4E5BA

Structure of p38a map kinase without bog
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
324
Chain Sequence
ERPTFYRQELKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipid Molecules Induce p38 alpha Activation via a Novel Molecular Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 106
structure length 324
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5bA01
3AXWA 4YZCA 2C0IA 4RBLA 3UMWA 1NY3A 3PJ3A 2Z7LA 5IEXA 3F88A 3F5GA 3BE9A 3AD6A 3BX5A 4JT3A 4RZVA 3VUTA 3OMVA 2PPQA 3Q9WA 3GFWA 4O0YA 3IW5A 5DEWA 3SOAA 2WMBA 4X3FB 3U6HA 3HMNA 1PMEA 3OCBA 2C0OA 3F3TA 2IWIA 3PY1A 2C5YA 4KA3A 4WG5A 4NKAA 2YHVA 4FV6A 4O0SA 1WVWA 3SXFA 1VJYA 3BWFA 2Z7RA 3W10A 5EYDA 2BKKA 1IRKA 5EKNA 2WIHA 4CLIA 2VGOA 3PY3A 1CSNA 4D5KA 4N57A 1GIHA 2O64A 3NUXA 4OTDA 4O82A 3FXXA 1OIQA 4L53A 3I7CA 4G2FA 4TYHB 5HE2A 4ASZA 3QZIA 4E6CA 3O71A 3P7CA 4QQJA 4B0GA 5GJGA 4ITJA 4CXAA 4B99A 2OSCA 1H1WA 4FIHA 1KE7A 3U87A 5CANA 1W98A 4GSBA 3GCVA 4ZXTA 3KQ7A 4G3DA 4YJOA 4ERWA 1SNUA 2BZHB 2R3RA 3E7OA 3O7LB 4UBAA 2XK4A 2BFXA 5D7AA 5DN3A 5JRSA 4U3YA 3ZU7A 1U46A 5HNGA 5B2KA 2WOUA 5FRIA 4BYJA 5IQEA 3COMA 3UGCA 3RPRA 5DLSA 4AW5A 4BBMA 3R7OA 3W2CA 4KBCA 4FTIA 4AFJA 2YERA 3OXZA 4OGRA 3RWPA 4GKIA 4FIEA 3DKCA 3UC3A 3GU5A 5KMNA 5IF1A 2JFLA 4F0FA 2BFYA 2UUEA 1HCKA 2XH5A 3FL5A 3UMXA 4F9CA 1APME 4DH7A 2VTSA 5EHOA 4ANBA 3SA0A 3Q6WA 3HA8A 5HO8A 1YXUA 3RI1A 1J7IA 2I0VA 4CFVA 1QPJA 2PUNA 4YJQA 4J7BA 4C4GA 3HECA 4UYNA 4O2PA 3LQ5A 3QHRA 4EHZA 5LMKA 2HXLA 2I7QA 4EEVA 2R5TA 2PYWA 2IZTA 3ZBXA 5HEZA 4R7BA 2XK8A 1FVRA 4RX5A 3EKNA 4NW6A 3G51A 3BYOA 5TR6A 4BTMA 3BU5A 4EQCA 2WMTA 2VO3A 5LWNA 4AA4A 2IW9A 5HICA 2OI4X 3OWPA 3DNEA 4FSNA 4R3RA 5FD2A 1IR3A 2WGJA 4H3QA 3QLGA 4APCA 5J79A 2C6KA 3MPMA 4HCTA 1XBAA 2R2PA 4FV1A 4C3FA 4I5PA 3OY3A 4YMJA 2Y0AA 5AUXA 4IVCA 5C9CA 3RM6A 3VUMA 4ZSAA 2VO7A 2Y8OA 4GVAA 2UZLA 3DXQA 3BYSA 3DFCB 1KSWA 2W1DA 3TZ7A 2BCJA 3DB8A 5CENA 1U59A 3AC3A 4FZ6A 4IB1A 4BKYA 4UB7A 2ITOA 4FSMA 2VWWA 5AIRA 1A06A 3SC1A 5IMEA 4L9IA 2F4JA 4U3ZA 4L7FA 5LVPA 3NUSA 5EI2A 4FTCA 4U43A 3FZRA 4KB8A 4WA9A 4YLJA 1U4DA 4LL5A 3V8SA 4GS6A 4NYEA 4O86A 3V3VA 3FBVA 5M06A 3VJNA 3PA5A 3FPMA 4PMTA 4DH3A 5ETIA 2FSOX 3R8UA 2G2IA 5LJJA 5J5SA 4EWQA 5CLPA 3QTSA 5FGKA 1QCFA 4UALA 5DRBA 3RHXA 3PSBA 5CT7A 4FVPA 5A54A 3QBNA 3IKAA 1ZZLA 3C1XA 3VBWA 5CZIA 3M1SA 1H07A 4AQCA 1Y57A 3EN9A 2XS0A 3BV3A 2EWAA 3CY2A 5G6VA 2ZDUA 5AIKA 5I3OA 3VNTA 3R7IA 4R7HA 4FODA 3RGFA 3OT3A 2YIQA 2HK5A 2QO9A 3PA3A 3KCKA 4IWPA 1OUYA 4EOLA 5HG9A 3II5A 4M13A 3MFTA 5K4JA 3EKKA 2UW8A 3TG1A 4ZEGA 5FWKK 4IW0A 3SHEA 3ZFMA 3QYWA 2RFNA 3OEZA 1U5RA 5D10A 4TWOA 4GU9A 4TTHB 3ZFXA 5L3AA 3EN4A 2VRXA 5AADA 2VO0A 5CWZA 4FE2A 5EOBA 2J4ZA 1XBCA 5CYIA 1Q8TA 4A9RA 5GHVA 3W2OA 4CEGA 4YP8A 1M52A 3V04A 4C61A 2OKRA 1AD5A 2GDOA 1I09A 3HKOA 4H3PA 4U97A 5HBEA 1OIUA 3L9NA 1J1CA 1CDKA 4D58A 3DS6A 4DFNA 2UW6A 4EJ7A 3P1AA 1G5SA 2WD1A 3ORLA 4WOVA 3IQ7A 4XG8A 4EBVA 4BF2A 2XK3A 2UZUE 5AR2A 5F1ZA 3TJCA 5CSVA 1WVYA 4JBQA 5ACKA 4QTAA 4C34A 4KUJA 1CKPA 4Y8DA 4L00A 5DEYA 4O6EA 2PVRA 1IG1A 3PWYA 1ZYDA 3BLQA 3LXKA 4K1BA 5M09A 4NW5A 4A7CA 4TXCA 3GCPA 4APPA 2WQOA 4FC0A 4FZFB 4HPTE 1JSUA 4EHVA 4RJ4A 4HGEA 5FP5A 4HZRA 2YM7A 3RTPA 3R21A 5J1VA 3V8WA 2XBJA 2UW5A 3Q53A 3QFVA 4A4OA 1WFCA 1RJBA 5HLPA 5DT3A 4DTKA 3A99A 4F09A 3FMDA 4PTCA 4BDAA 4C4HA 4QP8A 2XIXA 1OKZA 2OXDA 4IADA 4M97A 4ACMA 1PMVA 5EK7A 4ZZOA 3LQ3A 4OLIA 2O2UA 5AA8A 3S95A 2HOGA 3CP9A 4HYIA 5J8IA 3TXOA 2JLDA 3NNUA 4UZHA 4U41A 4ZTSA 4O7LA 3VJOA 4UWCA 5IUGA 2WU7A 3PJ8A 5GZ9A 4F7JA 5M4FA 3C5IA 3VS2A 4BN1A 3P79A 1WVXA 5HVYA 1CKJA 2ITWA 3KRRA 4ZSJA 5FTOA 1P4OA 1A48A 3DDQA 4GRBA 3Q4CA 4QP3A 4BCOA 5CEPA 3WARA 4ACGA 2B52A 1MP8A 3U9NA 4TWNA 1MQ4A 1QPEA 3F69A 4LG4A 2C6TA 2Z2WA 5L8JA 3VBQA 4FTLA 3CGOA 2G1TA 3C0IA 4JR7A 2W1GA 2C6EA 3FMNA 3LLTA 4H1MA 3QTWA 4HYUA 4IAZA 4MH7A 4QMTA 5L4QA 4HYSA 1R78A 3QXPA 4Q9SA 3BYMA 3TZ9A 4BDFA 4D9UA 2C5VA 4GIHA 2VTJA 3OFMA 4JIAA 4UV0A 1BI7A 4YNEA 2F57A 3IS5A 2OF4A 4I3ZA 1PJKA 2LAVA 2XB7A 4ANQA 2Z7QA 4MEDA 2C6MA 2CDZA 2ERKA 1VEBA 3KN6A 4AAAA 4AWIA 3NLBA 4YJNA 4O7WA 1PKGA 2C6DA 3WIKA 4U40A 2PE0A 1UA2A 1FMKA 2ETRA 5EDQA 4CKIA 5ICPA 2WQBA 1REJA 4LGGA 2VGPA 5M4UA 3MA3A 3DV3A 4QMZA 2CGWA 4P7EA 4BFMA 3KXGA 1H1RA 4P5QA 3ZMMA 4FSWA 4C57A 2CKEA 3C4WA 3KRJA 3TUDA 4R1VA 3UC4A 3VUHA 4M3QA 5E1SA 5HU3A 4LOOA 4L52A 4USFA 4EK8A 1ZOGA 2GNJA 2W5BA 3QCXA 5C8MA 4YO6A 3UNKA 1CM8A 4G9RA 3G6GA 4H58A 2XNOA 4TKSA 4X2GA 4AGCA 1BYGA 3UPXA 4HVHA 1SVEA 4K18A 1W0XC 1H08A 3IDCA 2WEIA 4RIXB 1UU3A 4GT3A 5BVOA 3U6JA 3FZTA 3ULZA 3IOPA 3PXYA 3TTJA 3ROCA 4QNAA 1FQ1B 3KU2A 2CMWA 4NL0A 3D2IA 1JKLA 5CSWA 4CFXA 5CT0A 3HZTA 3UYSA 2H34A 4X3JA 2QOBA 2W1IA 4PDSA 3D5VA 5AP6A 4IWDA 2Z60A 2YA9A 4U44A 1MQBA 3REPA 2YM5A 2IZUA 4JLCA 4CRLA 4OTQA 3W2PA 4KRCA 5BVDA 4Y95A 3NUAA 5AP5A 2WTKB 3S3IA 4KABA 2B9HA 3OEFX 4O1PA 5M55A 1HOWA 4ZSEA 4IM0A 3DKGA 4WNPA 4YU2A 3LXNA 1MRVA 2WKMA 5H3QA 3VN9A 4EHEA 4DFBA 2YAKA 4KIKB 3L9MA 2XJ1A 4I94A 4JXFA 2GTNA 4QD6A 3P78A 3DU8A 4IAIA 5KE0A 4YTCA 5BNJA 3TUCA 3A2CA 2X1NA 3QU0A 4AN9A 3F5PA 4TYHA 1V0PA 