99A 4WOVA 3QRTA 4JBPA 4FKOA 3AT2A 4C34A 2VRXA 3AD6A 1NVSA 2CNUA 1KOAA 2O63A 5A6NA 3OUKA 3NZ0A 4FIEA 2VD5A 4RT7A 3RBWA 5BUJA 2R3GA 1OL6A 1BL6A 2O5KA 2QKRA 2X81A 3PY0A 2R3OA 1L3RE 3FXWA 1CKIA 3A4OX 2WD1A 5KMMA 3R9OA 1T45A 1UNLA 3UQGA 4AT5A 3KXHA 3MVJA 1VYWA 2A19B 4JLCA 3TDVA 3GC7A 2JKMA 3D94A 3PA3A 4IHPA 5BVFA 4AZWA 1O6YA 5HCYA 2VGOA 5KZIA 4MX9A 3KK9A 5ETIA 4YBKA 2XF0A 3PG3A 4D55A 5C27A 5JGBA 1IR3A 5HD4A 1YXSA 2XK3A 4KBKA 4YPSA 4ANQA 5GINE 4I94A 4ZSJA 3CE3A 1LR4A 1H00A 2YZAA 4C61A 4MTAA 3H9RA 3U9NA 4CZYB 5GZAA 1J7UA 5LJJA 4JX3A 5CF4A 2XKCA 3I5ZA 1OKWA 4KA3A 3LJ1A 5FEEA 2IPXA 3S00A 1YKRA 3QD2B 3QCXA 2VU3A 3DAEA 4RJ6A 3ULZA 1H27A 5EM8A 3WZKA 3SRVA 2XKDA 3IKAA 4TWCA 3R71A 4ZJVA 2C0IA 3KN6A 4O2PA 4KKEA 1ATPE 4GU6A 4S31A 4HCUA 4JR3A 4KS7A 4ASDA 3G9LX 3ID6C 4Y83A 3QLGA 5J9ZA 3HA6A 3W1FA 2GS7A 4CTCA 3NX8A 5EYCA 2GNIA 5AUTA 4CGAA 4PTCA 5AR5A 4NK9A 3GNIB 2YA9A 3FPQA 1YHSA 3GT8A 3KVWA 1KE9A 4FV3A 3BGZA 4HGEA 3V5PA 4G9RA 2H34A 4MVFA 1OMWA 3DKOA 3BHHA 5LWMA 3F9NA 4I6HA 4I6FA 4FBXA 4BCQA 4YZCA 5JFVA 2NRYA 5DWRA 5HIBA 4D2VA 1FGKA 4ZTHA 4Z7GA 3BYSA 2BVAA 5LMKA 2YAAA 2VO0A 1H08A 1URCA 3PIYA 3WARA 4U7ZA 3O96A 3RPSA 1ZZLA 2W0JA 3FC1X 2BCJA 5CNNA 1PXIA 2EXEA 4CFUA 2NP8A 2PU8A 2JKQA 4P4CA 4IADA 4O0YA 3RK7A 4BYJA 2R4BA 4RJ4A 4YTHA 4AOIA 2ZVAA 2ITUA 2W1DA 5FXSA 1UKHA 3PVGA 4GT4A 3D0EA 2XNGA 1H8FA 3H0ZA 4KIPA 2WPAA 3IDBA 4AZVA 4CZTA 2R3HA 3ET7A 5HO8A 5AV4A 5LMKC 2J0JA 3Q4TA 2OXDA 2R7BA 3EQCA 3LIJA 4QD6A 2C1BA 3RM6A 3ORLA 3DXNA 2BDWA 4XP2A 2C6MA 4ANBA 4WNPA 5LVLA 1ZYSA 2JBOA 3FMHA 4O0RA 3COIA 3G2FA 5D12A 4K6ZA 3ZHPC 4DCEA 2BROA 1R39A 2YFXA 5AP7A 3ZLWA 5IDNA 4O1PA 2PZIA 4PRJA 2IO6A 3DBCA 4GV1A 4UALA 4EHGA 5HQ0A 4GS6A 5CEKA 4WD5A 3UOKA 2FSLX 3DLSA 2F7XE 4IE9A 4LI5A 5T3QA 4I0TA 5HD7A 3UIBA 4X2NA 1UU8A 4XJ0A 3UIXA 2PVJA 2JKKA 2O3PA 2XNEA 3D15A 3JYAA 4LOPA 4RWLA 1OL1A 2GMXA 3FMLA 4E6QA 2UV2A 4FV2A 4U40A 4PPBA 4J71A 3SGCA 3DKCA 2YLFA 4M8TA 2BRMA 1YOLA 4RZWA 4CKJA 2ZM1A 3EZVA 3FAAA 2HIWA 3GP0A 5J8IA 2W4KA 2WIHA 4IFCA 5HLNA 4RFZA 3D5WA 4IVAA 3TCPA 3V01A 4IM2A 3PVBA 3R1NA 5HCZA 3KREA 2IVUA 3BYUA 4G3DA 2QHNA 4RWJA 4H3PA 3NYXA 4YLLA 5D9HA 3UPXA 4CT2A 5IA0A 4BKZA 4J52A 3BIZA 1DAYA 5CF5A 2FA2A 2WHBA 1FVRA 4YHFA 3RP9A 3DCVA 4J95A 4F09A 3JS2A 5CZHA 2UUEA 4MBIA 5CAUA 3LMIA 2WXVA 4FT5A 4ZLZA 4DBXA 4F9AA 4OTGA 3NW5A 3L9MA 2QOBA 3Q9WA 3RWPA 3EYGA 3KRWA 1YHVA 2OW3A 4OTFA 3VRYA 2CCIA 4HVDA 1IA9A 2W4OA 1TQIA 4O38A 3HEGA 4G31A 5B7VA 1PXLA 2AUHA 2G15A 3PVUA 4KNBA 2QCSA 3H9FA 2B1PA 2UZVA 4EUUA 3CCNA 5AP6A 3R73A 2UW8A 3HVCA 1UKIA 2VTOA 2QOLA 2PWLA 3EL8A 3HA8A 3NAXA 3BYOA 5HE0A 2V62A 3TIYA 5KHXA 4H05A 3CS9A 4DEGA 4EOJA 3QQHA 3ZM4A 5DIAA 4C4FA 4O0XA 4C2WA 4HYHA 2XNOA 3UIUA 4BWKA 4YO4A 5K4IA 4DTBA 4HGLA 2PVKA 2XJ2A 1H25A 3D5UA 3RWQA 1F3MC 2PVMA 4ZZMA 3DK7A 4EOKA 2R0UA 3PXRA 4BN1A 2YWVA 3GQIA 3RJCA 1KE8A 3DKGA 4HVSA 3C5IA 2B9IA 4HYIA 2HYYA 2PSQA 4AE6A 3PWDA 3IOPA 5IF1A 5LXMA 1XH5A 4NT4A 3Q2MA 3KMUA 3D2IA 4G6NA 3RPOA 5CEMA 3QQLA 3I6WA 3E87A 1Q4LA 2YHVA 2UZEA 4FTTA 5E8YA 3DS6A 4BYIA 4ZAUA 1GJOA 4RIXA 4Z7HA 2I0HA 3FI4A 4ZTLA 1O6LA 1XWSA 2F7EE 2IVVA 2WELA 1ZY4A 3DOGA 4A9RA 3G9NA 4X2JA 4ANNA 5HGIA 4Y5HA 2FH9A 3LZBA 4D5HA 5F20A 4GFOA 4DINA 1W83A 2BALA 4X3FB 4EEVA 5ICPA 4WSYA 3UIMA 3QC9A 1Q5KA 3SA0A 4BBMA 1H26A 3COMA 4CFWA 4RIOA 5EM6A 3G6HA 3OWJA 4DGNA 1OECA 1VZOA 2BRHA 3MJ2A 1CM8A 3DU8A 2OH4A 2WNTA 2BRGA 4YBJA 4I22A 4HCTA 3E88A 5CAVA 5CF6A 2A27A 3LMHA 4N57A 2YM3A 4BCGA 2ZV7A 3Q4ZA 3TZ8A 3ELJA 3DZQA 4DH8A 4ZY5A 2XZSA 4JQEA 2CKPA 3QRUA 3NNUA 3QWJA 4H36A 4L7SA 2P0CA 2GNHA 2XP2A 1SNUA 2VV9A 2F4JA 3TG1A 2OIBA 3OZ6A 4WA9A 5FDPA 1U54B 1R3CA 2BAJA 3DT1A 5L2TA 4DLJA 