4E5BA

Structure of p38a map kinase without bog
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
324
Chain Sequence
ERPTFYRQELKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Lipid Molecules Induce p38 alpha Activation via a Novel Molecular Switch.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 324
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e5bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e5bA01
1JVPP 4LV8A 3M1SA 1R39A 3UYSA 5AEPA 4NYEA 4FV1A 2GCDA 5HIBA 5D11A 4QYYA 3D2KA 3LXLA 4Y5QA 5GIOE 3NWWA 1H00A 2ZM1A 3DS6A 5AR4A 1REJA 4HYSA 2OICA 4D2VA 3NRMA 2C0TA 4JI9A 4R7HA 4HVSA 3LMIA 4DF3A 5E8ZA 4FTRA 2QQ7A 3QD2B 2F7XE 5BMSA 2OZAA 3OWPA 3ANRA 2XIXA 4PDSA 3ORNA 4ALWA 4D55A 4D1XA 3KXHA 3E87A 3R8LA 5DLSA 4RWIA 3WF6A 3UG2A 4O0UA 5HU9A 3QF9A 1MRVA 4C62A 4NW5A 3KC3A 3DK3A 5FG8A 3QCQA 2VO0A 4EOQA 3ZONA 2FSOX 4BKJA 5IA3A 4Q9ZA 3DXQA 2F7ZE 3L8PA 3IO7A 3CD3A 4L01A 2JDSA 3HRCA 4U5JA 5CEPA 3BLHA 4PMTA 4QQTA 4ZAUA 1GY3A 2XJ0A 4BI2A 3GU7A 3RP9A 4ZMFA 4E4MA 4YSMA 4ZK5A 3K2LA 5DBXA 2YM7A 4IB1A 3RK9A 4RLLA 4R7BA 3ULIA 4O0YA 1BMKA 4XCUA 1XH8A 1ZMWA 4IB5A 1H0WA 5J1VA 4QMXA 3ZH8A 3C50A 3CQWA 1U59A 5M4CA 4RG0A 5HICA 3RK7A 5KBQA 5AUZA 1F5QA 3PG1A 4MCVA 4ZLZA 1FBNA 2WMXA 4CMUA 1PXJA 3BCEA 1PMEA 4YJNA 5IEVA 3SA0A 3LXPA 3R22A 3UJGA 3F5XA 3UIBA 3DKCA 4FTAA 4IJPA 4L45A 3C7QA 3PJ3A 1RJBA 4E3CA 4L9IA 3D7ZA 3L1SA 3OCTA 4FR4A 4ARKA 2WTKB 2PMOX 3QX2A 1YDTE 2LGCA 4PMPA 5HE1A 5JN2A 1OITA 3MH1A 2A4LA 4BICA 2BRMA 3GQLA 1WCCA 1PXIA 5AA8A 4PL4A 1S9JA 4OLIA 4KRCA 3EFWA 4DGGA 1YOMA 4H05A 1CSNA 3SG8A 3WARA 4U44A 2WTVA 2XEZA 3EN7A 3LJ0A 3GC9A 1L3RE 4QMLA 4TN6A 3GB2A 2PY3A 3EYGA 1YOJA 2GQGA 4HYIA 2XM8A 4IFGA 2YM6A 4MBIA 3TIYA 3VULA 4DN5A 3MA3A 4DEEA 5FP5A 3S3IA 3L9MA 4QQ5A 3B8QA 4C2WA 5T6KA 3C4EA 3NNUA 4EH8A 4F08A 3NCGA 4MBLA 3G0EA 4YC3A 3H0ZA 1K2PA 4DG3E 5JT2A 3LFAA 3MV5A 4XV9A 4YNEA 3RAKA 3Q4ZA 4CLIA 2PWLA 4FT5A 1JAMA 2QKRA 