2BRNA 3ZYAA 2C3KA 3FI4A 3FLYA 4G34A 3VQHA 4DEHA 5TT7A 3MWUA 1NVSA 3LFSA 3QD0A 2OF2A 3AGMA 3ZONA 5IQIA 4U80A 3FSKA 4YPDA 5KMMA 1J7UA 2E9OA 5DIAA 4D4YA 4QYYA 3GU4A 4TYJA 3C51A 4LI5A 5K0KA 5KHWA 3EYGA 3G90X 4MXAA 3U8WA 3T9IA 3G9NA 2CLQA 3LFAA 1PRYA 3E92A 4DAWA 4D2RA 4DEAA 4CD0A 5E91A 2X4ZA 2OIBA 3B2WA 4QMYA 4M12A 2X7GA 3DT1A 3F3WA 4J52A 1FOTA 4J8MA 2R3QA 3CY3A 4IXPA 3LFFA 5BVEA 4BDHA 3F2RA 4M69B 2XJ0A 3B8RA 5E8UA 3R1QA 4C3PA 4RQKA 2EUFB 4X3FC 4MX9A 4CFNA 2R3HA 5BUEA 3DZQA 4EOMA 3LMIA 2G01A 4TW9A 3RMFA 4AZFA 3JR1A 2H96A 2JIIA 4FTTA 4RRVA 5FBOA 4MBIA 2X2KA 4I20A 4V0GA 1PYEA 5I5ZA 4L3LA 3NCGA 4NKSA 1LEWA 2V22A 4ITHA 3GQLA 1HCLA 3KRXA 3FYJX 3R1SA 4R5YA 4G5PA 1KOAA 4W4WA 5DR2A 3GC9A 3QHWA 3SW4A 2CN8A 3DA6A 4FOCA 1JVPP 3UP7A 3IW7A 2HELA 4BWPA 2V0DA 3WIGA 2WTVA 2A4LA 4I23A 2XYNA 2RF9A 3QGYA 4IBMA 5EW3A 5GZ8A 4GFGA 5KBQA 1YDTE 4S34A 3CPCA 4OTHA 3VBTA 2JDVA 4HJOA 4HCVA 3H3CA 1NVRA 2XKFA 3UJGA 3ZEPA 4DTBA 4JL9A 3VBVA 2NNWB 3PLAE 4M14A 2PY3A 4ARKA 2YISA 2ITPA 3TT0A 4YTIA 2W9ZB 2YJSA 2CNVA 4WRSA 1BKXA 3RM7A 2WELA 3PJ2A 3DQXA 4YC6A 4D5HA 4LV5A 4DFXE 4QOXA 3E8EA 3FZOA 4J71A 2XF0A 3W18A 5HBJA 2PL0A 1IEPA 3IK3A 3L9LA 2ZM1A 5AP1A 2PMOX 3C4EA 4DEGA 3LFNA 4KBKA 3S1HA 4AFEA 2PUPA 2HIWA 3PWDA 3PPJA 3W2QA 4ALVA 1A9UA 1OBGA 2PE2A 3MDYA 2F7ZE 3MTFA 4A9TA 4AS0A 5CEOA 4DEIA 3LFBA 2CKPA 3NYVA 3U51A 3MTLA 5HG5A 3CD3A 3IECA 4ZMEA 4JJRA 4ZZNA 2BIYA 2JITA 4O96A 3MVMA 4IMYA 4QPSA 3KRLA 3S2PA 3ALNA 3LVPA 2VTMA 3MB7A 5L6WL 2XIRA 3DTCA 2C0TA 3GC0A 3KCFA 4IFCA 2YABA 4C37A 2GNHA 4TRLA 5L8LA 5I4NA 4FKRA 3C9WA 3ZLYA 3EIDA 1GIJA 3RK7A 4CTBA 4R77A 5EYCA 3R1YA 3G33A 3UIMA 5C26A 3UE4A 2QQ7A 3Q60A 5HIEA 3ACJA 5J9YA 5T68A 1V0OA 3AQVA 3HUBA 4Z9LA 1M14A 3TCPA 2CN5A 1XJDA 2HAKA 4FSRA 4RIWA 4WBOA 3V5TA 3Q5IA 4XG7A 3MI9A 1G3NA 2C6LA 5KZIA 3BWJA 1WBOA 5I9WA 3WZDA 2GU8A 3Q3BA 3PG3A 2XNMA 3IW6A 5DG5A 4BBEA 4D0WA 4NIFA 3KREA 4E5WA 4A9UA 3VS4A 1XBBA 3DLSA 4H36A 4G31A 4I0TA 4KIPA 3ZO2A 4Z3VA 4PX6A 5CF5A 3LMGA 1QPDA 1XH4A 4RC2A 5ETCA 4ONAA 4DG3E 2R3MA 4FSUA 1GJOA 1PXMA 5FTQA 2VTQA 4K6ZA 2AC3A 2ZB1A 4CCUA 4EUUA 4YSJA 4C2VA 2XUUA 4MHAA 1OPKA 4R3PA 3SDJA 4Q9ZA 2WTIA 2YM6A 4GFOA 4K2RA 1Q99A 4C2WA 2GHLA 3GB2A 4IFGA 3EZRA 3UIXA 3VHKA 2H6DA 3F82A 3LOKA 5FBNC 3T8OA 4E5AX 3P08A 4XUFA 5K4IA 2QONA 3E93A 1H8FA 4ZY6A 4XMOA 4FV4A 4QTBA 1Q24A 2GPHA 4WO5A 1J91A 3UQCA 1Z57A 5HORA 4UZDA 3D7TA 3E64A 3LLAA 1W8CA 1AGWA 3MY1A 3S0OA 4CV8A 3R02A 3BBWA 3NIEA 4IJPA 4USDA 4EOIA 3SG8A 2OO8X 4B7TA 3ZM9A 2CKQA 5EFQA 1SMHA 2ZV7A 4WG3A 3ZOSA 5HX6A 4Q2AA 2R3GA 3HRCA 3IOKA 2XIYA 1H27A 3POOA 4Z16A 2QR8A 2WMWA 1O6LA 5AV1A 1Q4LA 3C4ZA 4KSQA 2J5FA 3CCNA 2C1BA 2ZB0A 2PK9A 4H1JA 4OT5A 4OR5A 1KE6A 4WRGA 5EOLA 5C8NA 5JGBA 3RAKA 4XG2A 2UVYA 4XS2A 5AUUA 2QD9A 2WMRA 3DJ5A 3VS7A 3BHVA 4QMUA 2QG5A 3T9TA 4QMWA 3AT4A 3Q52A 1S9JA 5F20A 4BDJA 2CCIA 4F08A 2YDJA 1OL5A 2Y7JA 4M0YA 3EOCA 3W32A 5CAQA 2J0KA 5A4CA 4FV7A 3GU7A 3VC4A 4AT3A 4BCFA 4OBPA 3RAIA 2I0EA 2J0MB 3VF8A 4F6WA 2VTNA 1PYXA 4XBUA 4CT1A 5BPYA 3AC1A 2AYPA 2J9MA 3SAYA 3FI8A 1SM2A 2RG6A 4GIIA 2GTMA 3N4TA 2J0JA 1YOJA 3AC8A 4RFYA 3MH2A 4I6FA 1SVHA 4I41A 2BRGA 3QD3A 4GL9A 4C02A 1JBPE 3PPKA 2GFCA 4L45A 1JAMA 4QYGA 2YITA 4O91A 2W06A 1UVRA 4XP0A 3BKBA 3QZFA 4D1ZA 3TKUA 3NR9A 5F94A 3EH9A 4EL9A 1S9IA 5BVKA 5LARA 2W7XA 3EHAA 1OKVA 2JDTA 5HX8A 4FEXA 5AR7A 3GCQA 3PXFA 3RKBA 3POZA 2HW6A 2KTYA 1F5QA 1Q61A 4U81A 5TKDA 2HY81 5E8TA 4E93A 3D7TB 3ITZA 1LP4A 3MN3A 3AMAA 4FNZA 3VRZA 4WBBB 4EZ7A 2W4OA 2IN6A 3FMEA 3CR0A 4CKJA 1JSTA 3VS1A 4EHGA 2XNEA 4QMPA 5EYKA 4PDPA 1E1VA 4RX7A 2XK7A 5CNNA 3SLSA 4CKRA 1ZWSA 3SW7A 3CQUA 2BRHA 3DBEA 3A8XA 2V62A 3LCDA 5ANEA 3NSZA 4LUEA 5I9XA 3NEWA 3DY7A 3PE2A 3W55A 3S4QA 3I7BA 3RPYA 2QOHA 3MJ2A 4AT5A 4IAKA 2YIXA 2W0JA 2PVFA 1W83A 1ZLTA 3H9FA 4Y5HA 4AE6A 4DT9A 2JIVA 4AGWA 4XG3A 4EORA 3LCTA 2UW0A 4JBOA 4FTJA 3QCYA 2I0YA 3G0FA 3OTUA 3MPAA 4B4LA 3OD6X 2C5NA 3I81A 3HMPA 3MA6A 4FG7A 4QP4A 4MCVA 4IM2A 1WMKA 2PVHA 2P55A 3RZBA 3VS3A 2UZOA 4IAYA 5DR9A 4RFZA 4C35A 1NW1A 2JKQA 4NM3A 5AMNA 3M11A 4QPAA 4CG9A 4FA2A 2VWUA 2UW3A 3QTUA 2XIZA 3NYOA 4UN0C 4IB3A 3V5LA 5A3XA 5AR4A 4CMTA 2PZIA 3G5DA 4RQVA 3R9RA 4DCAA 2HENA 4YZBA 3DAKA 4X3FA 1JPAA 4HCUA 4J95A 3RK9A 4V01A 3WF8A 4FUYA 4WSQA 2Z8CA 3G6HA 4FSZA 4EOOA 3I0OA 4X2JA 2OIDA 3ATSA 2R0UA 4RWJA 1TKIA 3N4UA 3CE3A 4FSQA 4FG9A 3R7VA 4F9AA 4IJ9A 2XIKA 5ETAA 2PVYA 4ASXA 2VWYA 4BKZA 1XWSA 4GG5A 2FGIA 3MY5A 4S32A 2ONLA 1YWVA 4EI4A 1XH5A 5HESA 5HTBA 1SYKA 3NYNA 4F65A 4FKOA 5M4IA 1XKKA 3O51A 2ZOQA 5I3RA 1GNGA 4G5JA 2WTKC 5KKRB 2PZPA 1ZMVA 3SG9A 3DLZA 1BX6A 3I6UA 4QO9A 3WZJA 3QTXA 2C1AA 3IDBA 1WAKA 4FT7A 4FV0A 5AV3A 5C27A 4EOPA 1H1SA 3FI2A 4OTRA 5F4NA 4D1SA 3MIYA 3F5UA 4MK0A 1GIIA 4D55A 4YTHA 4CYJA 1Q8YA 3BU6A 5BVNA 4FEUA 5EQPA 3MFSA 5AM7A 4E7WA 2W1EA 2EXMA 3OY1A 2XYUA 3TKHA 2UZWE 4RG0A 4EH4A 2RFEA 4IX5A 4YJVA 2BPMA 3A4PA 4O7NA 2VTAA 3WF7A 3DKOA 3LCKA 4JBVA 5HD4A 2O0UA 3HL7A 4FTKA 3ZC5A 4XV3A 3KMUA 4IVDA 3CS9A 4C62A 2GQGA 3ORZA 2UZDA 3RNIA 4BHZA 4BIEA 5CAPA 1VYWA 1ATPE 5CAVA 4N0SA 3QA0A 4C7TA 1YI3A 4RWLA 2W99B 5EW9A 2YCFA 3PRIA 