4YR8A 3A62A 4DGGA 4J53A 2JLDA 5HEZA 4UWBA 3NVMB 1I09A 3QA0A 3F61A 3MA6A 4G5JA 4CKIA 1OB3A 5CY3A 3ATTA 4E8AA 2Z60A 3TTJA 4AN2A 5J9LA 2BMCA 4EBVA 1DI9A 2XNMA 4RA5A 2IJMA 4MXZA 4AN3A 5M4CA 3Q60A 2R5TA 1PXPA 4FIFA 3R7IA 2XUUA 2CMWA 3DTCA 1KE6A 3TACA 1OVEA 2V7AA 1Q3WA 2J90A 3DJ5A 3AG9A 3K3JA 4H3BA 4HZRA 5KMNA 3KCKA 3FLNC 5HO6A 2IVTA 5FLFA 4PNKA 2I0VA 4JL9A 2J7TA 3PXZA 4AGCA 3NYNA 5ANOA 3KRJA 3TZ7A 4E6CA 4YC6A 4K18A 5HIEA 4PP9A 4EYMA 1UWJA 3PJ1A 1H1WA 4H1MA 2B0QA 3PP0A 3RI1A 1PKGA 5A4EA 4FSRA 2C6OA 4B99A 3NUXA 4FKQA 3LJ2A 3MH0A 4IZAA 3PY3A 3CY3A 4KIQA 5AIRA 4WBBB 4C8BA 2CKEA 4IM3A 3R2BA 3I6UA 3QKKA 2G2HA 4L8MA 5AUXA 5JMSA 5L3AA 4D28A 4D4SA 4EOIA 1XR1A 4BF2A 4D4RA 1GZ8A 5M56A 4O82A 1JQHA 4F0GA 5EKNA 2R3MA 1WBVA 2WGJA 2XB7A 3KVXA 5I3OA 4ALWA 4UB7A 2HZNA 1G8AA 3AC8A 4QYHA 2ITYA 3IW8A 5CALA 5HG9A 3UQCA 4CFFA 2C69A 3O50A 1YVJA 4EQMA 5AAFA 3NWWA 4PTGA 4ZTNA 2WMQA 4MWIA 3DJ6A 2UZOA 5DEYA 1CTPE 4BZNA 3Q52A 2NRUA 3PSDA 1G8SA 2JDOA 3H3CA 3UQFA 2VNYA 3O8PA 3VBWA 4XCUA 2BHHA 2ZDUA 4QTAA 1ZYLA 2GS6A 4U45A 5C26A 2WMBA 3GGFA 5IQGA 2E9VA 1JLUE 2WTKB 4L45A 3R8VA 4RJ7A 4JDKA 2F9GA 4U41A 3SG9A 4R5YA 4R8QA 3P5KA 3S3IA 3ZFYA 3I1AA 5DHJA 3VQUA 5BPYA 3PLAE 5BYLA 3A8WA 2E9OA 2XKEA 5B2MA 1LUFA 3F5UA 2ZB1A 4I5HA 4HW7A 3DBFA 3WIKA 3ZUTA 2WQNA 3RK9A 2YIXA 5AV3A 5E8UA 3UGCA 5HTCA 1R0PA 4RIWB 3GC0A 5L6OA 3LCDA 3CR0A 4JOAA 5DT3A 5FD2A 3W8LA 4M0YA 4UX9A 3OCGA 2P2IA 3PPKA 4HGSA 5HICA 4CFMA 4GH2A 5DNRA 1REJA 2F2UA 3TIZA 3OG7A 2DUVA 2YIWA 1I44A 4XBUA 4G3FA 4O2ZA 1P5EA 4HVGA 4QYFA 3QD4A 1Q24A 5AR8A 1E1VA 3DZOA 1OL5A 2BZHB 5ETFA 3CSVA 5IQCA 4AXAA 1CSNA 3F7WA 1W0XC 5L2WA 4J97A 4BGGA 1K9AA 4C38A 3FZRA 3HLLA 5M4IA 5DEWA 1JNKA 5B2KA 3FZ1A 4RA4A 3M2WA 4M14A 3LM0A 2C5YA 5CENA 5GJGA 2UW4A 3OWPA 3RCJA 2WFYA 3R22A 4FSZA 4GT3A 3OWLA 4DEBA 5JT2A 5I9UA 3V6SA 4RX7A 1GIJA 2CGWA 4QRCA 4YJSA 4RMZA 5D7VA 3BWFA 2NNWB 5M57A 2WMTA 1KV1A 4WT6A 1LEZA 3KGAA 4AS0A 2X9EA 2WMAA 5EDQA 2C6EA 3PZEA 4M69B 3VUIA 4I3ZA 4HNFA 2CDZA 3QYZA 3A7HA 4J8NA 4HYSA 3P08A 4XG3A 3PRIA 3ZU7A 4IH8A 3TUDA 3EH9A 2W1ZA 5GZ9A 4FEUA 4V04A 4L9IA 4EOMA 2Y4PA 4PY1A 3CP9A 1FBNA 4UZDA 1YI3A 3T3VA 3FMNA 5H3QA 4DA5A 2PMLX 4PMPA 3II5A 3BV2A 3C0IA 5E92A 2XS0A 4UYAA 3D7ZA 4GL9A 5GHVA 2Y9QA 4EZ5A 2VTQA 1SNXA 3GCQA 4O6EA 4USDA 1UV5A 5M08A 3LCKA 1QPJA 4L00A 3HRBA 3KULB 4QTCA 5ANKA 1O6KA 3R8LA 3TT0A 3W2SA 4EUTA 4QPSA 1NW1A 3HZTA 3KXGA 2Y6MA 3BLRA 3FY2A 3HL7A 4NIFB 3UC4A 5BVWA 2J0MB 3F3UA 5J87A 4J98A 3MVMA 4DC2A 5FM3A 2QI8A 4YJNA 4FL3A 3FMMA 3K54A 3RM7A 3S95A 4AT3A 3QC4A 3QYWA 3FKNA 4D2RA 4FSTA 4QMNA 1W98A 1V0PA 4G3EA 4ID7A 4XMOA 5C8MA 2YCFA 5AP4A 4RRVA 3NDMA 2KTYA 4LGDA 4Z16A 1H24A 4JS8A 1PMNA 1YDRE 4E5BA 2ETKA 2X9FA 4IACA 4ZLOA 4XS2A 2PULA 4C58A 2Z8CA 2WMWA 3C1XA 1OPKA 3KN5A 4RC2A 2J9MA 4MXCA 1Q8UA 2H9VA 2XBJA 3BX5A 3V8WA 2WTKC 2YM7A 5HNIX 5LCKA 4NKAA 1IEPA 3LAUA 3PXYA 4RIWA 4TL0A 3KK8A 4LGGA 3GFWA 1ZYDA 3WYXA 3SC1A 3K5UA 5TKDA 1OPJA 4E73A 2YISA 1NT2A 3TZ9A 4II5A 3VWAA 2WOTA 4YO6A 4UMPA 4XX9A 3W18A 4OGRA 1OUKA 4NCTA 4PDSA 3ZFMA 4BCJA 3QFVA 2X2MA 4R7IA 4ANSA 3A2CA 3DBDA 2AYPA 3MW1A 3QXPA 3SV0A 3W16A 5IQIA 2PHKA 5EG3A 4FGRA 4RJ3A 3L9PA 4CT1A 2J51A 4FEWA 2OK1A 4ZJJA 3ZLYA 3EFKA 4XV3A 5EDPA 4UXLA 4EK6A 5K4JA 5L2SA 4KIOA 4D1SA 2VTHA 4IVCA 1H0VA 4Q9SA 5IQDA 3GI3A 3F6XA 5HHWA 3R8MA 2ERZE 4NCTC 3VUTA 4TYIA 3ETAA 2QVSE 3V3VA 4P5ZA 3QTIA 3P79A 1ZXEA 2O2UA 4F7LA 4DT8A 5LVMA 4AUAA 1OM1A 4RX8A 3V6RA 5IQAA 2IN6A 3W10A 3M1SA 4QYYA 4MYGA 5TR6A 4BDHA 3LE6A 5GJDA 4JQ7A 4QMUA 2X8IA 4S2ZA 2QQ7A 5AP2A 3SW4A 3EQHA 3T9TA 4YPDA 5A54A 3C4EA 3HUCA 1WBSA 3NNWA 3IGGA 2YJSA 3OEZA 4CRSA 2VX1A 5TT7A 4O1OA 3WF5A 4RVMA 5F4NA 5EYKA 3W33A 