3SXRA

Crystal structure of bmx non-receptor tyrosine kinase complex with dasatinib
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
260
Chain Sequence
GHMELKREEITLLKELGSVVKLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKMPYDLYTNSEVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of bone marrow kinase in the x chromosome: a Tec family kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Cytoplasmic tyrosine-protein kinase BMX
total genus 87
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sxrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sxrA01
3EZRA 4AZTA 3KRRA 3IONA 2ZYBA 3CD3A 1ZMVA 4JDHA 4BDHA 4EHEA 4CMOA 3GCUA 4LOOA 1GOLA 4S30A 3BWJA 3FZPA 4J8NA 4QYEA 4ANMA 1ZY4A 5BVOA 4X6RA 2B9IA 3MFRA 5I3OA 3EQHA 2GSFA 4MXZA 4AN9A 4M0ZA 3IDCA 2VV9A 4P5QA 4PUZA 3DFAA 3GT8A 3NUUA 3ZSHA 2X81A 4U3ZA 4W4WA 4BCIA 3I60A 3EFWA 3NYXA 4FKIA 5IQDA 4CFVA 3OZ6A 1TQMA 4FTUA 4KRDA 3P7CA 4GUEA 4NM3A 3QKLA 4E5WA 2B7AA 2ZOQA 5EH0A 1H1SA 4O81A 1H28A 3SD0A 2G2IA 1H0WA 3Q60A 1IG1A 2WMWA 4CNHA 4G16A 4U43A 3VW6A 3ZC5A 1NW1A 5ANJA 4I21A 4FMQA 3F7ZA 4DFZE 1G8AA 5M07A 4DBNA 5EYCA 2EVAA 1UKHA 4YJNA 5GJDA 4AN2A 1UU9A 2Y9QA 4W4XA 3FI2A 4L44A 3U6IA 4HCVA 3SGCA 2HIWA 5L6OA 4FT7A 1UVRA 5HU9A 2XK8A 1F5QA 3RBWA 4G9CA 1PHKA 4YHJA 5F94A 4BWXA 5KUPA 4XS2A 3TL8A 1IA8A 2GCDA 1O6LA 2OXYA 4C59A 1AD5A 1RQQA 2UZTA 1WCCA 1DAYA 3B8QA 3PSDA 4IB5A 3RTPA 1XQZA 2ZM1A 3F6XA 3WZJA 2I6LA 4WIHA 4NWMA 1YI6A 4R1YA 4F0GA 4FV4A 5AV3A 3UG2A 2HELA 2PTKA 3QX4A 4CFUA 5GZAA 4N57A 4R78A 4F7LA 5AM6A 2JBPA 2XJ1A 3MBLA 4MCVA 4FUXA 4DH8A 2IZTA 4AFEA 5I4NA 5I9XA 1XHAA 2QODA 3IG7A 4S32A 4AGDA 4APCA 1W82A 3R8LA 3QAME 4RSSA 2OJFE 2QR8A 5IISA 2EU9A 5AP2A 5EHLA 4CCBA 4JDIA 2BHEA 4NL0A 3FQEA 4NM0A 5M06A 5J9LA 1I44A 3AOXA 3Q5IA 4NZWB 4RC2A 5A4CA 4CT1A 4IXPA 5EW8A 5CYIA 3GBZA 5IUHA 4AX8A 5IH6A 3E8NA 4R7IA 2YWVA 2R7BA 3Q53A 3D83A 3HEGA 2R7IA 1B6CB 3VQUA 3QWKA 2QVSE 4Y46A 2O0UA 3ZONA 4F9BA 3TKUA 4E7WA 4IEBA 4AN3A 3OVVA 2A4LA 4JBPA 4NIFA 3W2QA 5EW3A 5BVWA 3DFCB 3EQGA 4JDKA 2JDSA 2CNVA 3NIZA 3E87A 3ODYX 3FMNA 3F7WA 4YLJA 2JDRA 4E93A 4HNIA 4U97A 4KIOA 4EUUA 3HP5A 4OGRA 3GCSA 4MF1A 4XG2A 1YI4A 4RZWA 3A99A 4ZTNA 2DS1A 3OCTA 4YJVA 1UV5A 3NNXA 4RVTA 1O6YA 4EK8A 1NXKA 4LOQA 5BYZA 4C35A 2A1AB 1YQJA 3MTLA 3QYZA 4IDTA 4UWCA 3AC2A 4P2KA 4YZMA 4CKIA 2YN8A 3WF6A 4R3RA 4MD8E 3FYJX 1ZZ2A 5AX3A 3ERKA 4GUBA 4QMTA 3R9OA 2VWZA 3T9IA 4IJPA 5CZIA 3R7IA 3QX2A 4IB3A 5KKRB 1REJA 4F08A 3RCJA 3EL8A 4YO4A 3WZDA 4DITA 4BTJA 5J79A 4IAKA 3DY7A 5CTPA 3PG3A 5T6KA 1WBNA 4D1SA 4ERKA 4TXCA 2J2IB 2BILB 4F0IA 5HX6A 2XK3A 3W2OA 2A2AA 5LWNA 3ZRKA 4MK0A 3D7TB 4IFCA 3O0GA 3PY1A 5HZNA 4D2TA 4QQCA 2X8IA 2A27A 2YIYA 4RX9A 1OITA 2OIDA 4I0SA 5HO6A 2VO6A 1G5SA 3BV2A 4JQ8A 1CMKE 4FIFA 4QMYA 3TNIA 4A9YA 5KZIA 4GRBA 3A7GA 5HG7A 3QTUA 4K8AA 4YHFA 4C4FA 3RWQA 4D28A 3ZDUA 3FMDA 3ZUTA 4RIXB 4RX5A 1ATPE 2FO0A 1Q8TA 3O17A 3QWJA 4QTAA 5ANOA 5FWKK 2ACXA 5CSHA 5KE0A 3QD4A 4O7LA 1Q3WA 2VAGA 4H3BA 2VRXA 3IOPA 1VZOA 3QFVA 3AMBA 2P4IA 2QI8A 3NNVA 5DRDA 2X2MA 1P2AA 3C0IA 4M3QA 2OG8A 4IJ9A 3RAWA 4CTBA 4E73A 4FE2A 3R1YA 3ZFMA 2WMRA 5CEOA 5T68A 4FSWA 3KFAA 3BYSA 4O0VA 4GT4A 1WZYA 4D5HA 5LXMA 3KU2A 2IZRA 5EYDA 2W7XA 2O65A 3ODZX 1SVEA 3NWWA 2YACA 1K2PA 3IK3A 5M56A 5IG1A 4QMQA 4EJNA 3LCKA 4C57A 2QOOA 3PIYA 4FZ7A 4HZSA 4X21A 1S9IA 3DU8A 3NX8A 4GT3A 4W8EA 2QURA 5JKGA 2GU8A 3OOGA 2G9XA 2WB8A 4I23A 4XV9A 5EK7A 1OPKA 2YLEA 3DBCA 3C0HA 4F9CA 3RPVA 3EFJA 3QZFA 5I5ZA 4XP3A 1OL1A 3D0EA 4B7TA 4AG8A 3C5UA 4V05A 4R7HA 1XH4A 4GEOA 2GPHA 2OZAB 3FZ1A 3NYOA 2REIA 4M66A 2YJSA 3R7GA 5DHJA 5C8MA 3QL8A 4N4SA 3BZ3A 5HBHA 3CJFA 3MS9A 3R01A 4R8QA 1FPUA 1U46A 4ITIA 4BIEA 3CD8A 5FTQA 4YU2A 3FXZA 4D1ZA 3MH0A 3QCXA 4B9DA 4F9YA 4D4SA 3NPCA 3PLAE 2PUNA 1SNUA 3L8XA 2O2UA 5JMSA 3LXNA 2CGWA 2YM4A 4AA0A 4IAYA 4EOQA 5AUVA 3MN3A 5M08A 4RWKA 2BZIB 2WTKB 3CQUA 1JVPP 4FV2A 5L2IA 2UZNA 3H30A 4K1BA 4PTEA 1PYXA 3RK5A 1M2QA 3ORMA 2VNWA 4EUTA 1YRPA 5HGIA 3BGZA 3ENMA 2VWUA 4NUSA 3I81A 5AR7A 4MNEA 4F64A 4OLIA 1HCLA 4NM5A 4F7NA 2CGVA 1PJKA 3AC5A 1XWSA 1UNHA 1KE8A 2X7FA 3F2AA 5DEWA 3K5VA 4F70A 5HU3A 4RBLA 5KNJA 5CVHA 2PUIA 3FLQA 2CCIA 5CAQA 5AFVA 3R30A 2YJRA 5FBNC 1RW8A 4PNIA 3MESA 4U8ZA 4S31A 2PWLA 2WPAA 4MD7E 4TN6A 5DRBA 1LEZA 3ORIA 2F57A 3ORKA 3WZUA 2PVLA 4CQEA 4KUJA 4X3FB 2B0QA 3C0GA 1IR3A 3LZBA 5AR3A 5AR8A 5HTBA 2XCHA 4G5PA 3IDBA 2X2KA 2IVUA 4ALVA 4DTAA 2P0CA 1Q8YA 2OF2A 3NYNA 2V0DA 4DBXA 3OD6X 1JNKA 4BDJA 1ZYLA 4TY1A 3WIGA 4EOKA 3FMEA 4GVJA 3C4ZA 4ANSA 3E3BX 4YTCA 2XNMA 3E3PA 2FSLX 3QD3A 2XIRA 2CN5A 1JAMA 2B52A 4YSJA 5JFXA 1VEBA 4I5CA 4YC6A 5C27A 1JWHA 1UU7A 2IG7A 1QMZA 5HHWA 2IVTA 2ITOA 3TG1A 2ONLA 3MV5A 4FZ6A 4I6BA 5EM8A 3S1HA 1M14A 4PP9A 2C5VA 4NTSA 4E1ZA 4X0MA 3GENA 4DFXE 4IH8A 5IF1A 3IW4A 3MYGA 5BVKA 4DT9A 4XNEA 1W98A 2CLQA 5CNNA 5AWMA 3NR9A 4Z9LA 4O38A 4CV8A 4L52A 5EM5A 4ZTQA 4A9UA 3P4KA 2HY0A 4HCUA 3WI6A 4IANA 5CNOA 4AXAA 3ANRA 1BYGA 3BIZA 3Q9YA 3U9NA 4CD0A 3SG8A 3RCDA 2YM7A 5IQFA 1V0OA 2XH5A 4II5A 3OROA 4KS8A 5CQUA 2ITXA 4JXFA 4QT1A 5AM7A 5HG9A 4TWNA 5E4HA 4CLIA 5BVNA 1URWA 3IGOA 3O71A 2YCQA 4LOPA 