4I6BA 3OWLA 3PE1A 3Q9YA 3OHTA 4YZ9A 3R9HA 3TNIA 4FF8A 1YDRE 5A6NA 1M17A 4U45A 5L2TA 4AOJA 5CAUA 4OBQA 3NDMA 4QP6A 4BCQA 4W8EA 4FTQA 3M42A 5EH0A 3GEQA 4GV1A 4XLIA 4CZTA 4FTUA 2VWBA 3HP5A 1H01A 4BR3A 1OL2A 2OJ9A 1CTPE 2WMAA 4HVDA 5HQ0A 3ZDUA 1H24A 3DAJA 4O0TA 4FKPA 1H28A 1F3MC 3ZHPC 1J7LA 4A06A 2ITQA 4FZ7A 3BEAA 3FDNA 4QYEA 2JEDA 1Q8ZA 4AZWA 2BTRA 4LUDA 3KXNA 4YUQA 4E73A 4UMPA 5I0BA 4MVFA 3I1AA 4K0YA 3ZLWA 3FLQA 4JS8A 2OICA 3O0GA 4QMNA 1GAGA 4L46A 4YURA 2W5AA 4FNWA 4NZWB 1NA7A 4YZDA 1LUFA 5AR8A 5LMAA 1BMKA 2WIPA 5IA3A 1REKA 4IM3A 5E8SA 1YWRA 3KXZA 3E5AA 5H8EA 2BZIB 4RX9A 3EFLA 4FKJA 2C3LA 4FIFA 4BZDA 5CNOA 4ZS0A 1YXTA 3GI3A 4HOKA 4D2PA 5FXRA 2F2UA 1UKHA 2XKCA 3D2KA 2QOCA 3KC3A 5CU6A 3HEGA 4JDJA 5K0XA 3GU6A 5B0XA 3V5JA 4ZS4A 3QXOA 5JGDA 3JVSA 3MYGA 3PDTA 2GNFA 3E63A 3ZCLA 3ZUVA 4ACCA 2HZIA 4L68A 4O2ZA 4WNMA 5JH6A 3I5NA 4BGQA 4MD8E 3AD4A 4YHFA 2FSLX 4CTCA 2FYSA 4O0VA 3IPHA 4RIWB 2X2LA 4XLVA 3W8LA 4KS8A 1EH4A 2GMXA 2XKDA 4JDHA 4LMNA 3W1FA 3QRTA 4BCMA 4A9SA 4RLLA 5KHXA 5IA1A 4N4SA 3A61A 4BI0A 3KGAA 4IAAA 2WB8A 3BGZA 2VWVA 2QHNA 4GUBA 4LRJA 1DAWA 2ONLC 1OPJA 5ANIA 2CHLA 3GC8A 3R6XA 4CG8A 2X4FA 5C1QB 5FTGA 1YDSE 3K54A 3NIZA 3QTZA 3OXTA 4H05A 4TWPA 3FUPA 1WBWA 5KUPA 4E6DA 4ZLOA 3ORNA 4NJ3A 3O7LD 2UZVA 3ZRMA 4OAVB 3KY2A 4GK4A 3ORTA 4EQUA 2B0QA 3HV5A 3HRBA 3LKMA 4D1XA 4E1ZA 3O23A 2VNYA 3ANQA 3ZUUA 4KD1A 2W96B 2UW9A 3R63A 3V51A 4NFNA 5FEQA 4YO4A 4BWKA 3NAXA 2PVJA 2PMLX 2VTLA 3RJCA 4LQMA 5HVJA 2R4BA 3GNIB 4IX6A 4XP3A 5TOZA 4I93A 2RKUA 4M7IA 3WZUA 4CFFA 4G6NA 4JIKA 3BLRA 4RC4A 4D0XA 2OJJA 3NUNA 2JIUA 4F7NA 1OUKA 1UWHA 1K9AA 3TDVA 3Q96A 3VBYA 2R3IA 2VD5A 3VW8A 2YM8A 4M15A 3R0TA 4DFZE 2ITUA 4E20A 2ITTA 4CMOA 3DK3A 3UZTA 4D4VA 3QX2A 3ZRKA 2ZYBA 4RIXA 4AXAA 3D5UA 5K5NA 1QPCA 2J7TA 4D28A 4NK9A 3HV4A 1TQIA 1OMWA 4DGNA 1KE8A 2PWLA 2QOLA 3F3UA 2R9SA 4Z7GA 3V8TA 3R2BA 5DMZA 4FIGA 3TUBA 4D9TA 3OS3A 4GCJA 1XQZA 2YCSA 5CEQA 4U7ZA 3TI1A 4AN3A 5E90A 3SRVB 3VHEA 3O50A 2R64A 1F0QA 4EKLA 4FBXA 4O7RA 3ZEWA 3OC1A 4PNIA 4QP7A 5AM6A 1GOLA 1SNXA 4EC9A 1GZNA 3LAUA 3PFQA 2XNBA 3QZHA 2X6EA 2YIRA 3R2YA 1DI8A 1Z9XA 4X2NA 5EQYA 4IIRA 1UNHA 3F2AA 3GCUA 4KKHA 4U79A 2XRUA 4LRKA 1KWPA 4ZTHA 4J8NA 4ALWA 2XNGA 4MF0A 3OUKA 4D2SA 2VTPA 4BL1A 3FHRA 4XG9A 3M2WA 3Q04A 2V7AA 5JSMA 3I4BA 3DB6A 5M44A 4FKVA 4J53A 5FXSA 4BCPA 4DLIA 5HCZA 4CMUA 4MNFA 5EW8A 2W1HA 1FMOE 3TDWA 1QMZA 3K3JA 3NZ0A 1NXKA 4KWPA 1PXKA 3FI3A 5CY3A 2X8EA 3H4JA 1MRYA 3LQ8A 3Q5ZA 4G3EA 4JR3A 4KBAA 5CX9A 4E4MA 1IA8A 1U5QA 4WSYA 1WBNA 5A46A 5CEMA 5IISA 4QMLA 5HD7A 4YJUA 1STCE 4I4FA 4FSYA 4RVKA 4AA5A 3NGAA 2WFYA 3QKKA 2W1FA 5E92A 5AP3A 2R3KA 3G15A 4R78A 5M08A 5AJQA 2W5HA 3U55A 2IZSA 5FEEA 3WE8A 1O9UA 3EN6A 1XH7A 3KMMA 4YC3A 3C50A 2OH0E 1I44A 3PZEA 4PP7A 4FR4A 2J0LA 3NW6A 2QU6A 3WBLA 4I0RA 2WTJA 5CQWA 5HBHA 3C4CA 2B54A 3E62A 4F6SA 3NPCA 2HZNA 5HCXA 4FYNA 3PA4A 3NYXA 4UX9A 4E4XA 3CQWA 5J7HA 4GUEA 5BVFA 3SX9A 3EMGA 5LVLA 2QO7A 2RSVA 4HZSA 2B9JA 2QOIA 2YACA 3V6SA 4IB0A 3ZO1A 4HNIA 4YBJA 3D0EA 4MD9E 3DKFA 3FMMA 3DPKA 3DBCA 2F9GA 1MUOA 4YPSA 1B6CB 4RC3A 4BVUA 2VN9A 2B1PA 5E8WA 3TEIA 5IU2A 3AT3A 5DT0A 4MAOA 2WHBA 3FY0A 3R83A 1P5EA 4CQEA 5BMSA 3ORPA 3T3UA 4DA5A 4BYIA 2WMQA 5B7VA 1ZMUA 2E9NA 3KN5A 3D14A 5CXHA 1XO2B 3F5XA 4DN5A 3PVWA 4M69A 2ITYA 4HGTA 1OI9A 2ITXA 1P2AA 3QWKA 3TNPC 4OTGA 1O6YA 5HZNA 3PVBA 3I79A 1O6KA 3SV0A 4O83A 3DBDA 5JFSA 1OVEA 1R0PA 2A27A 5J1WA 4PTEA 1Q41A 3COKA 2OFVA 4WUAA 3UYTA 4DH5A 4S30A 2XRWA 5IPJA 4L3PA 3QQGA 2ITVA 1PXOA 4FKIA 1YXVA 5FEDA 2WNTA 4DCEA 3KXXA 4MD7E 4D2WA 5KCVA 5L6OA 3FQHA 4L42A 4UEUA 4AW2A 4USEA 5EG3A 4QMVA 1FBNA 4LOPA 2WMUA 3QZGA 2IVVA 2GQRA 3BI6A 2CPKE 4PL4A 4RPVA 4EJNA 3RAWA 1RDQE 5M07A 4R3CA 3UIUA 2NPQA 4E26A 5EYMA 3UP2A 1OM1A 2CCHA 4I1ZA 3P23A 4K77A 4XCUA 3ALOA 3LW0A 4FVRA 1ZOEA 1BLXA 5L8KA 5BVWA 3R00A 3A8WA 4HGSA 5BUJA 4PRJA 3UIBA 4FTAA 3BE2A 1X8BA 4FTMA 2UZTA 3G0EA 3VVHA 4BI1A 3MS9A 4BCIA 4I5HA 2J50A 3GGFA 4ZY5A 5DR6A 3TM0A 4BIDA 3N51A 2R3LA 1U54B 4JAIA 3R1NA 4O22A 4YJTA 3D5XA 4JNWA 5ANKA 4EONA 3C7QA 3H9OA 3IW8A 5JKGA 2XMYA 3ETAA 4B8MA 1IAJA 4JVGA 2WOTA 4CV9A 3KXHA 3UBDA 3O2MA 3V01A 1PXPA 4XH6A 3ZO4A 3CEKA 4IH8A 1W7HA 2ESMA 3CPBA 4RJ7A 3QTRA 5IG1A 4FV2A 4I21A 3DQWA 3GQIA 3UDBA 5LOHA 4F70A 3LMHA 1CKIA 4AW1A 2YM4A 5E8XA 3QCSA 4ITIA 2QOFA 2CKOA 4LFIA 4R6VA 3MGYA 4XEYA 1DAYA 4PF4A 3LJ0A 4NFMA 1P4FA 3OT8A 5CSXA 5IMXA 5FG8A 3SVVA 1IA9A 5IQAA 3HDNA 4QPMA 4QYFA 3ODYX 2IVUA 4F9YA 3NAYA 4O0XA 4ZJIA 3I5ZA 5D12A 5DRDA 1V1KA 2BR1A 3BRBA 5AAFA 2DQ7X 3ZO3A 5AUZA 4IHPA 4LGHA 4UMUA 5LQFA 1M7QA 3DCVA 3FLNC 2BILB 3UG1A 4TT7A 5CF6A 4FL1A 4R7IA 5DHJA 3RCJA 3TNWA 1H0VA 3QUDA 4GU6A 4Y83A 2A2AA 3RCDA 3A7FA 2GHGA 4BTFA 3GBZA 3PXZA 1Q3DA 2WEVA 2WTDA 2FSMX 4N6ZA 2BRMA 3E3PA 4WD5A 2VX3A 5BYZA 4NM7A 3TJDA 4U9AA 4CFMA 2ZV2A 1YOMA 3HA6A 4GJ2A 1OBDA 4ID7A 4MNEB 4Y85A 4BZOA 2JC6A 3P9JA 4RX8A 3EN7A 3FC1X 2ZVAA 3PPZA 2BALA 5HNIX 3C4FA 3PXQA 3ZC6A 5JRQA 2YCRA 3OW4A 3HP2A 4FTOA 5KMJA 5E8ZA 2Y4IB 2UVZA 2QOOA 1WBTA 4PMSA 4FT3A 4FEQA 2WU6A 3DBQA 4BKJA 3H0YA 3A7JA 1CMKE 3ERKA 2XEYA 3P7BA 3AG9A 4NSTA 