3FBVA 4O7SA 3OEFX 4FT7A 3HV5A 1ZMWA 4V0GA 5FQDC 4FZFB 5FTOA 4XP0A 4Q2AA 4EK3A 4CCBA 4RC4A 1OITA 1PKDA 4DE4A 3BGPA 4RSSA 4FVRA 5CNOA 2PVHA 3LJ0A 4FV9A 4RFMA 3N4TA 4GG5A 5IEYA 3OFMA 5FDXA 3UBDA 3LFQA 4EONA 3D5VA 4RWIA 4PTEA 2ZJWA 3HX4A 4U0IA 4O7YA 4DFXE 2ZV9A 4JAJA 3VW6A 1AD5A 4NUSA 4AA5A 4AA0A 3A99A 3DDQA 5T68A 4WRSA 2A0CX 5LMAA 5KX8A 1YXTA 3DLZA 4FE2A 3AOXA 4ALUA 4J96A 2C5VA 4UV0A 4JRVA 4R6VA 4IAYA 4ZJIA 1RDQE 3GEQA 3QXOA 3C50A 3FI8A 5AR7A 5HE3A 5J1WA 4QMSA 3TDWA 3ENHA 4WNKA 3DY7A 5EKOA 3UE4A 2BTRA 3GCUA 4A06A 2W1HA 4EH8A 3QUEA 3W55A 3ODZX 1OI9A 4QP4A 2OZOA 3QQGA 3SX9A 3CQEA 3ORKA 3G51A 4C3PA 3E7OA 2XBAA 5E9EA 1PMUA 3OWKA 3D14A 5GIOE 5DG5A 2OSCA 3OCTA 5FTGA 4FI1A 3LHJA 3OMVA 3DK3A 5BYZA 5B2LA 3WF9A 4RIYB 4V01A 4MD7E 3RTPA 3FI2A 3FKOA 2QOQA 2XIKA 4B4LA 3EHAA 3DNEA 4NM0A 1B6CB 3COHA 5EI8A 4GVAA 3UG1A 2GFSA 2JC6A 2XK4A 5L6WL 1YI6A 4I20A 4M68A 2CHLA 4NFMA 5IU2A 4IQ6A 4FYOA 3UYTA 3VS0A 4BY9E 4YJQA 2YN8A 1PW2A 3JUHA 4I6BA 5BMMA 3TJDA 3PUPA 4A7CA 2CKQA 3TNPC 4DITA 3FJQE 4F1OA 4P5QA 3ALOA 5K3YA 5D10A 1JSUA 1J3HA 3BYVA 4HNIA 1PYXA 4JJRA 3DNDA 3OUNB 1YXXA 4XEYA 2RL5A 4EI4A 4W9WA 2FSMX 3P9JA 2QHMA 3ZUUA 3Q32A 3ZO4A 2YM6A 3F3ZA 4BZDA 2H96A 4BTJA 1K3AA 4UYNA 4PDOA 3UVPA 4FKTA 2VTLA 2UW7A 2W5HA 3SHEA 4G6OA 4EH3A 3N4UA 4Y46A 3W8QA 1OL2A 3SXSA 2VTNA 2PTKA 4QMXA 1L8TA 4IZ5A 2OKRA 3F2NA 3F5XA 4IX5A 1SMHA 2W1GA 3LQ5A 5IISA 2PK9A 3DGKA 3DFCB 4OTRA 3U8WA 1YHWA 4APCA 4I41A 2XCHA 4G9CA 2GHLA 3C13A 4D58A 1AQ1A 2QR8A 4K77A 3ZUVA 3P23A 3OP5A 2J6MA 3RALA 4F9YA 3RCDA 4IXPA 5I9YA 4C3FA 5CQUA 4DGOA 5HORA 3R9DA 3FSFA 4HOKA 4TPTA 2IW6A 4YMJA 4S30A 2R0IA 2R3RA 4OTWA 5AA8A 5M53A 1W8CA 5HNGA 4AA4A 3R21A 4QP9A 3QUDA 1ZMUA 3W2CA 3NSZA 4ASEA 4ZZOA 5ITAA 4DG2E 4F1TA 3IG7A 3BHVA 5CQWA 2WMRA 3MBLA 4YNEA 5H8EA 1GIIA 4RVKA 3VS3A 4BCIA 4QMMA 2W5AA 3K5VA 3RAWA 2BZJA 2Q0NA 3Q96A 4QO9A 3UODA 2JBPA 5HBHA 3TZMA 4K8AA 4A9SA 3C0GA 2RG5A 3CBLA 2G9XA 3ANRA 2WMXA 4FT0A 4WG5A 4BKYA 3L8PA 2WU7A 4AWIA 1OIYA 3ZXZA 4PDYA 2ITXA 3FDNA 2JITA 4MNEB 3ZSHA 4BRXA 3NW7A 4GVJA 4FYNA 4OLIA 1ZY5A 2O64A 3IDPA 4LOOA 3D7TA 2X8DA 3GC8A 3GU4A 4LG4A 4DEEA 3OS3A 3QTUA 4EKKA 3RINA 1M7NA 3NRMA 1TQMA 3O51A 3NUUA 4BCKA 3FWQA 1M2QA 4USFA 3GBZA 3VQHA 3GVUA 3ZRMA 1KV2A 4L44A 2R3LA 4CTBA 4ANOA 4JDJA 2PMIA 4FKVA 4FTQA 3OT8A 4DH5A 3HUBA 3ODYX 3ZEWA 1JKLA 2YDIA 2CGVA 3CQUA 5K9IA 3UMXA 4BVUA 2OF4A 2HWOA 3KXMA 1OPLA 3MPTA 4FL1A 1MRYA 2WTJA 3IECA 2B55A 4AW5A 3CC6A 2BRNA 4IIRA 4FK6A 4FNYA 2ONLA 3KMMA 3NUYA 3MH3A 3OD6X 3MY1A 4I5CA 1PXOA 3MFTA 3VUHA 4CSVA 4FKLA 4ACCA 2OGVA 3SG8A 3ZM9A 2VX3A 4F9CA 2Z7SA 5GJFA 4HVIA 1XH8A 3EZRA 3L9NA 3ANQA 3F3TA 3KCFA 4D9UA 5C1QB 2R3KA 2C6IA 4O7RA 4FTUA 2PUPA 2IZSA 2VX0A 4BGQA 2ETRA 4ASXA 4G3CA 1W7HA 2ONLC 3BHTA 3MFUA 3NUPA 4JIAA 4ACDA 4C59A 4YGAA 2BKZA 4DTKA 5JRSA 1Q8WA 4JIKA 5E91A 1IAHA 2VTAA 4FNXA 4JG8A 4O21A 4F7NA 4XUFA 4O7TA 4IAZA 4BDKA 1BYGA 4BWPA 4CYIA 2OICA 1HOWA 3CGOA 4ANLA 3FLQA 4MWHA 2QO2A 2C3LA 4MH7A 5IG1A 4FEXA 5K5XA 5A4CA 1PJKA 3OY3A 2PVNA 3PE1A 4KKGA 5HLPA 4ZY6A 2IW8A 4GU9A 5I5ZA 4JNWA 2EB2A 1IAJA 2JIUA 5ANDA 5IA5A 4FC0A 2P33A 5BQ0A 3CJFA 2RIOA 3KA0A 5CLPA 4IWOA 2R7IA 3KFAA 2ERKA 3AC1A 2QODA 3HMPA 4X21A 3OTUA 4X2FA 3VC4A 4EL9A 3QKLA 4YSJA 2WEVA 4ZTQA 3UNKA 4FK3A 1Z9XA 3TKUA 4EHZA 5J5TA 4A9TA 5HX8A 2C0TA 4YU2A 5GIPE 4F6SA 4DF3A 4IC8A 3MFSA 5KMIA 1UWHA 4TNBA 5IPJA 2RFSA 1QPEA 2XK7A 3E5AA 3PWYA 3HKOA 3PXFA 5HE2A 1Q97A 4R7BA 2VTSA 4M7IA 5IA2A 4HPTE 2ACXA 3LFNA 5J7BA 2Y7JA 3EFWA 4HGTA 3S2PA 5EOBA 4AF3A 4YHJA 5CSHA 2FVDA 4F9BA 3DFAA 4EH9A 3T3UA 4Z3VA 3MB7A 1XJDA 4CKRA 1DAWA 2ETMA 2VO3A 3VAPA 3C9WA 4MAOA 3ZO1A 1KE7A 2RSVA 2VTPA 1H1QA 2JGZA 3RVGA 2XNBA 