4QP4A 4ASEA 4CKIA 3GVUA 3R63A 5EYMA 4J96A 3OCGA 2GHMA 4QRCA 3F7WA 4IHPA 4W9WA 2X39A 2PVLA 1MP8A 4ZSEA 1X8BA 2WQEA 2WMVA 4FSNA 4JG7A 5FEDA 2CDZA 4M84A 2H6DA 5FM2A 4HVGA 4PUZA 1IAJA 3VUGA 5CU4A 5BVWA 2OK1A 1GIJA 2R3PA 4V01A 5CF5A 5TO8A 4X2GA 2HENA 4FTUA 3QX4A 5CASA 3P7CA 4IE9A 1W98A 4OUCA 3C4XA 3IOKA 4G6OA 4KUJA 3CTHA 2HWOA 4JRVA 4XYFA 1M7NA 3Q3BA 3D4QA 4KSQA 2BRBA 3QQKA 3ZUUA 2PPQA 1KV2A 2QG7A 4IADA 4YJQA 4FEXA 2KULA 2W99B 4O96A 1DI8A 5DVRA 5J5TA 5CU2A 3C5IA 4F70A 3ZBXA 3NZ0A 2A2AA 5KX8A 5ANJA 4OT5A 5AMNA 3PSCA 4FC0A 4ZZOA 5D7AA 2QOCA 5AUTA 1R3CA 4FSTA 4F0IA 3BYVA 4E26A 2BRGA 4FTMA 5IA2A 3D5VA 2QOKA 5FBNC 4JQ7A 3H4JA 1XKKA 2ZV7A 4PRJA 4O7ZA 4WRSA 5L3AA 1M17A 5ITAA 5L2SA 4QMSA 3W2QA 4XNEA 4U81A 3FZTA 3KRRA 1XWSA 4G9CA 3RPSA 2C6MA 4E4NA 3BX5A 4EQMA 5K4JA 4JBQA 5L2TA 3QUPA 4YZ9A 5AJQA 4AZEA 2RL5A 5EI8A 4F0GA 4W4XA 4AACA 3PA4A 5EM5A 5KHXA 3N51A 3QFVA 4MNFA 5A46A 1WBTA 4AUAA 2HK5A 3P7AA 2VWXA 1VR2A 4BB4A 4EK5A 2QHNA 4JVGA 1WZYA 3QC9A 3R2BA 1KE8A 2RIOA 4QQCA 4IB0A 2B54A 4DGOA 3PVUA 2C6KA 4BHNA 1J7UA 3M11A 4IB3A 3DJ6A 5HTIA 3QGYA 4YZDA 5HIDA 4ANQA 2PVRA 2ITWA 5GJFA 4DA5A 5F9EA 3DBCA 5A6NA 4AZWA 3M42A 4FL2A 3NYXA 3L8SA 3W8QA 3LQ8A 2X4ZA 1Q24A 4ITJA 1Y57A 3SLSA 4E5WA 2PVJA 3TNWA 2C6EA 1OPLA 4Z16A 1G3NA 4RX9A 4PNIA 4J97A 4TNBA 4FICA 4EOSA 5JFWA 3LAUA 3ZYAA 1CTPE 4EI4A 3GC0A 3V8SA 3FBVA 5FTGA 3PXQA 4NJDA 4YNOA 4YHJA 3OWLA 4A7CA 2X8EA 4FKIA 4FV3A 3BQCA 3DJ7A 1LR4A 1XQZA 5CAOA 2FYSA 1K9AA 3KREA 5A9UA 4DH1A 4L6QA 5HD7A 4EYMA 3F9NA 4TWPA 3TV7A 2GMXA 2YAAA 3G6HA 4CNHA 3G0FA 2JAMA 4IM2A 3GP0A 2OF4A 4HOKA 1GZNA 5DR9A 3LE6A 3ZZWA 4E1ZA 3KL8A 1JBPE 3O17A 5M44A 1Q8YA 1LUFA 2VWIA 2JIUA 4RIYA 3ZHPC 5DI1A 3RHXA 2BAQA 2PZRA 4I24A 4O91A 5AAGA 2V7OA 4RC4A 5IA1A 4IANA 4C59A 2VNWA 4H58A 3V6SA 5LVMA 2IW9A 1RDQE 3PYYA 3EQCA 5EM8A 4YTCA 4V05A 4JAJA 4F63A 3A2CA 4RQKA 3QZHA 4A9RA 4XX9A 3CCNA 4XJ0A 5HVKA 3KRXA 4ZY6A 3F3VA 1GZKA 1H01A 3EQGA 4GG5A 