4RC4A 3CE3A 3QZGA 5IH4A 2BFYA 1XR1A 4YJQA 2O5KA 2XK4A 4GU9A 1GZNA 2VD5A 4D2VA 4Z7HA 1U59A 3ZSIA 4OT6A 5CSXA 4K0YA 4EC8A 4NK9A 4ZJIA 3GFEA 4LI5A 4NSTA 1PXNA 3HAMA 4H05A 5L8JA 5TO8A 3MJ1A 4GMYA 4ANQA 4Z16A 4ZS4A 3CKXA 2IVSA 2FA2A 2LAVA 1ZMWA 3RPRA 4WKQA 2X7GA 5IQGA 3HYHA 3ZM9A 2YM5A 3BLQA 3OCSA 5FEDA 4GYGA 3RHKA 3SXRA 2VGOA 4MH7A 4RLKA 4YBKA 2IW9A 4KSPA 4NFNA 3SW7A 5IH5A 4I5PA 1PKGA 4CFMA 1JBPE 3MGYA 3V51A 1PXIA 3W2PA 5JSMA 4BHZA 4DYMA 5KMNA 4APPA 4BVUA 3NEWA 5J9YA 1OBGA 3H0ZA 2XRWA 3DZQA 2UVYA 2PYWA 3DLZA 3DB6A 4O0TA 4L01A 4C4HA 3W2SA 4KAOA 1J1CA 2GQSA 4JQEA 5CAPA 4QTEA 3UZTA 3U9CA 3LCSA 2Z7SA 4OTFA 1K3AA 3AQVA 5JZNA 2B9HA 1VR2A 4RJ8A 5FP6A 1KSWA 4QD6A 3TJCA 1HCKA 5IA2A 3ZUUA 4W8DA 1OB3A 2WO6A 1MQ4A 2XNPA 4FNWA 3RZBA 2OJJA 5CVGA 2BZJA 4A9TA 2JAVA 4UWBA 4UMPA 4YZDA 3MVJA 3UIBA 4PPAA 1H1PA 3E62A 2ZB0A 3DXQA 1DI9A 2X2LA 3ZLYA 4EKKA 2HZ4A 4HYUA 3II5A 4U7ZA 4XHKB 3ZRLA 4AZFA 1OPLA 4O0SA 4QMUA 4GVAA 1FGIA 3R8PA 3UO6A 4EWQA 4LQMA 5DA3A 3V8SA 3U87A 3C50A 5LJJA 2HZ0A 4XEYA 3V5TA 2Y0AA 2PUPA 4FTAA 4KWPA 4RRVA 5KZ0A 1FMKA 2PVFA 4P7EA 1RJBA 4WT6A 3UIXA 3UYTA 1NA7A 3H0YA 3VUIA 4ZLYA 5BQ0A 3D94A 1JSUA 3GC0A 2OSCA 3JPVA 4IAAA 2XKCA 3QHRA 4UV0A 4ZZOA 4W4YA 4E5BA 4ZY4A 3ATSA 2X6DA 2O3PA 3DBQA 4GH2A 5FM2A 3ZS5A 1OKVA 2H96A 2Q0BA 4JNWA 5G6VA 3R8MA 4BKJA 1H4LA 1XH7A 2PUUA 2Q0NA 4AE9A 3Q2MA 4D5KA 4DT8A 1E1XA 3QLFA 1E1VA 3V5PA 4PQNA 3R02A 3CKWA 2BTSA 4RPVA 2ZAZA 4GT5A 3IQ7A 1Z5MA 3HRCA 4XG4A 3PLSA 3CTJA 3FI4A 4QYFA 4R77A 3Q04A 3HUCA 1HOWA 2ZV7A 4A4OA 4AACA 4DFLA 1XBAA 3LFNA 1QL6A 5M44A 2XIXA 1SNXA 4XCUA 5ETAA 3BI6A 5CALA 3DKOA 5KMLA 3H3CA 3QLGA 5J8IA 1YWVA 4XRLA 1LEWA 2YITA 3RMFA 5CX9A 4FV9A 2HWPA 3LQ8A 3CTHA 4DEIA 2R64A 2WQEA 2YLFA 2SRCA 2A0CX 2X4FA 3L9PA 4LL0A 3GUBA 3P23A 3E64A 4QMSA 4X3FA 2FGIA 2WTCA 2YM3A 5HG5A 5LQFA 4O7SA 2GNFA 3GCVA 3OS3A 4LRKA 4XG7A 3VS4A 4BDCA 4TYIA 4FTOA 4ZLZA 1OUKA 4BGHA 2XNGA 4ZTMA 4D4VA 3UQFA 3GNIB 4RIOA 4I94A 4YTIA 2CKPA 4MBLA 1W83A 3DGKA 5D7VA 4HJOA 5AP7A 3DQXA 4XJ0A 3MFTA 3GQIA 5HIBA 5DFPA 3LPBA 3CY3A 1FOTA 3C4WA 2YERA 3EQRA 4AS0A 3OXTA 4LRMA 2YCSA 5IQHA 4EQMA 5CY3A 1NVSA 2C0OA 3TI1A 3QTWA 1H00A 4L46A 3VIDA 4AAAA 4F1TA 4QMPA 5JGDA 2OXXA 4CQGA 4YSMA 1REKA 2BHHA 4UY9A 4YO6A 5H9BA 3FZTA 1Y91A 4E6DA 5LMBA 4QMMA 3BU5A 3CY2A 1MRUA 2BDJA 3R8VA 2FSOX 3CCNA 2WU6A 4M8TA 4DEGA 2B1PA 2W1DA 3TM0A 3KA0A 2OKRA 3MH3A 3UMXA 2FVDA 4PX6A 2A19B 1WBTA 4FIIA 5CSWA 3LQ3A 1OIUA 3CGOA 3LFSA 4X2FA 3R73A 4A7CA 5JFSA 5GIOE 2FSMX 3I1AA 4UBAA 3ZEPA 2ETRA 1J1BA 1WVWA 4PL3A 2UVXA 4FZAB 5HE3A 2Z8CA 3VO3A 3ORXA 5CAVA 3PXZA 3G33A 3GU5A 3PPJA 4V0GA 3JR1A 2QOHA 5HNGA 2J0JA 3QTXA 3BEAA 4BFMA 3NUSA 4KA3A 4XOZA 3VS0A 4C02A 4XUFA 1Q99A 3R2YA 3VW8A 4FT3A 5EM6A 1SYKA 3SOAA 2YZLA 4AP7A 4C4EA 3E92A 3CP9A 2C0IA 4HPTE 4LYNA 4WNOA 3PA4A 5AAGA 3FQSA 5K5XA 5AIKA 3SG9A 4FEXA 2NO3A 3KCFA 2DYLA 2W1EA 1H1RA 3KXNA 2XK9A 4WG3A 4BCOA 3TXOA 2ZB1A 1GZ8A 5D7AA 3CTQA 4UB7A 2YWPA 3BCEA 4J71A 4RLLA 2PZYA 3LFEA 3PZEA 2BIYA 2YIRA 3QU0A 4JR3A 4Q2AA 1Y8GA 3W32A 4D0XA 3UPZA 5JFWA 4JT3A 4CSVA 4U40A 1QPEA 5HO7A 3GOKA 4R7BA 4IE9A 5DYJA 2IWIA 2WMQA 3UP2A 3DAEA 5AR2A 3IW6A 3EN6A 4UXLA 4AW1A 3HZTA 1IRKA 1M17A 1FVVA 5LMKC 1OL6A 1FBNA 2QO9A 2H6DA 5AUXA 1IEPA 1OL2A 2CHLA 2JDVA 3PFQA 3GU4A 3V8TA 4BI2A 4JBQA 4O1OA 2YIQA 4EQUA 3FMLA 3O7LD 3IOKA 4JVGA 1CTPE 4EWHA 3TZ9A 4F6WA 5CLPA 1KWPA 2RG6A 5HBEA 3TTIA 4IZAA 5LVOA 4N6YA 3Q5ZA 4FK3A 4DGOA 3ET7A 2GNGA 1FINA 4GIHA 2R0IA 3VNTA 4FKSA 2UW6A 1PKDA 3WZEA 3HV6A 4K77A 3KMWA 3ZHPC 4EORA 4AW2A 4CKJA 4R1VA 4O7VA 4USDA 4Z7GA 5ANKA 4BTKA 4UMTA 1CSNA 2W4KA 3FPMA 5LVNA 4D9UA 3PXYA 5J7BA 2QCSA 5FLFA 2BVAA 4WG4A 4QMWA 2V62A 3BBWA 3LCOA 2UW8A 5IA3A 4Y8DA 3MB6A 5HVKA 1NVQA 3REPA 3HV4A 3CXWA 2QKRA 2XM8A 4F7JA 2VX1A 3CC6A 3LJ1A 4O6LA 4BDGA 3COHA 1OL5A 2VO7A 4FEQA 4I93A 3VVHA 2VU3A 3D5XA 2X4ZA 5KMIA 4ZIMA 3N4TA 3IW7A 1LPUA 4RQVA 3LJ0A 4GU6A 4B8LA 4RFMA 3FLZA 1PYEA 5HNBA 5IEYA 4EYMA 5AP0A 2HZIA 1WFCA 2QC6A 4I22A 4YJOA 4FV0A 4FYOA 3OWPA 2EXEA 4CYIA 3MTFA 3H9OA 1E9HA 2RFSA 3AT3A 4N0SA 4OTWA 4RIYB 4U41A 4X7QA 4ZTRA 4V0GB 1Y57A 2CGXA 4FEVA 3O8TA 1YDRE 1U4DA 3LFDA 2QG5A 4U3YA 3VUMA 3AD5A 5DIAA 2WEIA 2X8DA 2UW9A 5CEKA 5A4LA 2OK1A 3MW1A 2VZ6A 4IB0A 2QG7A 2BZHB 2NP8A 4IVAA 4O6EA 3EFLA 5JK3A 2OO8X 3FKNA 2C3IB 2JIVA 3KXXA 3ENHA 4U9AA 4WRSA 3C4XA 3QTRA 4ACHA 4F63A 2YM8A 2VUWA 3OXZA 5C03A 4B4LA 5K4IA 4WNPA 2OIBA 2R3MA 2XKFA 3FDNA 1YHVA 2AC5A 4YTFA 5K9IA 5ETFA 4AA4A 1Q62A 3EIDA 4GW8A 4IADA 5CI6A 5CZHA 5FUTA 4BKYA 1KOAA 5M4UA 4IAZA 2YDJA 1BKXA 4H36A 5GJFA 2VTQA 1H1QA 2QOCA 2KULA 2W0JA 3FMMA 5FQDC 1OBDA 2CKEA 4ANBA 3UC4A 3F3TA 4J96A 4I4EA 1GZOA 3ULZA 2W9FB 2XK6A 5A14A 5IDNA 2V22A 1Y6BA 3OUNB 1OMWA 3F9NA 4O7RA 2R3HA 3LW0A 2ETMA 4WNMA 4A4XA 2J0LA 4FYNA 3HLLA 4X3JA 3IDPA 4NYEA 3T9TA 3W10A 2VTTA 4QP3A 2KTYA 5J1WA 4L9IA 3DKCA 4KIKB 4QQJA 2DQ7X 5FGKA 1ZAOA 1Z57A 5DI1A 3LFFA 3C4FA 1UKIA 3KVWA 4NW5A 3FMHA 5IKWA 4AZSA 3K3IA 1B39A 3BLHA 3VHEA 5K3YA 2Y4IB 3MPAA 4YLKA 2WZJA 4E20A 1OIRA 2W9ZB 4BDAA 3G6GA 4J99A 4PMSA 2EWAA 5ETIA 3GU8A 3THBA 4EK4A 2C3JA 4FX3A 2XNOA 2WD1A 3FWQA 3DT1A 1UWJA 3QALE 4GK4A 4J8MA 4RVLA 