3KF7A 3B2TA 4I5MA 5TF9A 3AMAA 4QTDA 4UWCA 4PDPA 2EUFB 4AAAA 4BIEA 2GS2A 3CEKA 4ZZNA 2XK9A 4WUAA 4XOZA 4BTKA 4DH1A 5AUYA 3B8RA 3AXWA 3EFLA 4GK3A 4XHKB 4Y73A 3RPYA 4F99A 4OBPA 5CEQA 4EQUA 4OTDA 5CANA 5K0XA 3HECA 4BHZA 1F0QA 2QD9A 2PUNA 2X39A 4MHAA 5HG8A 1XHAA 2R9SA 3C4FA 3WI6A 4FTAA 4IJ9A 5CI7A 5K0KA 3BV3A 4BDGA 1J7LA 4EZ3A 4G2FA 4YLJA 3SD0A 3VS5A 4YUQA 4G3GA 1RW8A 1JVPP 1XH4A 3F3WA 4A4LA 4GW8A 3U4WA 4MF1A 4MXYA 4GK2A 1MUOA 4L46A 4LV5A 1U59A 4NM3A 1B38A 5JRQA 2CGXA 1H0WA 3R02A 3ROYA 3UOJA 1VYZA 3JY9A 1U4DA 2OFUA 2WTCA 5A4LA 5K5NA 5IQHA 2ITOA 5A4QA 2BR1A 5AWMA 1J91A 1P2AA 4FKIA 3TWJA 2W7XA 3GENA 3PSCA 1SVHA 4BCMA 5EH0A 3VS2A 3ZLXA 3UNJA 4ERKA 3WF6A 3E93A 2OF2A 4C4EA 4ZSAA 3P7AA 3AQVA 2GTMA 3VBQA 5E8ZA 4QP7A 5LVPA 2GQSA 3LOKA 4FV5A 4FZAB 3ACKA 3DBEA 3I0QA 5EQYA 4U43A 4N6ZA 2OJIA 5T6KA 3TKIA 3B2WA 2OWBA 1KOBA 3QALE 4L3PA 5FP5A 5KZ0A 1R1WA 5CWZA 3TV4A 5FBOA 4NZWB 2PVLA 1MRVA 4D2PA 5HTBA 3FZSA 1ZWSA 2JFMA 3FSKA 5J95A 2XMYA 2WKMA 3RAHA 4IX3A 4QTBA 3IW6A 2IWIA 3BLQA 5JKGA 1BX6A 3ZSGA 4C3RA 1Y6AA 3QTSA 4BBEA 2BDJA 2CLXA 3D2KA 2GCDA 5EW9A 3WF8A 2VUWA 2XM9A 5CU3A 3AGMA 4UEUA 1P14A 3QQKA 3VHKA 4A07A 2J5FA 1HCKA 1ND4A 2I0YA 5E1EA 3VULA 4PUZA 3LM5A 4L7FA 4IC7A 4FODA 2LAVA 5EW3A 2P2HA 3C4WA 2PYWA 2J5EA 2V55A 4LV8A 2X7FA 3KC3A 4IB5A 4DHFA 3U55A 2YITA 4TXCA 3KU2A 3HMNA 3UOLA 3VO3A 3QCSA 1AGWA 4I1ZA 4CXAA 4BHNA 2XH5A 1XQZA 1Q8ZA 5HZNA 5LVNA 3HRCA 4GJ3A 3HDNA 5AM7A 2F2CB 3RZBA 4ZTSA 4DFLA 4RQVA 4TYHB 2Z7QA 5FG8A 3D5XA 5M4UA 3FZOA 2FSOX 3BHYA 3JR1A 4BDAA 4CG9A 3DJ7A 2R3NA 3OVVA 4LRJA 1ERKA 3IK3A 4B7TA 1QCFA 3H10A 1V0OA 3A7GA 3FHRA 4XNEA 5CAOA 3AC4A 3ZONA 3BE9A 4WG3A 4BZOA 5C8NA 4TKSA 3PTGA 4ACGA 3UPZA 3PDTA 3VBYA 4RWKA 5J9YA 2UZUE 2ITPA 1OIRA 2WMVA 1KE5A 3W2OA 4MNFA 3QHRA 2UZLA 3E64A 4OBOA 4XLVA 5FUTA 3IQ7A 4TYJA 5FXQA 3D4QA 2I6LA 4GEOA 4KBAA 5CU2A 3RKBA 3JPVA 4AG8A 1YXUA 4RJ8A 2VNWA 3NUNA 5HG7A 5DI1A 4EWHA 3ZOSA 5AAGA 2YDKA 4LRMA 2IVSA 3MJ1A 3KKVA 4DFBA 3BEGA 4C57A 3NYOA 3D83A 3LFDA 4QMOA 4ALVA 3MESA 5IQBA 3EQDA 5CI6A 3BE2A 2QOKA 4JT3A 4D2SA 3PFQA 3W2RA 5JGDA 5JH6A 5BVKA 3LFAA 3NYVA 5DR2A 4MQ1A 1APME 4OTIA 5ACBC 3QKMA 2YERA 4FIHA 4CMTA 5CZIA 4CCUA 2FUMA 4MD9E 2R3FA 3HAVA 5E8TA 4GUBA 3BELA 4YJPA 5DPVA 4QQTA 5M51A 3EJ1A 1FMKA 5AAEA 4X3FA 3ZO2A 4DG0E 3R7OA 4AACA 5CF8A 1PF8A 3GB2A 4OBQA 3EFJA 3F2AA 3NPCA 3PSBA 4KSPA 5HG5A 2PVFA 2QURA 3NW6A 2UW5A 4PPCA 1UNHA 5DT0A 4U44A 3ROCA 2BAQA 3DXPA 4W4XA 4FUYA 3E8EA 3A7FA 1FVTA 5HVJA 1FMOE 3DKFA 3IPHA 3R7EA 3RHXA 3THBA 3TEIA 3V04A 4X3FC 3FLSA 4C4IA 5FRIA 4XRJA 2OXYA 5KMJA 2X4ZA 2ESMA 2W06A 3ITZA 4BC6A 4BI1A 4M84A 2C5XA 5L6PA 3GU6A 3E8NA 1H1RA 3SW7A 3CLYA 3KXXA 2WTIA 3SOAA 5AV1A 5I9XA 4O0VA 4WSQA 5CVFA 4C02A 1U54A 1SVGA 1YOMA 1IG1A 2ZAZA 1WZYA 4U9AA 4O7LA 1WBPA 4JBVA 3ZFXA 5HTIA 3CPBA 3C0HA 4RGJA 2VWXA 5ETAA 4U3ZA 3WZUA 2X7GA 4UY9A 2OZAB 5DMZA 3TNHA 3PA4A 3EQFA 4IANA 4XG7A 3QRJA 2HY81 4F7SA 1J7IA 5IA4A 4M13A 2XIXA 2C3KA 2BRBA 3R8ZA 2JKOA 2YABA 4YJVA 4FV8A 4KS8A 4XG4A 3UOHA 3NUSA 3EKNA 3MTLA 2YDJA 3IS5A 5D41A 4UN0C 4B0GA 4C4GA 4BCNA 2PE0A 2DQ7X 1Q8TA 4YNOA 2HELA 3Q5IA 3TTIA 3VS6A 4CYJA 3TI1A 4JX7A 4YZDA 3UVQA 5L8KA 5LQFA 4MBJA 3JVRA 3MIYA 3IW4A 4APPA 2IZTA 2B53A 3Q9ZA 4FSMA 4YC8A 3AD4A 3R7YA 4E93A 1J1CA 1FVVA 3MDYA 4XV1A 4D0XA 3QAME 4R1YA 1W82A 5HLWA 4EWQA 4DH7A 2B9HA 2HAKA 4FSWA 1YRPA 4IAKA 3ZBFA 3LLTA 3ZRLA 2YIRA 4ITHA 3PE2A 3JXWA 2BIKB 3HV6A 4AX8A 4CV9A 3P1AA 4O0WA 1UU7A 2GNLA 4D2TA 4JBOA 4YJOA 2BFYA 5DH3A 3HP2A 3QRIA 4QMLA 2ITQA 5CSVA 3C4ZA 3TKHA 3ULIA 1BMKA 3HMOA 3K3IA 4OW8A 2W1EA 3VS4A 1WFCA 5I0BA 2E9PA 4TW9A 5TO8A 4QMTA 2X0GA 4TWNA 1QMZA 1UVRA 2ZB0A 4E20A 2ZM4A 4JVGA 3UO6A 2C3JA 