3R30A 5AR8A 5C27A 2WIHA 4AXAA 4DFZE 2GHGA 5KKRB 5I9WA 2OO8X 4XG3A 4G6LA 4BCIA 4XG2A 4GKHA 2XF0A 4ANLA 4BRXA 3ORLA 2VTNA 1H08A 3QTQA 3TACA 1OGUA 4JQ8A 4C4HA 1DM2A 1PXKA 2WAJA 2X0GA 4RJ8A 4YBJA 1OIQA 3NDMA 5HG7A 3NUAA 4YMJA 3FQSA 4FTQA 5AV4A 3UOLA 5M09A 4LMNA 1ZARA 4J71A 5K0KA 4EHVA 1YHVA 4Y72A 2BDJA 2XBAA 4TYHB 4I6QA 5C4KA 2Z7LA 4BTJA 4YZMA 4EHZA 3QD4A 4K2RA 3EH9A 2WTIA 5IMEA 3KCFA 4PL5A 5H3QA 5GZAA 5LVLA 3V5TA 1UA2A 4QPAA 4IC8A 4CYIA 4RWJA 4D1ZA 5TT7A 4ZMEA 1H24A 2PMNX 5D10A 3AMAA 3RCDA 4GJ2A 4GKIA 3ZBFA 2ITUA 1TQIA 3COHA 4JG8A 5DIAA 2WTCA 4ASXA 3S1HA 3FZRA 1OZ1A 3DOGA 3FLZA 3PP0A 3Q60A 1Z5MA 4S34A 3MFRA 2XM9A 1J91A 4YR8A 4F7JA 4L42A 1PMVA 2I0VA 4YJTA 4O0WA 5IQCA 4P5ZA 4GW8A 4U45A 4D9UA 5K9IA 4QTBA 3R02A 5BVKA 3CBLA 3ZXTA 3P86A 2AUHA 2PVFA 4I5HA 2DQ7X 5DT3A 4K6ZA 5CX9A 3D5XA 2IZRA 3LFCA 4IDTA 2WPAA 3DXPA 4NTTA 1Y6BA 2W9ZB 4I6BA 4F9BA 1OPKA 3R71A 3LOKA 3BEGA 3DQWA 4IAAA 4YZCA 5E8YA 5HO8A 4QMQA 2R3GA 3U4UA 2X2KA 4G3DA 4G34A 2XCHA 2BKZA 1W7HA 4XV2A 3WF9A 3SW7A 4TT7A 2FSMX 2RFNA 4LRJA 3SAYA 2X7OA 3OVVA 5D9HA 4RFZA 2YWVA 2C0OA 3SX9A 1NVSA 2BILB 1YRPA 2IW8A 3U54A 3R8PA 3BHYA 2QKWB 3Q5ZA 3ZSHA 4YUQA 4KRDA 3HRBA 4O86A 5E8TA 4YTIA 4UY9A 4BWKA 1PXOA 3EN4A 2ZMCA 3FQHA 2WEVA 3FDNA 5I5ZA 2EUFB 5HG8A 4CCBA 5JQ8A 2QO2A 4ZZNA 3IS5A 1SMHA 5KMIA 2G9XA 2XH5A 1JLUE 2A19B 5CSXA 1B6CB 2XNOA 3HMIA 2PUUA 4UWCA 4G6NA 2X9FA 4E6AA 4MK0A 4KIKA 3IPHA 4Z9LA 4X7QA 4JX3A 5J5SA 5KZ0A 3VQUA 1R1WA 4I23A 2R3LA 4L8MA 4XLVA 4B99A 2E9VA 2R3KA 1YWVA 4TYEA 4R7IA 5F1ZA 1ZRZA 5TOZA 5BX0A 5IZFA 2NP8A 3REPA 3C4CA 1DAWA 3KK9A 3QTWA 4LRMA 2YITA 2YIQA 1J3HA 3DBEA 2UW6A 4NH1A 3HV4A 3QTSA 1OL2A 1JKKA 4FKPA 4XP0A 4OTFA 2XRUA 3AD5A 3H9RA 4U42A 5E1SA 4ZTRA 2YDJA 1U4DA 3EN9A 4QPSA 4NTSA 3RI1A 3TZMA 2ZB0A 2IPXA 3N4VA 4GT4A 3OMVA 3KMUA 4MYGA 5HLPA 4NUSA 4AW2A 4UX9A 4R77A 4WNPA 3UIUA 3P4KA 4U6RA 4ZY5A 1H1RA 4AZVA 3NNXA 3ACJA 4Q5EA 3W2SA 5A6OA 4AW1A 2GQSA 1MRUA 2I6LA 