4BDBA 4HVGA 2ACXA 4IVBA 1AQ1A 3EQRA 5M53A 2VX0A 4J98A 3FE3A 1U54A 4HVIA 5T3QA 4CZYB 2C30A 3I60A 4I5MA 4IDVA 1Q8WA 1ZOHA 4YZNA 2XM9A 2ITNA 4UYAA 4LL0A 3HLLA 2XNPA 4RIYB 4PTGA 5IH4A 1L3RE 1P14A 1R3CA 3EB0A 5H9BA 3HX4A 3I6WA 4P5ZA 2NRYA 3ENMA 3MV5A 2QNJA 4XG4A 2QKRA 4XP2A 5DBXA 3ZRLA 5I9VA 5IA4A 1G8AA 4FMQA 5IDPA 5AFVA 2NP8A 4RWKA 4UMTA 3R7YA 3UNJA 1WCCA 4E4NA 2O3PA 1PW2A 3FMKA 4ACDA 2IZRA 2HZ4A 4FKUA 2VWXA 4QRCA 5IQHA 3PYYA 1FPUA 2PZRA 3QRUA 4Y73A 4KNBA 1ZYJA 2FH9A 4XX9A 1ZARA 3DDPA 5AX9A 3OUNB 4O81A 2BAJA 2HCKA 1UNLA 5KMIA 5L2SA 2O8YA 2PVMA 3LFCA 3FXWA 3PLSA 4E6QA 3R04A 2H8HA 3A60A 4L67A 3GVUA 3MIAA 5AP2A 4WIHA 2QURA 4FICA 5HU9A 3RALA 4DFYA 4FEVA 3GFEA 4F0GA 4EH8A 4PY1A 2ZV8A 3BGPA 5CSPA 4UWYA 5CSHA 4YZMA 3HMMA 5A6OA 4FV9A 3NS9A 1OZ1A 2ETKA 5K9IA 4CFUA 5IH6A 1KV1A 3CD8A 4YC8A 3JYAA 3FXZA 3K5VA 5B2LA 4IZ7A 5A4EA 5HHWA 1OKYA 4KAOA 5E7RA 4HW7A 1Q5KA 2HW7A 5AR3A 5JFVA 2EXEA 1WBPA 3BHYA 1YXXA 4BCGA 4KKGA 4J97A 1Y91A 3C4XA 4O0WA 5IA0A 1OB3A 4QP1A 4RWIA 2GS2A 4H39A 2GS6A 4NUSA 1SVGA 5DFPA 5EHLA 3EWHA 3R9DA 3T3VA 3WYYA 5CALA 3LHJA 5EKOA 2WMXA 1JWHA 4GFMA 5FXQA 1YHSA 2YLFA 4G3CA 1UU8A 5JEBA 2SRCA 2PMIA 4KINA 3TNHA 4RVLA 5D1JA 2WMVA 3EQCA 4UWBA 4YJRA 5J9LA 3RBWA 3WILA 3FWQA 3EL7A 2OG8A 4JQEA 3VS5A 2QOKA 4ZZMA 2QU5A 4G9CA 3R8LA 1XH6A 3EYHA 4J1RA 4DGOA 3OXIA 1FINA 3RPOA 2I0HA 5GZAA 4AT4A 4ENXA 4XV1A 2BZJA 3HVCA 5LCJA 4BIBA 3L8XA 3QGWA 3W16A 5CASA 1LR4A 4WT6A 5DE2A 3RHKA 4CRSA 2QOQA 2VAGA 4NU1A 5HGIA 3QA8A 5H8BA 2QCSA 4KIOA 4M84A 3FHIA 5IA2A 2BMCA 2PVLA 4ZLZA 1ERKA 1BL7A 4MXCA 3COIA 4GYGA 3BPRA 3PUPA 5EI6A 3F7WA 4J99A 4C4FA 2R7BA 5KMLA 3VBXA 2UW4A 2OXXA 4EZ3A 3A7HA 2BHHA 2DWBA 4EH3A 3LFEA 3O17A 4O7SA 5T6KA 4BTKA 5CU3A 2CNQA 3DXNA 4IZ5A 4AN2A 5JK3A 3CTHA 4HGLA 4V05A 5HG7A 3ZSGA 2PUUA 2OXYA 4CQGA 3CLYA 1OITA 3QTIA 4FUXA 2Q83A 3UODA 3ZLSA 5A9UA 2R0IA 4FV3A 4UXLA 4AG8A 3QKMA 3QRKA 1YWNA 4JG7A 2OLCA 4BY9E 4GJ3A 1ZYLA 2R3FA 3DK6A 3TWJA 4RSSA 1M2RA 3ZXZA 2RG5A 2VNWA 4IC7A 3R8ZA 3TN8A 4I0SA 3P7AA 4G3GA 4FIJA 1K3AA 3MVHA 4BCNA 5FQDC 5HVKA 3E8NA 1K2PA 4JQ8A 4O84A 4QTDA 4FT9A 2IPXA 4B9DA 2R7IA 1M2PA 3NUUA 3QD4A 2FO0A 2JD5A 2X81A 3HV6A 1JNKA 3KK8A 4JX3A 4O38A 3CBLA 3MY0A 4PP9A 4RJ5A 4YHJA 5EM5A 2XBAA 4M0ZA 4CCBA 1BL6A 1YVJA 5IQFA 4HVSA 3EQFA 3R7UA 5A4QA 2XKEA 2J6MA 4JI9A 4Q5EA 4F9BA 2BVAA 2X9FA 4EWHA 1GZ8A 1FGIA 2B55A 3QX4A 5C4LA 2XM8A 1YRPA 3CKXA 4NTSA 4FNXA 5CAOA 4HYHA 3W8QA 4BTJA 4F7SA 3FMLA 3ANRA 3O8PA 4DT8A 2I1MA 2IVTA 5AV0A 4Z7HA 2B9FA 3A4OX 4AE9A 4W9XA 1PKDA 2CLXA 2WQEA 3UVRA 3QQJA 4YBKA 5M57A 3U54A 4FKSA 4PQNA 4EQMA 3TV4A 3QKLA 2P3GX 3R7GA 4AZVA 1UWJA 2HXQA 3IO7A 4S2ZA 3DAEA 3VS0A 5HIBA 1RE8A 2JKOA 3U4WA 3BELA 4NH1A 4FOBA 4L3JA 1IAHA 5E8YA 4I4EA 4XV9A 5B2MA 2GCDA 2QVSE 3FQEA 4NCTA 5CZHA 1ND4A 3HMOA 3DJ6A 3VQUA 5LVMA 2BUJA 3BCEA 1DI9A 3A7IA 4KIKA 4X0MA 2GSFA 5D7VA 5AP4A 3ZH8A 4DLJA 2ZDTA 3E87A 4RA5A 2F2CB 3ROYA 3TIYA 3FJQE 3FV8A 2RIOA 2YLEA 4FTNA 4WHZA 1YQJA 4DFUA 5E1EA 3V5QA 1KE5A 2XZSA 3E8DA 4DINA 2YZLA 3BIZA 3IGGA 2EVAA 2GS7A 2YAAA 4BZNA 4C4EA 4LM5A 5F9EA 5LVNA 2F7XE 1ZRZA 3SOCA 1RQQA 3HNGA 4RVMA 3H9RA 3AC2A 5GJDA 3HV7A 4ANMA 1Q62A 2W4KA 2F49A 3QL8A 3D83A 3K2LA 4C4IA 5I9YA 3DBFA 2VUWA 2JAMA 5E4HA 3FKOA 3HGKA 1JKTA 1JLUE 5DT4A 3C0GA 4BCKA 4IANA 3WZKA 1SZMA 4FKGA 3QRJA 3FZPA 4CYIA 3DGKA 1H25A 4MQ1A 4YLKA 3ORXA 4IX4A 3EQGA 3QUEA 2YDIA 4MNEA 4WNKA 4ASDA 4IEBA 5CVFA 3RWQA 5L2WA 4C33A 1JOWB 3ENHA 2IW6A 4G1WA 5G1XA 3PIZA 3ZZEA 4NEUA 3MFUA 1ZMWA 3JY0A 2EB2A 2EXCX 4ZP5A 4BI2A 4D4RA 2B7AA 3ODZX 3S00A 3NVMB 2VU3A 4MYGA 2QG7A 5HCYA 3PSDA 3EQPA 2JAVA 1Y6BA 3ZS5A 4CZUA 2VWZA 4WG4A 2JDSA 3DNDA 3U6IA 3KF4A 1FGKA 2RGPA 4DH1A 4J96A 4K11A 5HLNA 4A4LA 2BAKA 2XP2A 3BBTB 2W05A 5DI1A 5JFXA 2CJMA 3OTVA 4I22A 4RMZA 1Q8UA 2OIQA 4FX3A 4EBWA 5AAGA 3F9NA 3PRFA 3ZZWA 4PNKA 3L9PA 5GIPE 3WE4A 2G2HA 4GK2A 1OL7A 3LCSA 4XHKB 5CI7A 1YOLA 4ZLYA 4RVTA 3FL4A 5AUTA 2G9XA 2X8IA 2IW8A 4BWXA 2OU7A 3QUPA 5HIDA 4DGMA 5HNBA 4GG7A 4FGBA 1J1BA 5EHYA 2P0CA 3ZXTA 4QMMA 4OUCA 4FTRA 3NVKI 3ATTA 3JVRA 3UOKA 3F3VA 5J7BA 2UW7A 4IZYA 4ZTLA 3K3IA 3LJ2A 4JG6A 4R5SA 4AOTA 5L2IA 3OROA 3TV6A 3RK5A 4PPBA 2OWBA 3GOKA 1PXIA 4PDOA 2ZJWA 3C5UA 2GNGA 3FKLA 4FG8A 3FLSA 4U8ZA 4X2KA 3OOGA 3QYZA 4LOQA 4HNFA 5EM7A 2P2IA 2FA2A 4RFMA 3LXLA 3VF9A 4F1TA 2B53A 4FV8A 3TKIA 4EYMA 3EQBA 3FQSA 3KB7A 5LXMA 2C69A 2W4JA 2GNIA 2RFSA 2WTWA 3RNYA 2OBJA 5IH5A 3TZMA 4OTPA 4AUAA 3KULA 1ZXEA 2PTKA 3AGLA 4MXOA 4TYEA 3VS6A 3LXPA 4MF1A 4CLJA 5CTPA 2FSTX 4AOIA 2HZ0A 5L6PA 3AMYA 5C4KA 4AZTA 3PP1A 4O0RA 4AACA 3PSCA 1OIRA 4S33A 2WXVA 4G17A 3V5WA 3OF0A 3ZDIA 4OAUC 1YI4A 2EU9A 1H00A 4BDKA 4CT2A 3BQRA 4ZK5A 1PXNA 3ZM4A 5DNRA 3R73A 3QAME 3HV3A 3LJ1A 4K33A 5HTCA 1PY5A 4MBLA 4Q5HA 5JZNA 2DS1A 4LGDA 3W33A 2H9VA 1WBSA 2XVDA 3PIXA 4TWCA 5C01A 3OCGA 3GCSA 3QWJA 2AUHA 4PL5A 4AF3A 5HLWA 4O7YA 4MKCA 4A4XA 2VZ6A 1M2QA 3NW5A 4BGGA 3R28A 3BHTA 4EH2A 1W84A 2IJMA 4L01A 5JFWA 4DC2A 4ENYA 4W4XA 4EOSA 3BEGA 2ZAZA 4V0GB 5TF9A 2E9VA 3BYUA 5HTIA 5ETFA 2P33A 2P2HA 3R9NA 3QTQA 3UQGA 3NMUF 1H26A 1VR2A 4XOYA 3LM5A 2GNLA 3EJ1A 5KZ0A 3C0HA 4TYIA 4L7SA 