2YCRA 4Y95A 3BU6A 4NJ3A 3I81A 1P4OA 1RE8A 3MTFA 1A9UA 5EFQA 2KULA 4WIHA 1YDTE 3MPMA 4Q9ZA 5CEPA 4U5JA 3I7CA 2OO8X 4QP6A 2YM5A 1EH4A 2VTIA 3LXNA 3MYGA 4BR3A 4EC9A 4FZDB 2WOUA 4ZSGA 2I7QA 3LVPA 2UVXA 2IZRA 4KKHA 5A6OA 4O96A 3RNIA 4OR5A 4TYGA 2YM4A 4ZTMA 5LMBA 3POZA 1JOWB 3DBQA 3S0OA 4UWYA 4KRCA 5EYMA 2G2FA 5F95A 4QQJA 3CKWA 4CZUA 3W32A 1M2PA 3LFEA 3QX2A 5FWKK 4GSBA 3KRXA 5AR4A 2XK8A 2VGPA 4TRLA 4DT9A 2BPMA 4NL0A 2W9ZB 4WNMA 4XYFA 5LARA 4KIKB 4ZMEA 5DA3A 2UVZA 4NSTA 3COKA 1KUTA 2PVYA 2Z2WA 4QYGA 5DRBA 4FNZA 3OC1A 4IWDA 4K9YA 5I9WA 2PPQA 4F64A 4EJ7A 3DB8A 3EIDA 5J79A 5DT4A 2VO7A 2ITWA 4LMNA 4O7WA 2C6TA 2OI4X 2PUIA 1STCE 4BDCA 3FC2A 2WZJA 3ORZA 4YZ9A 4DEAA 2BUJA 1U46A 3TV6A 3ZMMA 5DE2A 3NNXA 2UZNA 4OT6A 4QP3A 2QLQA 1XH9A 4MXOA 4QT1A 1MQBA 5L8LA 2UZBA 3CTJA 2OFVA
chains in the Genus database with same CATH superfamily
2BAKA 3C7QA 2GU8A 3E92A 1YWVA 2OU7A 3BBWA 4FKSA 2Y8OA 3BKBA 1YDSE 4M97A 4DYMA 2HZIA 3LFCA 1Y8YA 5IH5A 3ZTXA 5IZFA 2ITNA 1OKZA 1HCLA 2CGUA 4JDIA 4FTOA 4FT9A 5KBQA 4GFGA 4TN6A 4FR4A 1PY5A 2FGIA 3MVHA 4LL0A 2DYLA 4MXXA 4S32A 4L3JA 5CSWA 3VJNA 3ZDUA 2C6LA 2VWVA 2CN5A 1ZARA 3O23A 4FKJA 4FSUA 3F66A 4QPAA 5AX9A 5AX3A 5FXRA 3UDTA 2C3IB 3UTOA 3QGWA 3G33A 4I4FA 1Q62A 1JKKA 3EYHA 5IH6A 1Y6BA 5CVHA 2X7OA 4Y5QA 4KUJA 2R3QA 3R9NA 3S1HA 5IMEA 1PXMA 4DFUA 4B6LA 5J7HA 3JVSA 1WMKA 4M69A 4NEUA 1MP8A 4XG2A 1R78A 5AFVA 4AW0A 4IM0A 3FXXA 5E8SA 1XH7A 3KY2A 4EHEA 4LQMA 2H6DA 5AP1A 4YZMA 3LKMA 3QZFA 3AKJA 4GYIA 4Z55A 2LGCA 2OJFE 4U79A 1H07A 4MXAA 4Y85A 5H2UA 2IW9A 4D4YA 4YC3A 3UZPA 1Y91A 2X0OA 3DAKA 1H28A 3MWUA 5EHOA 4ZP5A 4UXQA 2JIIA 3SXFA 4EOPA 4M66A 3HNGA 5HU3A 3VUGA 4D5KA 4QMWA 1M7QA 4K33A 4IZ7A 3CD8A 4FKGA 4QYEA 3PVWA 5JQ5A 1XMLA 3DXQA 1YXVA 2OJ9A 2R64A 3A61A 3T8OA 2VWYA 3TUCA 3SAYA 4R77A 1ZLTA 1OKVA 2W5BA 4WO5A 3QBNA 3KXZA 3QD3A 3MFRA 1TQPA 3VBTA 3LFFA 3A60A 4KB8A 3NS9A 3KULA 4C0TA 3ENMA 4E5AX 4YTFA 4OUCA 3FYKX 4FIGA 4GK4A 1Z5MA 4S33A 4XH6A 4AZTA 1VLRA 1NA7A 4NIFA 5E90A 5CEIA 3LMGA 5IQEA 4UMTA 3ZZWA 4EH2A 5CU0A 2VZ6A 2J2IB 3DPKA 1VEBA 3H9OA 1QPDA 2QU6A 3CQWA 4BIDA 1GAGA 3MY0A 3PPJA 4TT7A 4WNOA 1PMVA 3Q04A 4IW0A 3SRVB 3UP7A 4CMOA 4F63A 3JY0A 3QRKA 2FO0A 3SLSA 5F9EA 2XA4A 3A7JA 3PA5A 4XBRA 2EU9A 5KMKA 1S9JA 1WBWA 3DQWA 1UU9A 4IBMA 2JD5A 1J1BA 3QQJA 3Q3BA 4F70A 4RX9A 4PPAA 2HCKA 2UVYA 4WUNA 3QTXA 4JRNA 4N4SA 3AT4A 2YZLA 2B54A 2Y4IB 4FRFA 2JIVA 4QOXA 2QG5A 5CYIA 3HV3A 3QLFA 4E4XA 3KL8A 2BKKA 3BL7A 1REKA 3DV3A 1PRYA 1P4FA 5HBEA 3U51A 3PLSA 1ZAOA 5AUVA 4AU8A 2YM8A 2I40A 1T46A 3O17A 3LFBA 4EH7A 2YEXA 3FI3A 2VWZA 2XRUA 3FXZA 3OCBA 4KINA 3QQFA 3F88A 3QF9A 3BLHA 4BCFA 3NEWA 1WVYA 3ACJA 4BDFA 4BDBA 4P7EA 5EHYA 2Z02A 3WOWA 3QTRA 4FL2A 4F4PA 4H3QA 3SDJA 2REIA 2A2AA 4W4VA 4AXFA 1FINA 3U6IA 4HPUE 1ZOHA 4P2KA 3M42A 1V1KA 3EMGA 4ZXTA 4OTPA 3NFGB 4EOQA 5I9ZA 4I93A 3Q4UA 2JDVA 4C4JA 4JI9A 4I0RA 3ZBXA 3GCSA 5CX9A 5LCJA 2P55A 4X6RA 3FMEA 4AW2A 5LVOA 2YWPA 5KKRC 4F6UA 3U9CA 2XCKA 4IX6A 1TVOA 3I60A 4FX3A 4ZEGA 5BMSA 5CT7A 5F94A 3ATSA 2JDTA 3NUAA 3UC3A 5AP5A 3QCQA 3C51A 3GU8A 3UJGA 4ARKA 5AR2A 1JSTA 5M55A 3ZRKA 2XK6A 4BTMA 2WMUA 1BLXA 4FTMA 1A48A 4O81A 3U87A 4IAIA 5M09A 3OT3A 4FV1A 1YI4A 4K11A 5I3RA 1O9UA 4RLKA 3FKLA 4FF8A 1B39A 2FSTX 5HOAA 3HRFA 4IX4A 5ANEA 3OBJA 3R04A 3EQBA 2ITTA 4RVTA 3LFSA 1WBOA 3U4UA 2QU5A 2XJ0A 2VTRA 3O8TA 1PYEA 2YLEA 3I0OA 4M0ZA 4X3JA 4DEHA 4QNYA 4F0IA 2F7ZE 4RX5A 4NWMA 3A8XA 3IONA 3FL5A 3G90X 2XAMA 1Q99A 2CCHA 2CPKE 4FGBA 4LFIA 4LM5A 3ORXA 3GOKA 4E1ZA 2GQRA 4L01A 3CJGA 2W05A 4I0SA 3QUPA 2E9NA 4I24A 4IFGA 4R3PA 5AUZA 5KCVA 2XEYA 3RAKA 4KABA 5JFWA 5DRDA 4YTIA 1WCCA 4GMYA 4GJ2A 4M12A 3MV5A 1RJBA 3G6GA 2WEIA 