4U6RA 4ANOA 3GXLA 4GFMA 3R63A 2PE2A 2QOIA 4KD1A 3QCSA 3HKOA 5AV0A 2W4OA 2E9NA 3I79A 3TT0A 4GV1A 1F3MC 1YVJA 5CXHA 4EH4A 4YJSA 5L6PA 3EN4A 4U81A 1W0XC 3G2FA 4HPUE 5CS6A 4BKZA 2GNLA 5J87A 1YWNA 4FT0A 5GJGA 2WMBA 4I5MA 2JKQA 4IACA 4NFMA 3HECA 4NH1A 3TZ7A 3UE4A 5HI2A 2XJ0A 2WMVA 3PVBA 3F66A 3BELA 5EYMA 3ZBFA 2H9VA 2XYUA 4DTKA 3NUAA 4BC6A 4MXXA 4QQ5A 2E9OA 4RJ5A 4AW0A 3NYVA 4HCTA 2YEXA 2XKDA 3FLNC 4ANLA 3UQCA 2F4JA 3NNWA 3TNQB 4ZEGA 3VBQA 5CXZA 4BCKA 3HMPA 2CNQA 3KRLA 4L6QA 3UOKA 4Q5EA 4BDEA 1M2RA 3MY1A 2IJMA 3AMYA 5DT4A 4WO5A 3HRFA 4L42A 3JY9A 3LFAA 4MHAA 5K0KA 5EI6A 3AGLA 1PXOA 3S3IA 4ZAUA 5DE2A 3MVHA 3C5IA 4EHZA 5AA9A 4FIEA 5KHXA 2Y4PA 4BF2A 4IC8A 2PL0A 4HOKA 4IWPA 5HEZA 5J5SA 3FI8A 1ZYSA 4I5HA 4IX5A 5I9UA 1X8BA 5GHVA 5HNIX 3DZOA 3F2RA 3BBTB 3VS7A 3OOMA 1JKTA 4IQ6A 4FV3A 5HCYA 1U54B 3PPZA 4ERWA 5L4QA 3EN7A 3I0OA 2J6MA 2QOLA 2XBJA 1JPAA 5A4QA 5JEBA 4R6VA 4CTCA 5HD4A 3BHTA 5HIEA 4YGAA 1ZZLA 3A62A 3ZCLA 1T45A 5AR5A 4ALWA 5E8YA 5IQAA 3DAKA 4YJTA 1YXTA 4C33A 2B4SB 3TNHA 2CDZA 4ACCA 3F88A 4F4PA 4RWJA 3BYUA 4EK6A 2X8EA 2G2FA 3GVUA 3BE2A 1NY3A 3BGQA 4IWOA 4A4LA 2BRHA 4D2PA 3EQIA 4FSMA 3F5UA 2Q83A 2WQOA 3F5GA 1F0QA 2XIKA 3VJOA 4CLJA 2NRUA 4G34A 4F1MA 4LMUA 2RSVA 3HDMA 4HYIA 3DA6A 3KQ7A 5KO1A 3ID6C 2QOQA 4TWPA 4EH8A 4JAIA 5E7RA 3HX4A 3JUHA 4BHNA 4BGGA 3WOWA 4EK3A 3PDTA 1FGKA 1BI7A 2QLQA 3RK9A 3VHKA 3G0EA 2B54A 1JSTA 2JGZA 3L8SA 5TE0A 4E4LA 4BBEA 2GTNA 2WMUA 5AR4A 4A9SA 2BUJA 1XKKA 3BQCA 2Z2WA 2UZDA 4ZOGA 1GAGA 3QQHA 4DAWA 5M55A 2I0YA 5FRIA 4ASEA 2PY3A 3MSSA 5EQEA 4MXAA 2F2CB 2OJIA 5DMZA 3OFMA 3QTSA 3GCPA 4OW8A 5E92A 3JYAA 5IMXA 2QR7A 4E4MA 1XO2B 4AA5A 5M4FA 4ONAA 4O0RA 4O1PA 3ZMMA 2QKWB 2WQBA 3NZ0A 4H3QA 2C3LA 3QZHA 3Q52A 4FSTA 4IVCA 5IQCA 3R71A 4TNDA 4EI4A 1R78A 4O21A 2BAQA 2I0EA 5JT2A 1Q61A 5E8TA 3LMHA 4L3JA 4MD9E 4FSNA 4IB1A 4WSQA 3O23A 2W05A 4BN1A 3SQQA 4EOJA 4PMPA 4B0GA 3MY0A 2XEYA 3EKKA 5FG8A 1GNGA 4YJRA 4FV7A 3R9RA 3FI3A 4LMNA 4IM2A 3T3UA 4A07A 4UZHA 5HG8A 5JGBA 2QOFA 4OTPA 3UBDA 4DG3E 4XG3A 3ULIA 2WFYA 5DNRA 4FI1A 4KABA 2DWBA 2GS2A 4P90A 1XBBA 3I7BA 4BCMA 5IA0A 5ANGA 5I9ZA 3OHTA 3BQRA 4UN0C 2OFVA 5L2SA 3KK8A 3KF4A 3WBLA 4CRSA 4I6HA 3DK6A 3F3WA 3PYYA 3UNZA 3E63A 3UTOA 3PIZA 4EOPA 4WNKA 3P79A 3NW6A 4WA9A 3SDJA 5FP5A 1XH9A 3C51A 2PHKA 4YZBA 4D0WA 3PXRA 3Q4TA 1K9AA 2OH0E 3S4QA 3VWAA 5JZJA 3EQCA 2GMXA 5EDRA 3B2WA 4FOBA 2DUVA 4G2FA 1WBVA 3NCGA 4D9TA 4Z55A 4PP7A 3POOA 4W4VA 4WBOA 4FZFB 2HK5A 2BRBA 4DF3A 3LXLA 2GS7A 1WBOA 4DH1A 4L00A 1RE8A 3G0FA 4FNXA 4GJ3A 3R9DA 3SXSA 2HOGA 3FLSA 1PMEA 2OJ9A 3ZYAA 3N9XA 2OLCA 5LARA 4DE4A 3MFUA 5KMKA 2B53A 2ZV9A 1ZY5A 2W1CA 3GGFA 4QTDA 3F2NA 3FAAA 3HV5A 3OWJA 3TJDA 4FKRA 3R7YA 3DCVA 4EK5A 5KBRA 2R3PA 4QP1A 2VTSA 3FC1X 5K0XA 2BZKB 3TNPC 4G6OA 1TQPA 3I4BA 3E7VA 1BI8A 3ALOA 1QPCA 3QGYA 4Y95A 5DT3A 1ZLTA 4I4FA 5AEPA 1SVHA 2R3RA 2XIZA 4GK2A 3W8QA 4BIBA 3RINA 3KXGA 4DINA 1WBSA 4TYEA 3GC7A 4HVGA 2C6IA 4J98A 4BR3A 3CEKA 3MWUA 4KKEA 2YDKA 4RIYA 5CU2A 5LVMA 3CS9A 4EKLA 4KBCA 4MWIA 3JXWA 4FNYA 5HE1A 1APME 3GEQA 3ACJA 3A7JA 3VC4A 5GZ8A 4OBQA 5FXQA 4YJUA 3CBLA 2WOTA 3RJCA 3LIJA 1OKZA 3FKLA 5K5NA 4FTMA 3VS1A 3D2IA 4C37A 4GKIA 1OIYA 3DNDA 4QMXA 4CFFA 1R39A 4O22A 3R1QA 3R7VA 3NVKI 4AGUA 5CU4A 4AE6A 5L8LA 3VS6A 2AUHA 3TKIA 2R3QA 4Y72A 3MIYA 4IM3A 4DEBA 3ZO1A 4J53A 4CYJA 3PJ3A 5C26A 2WIPA 5M4CA 3KKVA 3ZO3A 2W17A 4PDYA 4YZ9A 4K18A 3WF9A 1MRVA 3PA3A 4ASDA 2C6KA 3KXMA 4E6AA 4Q9SA 3NLBA 1U5QA 1JSVA 2R5TA 5IEVA 3R8ZA 2FUMA 4K33A 2HZNA 3VULA 5CF8A 1JKKA 4FTQA 3TKHA 4FL1A 5B2LA 3O50A 5CU3A 3R2BA 4FL3A 2IO6A 5HLWA 3IKAA 1MUOA 5EKNA 2C6MA 3BWFA 2I40A 2UZUE 3QTQA 4EH7A 4D1XA 3OUKA 5AV2A 1H01A 4AU8A 2OI4X 3DNEA 3R1NA 3AGMA 3LJ2A 4ZMEA 2IZSA 3TIYA 5IA5A 4C2WA 4HVHA 3ZO2A 5HTIA 4M15A 4X6QC 2VTHA 4FG9A 3V3VA 4IWDA 5TKDA 4HZRA 3HP2A 5EQPA 2R0UA 3R7UA 3UYSA 4CT2A 4CG8A 2BMCA 2XM9A 4DEAA 4QTBA 2ZMCA 1DM2A 1YXVA 4MYGA 3ATTA 4K9YA 2WTKC 3W8LA 4N70A 4IZ5A 4I92A 3QRTA 4NEUA 1YDTE 4OBPA 4FTRA 2JFLA 4XOYA 4MXOA 5DN3A 2V5QA 4OAUC 1U5RA 4R3CA 3IGGA 3FSKA 4BL1A 3UO5A 2JD5A 2RFEA 4DFBA 4JL9A 5AP3A 3F82A 3CR0A 5I9WA 1OL7A 1GY3A 1V0PA 3K5UA 1PXPA 3MFSA 3DQWA 3E93A 3FLWA 4PRJA 2G2HA 3QQUA 5LVLA 2VNYA 1TKIA 3DK7A 1W84A 1YOMA 4FF8A 3VS3A 2J50A 2V7OA 3ZOSA 3MA3A 3WYYA 5B0XA 3V5WA 3P78A 4NT4A 4EZ5A 1Q3DA 2JIIA 2C68A 2E9PA 3BHVA 3NS9A 4M12A 1FVTA 1ZOHA 3W33A 3V01A 5IDPA 2UZVA 5GZ9A 3VUKA 3EB0A 1XH8A 4P5ZA 2OGVA 4KKGA 1NVRA 1WAKA 4CEGA 3RPYA 3R7EA 3D15A 1S9JA 3QZIA 3DTCA 4F6SA 5L6WL 1KV2A 3GU7A 4EJ7A 4UZDA 4ZJJA 2X9EA 3AT4A 3QRUA 3IPHA 4LM5A 4ZTHA 5KMOA 1J7LA 3TDVA 3HMNA 3LHJA 3UP7A 2VTOA 5M51A 3OBGA 2QQ7A 2R3IA 4UYAA 2PSQA 5CAOA 4XG6A 5ICPA 3OW3A 2UZEA 2QO7A 4R3PA 1FVRA 4FTTA 5GINE 5AV4A 4UXQA 1UA2A 3K54A 4GJ2A 4XV3A 3U55A 3UNJA 2GFCA 2WXVA 3OT3A 4DGGA 3LM0A 3POZA 3Q9XA 3Q3BA 3V6SA 3D5UA 4IX6A 3IECA 3Q6UA 3ZFYA 3PJ8A 3ZUVA 4JS8A 3RAKA 2HWOA 4PMTA 2EUFB 3OCGA 3OP5A 4RIXA 4XX9A 4AUAA 1BMKA 2ITVA 2JBOA 2YISA 2ZJWA 1RDQE 5DGZA 3V5QA 4DG2E 4KB8A 4Q9ZA 3SHEA 5E8WA 2B9JA 4JQ7A 5EFQA 4LV5A 4XG8A 3FV8A 2X9FA 3AXWA 3JY0A 3FPQA 1P5EA 5DR6A 3H9FA 2C5YA 3QRIA 4WOVA 4AZEA 2VTIA 