4CFWA 4PWNA 1XR1A 2CSNA 2OJIA 3KK9A 3D15A 3LIJA 4F64A 5A4LA 5IQDA 4X7QA 2BROA 3BHHA 3UO5A 3CIKA 5DA3A 3R7EA 1Q97A 3DJ7A 4RJ6A 4AX8A 4EH9A 3ORIA 4XNEA 4R8QA 1BUHA 3CJFA 2XK9A 3JXWA 4QT1A 1URWA 4D2VA 4KIQA 4C3RA 3CTQA 3PY0A 4E4LA 4ERKA 4F0IA 5KMOA 4HPUE 3SRVA 4WKQA 5AUYA 4YLLA 5E8VA 1TQMA 3BZ3A 4Y46A 1UU9A 4PV0A 3LCOA 4DEBA 2C6IA 4H3BA 3LPBA 3PXKA 4NM5A 5FP6A 4QYHA 2NO3A 4NCTC 3OBGA 3LFDA 2B4SB 4FV5A 4YNOA 3AMBA 3VO3A 3MW1A 3PVUA 5DGZA 4UY9A 2PE1A 3WF5A 4ASEA 4C59A 3CKWA 4C8BA 1LEZA 3ORKA 4TPTA 4FSTA 4BDEA 2VV9A 3U9CA 2ZM3A 2V5QA 4X6RA 4O0UA 3E3BX 1ZZ2A 3PTGA 4PPCA 5H2UA 4E6AA 5FDPA 3VUIA 1XH9A 2J51A 3FSFA 4NJDA 1PXJA 5KO1A 5C03A 1LPUA 5GIOE 4IDTA 3QQFA 2CGUA 3FMJA 2WTCA 4GH2A 4W9WA 5GNKA 5BYYA 2UVXA 4O6LA 4QQTA 2C3JA 5ANDA 4IB5A 4GT5A 4UMQA 4PMMA 5LMKC 3CSVA 4M66A 5AAEA 2WAJA 3COHA 5I9ZA 2PULA 5IZFA 2UV2A 3UQFA 3FC2A 3LZBA 5AEPA 4FGRA 1RW8A 5AUVA 1OL6A 2QODA 3OCTA 5IQGA 3EFKA 2C3IB 4IE9A 3OP5A 4MXYA 3VW6A 1GZKA 4C36A 5LWMA 2QKWB 3JY9A 3H10A 4GW8A 5IDNA 3NNXA 4AGDA 1YXSA 1ZAOA 2YN8A 3TZ8A 5M4CA 3QLFA 3F2NA 4C0TA 2A19B 2X7OA 3FZSA 4PUZA 3MH3A 5CU4A 4F1OA 3HRFA 5HOAA 4OBOA 1Y8GA 3B2TA 2AC5A 5EM6A 2PUIA 3Q4TA 4ZY4A 4RIOA 1R1WA 5HI2A 5IEVA 1ZYSA 2VTIA 4YGAA 5HG8A 3ZFYA 5GINE 4MQ2A 3SQQA 2C5XA 1KV2A 3G9LX 1UKIA 3RVGA 4L6QA 3VAPA 4GYIA 4UXQA 3NWWA 4C4JA 2VO6A 4ZTNA 5HE3A 2FUMA 4DF3A 3JPVA 4ZTQA 3ZSIA 2YWPA 2BDFA 2B9IA 4AZSA 3BV2A 3IDPA 4LMUA 4F99A 5CXZA 3UO4A 5J5TA 4ZMFA 2X7FA 3FY2A 4GEOA 3FLZA 4Y5QA 1NVQA 3IONA 1UNGA 3KA0A 5ACBC 2ETMA 4FKTA 2Z02A 2QI8A 3EQDA 4P4CA 3FYKX 4DITA 2V55A 5HE0A 5HO7A 4FL3A 3VUDA 5AP7A 2JDOA 4OT6A 1XHAA 3ZBFA 5BUIA 1L8TA 2J90A 4R1YA 5F95A 4EKKA 4IACA 3H0ZA 3TIZA 2BDWA 2W1CA 4ZJJA 5HKMA 5J95A 5JZJA 2C4GA 4NM0A 3L1SA 4FT5A 5A4TA 2ZM4A 1H4LA 4FKWA 3PJCA 2QO2A 4G6OA 2J0IA 3KVXA 4EC8A 3AC4A 4UMRA 4FL2A 3R8MA 4DTAA 1OGUA 3ZSHA 3R8PA 3BYVA 1R0EA 3LFQA 1H0WA 1YI6A 2PSQA 4EYJA 4IAFA 4AGUA 4JBPA 1FVVA 2C47A 2VTOA 3OOMA 3PP0A 4QTCA 5ANJA 4A07A 3VUGA 3UPZA 3KULB 3KVWA 4X6QC 3FPQA 3DOGA 4JQ7A 4CGAA 4FYOA 3UG2A 1JSVA 2R3OA 2QLUA 1PHKA 3KL8A 4DG2E 3MB6A 3GC7A 5DWRA 4MWIA 3OZ6A 3SKCA 4G3FA 5JMSA 3KEXA 2I6LA 2REIA 3MBLA 1MRUA 1OPLA 5AR5A 4JX7A 3U4UA 2W17A 2PVKA 3ZTXA 4TL0A 3Q4ZA 5TO8A 4EH7A 3CJGA 4AP7A 5FM3A 2V7OA 4S31A 3D4QA 4YHTA 2XJ2A 3NX8A 4AU8A 3DZOA 5BYLA 2VTHA 4K9YA 2Q0NA 3L8PA 4O21A 4P2KA 3V6RA 4EZ5A 3QD2B 2YCQA 3OCSA 2WPAA 3F61A 3Q4UA 4MBJA 3A62A 3PJ1A 2ZMDA 5FM2A 2GQSA 4C38A 2JKMA 2G2FA 3NRMA 4KRDA 4EOJA 2BZKB 4KS7A 4GT4A 2FB8A 2ERZE 4JG8A 5KNJA 2EB3A 3KRWA 3MH0A 3UOHA 5KX8A 4O1OA 4F1MA 4QMSA 1DS5A 2CGXA 2WZJA 2XCHA 2Y6OA 4ANOA 4N70A 3PZHA 3CXWA 2JFMA 4NTTA 4XRJA 3W2SA 3VWAA 4MWHA 3IW4A 2HY0A 2OW3A 4BRXA 4DEEA 2YJRA 4ANLA 3SD0A 4BHNA 4TNBA 4TYGA 1OIYA 1OECA 1URCA 4RIYA 3Q6UA 4JAJA 3VULA 3ZLXA 4BDIA 4DGLC 4E8AA 4EK4A 4F63A 3FEGA 4DYMA 4YSMA 5ANOA 4CVAA 3OW3A 4IX3A 3C13A 3R30A 4PPAA 5DVRA 3PIYA 3WOWA 4TNDA 3VIDA 4JDKA 3WZEA 5AP0A 3UNZA 2OGVA 2GFSA 2E9UA 1DM2A 2LGCA 2UZBA 3AOXA 4KKEA 4NT4A 3O8UA 4L43A 4QP2A 4RA4A 1OL1A 5ANGA 3HAVA 2O63A 4BB4A 5EDRA 2DUVA 5IEYA 2IO6A 3NUPA 3QC4A 4IZAA 4CNHA 4E5BA 1E1XA 2R3PA 2YIWA 3HMIA 4I5CA 5D11A 4EK6A 5JQ5A 4BCJA 1G8SA 2QR7A 2CGVA 2E9PA 3FMHA 3Q2MA 4ANNA 3DXPA 3LE6A 5DH3A 1TQPA 1TVOA 4QQ5A 5AWMA 3I0QA 3N4VA 4PDYA 4BDGA 3E8CA 3HUCA 5BQ0A 3FKNA 3EL8A 4EH5A 2BIKB 3OVVA 4X21A 5KBRA 3F3ZA 4ZOGA 5LVOA 2RL5A 2Y6MA 1WZYA 4GMYA 5D9HA 5BMMA 3OBJA 2WO6A 4IQ6A 4BBFA 4LRMA 1H1PA 5JQ8A 3BGQA 4OTFA 3OWKA 5JN2A 1PXLA 2HWPA 4FKLA 1XH8A 5CS6A 1NT2A 5IA5A 2OZAA 5KMKA 4XRLA 3ULIA 5HO6A 4XV2A 4GKHA 2R3JA 3RINA 4F9WA 2OH4A 4FK6A 3SXSA 3UVQA 4FT0A 4XJ0A 4FEWA 4I6HA 4EOQA 2OK1A 5FLFA 3EFJA 2BDJA 2OJFE 3QQHA 2FVDA 4C58A 3NNVA 2PVNA 3QQLA 4FZDB 4XG6A 5K3YA 4NIFB 4P90A 4G6LA 4U0IA 1JKSA 2NRUA 3CGFA 5CU2A 1Q3WA 4XOZA 3OWJA 5AX3A 3Q9XA 1BI8A 4PMPA 4U5JA 2OZOA 3DTWA 4GVJA 3EN5A 4O7TA 4O27B 4V04A 4QTEA 1W82A 4ZSLA 3ZUTA 4O7ZA 4ORKA 4I92A 3PXRA 3E88A 4BCHA 2C68A 3IGOA 3KF7A 3R8VA 3MPTA 4XBRA 4Y72A 4O7VA 2YDKA 2UZNA 1E9HA 4RZWA 4W8DA 1V0BA 2A0CX 2PZ5A 2X39A 3L8VA 3MVJA 3P86A 2XEZA 4RLKA 2X8DA 4RGJA 5CI6A 5I9UA 5L2QA 4BDDA 3WF6A 5M56A 2JKKA 3JUHA 2Y4PA 4BICA 5IQBA 4N6YA 3Q32A 4FNYA 5JT2A 1VYZA 5LCKA 2QHMA 4QMXA 3EZVA 2W1ZA 1R39A 1QL6A 2PMNX 3KXMA 4RJ8A 4E3CA 5FDXA 2ITZA 3BHUA 4U42A 3UVPA 2VWIA 3VRYA 3W2RA 5CEKA 2I40A 2J2IB 4I6QA 3WYXA 5LMBA 4LV8A 2VTRA 4EOKA 2C5OA 3GT8A 4B6LA 5KKRC 5E9EA 3JS2A 5DOSA 3FAAA 5GJFA 3BQCA 3UOJA 3QF9A 3GOPA 1PMUA 2OJGA 3NNWA 4QMOA 3F7ZA 4DE4A 2GHMA 3B8QA 3H30A 1M7NA 3AC5A 5DPVA 5AV2A 3EFWA 3R9OA 4OTWA 4EUTA 4ALUA 3FZ1A 4RJ3A 2HYYA 2JGZA 2XNNA 5AV4A 2DYLA 4FIIA 2Q0BA 1UU7A 4L8MA 3QC9A 1H1QA 3UTOA 2YFXA 4I24A 3MJ1A 3TTIA 4BDCA 4WNOA 2YIYA 4DHFA 4NWMA 3WF9A 4CSVA 2C6OA 2YEXA 4EH6A 2X6DA 4DG0E 3UZRA 5EQEA 3G2FA 3E7VA 4U6RA 2WQMA 4YJPA 5CEIA 4YTFA 3MESA 4F7LA 3F66A 4DGGA 1JKKA 3D94A 4W4YA 3RPSA 5IQCA 2IVSA 1VZOA 1PMNA 3GUBA 4DFLA 4KSPA 4MXXA 2PZYA 1ZY4A 5DYJA 3QALE 3TV7A 3PG1A 5HE1A 1JQHA 4ZIMA 4L44A 3TL8A 4FZAB 2P4IA 3ET7A 4EK5A 1T45A 4YR8A 4ZTMA 2BRBA 3D5WA 4LYNA 5EDPA 