1A06A 3OXIA 3SQQA 3VBXA 1CMKE 2CN8A 3NCGA 2CKOA 3F5GA 5HVYA 5E8WA 2P3GX 1ST4A 3FQSA 4IAAA 4NYEA 3BEAA 3B8QA 5HX6A 5CU4A 3PIXA 2RFDA 4F7JA 4G6LA 4F65A 2RFNA 3RZFA 4DBNA 3CXWA 4U80A 4AZEA 4G5PA 2V5QA 2VTJA 2HW6A 5EI6A 2PUUA 2BIYA 5LWNA 4CEGA 3MGYA 4FOCA 2BZIB 2GNGA 3R0TA 3CGFA 4LL5A 1GZKA 5AUWA 4AQCA 4BTFA 2AC5A 1LP4A 3IW7A 4EK4A 4RIYA 4CNHA 5JN2A 4AAYA 4MBLA 4FZ7A 2HZ4A 5IDPA 2G1TA 2J50A 2X4FA 4LOQA 3ALNA 1CDKA 3TUBA 4H58A 3C5UA 5H9BA 2VTMA 3EN9A 3GQLA 3VW8A 2PE1A 4BWXA 4AOJA 4EZ7A 4OTHA 2F57A 4D2WA 3O2MA 3PJ2A 4D4VA 3UO4A 2RG6A 4PF4A 2UW3A 3CD3A 2OG8A 3OCSA 5FM2A 5E8XA 4EORA 1NXKA 2OBJA 2OXXA 2Y4IC 2Y0AA 3VS7A 3D9VA 3R9RA 1BI8A 2OIDA 5EOLA 1PMEA 1X8BA 3BCEA 3O7LD 3BWJA 3KRRA 3R30A 5A14A 4A4XA 3VUMA 4W4WA 2ZYBA 4IZYA 3IGOA 5CT0A 3CTHA 1GNGA 4MEDA 3ZXTA 3EQPA 3GUBA 2UZWE 5KKRB 2QG7A 4O7VA 2QOCA 2WMSA 3LXLA 3SKCA 4YZBA 3CIKA 2GTNA 4IB3A 4RBLA 5FBNC 3CTQA 2X2KA 4YSMA 3O7LB 4OAUC 4RIXB 3QCYA 3GCPA 4JG6A 5IEXA 4NU1A 4FT3A 3QD0A 2J0LA 2QOOA 4YJRA 5BUEA 2W1FA 4AGWA 4B8MA 4I92A 3ZO3A 5JSMA 2YACA 2G01A 3TMOA 5JFSA 5I4NA 1G8KA 4O4BB 3FY0A 4XG8A 5FEQA 3N4VA 3HMMA 3N9XA 4GT5A 1QPCA 2QO7A 2X8EA 3PG1A 4M67A 2ZV8A 4XV9A 3ZLSA 3LQ8A 2AC3A 4BDEA 4EK8A 4XRLA 4AN9A 4EOLA 1YOJA 3IDCA 2WQBA 3F5PA 4PL5A 3ZZEA 5KMOA 2UW9A 2VWWA 5KHWA 4BDIA 3LW0A 3ZCLA 4DEIA 4ASZA 3TL8A 3MA3A 3LXPA 3NIZA 5CTPA 3P4KA 3EL7A 4FG9A 3I5NA 2R3JA 3Q9YA 3REPA 5LOHA 3Q2JA 4UBAA 4Z9LA 4R78A 4I6LA 4PX6A 4H1JA 4NW6A 3PJ3A 3MH1A 1Q41A 2C4GA 3BGQA 4FTRA 5TOZA 4TWOA 3ZC5A 4F1MA 5JK3A 3G0FA 3M11A 4I23A 4JXFA 3P7CA 2PMNX 2ZV2A 4I5PA 4W8EA 3MPAA 3R1QA 3CPCA 5CVGA 4BGHA 2XJ1A 4FKUA 4L43A 4ITJA 4O0SA 4U81A 4ZMFA 1OIQA 3OW3A 2HK5A 3UYSA 4O7NA 2XEZA 1F5QA 1M14A 4YP8A 4O27B 3W2QA 4GKIA 4QP8A 3PP1A 2JDSA 4X2GA 4RVLA 4MNEA 4O84A 2CSNA 3I79A 5D1JA 3QU0A 3R01A 4F9WA 1IA8A 3R2YA 4AZFA 5IMXA 3C4XA 4BICA 4CLIA 3U6HA 5FTQA 3R63A 2FB8A 4NM5A 2VWBA 2W17A 3V5JA 3NMUF 3F69A 4FVQA 4FIIA 5KUPA 3FL4A 5C03A 3U54A 2WAJA 2QOFA 3N51A 2HWPA 5ACKA 3NLBA 1OBGA 4L68A 2B9FA 4NM7A 2EWAA 3VIDA 3DA6A 4MF0A 1JPAA 4UZHA 1XKKA 2GNJA 4FZ6A 5HKMA 3POOA 2OIQA 4FTLA 4UMUA 4DEDA 5F1ZA 1ZRZA 2PVRA 4C35A 4ZLYA 3HYHA 3V5LA 2EVAA 2O0UA 3ORMA 4ACMA 4EK5A 4MQ2A 5HESA 2R2PA 2W9FB 5AP0A 2GHGA 3AC5A 3EN4A 1Q3DA 1KSWA 4ENYA 1SZMA 3Q6UA 5C9CA 4PP7A 3L9LA 3AC3A 4D1XA 4IDVA 4MKCA 4PMMA 4DCAA 1JSVA 3NAYA 3VVHA 4ZY4A 1BI7A 5DR9A 4D1ZA 3PRFA 3R7UA 4E4MA 5A4TA 2ZM3A 4W9XA 4BB4A 2X6DA 3NGAA 4ZS0A 1WAKA 1U5RA 5L2QA 3KXNA 5ANIA 4L3LA 4A9UA 5JGAA 4JAIA 4FTKA 4J8MA 2W99B 2ZOQA 2QLUA 2F49A 3GOPA 4NKSA 3QQUA 4QP2A 2VAGA 1MRUA 3PJCA 4LGHA 5DN3A 4J1RA 2WTDA 4O91A 5BVEA 3VUDA 4RLLA 4DGMA 3OOGA 5AV0A 4AGUA 3KEXA 4C2VA 3FMJA 2CNVA 4ANMA 4GG7A 5M07A 3EKKA 5DBXA 1M2RA 2QC6A 4DLIA 4GUEA 2PZRA 4H39A 3Q4CA 4K0YA 1DS5A 1GIHA 5IEVA 1ZYCA 5CS6A 4QTEA 4W8DA 1GOLA 3RMFA 4GIHA 4BDJA 3WIGA 4AQKA 3QTQA 4IVDA 3R1YA 5C4LA 1WVWA 1LEWA 2Z7LA 4XLIA 1Y57A 1V0BA 5CSPA 5IQFA 4FTJA 4FVPA 4B9DA 3U6JA 3PPZA 2C47A 3AD5A 3H30A 3UNZA 4BIBA 4ERWA 4DG3E 4EH4A 4IWPA 4L6QA 3FPMA 4RG0A 5DYJA 5HE1A 4C7TA 3MN3A 1ZZ2A 3AKLA 2RFEA 2RF9A 1K2PA 4BCHA 3KF4A 3VF9A 4PL3A 2BDFA 2UW6A 4X6QC 5JZJA 4JQ8A 3DB6A 4AFEA 5L4QA 5KMLA 2X2LA 3R9HA 3BLAA 1DI8A 1JKSA 4IB1A 4FV6A 3WE4A 1UA2A 3VRZA 4CFVA 1ZOGA 2HXQA 1M52A 1XH6A 4GRBA 3FLYA 5AUUA 4EJNA 3OY1A 4MCVA 3KMWA 4UMQA 4FSQA 5CXHA 1LPUA 4BBFA 4X0MA 2VO6A 4AP7A 4WBOA 4EH6A 4NW5A 4O22A 1FQ1B 4ZIMA 5KO1A 3FEGA 1PXKA 4AE9A 5IA3A 4WRGA 4L42A 3TNQB 5H8GA 3AGLA 4FKRA 1E9HA 5C8KA 3HGKA 4G1WA 2O65A 5GZ8A 3VF8A 3P0MA 4C62A 5J1VA 4LMUA 1H4LA 2XYUA 5HBJA 5BNJA 2I1MA 4D0WA 4FTIA 4Y72A 2A1AB 5EYDA 5HU9A 1YW2A 3QZGA 5CASA 1NVRA 2GDOA 2PMOX 