1L3RE 3BYOA 3BU6A 4UWYA 1YDSE 2YABA 5B2KA 2JDOA 3HRBA 4U0IA 1SM2A 2O64A 1PXLA 2ZV8A 4GCJA 4ZSEA 3ZU7A 2BRMA 4DC2A 5AMNA 3G9NA 3HMMA 3RZFA 3WZKA 3PP1A 5AUZA 1XJDA 3SKCA 3E5AA 4H1JA 3Q6WA 3Q9WA 4BCJA 4FL2A 4RFZA 2R2PA 5J5TA 4G5JA 4AT3A 2C30A 4U44A 1KUTA 2PVHA 4D2SA 4Y85A 4MXYA 4CFNA 3HA6A 3M11A 2PZPA 4JBOA 1Q97A 3QTIA 4V01A 2GQRA 1H8FA 2OXDA 4RX7A 1R0PA 3QUDA 3ZRMA 5IUIA 4BZOA 2W5BA 4MBIA 3G90X 3A61A 4P4CA 4YC8A 1ZOGA 3QC9A 5DR9A 5ANEA 4XP2A 3UG1A 1ZMUA 4ZY5A 2VTNA 2XB7A 3SRVB 2J5FA 4EHGA 3MPMA 3BHHA 4O7YA 2HW7A 3E8EA 4ORKA 2W99B 4PWNA 4CCUA 5IQIA 5A6OA 4IM0A 2XP2A 2Z7RA 2YFXA 2IN6A 5HO8A 4MKCA 3TIZA 4XBRA 3UO4A 4D4RA 3LE6A 4DCAA 4DGNA 4E3CA 2C4GA 2WGJA 4FKGA 5C01A 3CLYA 2GFSA 3QA8A 5HLNA 3B2TA 4HGLA 1ND4A 2ZM4A 2CKOA 2C0TA 2AC3A 3OCBA 3UIUA 3C4EA 4L8MA 4TT7A 5D9HA 3RWPA 3UOHA 4PL4A 4RQKA 4EOOA 4DFNA 4BDKA 5AADA 2GDOA 4WSYA 3A7HA 5FXSA 1PXMA 4EYJA 3HL7A 4AZWA 4AGWA 3RGFA 2J7TA 4BTFA 3QKMA 3TCPA 4K2RA 2R3KA 5B7VA 2C47A 3QXOA 1Q8UA 1O9UA 2WTDA 2RKUA 3FHRA 3OEFX 4O96A 4EOIA 1BL7A 5L2QA 3RM6A 2OZOA 5LMKA 4ZP5A 1VYZA 3NVMB 3Q4UA 3OC1A 3QF9A 4OUCA 5KMMA 3DKGA 3GB2A 3QQFA 3FEGA 5A3XA 2W1HA 4F99A 5BYYA 1PW2A 2PE1A 3ZO4A 4C0TA 4CGAA 5CEMA 1UNLA 3AC4A 4GSBA 3FHIA 4IIRA 4PDOA 5CSVA 2B9FA 2PPQA 5TOZA 1YKRA 4PDPA 4DEDA 4BCHA 5AP5A 5CVFA 4JG6A 5HQ0A 2WKMA 4D2RA 4LGGA 3IO7A 3QQKA 4YPDA 4BGQA 1FMOE 4IW0A 4RX8A 2JC6A 3R1SA 5ETCA 4QMVA 3VF8A 3LXKA 1Y6AA 2PVJA 2BKZA 3HMIA 4M13A 4E6CA 2PMNX 4HW7A 4S33A 4XBUA 4C58A 1EH4A 1V0BA 3QXPA 1ZOEA 1Q5KA 3A8WA 4U80A 4GFOA 3FUPA 1G8SA 4LG4A 4X2JA 5TT7A 1R1WA 2ITQA 2UW4A 3LLAA 2J5EA 5D12A 3TV4A 3NMUF 4FT5A 4RMZA 5H8EA 3UZPA 3WIKA 2WQMA 3L9NA 5DWRA 3VBVA 3PRFA 3ZLXA 4FSQA 4M67A 4TYJA 4CKRA 4M68A 3UOLA 3EN5A 2J90A 3TN8A 3L8VA 3KEXA 4YLLA 3QD0A 2C5NA 2LGCA 2X6EA 3GU6A 4F7SA 1KV1A 4BY9E 4BI1A 2XYNA 3D5WA 3DPKA 4QNAA 5AP4A 3AD6A 3MVLA 5AUWA 2NPQA 3KF7A 2XRUA 3COMA 3PIXA 4QP2A 3LOKA 4C3PA 3PWYA 3PPKA 4FIGA 2BAKA 4L67A 4RA5A 4G3DA 5H8BA 1SMHA 3CGFA 3PXQA 5EQYA 4DFYA 3O7LB 5HD7A 5JRSA 3ZBXA 1YI3A 5CSPA 3VUHA 3L8PA 5KCVA 4DGLC 5HOAA 2O63A 2X39A 2XUUA 5AX9A 4IBMA 3S95A 3KREA 3G5DA 4O84A 4B6LA 5EHYA 2NRYA 3TUCA 1KOBA 1IASA 5DVRA 4XV1A 3SW4A 2ITZA 4FV5A 3OEZA 3A2CA 2PMOX 2Y6MA 2E9VA 5CF4A 5ACBC 4XH6A 4EH6A 2CJMA 2H8HA 1O6KA 5BYLA 3FXXA 3PTGA 4O27B 4Y73A 4ZTLA 1OKWA 5LCKA 2RFNA 3W55A 3DKFA 5BX0A 3F61A 3MIAA 4BCQA 1H24A 4LGDA 4BCPA 3BYVA 2WAJA 5E90A 5LVPA 3EL7A 2PZ5A 2R9SA 2XIYA 1OPJA 2HXQA 3I0QA 3I5NA 3G15A 4FC0A 2JAMA 2Y7JA 2Z60A 3CQEA 5A6NA 4G3CA 2J9MA 5HIDA 4JIKA 1WBWA 4I6FA 2XZSA 3G9LX 5K4JA 3DAJA 4Y5QA 3ZLWA 2CKQA 4KBKA 3CPCA 4IX4A 4FKOA 2C6EA 4QP4A 4DG0E 3C9WA 3KN5A 2CN8A 4RJ3A 2RFDA 1CDKA 4OT5A 3S0OA 4RFYA 3UPXA 3BKBA 3SX9A 2PVKA 4TYGA 3FLYA 3FE3A 3UOJA 5HCZA 4BIDA 2G01A 2G1TA 3BLRA 3RK7A 5D41A 3BEGA 3TEIA 3A4PA 3R9NA 4BYIA 4JBVA 5EDPA 2UV2A 4OBOA 4O7NA 2C6DA 3NUPA 1MP8A 4FGBA 4ZSJA 3ZH8A 2RF9A 4YC3A 3LFBA 5HCXA 1ZXEA 4OTQA 4RIWA 3VJNA 5FBOA 1ZWSA 1JOWB 5JQ5A 4M0YA 3ORTA 5EM7A 2JFMA 3DOGA 4ZXTA 4JAJA 3UNKA 3N4UA 5EHOA 4D2WA 3BV3A 3ORNA 4PV0A 4C8BA 4EONA 3D14A 2XS0A 4OTGA 4A9RA 5CASA 1JQHA 2R3OA 1DAWA 2QNJA 4MF0A 3SXFA 2PVMA 2P33A 3C13A 5BNJA 5BVFA 4FR4A 4JRVA 1PRYA 2ITWA 3QKKA 3RAIA 3QQJA 2XF0A 5IMEA 1NT2A 4H3PA 3DDPA 3D7TA 1FQ1B 3DDQA 4XLVA 3WARA 3UQGA 1KE6A 2HCKA 5HESA 3SLSA 3N51A 3S2PA 3FC2A 5E8XA 5HLPA 2C6LA 2ZM3A 4CXAA 1IAJA 2R3FA 4J1RA 1BLXA 2P2IA 3U8WA 5AP1A 4FTCA 3O2MA 2X7OA 4TYHB 2W1IA 4Y83A 4AOIA 5GIPE 3C1XA 2WNTA 4O2ZA 3MH1A 4F9AA 4RWIA 3D5VA 4O7TA 4E8AA 3DJ7A 3P7BA 4QO9A 5AIRA 3DBFA 3OWLA 4LUEA 4CRLA 2ZMDA 2GQGA 4L3PA 2J0IA 3DJ6A 5CT0A 5CENA 3FBVA 2WMAA 2ITUA 3PJ1A 2BKKA 3DTWA 2CLXA 1UU3A 2CCHA 4MWHA 1OM1A 2JLDA 3ORLA 2XCKA 4QP9A 2PVYA 3QBNA 4YP8A 3O96A 3PG1A 4OTRA 4BTMA 3NNUA 3RPOA 4IDVA 2EB3A 2E2BA 2ITTA 4RZVA 3COKA 3AMAA 4FV6A 5FXRA 2Z7QA 3IS5A 4JX3A 4WG5A 4BDDA 1VJYA 4QYGA 4UMQA 3ZDIA 5CANA 5M09A 4AGCA 3ZXZA 2WU7A 3FJQE 4FIHA 3CPBA 3OY1A 4FIJA 2BRGA 3M42A 1PMNA 4QOXA 2OU7A 4U79A 3SAYA 5EYKA 3MJ2A 1TVOA 2BFXA 2ITYA 4WHZA 4FKVA 2VO0A 5F20A 3RPSA 4AT4A 2VTRA 2B55A 4E4NA 3KL8A 2IW6A 3T3VA 4O86A 3FYKX 4GK3A 3EZVA 2ZDUA 2QD9A 2R3JA 5CQWA 3MI9A 5EI2A 3LFCA 4CZUA 3EYHA 4BRXA 4EOMA 3Q9ZA 4I1ZA 4CV9A 1YW2A 3VBXA 4D55A 3ZZWA 3HV7A 4O0UA 3P1AA 2PVRA 4WBBB 4BDFA 4C3RA 3U6JA 4MBJA 4QP6A 5DOSA 4EH9A 3HAVA 3QRKA 4I41A 3LCTA 1TQIA 2RGPA 3KY2A 3RHXA 3UC3A 3QQLA 5IEXA 1W7HA 3TDWA 4EZ7A 3BHYA 1PMVA 3EYGA 3HGKA 2PMLX 3I5ZA 3JS2A 5LMAA 2VWVA 3QCQA 3QGWA 1SZMA 5KX8A 3F3UA 1MQBA 3F69A 3PY3A 3QUPA 5FDPA 2C6OA 3FZSA 2UW7A 3KULB 4ZZNA 5AA8A 5BUIA 3B8RA 4G3FA 4CZTA 4HVDA 4W9WA 3UDBA 3ZXTA 1IA9A 5JFVA 4AF3A 2V7AA 5HVJA 2IVVA 2GS6A 3VUDA 2VWYA 4YURA 5BPYA 4QTCA 1XBCA 4M14A 4BCFA 1QCFA 4AT5A 5D11A 3RAHA 5JH6A 4ENXA 2FSTX 1OKYA 3O51A 1VYWA 3U54A 3D4QA 3P9JA 3V5JA 1AGWA 2WIHA 3KCKA 5EOBA 3W2RA 3L1SA 4FKQA 3KN6A 1LP4A 4TKSA 2W1ZA 3PE1A 3R8UA 3RM7A 1A48A 3KVXA 3U4UA 2VGPA 4IVBA 1KE7A 3PP0A 2VWWA 3ITZA 3WF7A 5I9VA 5I3RA 4BB4A 3LCDA 4PY1A 3V5LA 2WTIA 2PZRA 2OICA 2VWXA 2JDTA 4PMMA 3HMOA 5KBQA 5D10A 4ZY6A 5LWMA 1BL6A 4RJ7A 4JX7A 2GHLA 1A9UA 4NKSA 3VF9A 