4ZTRA 3EQIA 4A9YA 3THBA 5D41A 2OZAB 1ZYCA 3MVLA 3NUYA 4M8TA 3VUKA 4ZAUA 2PHKA 2VTTA 3BU3A 4X2FA 4EK3A 5EM8A 3EQHA 1OKWA 2J5EA 4AZEA 3V5PA 4QQCA 3TACA 2YZAA 4F6UA 3R22A 3P5KA 4IWOA 1YHWA 5J87A 5A14A 3NCZA 5EI8A 3ID6C 4FVQA 3P4KA 4PL3A 4QMQA 2RFDA 4DBNA 5CVGA 1UV5A 1ZY5A 5FUTA 5H8GA 4DBXA 1B39A 2OFUA 3OG7A 3TNQB 2XK6A 4IVAA 4II5A 2F7EE 2XA4A 3O8TA 2JBOA 4GK3A 3UZPA 2YWVA 4RT7A 2X0GA 4W4VA 3UOLA 3AD5A 3HYHA 4B8LA 2JDRA 4D4SA 3QCQA 2BKZA 2QLQA 3KMWA 3GP0A 4M68A 5CU0A 4MXZA 3CC6A 5IKWA 3P0MA 2JBPA 5M51A 3HAMA 3Q9ZA 2ZV9A 4MTAA 3RP9A 3L8SA 5K5XA 4F4PA 2BHEA 5CQUA 3DFAA 4IC8A 4ACHA 1Z5MA 5TE0A 3CQEA 2IG7A 3CTJA 3MFRA 1YW2A 3RZFA 2QC6A 3LM0A 5CF4A 4TY1A 4JRNA 3D7ZA 4ZSGA 5IUIA 2YM3A 2VX1A 3K5UA 3MSSA 3RAHA 5C8KA 2R3NA 2WMSA 3N9XA 2X9EA 3O96A 1T46A 4WUNA 3SGCA 2E2BA 1YKRA 5CF8A 2PU8A 3NW7A 2BTSA 4DH8A 2UZEA 3ELJA 4DEDA 2A1AB 1KE9A 2XCKA 3MH1A 3SXRA 1GY3A 3FLWA 4TN6A 4Z55A 3PVGA 2BAQA 3GXLA 2Z7SA 1GZOA 1B38A 4M67A 1YHVA 5AA9A 5BX0A 3HDMA 3ORMA 4K8AA 5AUWA 4ANSA 1J3HA 4IWQA 2G15A 2Y4IC 3DK7A 4QNYA 4BC6A 4OW8A 3UO6A 2KULA 3GU8A 5ITAA 2HWOA 1KOBA 3R71A 4G16A 3RPVA 5J9ZA 3F6XA 2W9FB 3ACKA 3GENA 5JGAA 3QQUA 3R01A 3D9VA 1Y6AA 4FI1A 4FKQA 4TZRA 5CVHA 1Y8YA 3WI6A 3IG7A 2ZMCA 1KUTA 2Y9QA 1IASA 2O5KA 4XYFA 5IUHA 3A7GA 4D2TA 1FVTA 2X2MA 4QP9A 2CNUA 3Q2JA 3KKVA 4FK3A 4BGHA 3QQKA 2WQNA 3KFAA 1PF8A 4JRVA 4YJSA 4OTIA 3AT2A 3BLHA 4JDIA 4JOAA 4ZJVA 4AW0A 4AA0A 3QRIA 2O65A 1WBVA
chains in the Genus database with same CATH superfamily
3AXWA 4YZCA 2C0IA 4RBLA 3UMWA 1NY3A 3PJ3A 2Z7LA 5IEXA 3F88A 3F5GA 3BE9A 3AD6A 3BX5A 4JT3A 4RZVA 3VUTA 3OMVA 2PPQA 3Q9WA 3GFWA 4O0YA 3IW5A 5DEWA 3SOAA 2WMBA 4X3FB 3U6HA 3HMNA 1PMEA 3OCBA 2C0OA 3F3TA 2IWIA 3PY1A 2C5YA 4KA3A 4WG5A 4NKAA 2YHVA 4FV6A 4O0SA 1WVWA 3SXFA 1VJYA 3BWFA 2Z7RA 3W10A 5EYDA 2BKKA 1IRKA 5EKNA 2WIHA 4CLIA 2VGOA 3PY3A 1CSNA 4D5KA 4N57A 1GIHA 2O64A 3NUXA 4OTDA 4O82A 3FXXA 1OIQA 4L53A 3I7CA 4G2FA 4TYHB 5HE2A 4ASZA 3QZIA 4E6CA 3O71A 3P7CA 4QQJA 4B0GA 5GJGA 4ITJA 4CXAA 4B99A 2OSCA 1H1WA 4FIHA 1KE7A 3U87A 5CANA 4DHJA 1W98A 4GSBA 3GCVA 4ZXTA 3KQ7A 4G3DA 4YJOA 4ERWA 1SNUA 2BZHB 2R3RA 3E7OA 3O7LB 4UBAA 2XK4A 2BFXA 5D7AA 5DN3A 5JRSA 4U3YA 3ZU7A 1U46A 5HNGA 5B2KA 2WOUA 5FRIA 4BYJA 5IQEA 3COMA 3UGCA 3RPRA 5DLSA 4AW5A 4BBMA 3R7OA 3W2CA 4KBCA 4FTIA 4AFJA 2YERA 3OXZA 4OGRA 3RWPA 4GKIA 4FIEA 3DKCA 3UC3A 3GU5A 5KMNA 5IF1A 2JFLA 4F0FA 2BFYA 2UUEA 1HCKA 2XH5A 3FL5A 3UMXA 4F9CA 1APME 4DH7A 2VTSA 5EHOA 4ANBA 3SA0A 3Q6WA 3HA8A 5HO8A 1YXUA 3RI1A 1J7IA 2I0VA 4CFVA 1QPJA 2PUNA 4YJQA 4J7BA 4C4GA 3HECA 4UYNA 4O2PA 3LQ5A 3QHRA 4EHZA 5LMKA 2HXLA 2I7QA 4EEVA 2R5TA 2PYWA 2IZTA 3ZBXA 5HEZA 4R7BA 2XK8A 1FVRA 4RX5A 3EKNA 4NW6A 3G51A 3BYOA 5TR6A 4BTMA 3BU5A 4EQCA 2WMTA 2VO3A 5LWNA 4AA4A 2IW9A 5HICA 2OI4X 3OWPA 3DNEA 4FSNA 4R3RA 5FD2A 1IR3A 2WGJA 4H3QA 3QLGA 4APCA 5J79A 1G8JA 2C6KA 3MPMA 4HCTA 1XBAA 2R2PA 4FV1A 4C3FA 4I5PA 3OY3A 4YMJA 2Y0AA 5AUXA 4IVCA 5C9CA 3RM6A 3VUMA 4ZSAA 2VO7A 2Y8OA 4GVAA 2UZLA 3DXQA 3BYSA 3DFCB 1KSWA 2W1DA 3TZ7A 2BCJA 3DB8A 5CENA 1U59A 3AC3A 4FZ6A 4IB1A 4BKYA 4UB7A 2ITOA 4FSMA 2VWWA 5AIRA 1A06A 3SC1A 5IMEA 4L9IA 2F4JA 4U3ZA 4L7FA 5LVPA 3NUSA 5EI2A 4FTCA 4QDVA 4U43A 3FZRA 4KB8A 4WA9A 4YLJA 1U4DA 4LL5A 3V8SA 4GS6A 4NYEA 4O86A 3V3VA 3FBVA 5M06A 3VJNA 3PA5A 3FPMA 4PMTA 4DH3A 5ETIA 2FSOX 3R8UA 2G2IA 5LJJA 5J5SA 4EWQA 5CLPA 3QTSA 5FGKA 1QCFA 4UALA 5DRBA 3RHXA 3PSBA 5CT7A 4FVPA 5A54A 3QBNA 3IKAA 1ZZLA 3C1XA 3VBWA 5CZIA 3M1SA 1H07A 4AQCA 4DDGA 1Y57A 3EN9A 2XS0A 3BV3A 2EWAA 3CY2A 5G6VA 2ZDUA 5AIKA 5I3OA 3VNTA 3R7IA 4R7HA 4FODA 3RGFA 3OT3A 2YIQA 2HK5A 2QO9A 3PA3A 3KCKA 4IWPA 1OUYA 4EOLA 5HG9A 3II5A 4M13A 3MFTA 5K4JA 3EKKA 2UW8A 3TG1A 4ZEGA 5FWKK 4IW0A 3SHEA 3ZFMA 3QYWA 2RFNA 3OEZA 1U5RA 5D10A 2X0OA 4TWOA 4GU9A 4TTHB 3ZFXA 5L3AA 3EN4A 2VRXA 5AADA 2VO0A 5CWZA 4FE2A 5EOBA 2J4ZA 1XBCA 5CYIA 1Q8TA 4A9RA 5GHVA 3W2OA 4CEGA 4YP8A 1M52A 3V04A 4C61A 2OKRA 1AD5A 2GDOA 1I09A 3HKOA 4H3PA 4U97A 5HBEA 1OIUA 3L9NA 1J1CA 1CDKA 4D58A 3DS6A 4DFNA 2UW6A 4EJ7A 3P1AA 1G5SA 2WD1A 3ORLA 4WOVA 3IQ7A 4XG8A 4EBVA 4BF2A 2XK3A 2UZUE 5AR2A 5F1ZA 3TJCA 5CSVA 1WVYA 4JBQA 5ACKA 4QTAA 4C34A 4KUJA 1CKPA 4Y8DA 4L00A 5DEYA 4O6EA 2PVRA 1IG1A 3PWYA 1ZYDA 3BLQA 3LXKA 4K1BA 5M09A 4NW5A 4A7CA 4TXCA 3GCPA 4APPA 4LDTA 2WQOA 4FC0A 4FZFB 4HPTE 1JSUA 4EHVA 4RJ4A 4HGEA 5FP5A 4HZRA 2YM7A 3RTPA 3R21A 5J1VA 3V8WA 2XBJA 2UW5A 3Q53A 3QFVA 4A4OA 1WFCA 1RJBA 5HLPA 5DT3A 4DTKA 3A99A 4F09A 3FMDA 4PTCA 4BDAA 4C4HA 4QP8A 2XIXA 1OKZA 2OXDA 4IADA 4M97A 4ACMA 1PMVA 5EK7A 4ZZOA 3LQ3A 4OLIA 2O2UA 5AA8A 3S95A 2HOGA 3CP9A 4HYIA 5J8IA 3TXOA 2JLDA 3NNUA 4UZHA 4U41A 4ZTSA 4O7LA 3VJOA 4UWCA 5IUGA 2WU7A 3PJ8A 5GZ9A 4F7JA 5M4FA 3C5IA 3VS2A 4BN1A 3P79A 1WVXA 5HVYA 1CKJA 2ITWA 3KRRA 4ZSJA 5FTOA 1P4OA 1A48A 3DDQA 4GRBA 3Q4CA 4QP3A 4BCOA 5CEPA 3WARA 4ACGA 2B52A 1MP8A 3U9NA 4TWNA 1MQ4A 1QPEA 3F69A 4LG4A 2C6TA 2Z2WA 2XANA 5L8JA 3VBQA 4FTLA 3CGOA 4DHIB 2G1TA 3C0IA 4JR7A 2W1GA 2C6EA 3FMNA 3LLTA 4H1MA 3QTWA 4HYUA 4IAZA 4MH7A 4QMTA 5L4QA 4HYSA 1R78A 3QXPA 4Q9SA 3BYMA 3TZ9A 4BDFA 4D9UA 2C5VA 