3RHKA 1RQQA 3BU5A 3LCTA 4PL4A 5EQPA 4IDTA 4DH3A 4FA2A 4M15A 3VN9A 2JDRA 2ZDTA 4CD0A 1S9IA 3E62A 3OROA 3MIAA 1URWA 3UG2A 3QZIA 5BYYA 2R3IA 3EQGA 3QWKA 4LRKA 4O0UA 3L1SA 4DFNA 3QA8A 3EOCA 3OHTA 3MY5A 4R3RA 4TNDA 5E8VA 5EK7A 4IVBA 3FMKA 3TNWA 4IB0A 4QMYA 2I0EA 2J4ZA 3GCVA 3GU5A 1FOTA 4Q5EA 3Q6WA 4FG7A 3NR9A 5TE0A 3R83A 5CEOA 3MB6A 1TKIA 4YTCA 3ORNA 2YIQA 2B4SB 2GHMA 2XNPA 2PZPA 3PXKA 1H01A 4E6AA 3UZRA 4FTNA 3ZO1A 4FKPA 5IA1A 5AIKA 3Q5ZA 3IOKA 3E7VA 3ORPA 4ITIA 4DN5A 5E4HA 1CKJA 4BCPA 3RAIA 1JWHA 1JKTA 2GNFA 1OL7A 4PQNA 3CKXA 3WBLA 4XG9A 3OTVA 4BL1A 2FYSA 3LLAA 1UNGA 4N70A 3TXOA 1ZOEA 4MK0A 3WZEA 2C6DA 4JBQA 4FEVA 1WBNA 3IW5A 4CFXA 5DFPA 3R8PA 5GNKA 4C36A 5M4FA 2CNQA 5FP6A 5A3XA 2BTSA 2HXLA 3BRBA 4YJTA 4G34A 3W0NA 1QL6A 3ZEPA 2PE2A 2QNJA 4O0TA 4CQEA 2OJJA 1JBPE 2IG7A 1XBCA 4AOTA 4GYGA 4FOBA 3F7ZA 4XV2A 3DAJA 3L8VA 2WB8A 1NY3A 1G5SA 5EHLA 4NFNA 2EXCX 3KB7A 4GFMA 4JG7A 3G15A 3FHIA 5KBRA 3ZH8A 2V0DA 3MSSA 3OBGA 3QHWA 1ZYJA 2PL0A 5HNBA 3VJOA 3PYYA 3AT3A 3BQCA 4V05A 3PJ8A 4U42A 3R7VA 5CXZA 5DGZA 4DAWA 3WZJA 3P5JC 4WHZA 5HCXA 1CKPA 4IAFA 4PNIA 4KAOA 1GY3A 4HZSA 2E9UA 3BHUA 4TYHA 3LQ3A 2C5NA 4O83A 2BZKB 4KWPA 2EXMA 2QOHA 4R1VA 3I7BA 1G3NA 3RK5A 3TM0A 3F82A 3V5TA 4FG8A 1M17A 5KNJA 2W96B 2UW0A 3BU3A 3A7IA 5FEDA 4HVHA 5HVKA 3AMBA 2WIPA 3HMIA 5ANGA 3ZC6A 3BI6A 2JFLA 4FKWA 4BI0A 2HY0A 4E4LA 1YWRA 4FSYA 4TZRA 1XBBA 3O71A 3S4QA 4EOOA 4QMZA 1OUYA 2YCSA 3QTZA 1SYKA 4B8LA 4O86A 4CMUA 4BKJA 1OIUA 1OGUA 4DFZE 3E8DA 2QOIA 4RZVA 3NVKI 1SM2A 4NTSA 4FTCA 2B7AA 2QR7A 4ZS4A 2W1CA 4PMSA 5D7AA 3WILA 4BDDA 5A9UA 3MH2A 3E3BX 4Q5HA 5DOSA 2Y6OA 3SVVA 2OH0E 4PMTA 5B0XA 5AA9A 5ETCA 3UZTA 5EM5A 2X6EA 4M3QA 3WZDA 4E26A 5DVRA 3H0YA 3ORIA 2XKFA 3SXRA 3AC2A 2EB3A 4NTTA 4ENXA 5EQEA 3LXKA 4K2RA 3EB0A 2XYNA 4PWNA 4W4YA 3R6XA 2GQGA 4K1BA 2V22A 4QP1A 1NVQA 3TN8A 1UU3A 3DDPA 3NIEA 3I4BA 5DLSA 4ZTRA 2XNNA 2PZ5A 4V0GB 3AMYA 2WTVA 2Z7RA 4YHTA 3RNYA 4U8ZA 1U5QA 2W1IA 4QMQA 5HI2A 2Q83A 3BZ3A 3FQEA 4U6RA 4YLKA 3EQRA 3RPRA 4TYEA 4XP3A 1Y8GA 3FZTA 4X2KA 3WF7A 3WYYA 1GZOA 5AM6A 5JZNA 1MQ4A 4FIJA 4WG4A 3PY1A 3GXLA 3ERKA 3NCZA 4GCJA 3EWHA 2V7OA 2XIRA 3IO7A 5AV2A 2BILB 3A4PA 3HP5A 3RPVA 4C4HA 2JAMA 2JAVA 3DTWA 3MVLA 2ZFYA 2E2BA 3V5QA 4ORKA 5JEBA 2B9JA 2XIYA 3LCOA 3ZDIA 4N0SA 1ZMVA 3FYJX 4L53A 3VS1A 2YAKA 3UMWA 4O7ZA 4FSNA 4R3CA 5DR6A 2YJRA 4NJDA 1YQJA 2GFCA 3WE8A 5EW8A 5JFXA 4RPVA 4XOYA 2J0IA 3OXTA 4EOSA 5BVDA 4XG6A 4HJOA 3PIZA 3R8UA 3QX4A 4AFJA 2OLCA 5CSXA 1H1PA 3HV7A 3R28A 4QMPA 2C1AA 4AGDA 3LCSA 4FEQA 2WTWA 4UMRA 2VWUA 2ZMDA 4EYJA 1PHKA 5BUIA 1VR2A 3Q9XA 2ITZA 4G17A 2XIZA 2BFXA 4IWQA 3L8XA 3EN6A 5IUGA 3ORTA 2B52A 3QZHA 5ANJA 3BYMA 5G6VA 4E7WA 1OKYA 1XBAA 3EN7A 3T9IA 1Q61A 2OZAA 3MS9A 4ONAA 5AP3A 3OW4A 4EH5A 2YIYA 3K2LA 2IZUA 5M44A 4Y8DA 3F2RA 1FPUA 3R7GA 2C5OA 4ZOGA 1WBTA 5HO7A 3FE3A 5HIDA 4FV7A 5E7RA 2CJMA 4OAVB 2ZMCA 5AR3A 5E1SA 3NNVA 4GIIA 3BBTB 2XVDA 3UP2A 4C33A 1IASA 3HDMA 4YJUA 4GKHA 3EN5A 4IMYA 4LYNA 5AMNA 3G5DA 3ZS5A 2QO9A 3HAMA 4RFYA 3CY2A 2A98A 2O8YA 2OJGA 5CU6A 2HENA 1W84A 5IUHA 4LDTA 3VHEA 3V8SA 4AZSA 3HV4A 3PZHA 1DM2A 1WVXA 3G0EA 3MI9A 1FGIA 2SRCA 1PXJA 1Q8YA 4BCOA 4S34A 2VTTA 4I21A 4CQGA 1JAMA 3BQRA 2RKUA 4RC3A 1XO2B 4E3CA 3C4CA 4L52A 2C68A 5AJQA 4N6YA 4KSQA 2XM8A 4R5SA 4E5WA 3R00A 4TWPA 4MD8E 3W2PA 3UVRA 3E8CA 3W0MA 4FMQA 5C4KA 2VWIA 3Q53A 2YCQA 4X7QA 5IUIA 4ACHA 4O6LA 2WQEA 3F3VA 5AADA 3EQIA 5BVOA 1YWNA 3FV8A 3OF0A 3TJCA 1E1XA 5AEPA 2QONA 3O8UA 4I4EA 4QQ5A 1ST0A 4FUXA 1GZNA 1KWPA 4KRDA 5EM7A 4QQCA 3VUKA 3GC9A 4P90A 3BPRA 4F08A 2C6KA 3FZPA 3GU7A 3O0GA 2X1NA 2X0QA 3FLWA 5D11A 3VNTA 4DTAA 3PXQA 4CFNA 4CVAA 3R1SA 4DGLC 4LUEA 5G1XA 3FUPA 3FLZA 