1CKJA 4G3GA 4NIFB 5BVEA 3PVUA 3LFQA 2VWIA 3EKNA 4MEDA 2WMXA 1UNGA 2OZAA 3SRVA 4E26A 4LUDA 2JKOA 3R21A 3SV0A 5H2UA 4CVAA 3JVSA 4YBJA 3W2CA 3A7IA 4XMOA 1OZ1A 3F5XA 4GFGA 4OR5A 1ERKA 4TZRA 2QHNA 1STCE 3UJGA 1DI8A 3V6RA 2W06A 3TTJA 1XH6A 4FKTA 4ACGA 2I1MA 4BZDA 2W1GA 4E6QA 1ZYDA 2RG5A 4O2PA 4RT7A 5M53A 3BHUA 4NTTA 4EOLA 3PVGA 4HNFA 3A7FA 4E5AX 4R5SA 4CZYB 2WOUA 3Q32A 5C9CA 1LUFA 3V8WA 4FEUA 4IZ7A 3ETAA 4M69B 5JQ8A 3NAYA 4NJDA 2HXLA 4FGRA 5F95A 4BDIA 4ZJVA 1H25A 2OH4A 3KMUA 3CSVA 1GIHA 2UVZA 3NCZA 4D58A 1UWHA 2X1NA 3WE8A 5EI8A 3DV3A 5CWZA 4BBMA 3VUGA 3DLSA 4FV1A 4C62A 2R4BA 2OBJA 4QPSA 4WUNA 4FV8A 2HAKA 5FEEA 5FM3A 4RG0A 3GQLA 1Q8ZA 3FL5A 4HYHA 4U5JA 4QMLA 3O8UA 2RIOA 3IW8A 1J7IA 3AT2A 4R5YA 2XNNA 2QOKA 4MXCA 3VAPA 2QU5A 3PJ2A 3KMMA 2QO2A 4LL5A 2BALA 4BICA 4F9WA 3Q96A 4JOAA 4O0XA 5HORA 4AOTA 3U4WA 4KRCA 2VO3A 3CQWA 1PXJA 4F09A 3VBYA 4I6QA 3WF5A 3GCQA 2VX3A 3HDNA 3HV3A 3FL4A 3LMGA 4U45A 1OI9A 4Y5HA 3ZM4A 4EQCA 2F7ZE 3ZZEA 3FY2A 4DA5A 3OY3A 3DK3A 3FZRA 3HA8A 1PF8A 4GL9A 3DS6A 3KXZA 4IFGA 4S2ZA 5LOHA 3R04A 4EC9A 4ZMFA 3EQFA 2ITPA 3PRIA 4NM7A 5B2MA 2WTVA 4PTCA 3VBTA 4OAVB 5C4LA 4JI9A 1P4OA 5DPVA 2WHBA 3QRJA 5ANDA 3OF0A 4FSUA 5AUTA 3R22A 3PXFA 1ZYJA 2P3GX 4OTIA 5CAUA 2VTLA 4MX9A 2ITNA 4EH5A 4C2VA 4PPCA 3PUPA 4WUAA 2XEZA 4MVFA 3R28A 1SVGA 4J52A 2JITA 2UZLA 5KKRC 1MRYA 2BAJA 4H58A 3ZEWA 2Y4IC 4AOJA 3P08A 2OJGA 3Q4ZA 2HW6A 2J0MB 4C4GA 4KNBA 3VQHA 1JKSA 2C6TA 5EOLA 5TF9A 4DH7A 5CU0A 1GZKA 2UW0A 2UUEA 2J4ZA 5C8KA 4C38A 4DTBA 2BTRA 4FKJA 4L68A 5EDQA 4FZDB 4NCTC 4RA4A 1W8CA 3BGPA 1QPDA 1URCA 2XA4A 2VWBA 3FY0A 3NUXA 3M2WA 1Y8YA 3NSZA 3PJCA 4QP8A 4H1MA 5HX8A 1P4FA 4MNFA 4O7WA 3C4CA 4QP7A 2RL5A 2W5HA 3MVMA 3V04A 1M7QA 5IA1A 3PZHA 4YPSA 2HYYA 5HE2A 3F3VA 4ASXA 3OMVA 4JG8A 2OFUA 5J95A 1YHSA 2P55A 4YNOA 5CI7A 4ZTSA 2FB8A 1YXXA 3HUBA 3U51A 2VTJA 4EBWA 5M57A 4O0YA 5DBXA 5TR6A 4CG9A 4FTKA 4ZZMA 5DG5A 3LLTA 4I3ZA 4DCEA 3MH2A 2C69A 4XYFA 2R3LA 2VX0A 2UZBA 3KULA 4FT9A 4JDJA 4QNYA 4HYSA 5G1XA 1Q8WA 5CF6A 4IHPA 3H10A 2J51A 1T46A 4FBXA 4MQ2A 2ERZE 2PE0A 4DLJA 1J3HA 4FG8A 3D2KA 2F49A 3PA5A 4KBAA 5C1QB 1P14A 2YZAA 2BPMA 4O83A 1ZARA 3FSFA 5J1VA 2PULA 1AQ1A 5ITAA 3R9HA 5AAEA 5EKOA 4FSZA 3QA0A 4FSRA 2F2UA 4A06A 2XNBA 3DXNA 3G51A 3ALNA 4AQCA 4EOSA 2ZV2A 5ACKA 4DEEA 5JGAA 4RGJA 2R3NA 2PVNA 4X3FC 2Z7LA 5JRQA 5AJQA 3BPRA 3O8PA 2G15A 3D9VA 5EW9A 2IW8A 4DEHA 4ZSAA 4FVPA 4TRLA 4YNEA 4ID7A 5BMSA 3MDYA 4OTHA 4ZSLA 3RKBA 3VBWA 4ALUA 4FA2A 4FICA 3OG7A 4CFXA 4TPTA 4BCGA 3LQ5A 3KC3A 5CF5A 2VTAA 4ACDA 4L43A 4NJ3A 4DH3A 3VS5A 2CMWA 5IA4A 5I9YA 1YHWA 2UW3A 3TZMA 2O8YA 4ANNA 4C4IA 5A54A 4USEA 4HVIA 1I09A 4GG5A 2R3GA 2QOBA 3H9RA 4I20A 4IAFA 4ITJA 4JLCA 4QPMA 4YZNA 2Y8OA 2FYSA 5A4TA 4HGTA 4FG7A 3ZSGA 5FEQA 4G9RA 4YHTA 3P7AA 3AD4A 3NUYA 3KXHA 2VTPA 4L45A 3VN9A 3ACKA 2JEDA 2ZVAA 1OECA 3SVVA 5LCJA 3WF8A 2GHGA 2C5OA 1KE5A 1M52A 4UMRA 2V55A 5HVYA 2BCJA 4UX9A 3ROYA 3UVQA 5BUJA 4F65A 3W18A 4AFJA 3PWDA 4IVDA 4ARKA 3NDMA 3ORZA 4XG9A 3T8OA 4KKHA 5F4NA 4L7FA 4FODA 3WE4A 3KB7A 3TWJA 4DHFA 4X2KA 4BWPA 1A06A 3OXIA 3E8DA 1B38A 2ERKA 4EH2A 3K3JA 3QQGA 2W4JA 3MY5A 3QCYA 4ZK5A 3PE2A 4G31A 5A9UA 3L9MA 5HBJA 4QRCA 5BVDA 1H07A 5DEYA 2EB2A 5E8UA 4V04A 3Q2JA 3N4VA 4O82A 2XKEA 4KIQA 1UU8A 3EWHA 4OTDA 5E91A 2HY81 3NRMA 4QQTA 4YZCA 2ESMA 3RVGA 4TYHA 3QHWA 5KMJA 2C1AA 4C7TA 3BRBA 4GYIA 5IU2A 2YM6A 3ORPA 3R83A 3ZLSA 5GNKA 4GKHA 3PXKA 4RWLA 2QU6A 3PY0A 1Z9XA 3BU3A 4WRGA 4O0WA 1H27A 2ETKA 3E7OA 4C61A 4RJ6A 3MA6A 1KE9A 4LFIA 3PSCA 3TZ8A 4TL0A 5L2WA 5AAFA 4EL9A 2I7QA 3ZC6A 1H08A 2EXCX 1G3NA 2JKMA 4LRJA 4TTHB 3DBDA 5CU6A 5AV1A 2X0GA 1DS5A 1OGUA 3VRZA 2AYPA 3GP0A 3UMWA 4TWCA 3U6HA 2F9GA 4IAIA 3FXWA 5FTOA 1M7NA 3NIEA 3QD2B 1YOJA 3BE9A 4FKPA 4D4YA 5M4IA 1H1WA 3ELJA 4UMUA 4EHVA 3VUTA 3OTVA 5IQEA 3EFKA 1V1KA 1J91A 2BDFA 2FH9A 4FKWA 5H8GA 3SOCA 4FSYA 4PTGA 2GNHA 3FZOA 3QC4A 3F3ZA 4RIWB 4UYNA 3VRYA 4BBFA 1GJOA 2OWBA 3A60A 4DFUA 2QHMA 4XRJA 2PU8A 5HE0A 3LXPA 4NU1A 3BX5A 3HNGA 4ZSGA 4ENYA 5FD2A 4FTIA 4MAOA 1PMUA 5DT0A 4EZ3A 3FKOA 3GC9A 4FKLA 5I0BA 4B8MA 4C36A 2JKKA 5L8KA 4M97A 4K6ZA 4IX3A 2YIXA 4G6LA 2XK7A 3DB8A 2CNUA 2YAAA 4LGHA 3P86A 1OUYA 2I0HA 2XBAA 3AC8A 4RJ4A 4W9XA 2PMIA 2WEVA 5T3QA 2WMTA 3VS2A 3LVPA 1R3CA 4YJPA 3UODA 1M2PA 4CMTA 4IZYA 4KIPA 3MPTA 1WVXA 2F7XE 4GG7A 4J95A 4U42A 2P2HA 1OVEA 4NW6A 4RC3A 1BX6A 2C5XA 5H3QA 2EXMA 3GFWA 4FTNA 2OW3A 4KS7A 3W1FA 3SC1A 3A8XA 4FEWA 4RVMA 4IMYA 5FDXA 2E9UA 3UVRA 3WILA 5E8VA 4S34A 4NKAA 4DH5A 1XH5A 2QLUA 2XMYA 4ASZA 5A46A 5HTCA 4PDSA 2H34A 2YHVA 4F0FA 2UZOA 1YWRA 3DXPA 3RNYA 1WVYA 3L9LA 1H26A 2UW5A 4O91A 3EQBA 3Q4CA 3OBJA 4JRNA 3F5PA 3QUEA 3R00A 4PPBA 4M69A 1GIJA 3KRJA 1GIIA 4I24A 4ACMA 4BDBA 4DN5A 4TW9A 5AUYA 2OF4A 3P5KA 5F1ZA 4C34A 3GI3A 1YOLA 5J9ZA 5E1SA 5IPJA 5DLSA 1Q41A 4MNEB 4BZNA 4FTJA 4FVQA 4UEUA 3CJGA 3H4JA 4FKUA 4IC7A 4FOCA 4QMZA 5AP6A 2VN9A 3TV7A 2XNEA 4B99A 2BRNA 3KGAA 2HENA 4TNBA 3ZTXA 4AW5A 3NUNA 2WTWA 3FMKA 4KIKA 4NCTA 3EMGA 3PVWA 4XLIA 4YUQA 5F9EA 4KSQA 3AC1A 3KRWA 2WELA 3D7ZA 4J97A 2W1FA 3QTZA 3DBEA 3TNWA 2GHMA 3C7QA 4N6ZA 3I6WA 5CEQA 3TUBA 2JIUA 4BWKA 3UVPA 5E8ZA 4DLIA 