4GIHA 2VTJA 3OFMA 4JIAA 4UV0A 1BI7A 4YNEA 2F57A 3IS5A 3PFYA 2OF4A 4I3ZA 1PJKA 2LAVA 2XB7A 4ANQA 2Z7QA 4MEDA 2C6MA 2CDZA 2ERKA 1VEBA 3KN6A 4AAAA 4AWIA 3NLBA 4YJNA 4O7WA 1PKGA 2C6DA 3WIKA 4U40A 2PE0A 1UA2A 1FMKA 2ETRA 5EDQA 4CKIA 5ICPA 2WQBA 1REJA 4LGGA 2VGPA 5M4UA 3MA3A 3DV3A 4QMZA 2CGWA 4P7EA 4BFMA 3KXGA 1H1RA 4P5QA 3ZMMA 4FSWA 4C57A 2CKEA 3C4WA 3KRJA 3TUDA 4R1VA 3UC4A 3VUHA 4M3QA 4QDEA 5E1SA 5HU3A 4LOOA 4L52A 4USFA 4EK8A 1ZOGA 2GNJA 2W5BA 3QCXA 5C8MA 4YO6A 3UNKA 1CM8A 4G9RA 3G6GA 4H58A 2XNOA 4TKSA 4X2GA 4AGCA 1BYGA 3UPXA 4HVHA 1SVEA 4K18A 1W0XC 1H08A 3IDCA 2WEIA 4RIXB 1UU3A 4GT3A 5BVOA 3U6JA 3FZTA 3ULZA 3IOPA 3PXYA 3TTJA 3ROCA 4QNAA 1FQ1B 3KU2A 2CMWA 4NL0A 3D2IA 1JKLA 5CSWA 4CFXA 5CT0A 3HZTA 3UYSA 2H34A 4X3JA 2QOBA 2W1IA 4PDSA 3D5VA 5AP6A 4IWDA 2Z60A 2YA9A 4U44A 1MQBA 3REPA 2YM5A 2IZUA 4JLCA 4CRLA 4OTQA 3W2PA 4KRCA 5BVDA 4Y95A 3NUAA 5AP5A 2WTKB 3S3IA 4KABA 2B9HA 3OEFX 4O1PA 5M55A 1HOWA 4ZSEA 4IM0A 3DKGA 4WNPA 4YU2A 3LXNA 1MRVA 2WKMA 5H3QA 3VN9A 4EHEA 4DFBA 2YAKA 4KIKB 3L9MA 2XJ1A 4I94A 4JXFA 2GTNA 4QD6A 3P78A 3DU8A 4IAIA 5KE0A 4YTCA 5BNJA 3TUCA 3A2CA 2X1NA 3QU0A 4AN9A 3F5PA 4TYHA 1V0PA 2BRNA 1XMMA 3ZYAA 2C3KA 3FI4A 3FLYA 4G34A 3VQHA 4DEHA 5TT7A 3MWUA 1NVSA 3LFSA 3QD0A 2OF2A 3AGMA 3ZONA 5IQIA 4U80A 3FSKA 4YPDA 3W0OA 5KMMA 1J7UA 2E9OA 5DIAA 4D4YA 4QYYA 3GU4A 4TYJA 3C51A 4LI5A 5K0KA 5KHWA 3EYGA 3G90X 4MXAA 3U8WA 3T9IA 3G9NA 2CLQA 3LFAA 1PRYA 3E92A 4DAWA 4D2RA 4DEAA 4CD0A 5E91A 2X4ZA 2OIBA 3B2WA 4QMYA 3VONA 4M12A 2X7GA 3DT1A 3F3WA 4J52A 1FOTA 4J8MA 2R3QA 3CY3A 4IXPA 3LFFA 5BVEA 4BDHA 3F2RA 4M69B 2XJ0A 3B8RA 5E8UA 3R1QA 4C3PA 4RQKA 2EUFB 4X3FC 4MX9A 4CFNA 2R3HA 5BUEA 4DHZA 3DZQA 4EOMA 3LMIA 2G01A 4TW9A 4O4CA 3RMFA 4AZFA 3JR1A 2H96A 2JIIA 4FTTA 4RRVA 5FBOA 4MBIA 2X2KA 4I20A 4V0GA 1PYEA 5I5ZA 4L3LA 3NCGA 4NKSA 1LEWA 2V22A 4ITHA 3GQLA 1HCLA 3KRXA 3FYJX 3R1SA 4R5YA 4G5PA 1KOAA 4W4WA 5DR2A 3GC9A 3QHWA 3SW4A 2CN8A 3DA6A 4FOCA 1JVPP 3UP7A 3IW7A 2HELA 4BWPA 2V0DA 3WIGA 2WTVA 2A4LA 4I23A 2XYNA 2RF9A 3QGYA 4IBMA 5EW3A 5GZ8A 4GFGA 5KBQA 1YDTE 4S34A 3CPCA 4OTHA 3VBTA 2JDVA 4HJOA 4HCVA 3H3CA 1NVRA 2XKFA 3UJGA 3ZEPA 4DTBA 4JL9A 3VBVA 2NNWB 3PLAE 4M14A 2PY3A 4ARKA 2YISA 2ITPA 3TT0A 4YTIA 2W9ZB 2YJSA 2CNVA 4WRSA 1BKXA 3RM7A 2WELA 3PJ2A 3DQXA 4YC6A 4D5HA 4LV5A 4DFXE 4QOXA 3E8EA 3FZOA 4J71A 2XF0A 3W18A 5HBJA 2PL0A 1IEPA 3IK3A 3L9LA 2ZM1A 5AP1A 2PMOX 3C4EA 4DEGA 3LFNA 4KBKA 3S1HA 4AFEA 2PUPA 2HIWA 3PWDA 3PPJA 3W2QA 4ALVA 1A9UA 1OBGA 2PE2A 3MDYA 2F7ZE 3MTFA 4A9TA 4AS0A 5CEOA 4DEIA 3LFBA 2CKPA 3NYVA 3U51A 3MTLA 5HG5A 3CD3A 3IECA 4ZMEA 4JJRA 4ZZNA 2BIYA 2JITA 4O96A 3MVMA 4IMYA 4QPSA 3KRLA 3S2PA 3ALNA 3LVPA 2VTMA 3MB7A 5L6WL 2XIRA 3DTCA 2C0TA 3GC0A 3KCFA 4IFCA 2YABA 4C37A 2GNHA 4TRLA 5L8LA 5I4NA 4FKRA 3C9WA 3ZLYA 3EIDA 1GIJA 3RK7A 4CTBA 3PUFC 5EYCA 4R77A 3R1YA 3G33A 3UIMA 5C26A 3UE4A 2QQ7A 3Q60A 5HIEA 3ACJA 5J9YA 5T68A 1V0OA 3AQVA 3HUBA 4Z9LA 1M14A 3TCPA 2CN5A 1XJDA 2HAKA 4FSRA 4RIWA 4WBOA 3V5TA 3Q5IA 4XG7A 3MI9A 1G3NA 2C6LA 5KZIA 3BWJA 1WBOA 5I9WA 3WZDA 2XALA 2XARA 2GU8A 3Q3BA 3PG3A 2XNMA 3IW6A 5DG5A 4BBEA 4D0WA 4NIFA 3KREA 4E5WA 4A9UA 3VS4A 1XBBA 3DLSA 4H36A 4G31A 4I0TA 4KIPA 3ZO2A 4Z3VA 4PX6A 5CF5A 3LMGA 1QPDA 1XH4A 4RC2A 5ETCA 4ONAA 4DG3E 2R3MA 4FSUA 1GJOA 1PXMA 5FTQA 2VTQA 4K6ZA 2AC3A 2ZB1A 4CCUA 4EUUA 4YSJA 4C2VA 2XUUA 4MHAA 1OPKA 4R3PA 4BJJA 3SDJA 4Q9ZA 2WTIA 2YM6A 4GFOA 4K2RA 1Q99A 4C2WA 2GHLA 3GB2A 4IFGA 3EZRA 3UIXA 3VHKA 2H6DA 3F82A 3LOKA 5FBNC 3T8OA 4E5AX 3P08A 4XUFA 5K4IA 2QONA 3E93A 1H8FA 4ZY6A 4XMOA 4FV4A 4QTBA 1Q24A 2GPHA 4WO5A 1J91A 3UQCA 1Z57A 5HORA 4UZDA 3D7TA 3E64A 3LLAA 1W8CA 1AGWA 3MY1A 3S0OA 4CV8A 3R02A 3BBWA 3NIEA 4IJPA 4USDA 4EOIA 3SG8A 2OO8X 4B7TA 3ZM9A 2CKQA 5EFQA 1SMHA 2ZV7A 4WG3A 3ZOSA 5HX6A 4Q2AA 2R3GA 3HRCA 3IOKA 2XIYA 1H27A 3POOA 4Z16A 2QR8A 2WMWA 1O6LA 5AV1A 1Q4LA 3C4ZA 4KSQA 2J5FA 3CCNA 2IEWA 2C1BA 2ZB0A 2PK9A 4H1JA 4OT5A 3TYKA 4OR5A 1KE6A 4WRGA 5EOLA 5C8NA 5JGBA 3RAKA 4XG2A 2UVYA 4XS2A 5AUUA 2QD9A 2WMRA 3DJ5A 3VS7A 3BHVA 4BJJB 4QMUA 2QG5A 4DDIA 3T9TA 4QMWA 3AT4A 3Q52A 1S9JA 5F20A 4BDJA 2CCIA 4F08A 2YDJA 1OL5A 2Y7JA 4M0YA 3EOCA 3W32A 5CAQA 2J0KA 5A4CA 4FV7A 3GU7A 3VC4A 4AT3A 4BCFA 4OBPA 3RAIA 2I0EA 2J0MB 3VF8A 4F6WA 2VTNA 1PYXA 4XBUA 4CT1A 5BPYA 3AC1A 2AYPA 2J9MA 3SAYA 3FI8A 1SM2A 2RG6A 4GIIA 2GTMA 3N4TA 2J0JA 1YOJA 3AC8A 4RFYA 3MH2A 4I6FA 1SVHA 4I41A 3UDZA 2BRGA 3QD3A 4GL9A 4C02A 1JBPE 3PPKA 2GFCA 4L45A 1JAMA 4QYGA 2YITA 4O91A 2W06A 1UVRA 4XP0A 3BKBA 3QZFA 4D1ZA 3TKUA 3NR9A 5F94A 3EH9A 4EL9A 1S9IA 5BVKA 5LARA 2W7XA 3EHAA 1OKVA 2JDTA 5HX8A 4FEXA 5AR7A 3GCQA 3PXFA 3RKBA 3POZA 2HW6A 2KTYA 1F5QA 1Q61A 4U81A 5TKDA 2HY81 5E8TA 4E93A 3D7TB 3ITZA 1LP4A 3MN3A 3AMAA 4FNZA 3VRZA 4WBBB 4EZ7A 2W4OA 2IN6A 3FMEA 3CR0A 4CKJA 1JSTA 3VS1A 4EHGA 2ZFYA 2XNEA 4QMPA 5EYKA 4PDPA 1E1VA 4RX7A 2XK7A 5CNNA 3SLSA 4CKRA 1ZWSA 3SW7A 3CQUA 2BRHA 3DBEA 3A8XA 2V62A 3LCDA 5ANEA 3NSZA 4LUEA 5I9XA 3NEWA 4FRFA 3DY7A 3PE2A 3W55A 3S4QA 3I7BA 3RPYA 2QOHA 3MJ2A 4AT5A 4IAKA 2YIXA 2W0JA 2PVFA 1W83A 1ZLTA 3H9FA 4Y5HA 4AE6A 4DT9A 2JIVA 4AGWA 