3UO5A 4KD1A 4E4NA 2XRWA 1H1SA 2CLQA 2UZDA 3DK6A 4FICA 4RJ5A 4ZSEA 5H8BA 3GFEA 4EKLA 3V51A 2P4IA 4ZK5A 4F6WA 2WU6A 2Q0BA 4BFMA 5L8JA 4HYUA 4BI2A 3V5WA 4EC8A 1OBDA 1PXNA 3ZYAA 2JEDA 1BUHA 2W4JA 4R7HA 3L8SA 4JR7A 4ZSLA 3FMDA 4EQCA 5IKWA 4J7BA 2NPQA 4L67A 1R0EA 3RGFA 4OT5A 4OTQA 4EBWA 1Z57A 2GSFA 3OOMA 3P7BA 4KIKA 4CG8A 1IRKA 2AQXA 3QTWA 2WQOA 4G16A 2J0KA 3TV7A 2VN9A 4D9TA 5M06A 5KE0A 5L2IA 4C37A 4CRLA 3LPBA 4QPMA 3D7TB 4QMVA 5FGKA 5C01A 2PZYA 4PV0A 3V8TA 5JQ8A 4DFYA 4KBCA 1BL7A 4A4OA 3QGYA 2PY3A 5CAQA 3QL8A 2DS1A 4FV4A 5EI2A 2C30A 4A9YA 5BX0A 2H8HA 3KRLA 4TTHB 4WKQA 5EDRA 1SVEA 4USEA 4NH1A 2HW7A 4RQKA 3P86A 1VJYA 4AW1A 2G2IA 3TNIA 4HCVA 5BVNA 2C0OA 2QKWB 4I6QA 3H4JA 2HZ0A 3VBVA 3TYKA 4E6DA 1OGYA 2WO6A 2HOGA 4EHVA 3KQ7A 2ITVA 4IEBA 5J5SA 4FV0A 4CLJA 2UZTA 3UDBA 2RGPA 4CV8A 1OZ1A 5CAPA 3P78A 4FNWA 1BKXA 4TY1A 4YURA 2DWBA 4F0FA 5I9VA 5IH4A 4U3YA 2NO3A 2A4LA 2WQMA 4IJPA 4JDHA 4YZNA 2GPHA 4LUDA 3SOCA 3ZSIA 2BHEA 3OXZA 3DQXA 3E63A 4AT4A 5A46A 2R3PA 4QNAA 3E3PA 3FQHA 4U97A 4J99A 4WOVA 3QRTA 4JMQA 4JBPA 4FKOA 3AT2A 4C34A 2VRXA 3AD6A 1NVSA 2CNUA 1KOAA 2O63A 5A6NA 3OUKA 3NZ0A 4FIEA 2VD5A 4RT7A 3RBWA 5BUJA 2R3GA 1OL6A 1BL6A 2O5KA 2QKRA 2X81A 3PY0A 2R3OA 1L3RE 3FXWA 1CKIA 3A4OX 2WD1A 5KMMA 3R9OA 1T45A 1UNLA 3UQGA 4AT5A 3KXHA 3MVJA 1VYWA 2A19B 4JLCA 3TDVA 3GC7A 2JKMA 3D94A 3PA3A 4IHPA 5BVFA 4AZWA 1O6YA 5HCYA 2VGOA 5KZIA 4MX9A 3KK9A 5ETIA 4YBKA 2XF0A 3PG3A 4D55A 5C27A 3W0PA 5JGBA 1IR3A 5HD4A 1YXSA 2XK3A 4KBKA 4YPSA 4ANQA 5GINE 4I94A 4ZSJA 3CE3A 1LR4A 1H00A 2YZAA 4C61A 4MTAA 3H9RA 3U9NA 4CZYB 5GZAA 1J7UA 5LJJA 4JX3A 5CF4A 2XKCA 3I5ZA 1OKWA 4KA3A 3LJ1A 5FEEA 2IPXA 3S00A 1YKRA 3QD2B 3QCXA 2VU3A 3DAEA 4RJ6A 3ULZA 1H27A 5EM8A 3WZKA 3SRVA 2XKDA 3IKAA 4TWCA 3R71A 4ZJVA 2C0IA 3KN6A 4O2PA 4KKEA 1ATPE 4GU6A 4S31A 4HCUA 4JR3A 4KS7A 4ASDA 3G9LX 3ID6C 4Y83A 3QLGA 5J9ZA 3HA6A 3W1FA 2GS7A 4CTCA 3NX8A 5EYCA 2X0PA 2GNIA 5AUTA 4CGAA 4PTCA 5AR5A 4NK9A 3GNIB 2YA9A 3FPQA 1YHSA 3GT8A 3KVWA 1KE9A 4FV3A 3BGZA 4HGEA 3V5PA 4G9RA 2H34A 4MVFA 1OMWA 3DKOA 3BHHA 5LWMA 3F9NA 4I6HA 4I6FA 4FBXA 4BCQA 4YZCA 5JFVA 2NRYA 5DWRA 5HIBA 4D2VA 1FGKA 4ZTHA 4Z7GA 3BYSA 2BVAA 5LMKA 2YAAA 2VO0A 1H08A 1URCA 3PIYA 3WARA 4U7ZA 3O96A 3RPSA 1ZZLA 2W0JA 3FC1X 2BCJA 5CNNA 1PXIA 2EXEA 4CFUA 2NP8A 2PU8A 2JKQA 4P4CA 4IADA 4O0YA 3RK7A 4BYJA 2R4BA 4RJ4A 4YTHA 4AOIA 2ZVAA 2ITUA 2W1DA 5FXSA 1UKHA 3PVGA 4GT4A 3D0EA 2XNGA 1H8FA 3H0ZA 4KIPA 2WPAA 3IDBA 4AZVA 4CZTA 2R3HA 3ET7A 5HO8A 5AV4A 5LMKC 2J0JA 3Q4TA 2OXDA 2R7BA 3EQCA 3LIJA 4QD6A 2C1BA 3RM6A 3ORLA 3DXNA 2BDWA 4XP2A 2C6MA 4ANBA 4WNPA 5LVLA 3NFFB 1ZYSA 2JBOA 3FMHA 4O0RA 3COIA 3G2FA 5D12A 4K6ZA 3ZHPC 4DCEA 2BROA 1R39A 2YFXA 5AP7A 3ZLWA 5IDNA 4O1PA 2PZIA 4PRJA 2IO6A 3DBCA 4GV1A 4UALA 4EHGA 5HQ0A 4GS6A 5CEKA 4WD5A 3UOKA 2FSLX 3DLSA 2F7XE 4IE9A 4LI5A 5T3QA 4I0TA 5HD7A 3UIBA 4X2NA 1UU8A 4XJ0A 3UIXA 2PVJA 2JKKA 2O3PA 2XNEA 3D15A 3JYAA 4LOPA 4RWLA 1OL1A 2GMXA 3FMLA 4E6QA 2UV2A 4FV2A 4U40A 4PPBA 4J71A 3SGCA 3DKCA 2YLFA 4M8TA 2BRMA 1YOLA 4RZWA 4CKJA 2ZM1A 3EZVA 3FAAA 2HIWA 3GP0A 5J8IA 2W4KA 2WIHA 4IFCA 5HLNA 4RFZA 3D5WA 4IVAA 3TCPA 3V01A 4IM2A 3PVBA 3R1NA 5HCZA 3KREA 2IVUA 3BYUA 4G3DA 2QHNA 4RWJA 4H3PA 3NYXA 4YLLA 5D9HA 3UPXA 4CT2A 5IA0A 4BKZA 4J52A 3BIZA 1DAYA 5CF5A 2FA2A 2WHBA 1FVRA 4YHFA 3RP9A 3DCVA 4J95A 4F09A 3JS2A 5CZHA 2UUEA 4MBIA 5CAUA 3LMIA 2WXVA 4FT5A 4ZLZA 4DBXA 4F9AA 4OTGA 3NW5A 3L9MA 2QOBA 3Q9WA 3RWPA 3EYGA 3KRWA 3UDSA 1YHVA 1G8JA 2OW3A 4OTFA 3VRYA 2CCIA 4HVDA 1IA9A 2W4OA 1TQIA 4O38A 3HEGA 4G31A 5B7VA 1PXLA 2AUHA 2G15A 3PVUA 4KNBA 2QCSA 3H9FA 2B1PA 2UZVA 4EUUA 3CCNA 5AP6A 3R73A 2UW8A 3HVCA 1UKIA 2VTOA 3VONA 2QOLA 2PWLA