2Y6OA 2J0KA 5C4KA 3EH9A 1U54A 5HICA 4USFA 1IAHA 4X2NA 4FNZA 4AZVA 5DR2A 1OIQA 1ZYCA 4QMOA 4XV2A 4CFWA 3GC8A 4FK6A 4QYHA 2Z02A 4G17A 4JIAA 2IPXA 3OT8A 3ANQA 2CPKE 4L3LA 4MTAA 5ANIA 5BMMA 4BI0A 2CSNA 3EQDA 1ZRZA 3FQHA 1QPJA 5E1EA 2GNJA 1BUHA 4BYJA 2WTJA 3EN9A 3JVRA 4G1WA 4JJRA 5DH3A 3EOCA 2YCRA 3E8CA 2BDWA 3W16A 4EBVA 4WD5A 5AUUA 5CEIA 3G6HA 1CM8A 4RVKA 4C3FA 2BIKB 4G6NA 3NAXA 2BR1A 4KINA 1WBPA 4M84A 3AG9A 2XVDA 3AC3A 4QYYA 3RP9A 4DGMA 4Q5HA 2ONLC 3CIKA 5CT7A 4F6UA 4TWOA 4JR7A 4F1OA 3HVCA 1PXKA 4Z3VA 3LKMA 3A4OX 3M1SA 3TV6A 4QMNA 2WQNA 5CEPA 5IZFA 2F7EE 1CKIA 4FUYA 4HGEA 4CMUA 3E88A 4K11A 5L2TA 2YIWA 4QPAA 3I7CA 5FTGA 4J7BA 5J7HA 1CKPA 4PF4A 5D1JA 3OTUA 3UZRA 4H39A 4X2GA 1J7UA 2YAKA 4XP0A 3TACA 2NNWB 4EH3A 3UGCA 5E9EA 4PL5A 1WMKA 4C4JA 5A4EA 1LR4A 4EEVA 3EHAA 4HVSA 2I0VA 4AWIA 4ITHA 3K2LA 3RALA 3ROCA 5IUGA 2VTMA 3UIMA 3OW4A 4PNKA 2W5AA 2C1BA 2ZDTA 2IZUA 4FVRA 1L8TA 5E8SA 3RNIA 2GNIA 5KHWA 2YDIA 4M7IA 2OIQA 3R6XA 4YTHA 5EG3A 3ZFXA 3NW7A 3P0MA 5IQBA 4HGSA 4GS6A 1PY5A 3BYMA 1YXSA 4GIIA 2W96B 2YA9A 3QYWA 4ZS0A 4JG7A 4BCNA 4O7ZA 3NW5A 3MB7A 1H0VA 2BROA 2WMSA 4E4XA 2GTMA 3GOPA 3KRXA 5C8NA 3LM5A 1JKLA 3PSBA 4L7SA 3KK9A 3TUDA 4I0RA 2YCFA 5JN2A 3WYXA 2PK9A 3R7OA 1Q4LA 1YXUA 1JLUE 2PZIA 3COIA 4IWQA 4L53A 4ZLOA 3EQPA 2CGUA 3DJ5A 3RI1A 5HKMA 3LMIA 2XJ2A 3SA0A 5BUEA 1Q24A 3EJ1A 3NGAA 4FTLA 4G3EA 3S00A 4UALA 3IW5A 4YR8A 2UZWE 3I6UA 4YMJA 2C3KA 1R0EA 2QONA 4MQ1A 4LV8A 3R0TA 3FMJA 3OWKA 4I0TA 5L3AA 3LAUA
chains in the Genus database with same CATH superfamily
3EZRA 4AZTA 3KRRA 3IONA 2ZYBA 3CD3A 1ZMVA 4JDHA 4BDHA 4EHEA 4CMOA 1XMMA 3GCUA 4LOOA 1GOLA 4S30A 3BWJA 3FZPA 4J8NA 4QYEA 4ANMA 1ZY4A 5BVOA 4X6RA 2B9IA 3MFRA 5I3OA 3EQHA 2GSFA 4MXZA 4AN9A 4M0ZA 3IDCA 2VV9A 4P5QA 4PUZA 3DFAA 3GT8A 3NUUA 3ZSHA 2X81A 4U3ZA 4W4WA 4BCIA 3I60A 3EFWA 3NYXA 4FKIA 5IQDA 4CFVA 3OZ6A 1TQMA 4FTUA 4KRDA 3P7CA 4GUEA 4NM3A 3QKLA 4E5WA 2B7AA 2ZOQA 5EH0A 1H1SA 4O81A 1H28A 3SD0A 2G2IA 1H0WA 3Q60A 1IG1A 2WMWA 4CNHA 4G16A 4U43A 3VW6A 3ZC5A 1NW1A 5ANJA 4I21A 4FMQA 3F7ZA 4DFZE 1G8AA 5M07A 4DBNA 5EYCA 2EVAA 1UKHA 4YJNA 5GJDA 4AN2A 1UU9A 2Y9QA 4W4XA 3FI2A 4L44A 3U6IA 4HCVA 3SGCA 2HIWA 5L6OA 4FT7A 1OGYA 1UVRA 5HU9A 2XK8A 1F5QA 3RBWA 4G9CA 1PHKA 4YHJA 5F94A 4BWXA 5KUPA 4XS2A 3TL8A 1IA8A 2GCDA 1O6LA 2OXYA 4C59A 1AD5A 1RQQA 2UZTA 1WCCA 1DAYA 3B8QA 3PSDA 4IB5A 3RTPA 1XQZA 2ZM1A 3F6XA 3WZJA 2I6LA 4WIHA 4NWMA 1YI6A 4R1YA 4F0GA 4FV4A 5AV3A 3UG2A 2HELA 2PTKA 3QX4A 4CFUA 5GZAA 4N57A 4R78A 4F7LA 5AM6A 2JBPA 2XJ1A 3MBLA 4MCVA 4FUXA 4DH8A 2IZTA 4AFEA 5I4NA 5I9XA 1XHAA 2QODA 3IG7A 4S32A 4AGDA 4APCA 1W82A 3R8LA 3QAME 4RSSA 2OJFE 2QR8A 5IISA 2EU9A 5AP2A 5EHLA 4CCBA 4JDIA 2BHEA 4NL0A 3FQEA 4NM0A 5M06A 5J9LA 1I44A 3AOXA 3Q5IA 4NZWB 4RC2A 5A4CA 4CT1A 4IXPA 5EW8A 5CYIA 3GBZA 5IUHA 4AX8A 5IH6A 3E8NA 4R7IA 2YWVA 2R7BA 3Q53A 3D83A 3HEGA 2R7IA 1B6CB 3VQUA 3QWKA 2QVSE 4Y46A 2O0UA 3ZONA 4F9BA 3TKUA 4E7WA 4IEBA 4AN3A 3OVVA 2A4LA 4JBPA 4NIFA 3W2QA 5EW3A 5BVWA 3DFCB 3EQGA 4JDKA 2JDSA 2CNVA 3NIZA 3E87A 3ODYX 3FMNA 3F7WA 4YLJA 2JDRA 4E93A 4HNIA 4U97A 4KIOA 4EUUA 3HP5A 4OGRA 3GCSA 4MF1A 4XG2A 1YI4A 4RZWA 3A99A 4ZTNA 2DS1A 3OCTA 4YJVA 1UV5A 3NNXA 4RVTA 1O6YA 4EK8A 1NXKA 4LOQA 5BYZA 4C35A 2A1AB 1YQJA 3MTLA 3QYZA 4IDTA 4UWCA 3AC2A 4P2KA 4YZMA 4CKIA 2YN8A 3WF6A 4R3RA 4MD8E 3FYJX 1ZZ2A 5AX3A 3ERKA 4GUBA 4QMTA 3R9OA 2VWZA 3T9IA 4IJPA 5CZIA 3R7IA 3QX2A 4IB3A 5KKRB 1REJA 4F08A 3RCJA 3EL8A 4YO4A 3WZDA 4DITA 4BTJA 5J79A 4IAKA 3DY7A 5CTPA 3PG3A 5T6KA 1WBNA 4D1SA 4ERKA 4TXCA 2J2IB 2BILB 4F0IA 5HX6A 2XK3A 3W2OA 2A2AA 5LWNA 3ZRKA 4MK0A 3D7TB 4IFCA 3BL7A 3O0GA 3PY1A 5HZNA 4D2TA 4QQCA 2X8IA 2A27A 2YIYA 4RX9A 1OITA 2OIDA 4I0SA 5HO6A 2VO6A 1G5SA 3BV2A 4JQ8A 1CMKE 4FIFA 4QMYA 3TNIA 4A9YA 5KZIA 4GRBA 3A7GA 5HG7A 3QTUA 4K8AA 4YHFA 4C4FA 3RWQA 4D28A 3ZDUA 3FMDA 3ZUTA 4RIXB 4RX5A 1ATPE 2FO0A 1Q8TA 3O17A 3QWJA 4QTAA 5ANOA 5FWKK 2ACXA 5CSHA 5KE0A 3QD4A 4O7LA 1Q3WA 2VAGA 4H3BA 2VRXA 3IOPA 1VZOA 3QFVA 3AMBA 2P4IA 2QI8A 3NNVA 5DRDA 2X2MA 1P2AA 3C0IA 4M3QA 2OG8A 4IJ9A 3RAWA 4CTBA 4E73A 4FE2A 3R1YA 3ZFMA 2WMRA 5CEOA 2X0PA 5T68A 4FSWA 3KFAA 3BYSA 4O0VA 4GT4A 1WZYA 4D5HA 5LXMA 3KU2A 2IZRA 5EYDA 2W7XA 2O65A 3ODZX 1SVEA 3NWWA 2YACA 1K2PA 3IK3A 5M56A 5IG1A 4QMQA 4EJNA 3LCKA 4C57A 2QOOA 3PIYA 4FZ7A 4HZSA 4X21A 1S9IA 3DU8A 3NX8A 4GT3A 4W8EA 2QURA 5JKGA 2GU8A 3OOGA 2G9XA 2WB8A 4I23A 4XV9A 5EK7A 1OPKA 2YLEA 3DBCA 3C0HA 4F9CA 3RPVA 3EFJA 3QZFA 5I5ZA 4XP3A 1OL1A 3D0EA 4B7TA 4AG8A 3C5UA 4V05A 4R7HA 1XH4A 4GEOA 2GPHA 2OZAB 3FZ1A 3NYOA 2REIA 4M66A 2YJSA 3R7GA 5DHJA 5C8MA 3QL8A 4N4SA 3BZ3A 5HBHA 3CJFA 3MS9A 3R01A 4R8QA 1FPUA 1U46A 4ITIA 3W0NA 4BIEA 3CD8A 5FTQA 4YU2A 3FXZA 4D1ZA 3MH0A 3QCXA 4B9DA 4F9YA 4D4SA 3NPCA 3PLAE 2PUNA 1SNUA 3L8XA 2O2UA 5JMSA 3LXNA 2CGWA 2YM4A 4AA0A 4IAYA 4EOQA 5AUVA 3MN3A 5M08A 4RWKA 2BZIB 2WTKB 3CQUA 1JVPP 4FV2A 5L2IA 2UZNA 3H30A 4K1BA 4PTEA 1PYXA 3RK5A 1M2QA 3ORMA 2VNWA 4EUTA 1YRPA 5HGIA 3BGZA 3ENMA 2VWUA 4NUSA 3I81A 5AR7A 4MNEA 4F64A 4OLIA 1HCLA 4NM5A 4F7NA 2CGVA 1PJKA 3AC5A 1KE8A 1UNHA 1XWSA 2X7FA 3F2AA 5DEWA 3K5VA 4F70A 5HU3A 4RBLA 5KNJA 5CVHA 