4XG3A 4EORA 3LCTA 2UW0A 4JBOA 4FTJA 3QCYA 2I0YA 3G0FA 3OTUA 3MPAA 4B4LA 3OD6X 2C5NA 3I81A 3HMPA 3MA6A 4FG7A 4QP4A 4MCVA 4IM2A 1WMKA 2PVHA 2P55A 3RZBA 4AQKA 3VS3A 2UZOA 4IAYA 5DR9A 4RFZA 4C35A 1NW1A 2JKQA 4NM3A 5AMNA 3M11A 4QPAA 4CG9A 4FA2A 2VWUA 2UW3A 3QTUA 2XIZA 3NYOA 4UN0C 4IB3A 3V5LA 5A3XA 5AR4A 4CMTA 2PZIA 3G5DA 4RQVA 3R9RA 4DCAA 2HENA 4YZBA 3DAKA 4X3FA 1JPAA 4HCUA 4J95A 3RK9A 4V01A 3WF8A 4FUYA 4WSQA 2Z8CA 3G6HA 4FSZA 4EOOA 3I0OA 4X2JA 2OIDA 2X0QA 3ATSA 2R0UA 4RWJA 1TKIA 3N4UA 3CE3A 4FSQA 4FG9A 3R7VA 4F9AA 4IJ9A 2XIKA 5ETAA 2PVYA 4ASXA 2VWYA 4BKZA 1XWSA 4O4BB 4GG5A 2FGIA 3MY5A 4S32A 2ONLA 1YWVA 4EI4A 1XH5A 5HESA 5HTBA 1SYKA 3NYNA 4F65A 4FKOA 5M4IA 1XKKA 3O51A 2ZOQA 5I3RA 1GNGA 4G5JA 2WTKC 5KKRB 2PZPA 1ZMVA 3SG9A 3DLZA 1BX6A 3I6UA 4QO9A 3WZJA 3QTXA 2C1AA 3IDBA 1WAKA 4FT7A 4FV0A 5AV3A 5C27A 4EOPA 1H1SA 3FI2A 4OTRA 5F4NA 4D1SA 3MIYA 3F5UA 4MK0A 1GIIA 4D55A 4YTHA 4CYJA 1Q8YA 3BU6A 5BVNA 4FEUA 5EQPA 3MFSA 5AM7A 4E7WA 2W1EA 1W2CA 2EXMA 3OY1A 2XYUA 3TKHA 2UZWE 4RG0A 4EH4A 2RFEA 4IX5A 4YJVA 2BPMA 3A4PA 4O7NA 2VTAA 3WF7A 3DKOA 3LCKA 4JBVA 5HD4A 2O0UA 3HL7A 4FTKA 3ZC5A 4XV3A 3KMUA 4IVDA 3CS9A 4C62A 2GQGA 3ORZA 2UZDA 3RNIA 4BHZA 4BIEA 5CAPA 1VYWA 1ATPE 5CAVA 1ST4A 4N0SA 3QA0A 4C7TA 1YI3A 4RWLA 2W99B 5EW9A 2YCFA 3PRIA 4I6BA 3OWLA 3PE1A 3Q9YA 3OHTA 4YZ9A 3R9HA 3TNIA 4FF8A 1YDRE 5A6NA 1M17A 4U45A 5L2TA 4AOJA 5CAUA 4OBQA 3NDMA 4QP6A 4BCQA 4W8EA 4FTQA 3M42A 5EH0A 3GEQA 4GV1A 4XLIA 4CZTA 4FTUA 2VWBA 3HP5A 1H01A 4BR3A 1OL2A 2OJ9A 1CTPE 2WMAA 4HVDA 5HQ0A 3ZDUA 1H24A 3DAJA 4O0TA 4FKPA 1H28A 1F3MC 3ZHPC 1J7LA 4A06A 2ITQA 4FZ7A 3BEAA 3FDNA 4QYEA 2JEDA 1Q8ZA 4AZWA 2BTRA 4LUDA 3KXNA 4YUQA 4E73A 4UMPA 5I0BA 4MVFA 3I1AA 4K0YA 3ZLWA 3FLQA 4JS8A 2OICA 4LV7A 3O0GA 4QMNA 1GAGA 4L46A 4YURA 2W5AA 4FNWA 4NZWB 1NA7A 4YZDA 1LUFA 5AR8A 5LMAA 1BMKA 2WIPA 5IA3A 1REKA 4IM3A 5E8SA 1YWRA 3KXZA 3E5AA 5H8EA 2BZIB 4RX9A 3EFLA 4FKJA 2C3LA 4FIFA 4BZDA 5CNOA 4ZS0A 1YXTA 3GI3A 4HOKA 4D2PA 5FXRA 2F2UA 1UKHA 2XKCA 3D2KA 2QOCA 3KC3A 5CU6A 3HEGA 4JDJA 5K0XA 3GU6A 5B0XA 3V5JA 4ZS4A 3QXOA 5JGDA 3JVSA 3MYGA 3PDTA 2GNFA 3E63A 3ZCLA 3ZUVA 4ACCA 2HZIA 4L68A 4O2ZA 4WNMA 5JH6A 3I5NA 4BGQA 4MD8E 3AD4A 4YHFA 2FSLX 4CTCA 2FYSA 4O0VA 3IPHA 4RIWB 2X2LA 4XLVA 3W8LA 4KS8A 1EH4A 2GMXA 2XKDA 4JDHA 4LMNA 3W1FA 3QRTA 4BCMA 4A9SA 4RLLA 5KHXA 5IA1A 4N4SA 3A61A 4BI0A 3KGAA 4IAAA 2WB8A 3BGZA 2VWVA 2QHNA 4GUBA 4LRJA 1DAWA 2ONLC 1OPJA 5ANIA 2CHLA 3GC8A 3R6XA 4CG8A 2X4FA 5C1QB 5FTGA 1YDSE 3K54A 3NIZA 3QTZA 3OXTA 4H05A 4TWPA 3FUPA 3W0SA 1WBWA 5KUPA 4E6DA 4ZLOA 3ORNA 4NJ3A 3O7LD 2UZVA 3ZRMA 4OAVB 3KY2A 4GK4A 3ORTA 4EQUA 1ST0A 2B0QA 3W0QA 3HV5A 3HRBA 3LKMA 4D1XA 4E1ZA 3O23A 2VNYA 3ANQA 3ZUUA 4KD1A 2W96B 2UW9A 3R63A 3V51A 4NFNA 5FEQA 4YO4A 4BWKA 3NAXA 2PVJA 2PMLX 2VTLA 3RJCA 4LQMA 5HVJA 2R4BA 3GNIB 4IX6A 4XP3A 5TOZA 4I93A 2RKUA 4M7IA 3WZUA 4CFFA 4G6NA 4JIKA 3BLRA 4RC4A 4D0XA 2OJJA 3NUNA 2JIUA 4F7NA 1OUKA 1UWHA 1K9AA 3TDVA 3Q96A 3VBYA 2R3IA 2VD5A 3VW8A 2YM8A 4M15A 3R0TA 4DFZE 2ITUA 4E20A 2ITTA 4CMOA 3DK3A 3UZTA 4D4VA 3QX2A 3ZRKA 2ZYBA 4RIXA 4AXAA 3D5UA 5K5NA 1QPCA 2J7TA 4D28A 4NK9A 3HV4A 1TQIA 1OMWA 4DGNA 1KE8A 2PWLA 2QOLA 3F3UA 2R9SA 4Z7GA 3V8TA 3R2BA 5DMZA 4FIGA 3TUBA 4D9TA 3OS3A 4GCJA 1XQZA 2YCSA 5CEQA 4U7ZA 3TI1A 4AN3A 5E90A 3SRVB 4AXDA 3VHEA 3O50A 2R64A 1F0QA 4EKLA 4FBXA 4O7RA 3ZEWA 3OC1A 4PNIA 4QP7A 5AM6A 1GOLA 1SNXA 4EC9A 1GZNA 3LAUA 3PFQA 2XNBA 3QZHA 3W0RA 2X6EA 2YIRA 3R2YA 1DI8A 1Z9XA 4X2NA 5EQYA 4IIRA 1UNHA 3F2AA 3GCUA 4KKHA 4U79A 2XRUA 4LRKA 1KWPA 4ZTHA 4J8NA 4ALWA 2XNGA 4MF0A 3OUKA 4D2SA 2VTPA 4BL1A 3FHRA 4XG9A 3M2WA 3Q04A 2V7AA 2AQXA 5JSMA 3I4BA 3DB6A 5M44A 4FKVA 4J53A 5FXSA 4BCPA 4DLIA 5HCZA 4CMUA 4MNFA 5EW8A 2W1HA 1FMOE 3TDWA 1QMZA 3K3JA 3NZ0A 1NXKA 4KWPA 1PXKA 3FI3A 5CY3A 2X8EA 3H4JA 1MRYA 3LQ8A 3Q5ZA 1TZDA 4G3EA 4JR3A 4KBAA 5CX9A 1IA8A 1U5QA 4WSYA 1WBNA 5A46A 5CEMA 5IISA 4QMLA 5HD7A 4YJUA 1STCE 4I4FA 4FSYA 4RVKA 4AA5A 3NGAA 2WFYA 3QKKA 2W1FA 5E92A 5AP3A 2AEGA 2R3KA 3G15A 4R78A 5M08A 5AJQA 2W5HA 3U55A 2IZSA 5FEEA 3WE8A 1O9UA 3EN6A 1XH7A 3KMMA 4YC3A 3C50A 2OH0E 1I44A 3PZEA 4PP7A 4FR4A 2J0LA 3NW6A 2QU6A 3WBLA 4I0RA 2WTJA 5CQWA 5HBHA 3C4CA 2B54A 3E62A 4F6SA 3NPCA 2HZNA 5HCXA 4FYNA 3PA4A 3NYXA 4UX9A 4E4XA 3CQWA 5J7HA 4GUEA 5BVFA 3SX9A 3EMGA 5LVLA 2QO7A 2RSVA 4HZSA 2B9JA 2QOIA 2YACA 3V6SA 4IB0A 3ZO1A 4HNIA 4YBJA 3D0EA 4MD9E 3DKFA 3FMMA 3DPKA 3DBCA 2F9GA 1MUOA 4YPSA 1B6CB 4RC3A 4BVUA 2VN9A 2B1PA 5E8WA 3TEIA 5IU2A 3AT3A 5DT0A 4MAOA 2WHBA 3FY0A 3R83A 1P5EA 4CQEA 5BMSA 3ORPA 3T3UA 4DA5A 2X0PA 4BYIA 2WMQA 5B7VA 1ZMUA 2E9NA 3KN5A 3D14A 5CXHA 1XO2B 3F5XA 4DN5A 3PVWA 4M69A 2ITYA 4HGTA 1OI9A 2ITXA 1P2AA 3QWKA 3TNPC 4OTGA 1O6YA 5HZNA 3PVBA 3I79A 1W2DA 1O6KA 3SV0A 4O83A 3DBDA 5JFSA 1OVEA 1R0PA 2A27A 5J1WA 4PTEA 1Q41A 3COKA 2OFVA 4WUAA 3UYTA 4DH5A 4S30A 2XRWA 5IPJA 4L3PA 3QQGA 2ITVA 1PXOA 4FKIA 4I6LA 1YXVA 5FEDA 2WNTA 4DCEA 3KXXA 4MD7E 4D2WA 5KCVA 5L6OA 3FQHA 4L42A 4UEUA 4AW2A 4USEA 5EG3A 4QMVA 1FBNA 4LOPA 2WMUA 3QZGA 2IVVA 2GQRA 3BI6A 2CPKE 4PL4A 4RPVA 4EJNA 3RAWA 1RDQE 5M07A 4R3CA 3UIUA