2PUIA 3FLQA 2CCIA 5CAQA 5AFVA 3R30A 2YJRA 5FBNC 1RW8A 4PNIA 3MESA 4U8ZA 3TMOA 4S31A 2PWLA 2WPAA 4MD7E 4TN6A 5DRBA 1LEZA 3ORIA 2F57A 3ORKA 3WZUA 2PVLA 4CQEA 4KUJA 4X3FB 2B0QA 3C0GA 1IR3A 3LZBA 5AR3A 5AR8A 5HTBA 2XCHA 4G5PA 3IDBA 2X2KA 2IVUA 4ALVA 4DTAA 2P0CA 1Q8YA 2OF2A 3NYNA 2V0DA 4DBXA 3OD6X 1JNKA 4BDJA 1ZYLA 4TY1A 3WIGA 4EOKA 3FMEA 4GVJA 3C4ZA 4ANSA 3E3BX 4YTCA 2XNMA 3E3PA 2FSLX 3QD3A 2XIRA 2CN5A 1JAMA 2B52A 4YSJA 5JFXA 1VEBA 4I5CA 4YC6A 5C27A 1JWHA 1UU7A 2IG7A 1QMZA 5HHWA 2IVTA 2ITOA 3TG1A 2ONLA 3MV5A 4FZ6A 4I6BA 5EM8A 3S1HA 1M14A 4PP9A 2C5VA 4NTSA 4E1ZA 4X0MA 3GENA 4DFXE 4IH8A 5IF1A 3IW4A 3MYGA 5BVKA 4DT9A 4XNEA 4I6LA 1W98A 2CLQA 5CNNA 5AWMA 3NR9A 4Z9LA 4O38A 4CV8A 4L52A 5EM5A 4ZTQA 4A9UA 3P4KA 2HY0A 4HCUA 3WI6A 4IANA 5CNOA 4AXAA 3ANRA 1BYGA 3BIZA 3Q9YA 3U9NA 4CD0A 3SG8A 3RCDA 2YM7A 5IQFA 1V0OA 3W0MA 2XH5A 4II5A 3OROA 4KS8A 5CQUA 2ITXA 4FJVA 4JXFA 4QT1A 5AM7A 5HG9A 4TWNA 5E4HA 4CLIA 5BVNA 1URWA 3IGOA 3O71A 2YCQA 4LOPA 4RC4A 3CE3A 3QZGA 5IH4A 2BFYA 1XR1A 4YJQA 2O5KA 2XK4A 4GU9A 1GZNA 2VD5A 4D2VA 4Z7HA 1U59A 3ZSIA 1TZDA 4OT6A 5CSXA 4K0YA 4EC8A 4NK9A 4ZJIA 3GFEA 4LI5A 4NSTA 1PXNA 3HAMA 4H05A 5L8JA 5TO8A 3MJ1A 4GMYA 4ANQA 4Z16A 4ZS4A 3CKXA 2IVSA 2FA2A 2LAVA 1ZMWA 3RPRA 4WKQA 2X7GA 5IQGA 3HYHA 3ZM9A 2YM5A 3BLQA 3OCSA 5FEDA 4GYGA 3RHKA 3SXRA 2VGOA 4MH7A 4RLKA 4YBKA 2IW9A 4KSPA 4NFNA 3SW7A 5IH5A 4I5PA 1PKGA 4CFMA 1JBPE 3MGYA 3V51A 1PXIA 3W2PA 5JSMA 4BHZA 4DYMA 5KMNA 4APPA 4BVUA 3NEWA 5J9YA 1OBGA 3H0ZA 2XRWA 3DZQA 2UVYA 2PYWA 3DLZA 3DB6A 4O0TA 4L01A 4C4HA 4DHJA 3W2SA 4KAOA 1J1CA 2GQSA 4JQEA 5CAPA 4QTEA 3UZTA 3U9CA 3LCSA 2Z7SA 4O4BB 4OTFA 1K3AA 3AQVA 5JZNA 2B9HA 1VR2A 4RJ8A 5FP6A 1KSWA 4QD6A 3TJCA 1HCKA 5IA2A 3ZUUA 4W8DA 1G8JA 1OB3A 2WO6A 1MQ4A 2XNPA 4FNWA 3RZBA 2OJJA 5CVGA 2BZJA 4A9TA 2JAVA 4UWBA 4UMPA 4YZDA 3MVJA 3UIBA 4PPAA 1H1PA 3E62A 2ZB0A 3DXQA 1DI9A 2X2LA 3ZLYA 4EKKA 2HZ4A 4HYUA 3II5A 4U7ZA 4XHKB 3ZRLA 4AZFA 1OPLA 4O0SA 4QMUA 4GVAA 1FGIA 3R8PA 3UO6A 4EWQA 4LQMA 5DA3A 3V8SA 3U87A 3C50A 5LJJA 2HZ0A 4XEYA 3V5TA 2Y0AA 2PUPA 4FTAA 4KWPA 4RRVA 5KZ0A 1FMKA 2PVFA 4P7EA 1RJBA 4WT6A 3UIXA 3UYTA 1NA7A 3H0YA 3VUIA 4ZLYA 5BQ0A 3D94A 1JSUA 3GC0A 2OSCA 3JPVA 4IAAA 2XKCA 3QHRA 4UV0A 4ZZOA 4W4YA 4E5BA 4ZY4A 3ATSA 2X6DA 2O3PA 3DBQA 4GH2A 5FM2A 3ZS5A 1OKVA 2H96A 2Q0BA 4JNWA 5G6VA 3R8MA 4BKJA 1H4LA 1XH7A 2PUUA 2Q0NA 4AE9A 3Q2MA 4D5KA 4DT8A 1E1XA 3QLFA 1E1VA 3V5PA 4PQNA 3R02A 3CKWA 2BTSA 4RPVA 2ZAZA 4GT5A 3IQ7A 1Z5MA 3HRCA 4XG4A 3PLSA 3CTJA 3FI4A 4QYFA 4R77A 3Q04A 3HUCA 1HOWA 2ZV7A 4A4OA 1W2DA 4AACA 4DFLA 1XBAA 3LFNA 1QL6A 5M44A 2XIXA 1SNXA 4XCUA 5ETAA 3BI6A 5CALA 3DKOA 5KMLA 3H3CA 3QLGA 5J8IA 1YWVA 4XRLA 1LEWA 2YITA 3RMFA 5CX9A 4FV9A 2HWPA 3LQ8A 3CTHA 4DEIA 2R64A 2WQEA 2YLFA 3NFFB 2SRCA 2A0CX 2X4FA 3L9PA 4LL0A 3GUBA 3P23A 3E64A 4QMSA 4X3FA 2FGIA 2WTCA 2YM3A 5HG5A 5LQFA 4O7SA 2GNFA 3GCVA 3OS3A 4LRKA 4XG7A 3VS4A 4BDCA 4TYIA 4FTOA 4ZLZA 1OUKA 4BGHA 2XNGA 4ZTMA 4D4VA 3UQFA 3GNIB 4RIOA 4I94A 4YTIA 2CKPA 4MBLA 1W83A 3DGKA 5D7VA 4HJOA 5AP7A 1ST0A 3DQXA 4XJ0A 3MFTA 3GQIA 5HIBA 5DFPA 3LPBA 3CY3A 1FOTA 3C4WA 2YERA 3EQRA 4AS0A 3OXTA 4LRMA 2YCSA 5IQHA 4EQMA 5CY3A 1NVSA 2C0OA 3TI1A 3QTWA 1H00A 4L46A 3VIDA 4AAAA 4F1TA 4QMPA 5JGDA 2OXXA 4CQGA 4YSMA 1REKA 2BHHA 4UY9A 4YO6A 5H9BA 3FZTA 1Y91A 4E6DA 5LMBA 4QMMA 2NYAA 3BU5A 3CY2A 1MRUA 2BDJA 3R8VA 2FSOX 3CCNA 2WU6A 4M8TA 4DEGA 2B1PA 2W1DA 3KIOC 3KA0A 2OKRA 3MH3A 3UMXA 2FVDA 4PX6A 3TM0A 2A19B 1WBTA 4FIIA 5CSWA 3LQ3A 1OIUA 3CGOA 3LFSA 4X2FA 3R73A 4A7CA 5JFSA 5GIOE 2FSMX 3I1AA 4UBAA 3ZEPA 2ETRA 1J1BA 1WVWA 4PL3A 2UVXA 4FZAB 5HE3A 2Z8CA 3VO3A 3ORXA 5CAVA 3PXZA 3G33A 3GU5A 3PPJA 4V0GA 4BJJB 3JR1A 2QOHA 5HNGA 2J0JA 3QTXA 3BEAA 4BFMA 3NUSA 4KA3A 4XOZA 3VS0A 4C02A 3P5JC 4XUFA 1Q99A 3R2YA 3VW8A 4FT3A 5EM6A 1SYKA 3SOAA 2YZLA 4AP7A 4C4EA 3E92A 3CP9A 2C0IA 4HPTE 4LYNA 4WNOA 3PA4A 5AAGA 3FQSA 5K5XA 5AIKA 3SG9A 4FEXA 2NO3A 3KCFA 2DYLA 2W1EA 1H1RA 3KXNA 2XK9A 4WG3A 4BCOA 3TXOA 2ZB1A 1GZ8A 5D7AA 3CTQA 4UB7A 2YWPA 3BCEA 4J71A 4RLLA 2PZYA 3LFEA 3PZEA 2BIYA 2YIRA 3QU0A 4JR3A 4Q2AA 1Y8GA 3W32A 4D0XA 3UPZA 5JFWA 4JT3A 4CSVA 4U40A 1QPEA 5HO7A 3GOKA 4R7BA 4IE9A 5DYJA 2IWIA 2ZFYA 2WMQA 3UP2A 3DAEA 5AR2A 3IW6A 3EN6A 4UXLA 4AW1A 3HZTA 1IRKA 1M17A 1FVVA 5LMKC 1OL6A 1FBNA 2QO9A 2H6DA 5AUXA 1IEPA 1OL2A 2CHLA 2JDVA 3PFQA 3GU4A 3V8TA 4O4EA 4BI2A 4JBQA 4O1OA 2YIQA 4EQUA 3FMLA 3O7LD 3IOKA 4JVGA 1CTPE 4EWHA 3TZ9A 4F6WA 5CLPA 1KWPA 2RG6A 5HBEA 3TTIA 4IZAA 5LVOA 4N6YA 3Q5ZA 4FK3A 4DGOA 3ET7A 2GNGA 1FINA 4GIHA 2R0IA 3VNTA 4FKSA 2UW6A 1PKDA 3WZEA 3HV6A 4K77A 3KMWA 3ZHPC 4EORA 4AW2A 4CKJA 4R1VA 4O7VA 4USDA 4Z7GA 5ANKA 4BTKA 4UMTA 1CSNA 2W4KA 3FPMA 5LVNA 4D9UA 3PXYA 5J7BA 2QCSA 5FLFA 2BVAA 4WG4A 4QMWA 2V62A 3BBWA 3LCOA 2UW8A 5IA3A 4Y8DA 3MB6A 5HVKA 1NVQA 2X0QA 3REPA 3HV4A 3CXWA 2QKRA 2XM8A 4F7JA 2VX1A 3CC6A 3LJ1A 4O6LA 4BDGA 3COHA 1OL5A 2VO7A 4FEQA 4I93A 3VVHA 2VU3A 3D5XA 2X4ZA 5KMIA 4ZIMA 3N4TA 3IW7A 1LPUA 4RQVA 3LJ0A 4GU6A 4B8LA 4RFMA 3FLZA 1PYEA 5HNBA 5IEYA 4EYMA 5AP0A 2HZIA 1WFCA 2QC6A 4I22A 4YJOA 4FV0A 4FYOA 3OWPA 2EXEA 4CYIA 3MTFA 3H9OA 1E9HA 2RFSA 3AT3A 4N0SA 4OTWA 4RIYB 4U41A 4X7QA 4ZTRA 4V0GB 1Y57A 2CGXA 4FEVA 4O4CA 3O8TA 1YDRE 1U4DA 3LFDA 2QG5A 4U3YA 3VUMA 3AD5A 5DIAA 2WEIA 2X8DA 2UW9A 3UDZA 5CEKA 5A4LA 2OK1A 3MW1A 2VZ6A 4IB0A 2QG7A 2BZHB 2NP8A 4AQKA 4IVAA 4O6EA 3EFLA 5JK3A 2OO8X 3FKNA 2C3IB 2JIVA 3KXXA 3ENHA 4U9AA 4WRSA 3C4XA 3QTRA 4ACHA 4F63A 2YM8A 2VUWA 3OXZA 5C03A 4B4LA 5K4IA 4WNPA 2OIBA 2R3MA 2XKFA 3FDNA 1YHVA 2AC5A 4YTFA 5K9IA 5ETFA 4AA4A 1Q62A 3EIDA 4GW8A 4IADA 5CI6A 5CZHA 5FUTA 4BKYA 1KOAA 5M4UA 4IAZA 2YDJA 1BKXA 4H36A 5GJFA 2VTQA 4F78A 1H1QA 2QOCA 2KULA 2W0JA 3FMMA 5FQDC 1OBDA 2CKEA 4ANBA 3UC4A 3F3TA 4J96A 4I4EA 1GZOA 3ULZA 2W9FB 2XK6A 5A14A 5IDNA 2V22A 1Y6BA 3OUNB 1OMWA 3F9NA 4O7RA 2R3HA 3LW0A 2ETMA 4WNMA 4A4XA 2J0LA 4FYNA 3HLLA 4X3JA 3IDPA 4NYEA 3T9TA 3W10A 2VTTA 4QP3A 2KTYA 5J1WA 4L9IA 3DKCA 4KIKB 4QQJA 2DQ7X 5FGKA 1ZAOA 1Z57A 5DI1A 3LFFA 3C4FA 1UKIA 3KVWA 4NW5A 3FMHA 5IKWA 4AZSA 3K3IA 1B39A 3BLHA 3VHEA 5K3YA 2Y4IB 3MPAA 4YLKA 2WZJA 4E20A 1OIRA 2W9ZB 4BDAA 3G6GA 4J99A 4PMSA 2EWAA 5ETIA 3GU8A 3THBA 4EK4A 2C3JA 4FX3A 2XNOA 2WD1A 3FWQA 3DT1A 1UWJA 3QALE 4GK4A 4J8MA 4RVLA 4U6RA 3PFYA 4ANOA 3GXLA 4GFMA 3R63A 2PE2A 2QOIA 4KD1A 3QCSA 3HKOA 5AV0A 2W4OA 2E9NA 3I79A 3TT0A 4GV1A 1F3MC 1YVJA 5CXHA 4EH4A 4YJSA 5L6PA 3EN4A 4U81A 1W0XC 3G2FA 4HPUE 5CS6A 4BKZA 2GNLA 5J87A 1YWNA 4FT0A 5GJGA 2WMBA 4I5MA 2JKQA 4IACA 4NFMA 3HECA 4NH1A 3TZ7A 3UE4A 5HI2A 2XJ0A 2WMVA 1G8KA 3PVBA 3F66A 3BELA 5EYMA 3ZBFA 2H9VA 2XYUA 4DTKA 3NUAA 4BC6A 4MXXA 4QQ5A 2E9OA 4RJ5A 4AW0A 3NYVA 4HCTA 2YEXA 2XKDA 3FLNC 4ANLA 3UQCA 2F4JA 3NNWA 3TNQB 4ZEGA 3VBQA 5CXZA 4BCKA 3HMPA 4O4DA 2CNQA 3KRLA 4L6QA 3UOKA 4Q5EA 4BDEA 1M2RA 3MY1A 2IJMA 3AMYA 5DT4A 4WO5A 3HRFA 4L42A 3JY9A 3LFAA 4MHAA 5K0KA 5EI6A 3AGLA 1PXOA 3S3IA 4ZAUA 5DE2A 3MVHA 3C5IA 4EHZA 5AA9A 4FIEA 5KHXA 2Y4PA 4BF2A 4IC8A 2PL0A 4HOKA 4IWPA 5HEZA 5J5SA 3FI8A 1ZYSA 4I5HA 4IX5A 5I9UA 1X8BA 5GHVA 5HNIX 3DZOA 3F2RA 3BBTB 3VS7A 3OOMA 1JKTA 4IQ6A 4FV3A 5HCYA 1U54B 3PPZA 4ERWA 5L4QA 3EN7A 3I0OA 2J6MA 2QOLA 2XBJA 1JPAA 5A4QA 5JEBA 4R6VA 4CTCA 5HD4A 3BHTA 5HIEA 4YGAA 1ZZLA 1ST4A 3A62A 3ZCLA 1T45A 5AR5A 4ALWA 5E8YA 5IQAA 3DAKA 4YJTA 1YXTA 4C33A 2B4SB 3TNHA 2CDZA 4ACCA 3F88A 4F4PA 4RWJA 3BYUA 4EK6A 2X8EA 2G2FA 3GVUA 3BE2A 1NY3A 3BGQA 4IWOA 4A4LA 2BRHA 4D2PA 3EQIA 4FSMA 3F5UA 2Q83A 2WQOA 3F5GA 1F0QA 2XIKA 3VJOA 4CLJA 2NRUA 4G34A 4F1MA 4LMUA 2RSVA 3HDMA 4HYIA 3DA6A 3KQ7A 5KO1A 3ID6C 2QOQA 4TWPA 4EH8A 4JAIA 5E7RA 3HX4A 3JUHA 4BHNA 4AXCA 4BGGA 3WOWA 1W2CA 4EK3A 3PDTA 1FGKA 1BI7A 2QLQA 3RK9A 3VHKA 3G0EA 2B54A 1JSTA 2JGZA 3L8SA 5TE0A 4E4LA 4BBEA 2GTNA 2WMUA 5AR4A 4A9SA 2BUJA 1XKKA 3BQCA 2Z2WA 2UZDA 4ZOGA 1GAGA 1W2FA 3QQHA 4DAWA 5M55A 2I0YA 5FRIA 4ASEA 2PY3A 3MSSA 3BLAA 5EQEA 4MXAA 2F2CB 2OJIA 5DMZA 3OFMA 3QTSA 3GCPA 4OW8A 5E92A 3JYAA 5IMXA 2QR7A 4E4MA 1XO2B 4AA5A 5M4FA 4ONAA 4O0RA 4O1PA 3ZMMA 2QKWB 2WQBA 3NZ0A 4H3QA 2C3LA 3QZHA 3Q52A 4FSTA 4IVCA 5IQCA 3R71A 4TNDA 4EI4A 1R78A 4O21A 2BAQA 2I0EA 5JT2A 1Q61A 5E8TA 3LMHA 4L3JA 4MD9E 2XAOA 4FSNA 4IB1A 4WSQA 3O23A 2W05A 4BN1A 3SQQA 4EOJA 4PMPA 4B0GA 3MY0A 2XEYA 3EKKA 5FG8A 1GNGA 4YJRA 4FV7A 3R9RA 3FI3A 4LMNA 4IM2A 3T3UA 4A07A 4UZHA 5HG8A 5JGBA 2QOFA 4OTPA 3UBDA 4DG3E 4XG3A 3ULIA 2WFYA 5DNRA 4FI1A 4KABA 2DWBA 2GS2A 4P90A 1XBBA 3I7BA 4BCMA 5IA0A 5ANGA 5I9ZA 3OHTA 3BQRA 4UN0C 2OFVA 5L2SA 3KK8A 3KF4A 3WBLA 4CRSA 4I6HA 3DK6A 3F3WA 3PYYA 3UNZA 3E63A 3UTOA 3PIZA 4EOPA 4WNKA 3P79A 3NW6A 4WA9A 3SDJA 5FP5A 1XH9A 3C51A 2PHKA 4YZBA 4D0WA 3PXRA 3Q4TA 1K9AA 1VLRA 2OH0E 3S4QA 3VWAA 5JZJA 3EQCA 2GMXA 5EDRA 3B2WA 4FOBA 2DUVA 4G2FA 1WBVA 3NCGA 4D9TA 4Z55A 4PP7A 3POOA 4W4VA 4WBOA 4FZFB 2HK5A 2BRBA 4DF3A 3LXLA 2GS7A 1WBOA 4DH1A 4L00A 1RE8A 3G0FA 4FNXA 4GJ3A 3R9DA 3SXSA 2HOGA 3FLSA 1PMEA 2OJ9A 3ZYAA 3N9XA 4LV7A 2OLCA 5LARA 4DE4A 3MFUA 5KMKA 2B53A 2ZV9A 1ZY5A 2W1CA 3GGFA 4QTDA 3F2NA 3FAAA 3HV5A 3OWJA 3TJDA 4FKRA 3R7YA 3DCVA 4EK5A 5KBRA 2R3PA 4QP1A 2VTSA 3FC1X 5K0XA 2BZKB 3TNPC 4G6OA 1TQPA 3I4BA 3E7VA 1BI8A 3ALOA 1QPCA 3QGYA 4Y95A 5DT3A 1ZLTA 4I4FA 5AEPA 1SVHA 2R3RA 2XIZA 4GK2A 3W8QA 4BIBA 3RINA 3KXGA 4DINA 1WBSA 4TYEA 3GC7A 4HVGA 2C6IA 4J98A 4BR3A 3CEKA 3MWUA 4KKEA 2IEWA 2YDKA 4RIYA 5CU2A 5LVMA 3CS9A 4EKLA 4KBCA 4MWIA 3JXWA 4FNYA 5HE1A 1APME 3GEQA 3ACJA 3A7JA 3VC4A 5GZ8A 4OBQA 5FXQA 4YJUA 3CBLA 2WOTA 3RJCA 3LIJA 1OKZA 3FKLA 5K5NA 4FTMA 3VS1A 3D2IA 4C37A 4GKIA 1OIYA 3DNDA 4QMXA 4CFFA 1R39A 4O22A 3R1QA 3R7VA 3NVKI 4AGUA 5CU4A 4AE6A 5L8LA 3VS6A 2AUHA 3TKIA 4MUQA 2R3QA 4Y72A 3MIYA 4IM3A 4DEBA 3ZO1A 4J53A 4CYJA 3PJ3A 5C26A 2WIPA 5M4CA 3KKVA 3ZO3A 2W17A 4PDYA 4YZ9A 4K18A 3WF9A 1MRVA 3PA3A 4ASDA 2C6KA 3KXMA 4E6AA 4Q9SA 3NLBA 1U5QA 1JSVA 2R5TA 5IEVA 2AEGA 3R8ZA 2FUMA 4K33A 2HZNA 3VULA 5CF8A 1JKKA 4FTQA 3TKHA 4FL1A 5B2LA 3O50A 5CU3A 3R2BA 4FL3A 2IO6A 5HLWA 3IKAA 1MUOA 5EKNA 2C6MA 3BWFA 2I40A 2UZUE 3QTQA 4EH7A 4D1XA 3OUKA 5AV2A 1H01A 4AU8A 2OI4X 3DNEA 3R1NA 3AGMA 3LJ2A 4ZMEA 2IZSA 3TIYA 5IA5A 4C2WA 4HVHA 3ZO2A 5HTIA 4M15A 4X6QC 2VTHA 4FG9A 3V3VA 4IWDA 5TKDA 4HZRA 3HP2A 5EQPA 2R0UA 3R7UA 3UYSA 4CT2A 4CG8A 2BMCA 2XM9A 4DEAA 4QTBA 2ZMCA 1DM2A 1YXVA 4MYGA 3ATTA 4K9YA 2WTKC 3W8LA