3KGAA 3A60A 4XG8A 1WBWA 4GT3A 4KA3A 4RVMA 5FM3A 2LAVA 4E4XA 4KKEA 4WRGA 3G90X 4OTDA 3Q04A 2FSLX 5DOSA 4ZLYA 4BDHA 2IJMA 5HTBA 3EOCA 3DU8A 3PZHA 4ACMA 2JKQA 4BTFA 5BVEA 3A7GA 3HP2A 3VUHA 2B1PA 3LHJA 2C5NA 2CGXA 5AUVA 1FGIA 4TWCA 3F5GA 4JL9A 2UW5A 4X2NA 1Q99A 1ZYSA 1OECA 4CMTA 2G15A 3ZOSA 4E73A 5BVDA 1NVRA 2OZAB 4I1ZA 4O2PA 3MN3A 1ZWSA 4TZRA 3QTIA 4BDCA 4FZAB 2W06A 4RJ7A 4BCMA 5M08A 1QPCA 1UNGA 2IVSA 3DK7A 4PF4A 4WBBB 2GNIA 3G33A 5FRIA 2PMIA 4TPTA 5AAEA 5IH6A 4C3FA 2CN5A 5AADA 5CAVA 1P4FA 3BGQA 5EHLA 4EZ5A 3L8VA 2R4BA 3PRFA 4O0TA 3FXWA 3ZXZA 4D9TA 5EHYA 2VO6A 1PF8A 4FT0A 1PMNA 3OTVA 3MFTA 3UVQA 2YM5A 4NM0A 1WAKA 2QOLA 2X6DA 4KIOA 5B0XA 3P79A 3TJCA 5LWMA 3PXFA 5HBJA 2VX3A 3EFLA 3FJQE 3NUNA 3ET7A 4O7WA 3HNGA 1RQQA 2YHVA 4JDIA 1GZ8A 2W9FB 3GOKA 3NYOA 3F5UA 4ZIMA 2PE1A 3BGZA 4YJOA 4R78A 1S9IA 2YEXA 2QI8A 2Z7QA 2PL0A 3DBQA 4LGDA 3R9DA 3ZM4A 4PV0A 5G1XA 3R1YA 4LUDA 3JY9A 2JDRA 3RVGA 1HCLA 4ORKA 1W82A 3UVPA 1OUYA 2E2BA 3AOXA 4N4SA 3RJCA 3BYSA 5M57A 1GJOA 3UOJA 4XRLA 1OVEA 4M0ZA 5CAPA 2Q83A 2WTKC 5E9EA 2QOIA 2XYNA 3ROCA 2V7AA 4DHFA 4UMUA 3KEXA 3QWKA 4RC2A 4GG7A 1OI9A 3TUDA 5J9ZA 5JZJA 5DH3A 1XH7A 3I1AA 3R7OA 3OP5A 4GRBA 3V5QA 4EK8A 5L8JA 3BV3A 4ZSAA 3PFQA 4HCTA 1WBVA 1UKIA 2HZIA 2VTIA 3DZOA 4O0SA 4Y46A 3JR1A 3AC8A 5AP2A 1MRYA 3HA6A 5CT0A 4FI1A 4C57A 5IUGA 3FL4A 3MIYA 2X7GA 2FVDA 3DAJA 3MS9A 3VS5A 5FDXA 5CU0A 2WHBA 5AR3A 4ZLOA 2UZTA 5E8UA 5TKDA 3F2RA 1OKYA 1OB3A 3QRJA 2BALA 3VUTA 4HZSA 3UODA 4U41A 2BDFA 4FIFA 5FTQA 4EKKA 4O7SA 2Y9QA 1ZY5A 5CI6A 2GNHA 4FTIA 4J99A 3QRTA 3WILA 2VWYA 4BCQA 3QUEA 5M4UA 3GU6A 3LFQA 4J1RA 5D7VA 4J8NA 4BTKA 3TDWA 3P08A 1XH6A 4D28A 4ZSGA 5ANIA 2QG5A 3T9IA 3RZFA 4ASDA 2PVMA 4YHFA 4E6QA 3TCPA 1VYZA 4YZNA 1FOTA 4OTWA 4I5PA 2YIWA 3C0HA 3EN5A 4IX4A 1FPUA 5L2IA 3WZKA 3FEGA 2ZDUA 3RNIA 3ZRMA 2CNVA 4JX7A 5EYCA 3QRKA 3JYAA 2O2UA 5FXSA 3UMWA 3FWQA 4RMZA 5AUUA 5LVOA 1G8AA 1H26A 3DZQA 4IQ6A 3GOPA 4YJUA 1T46A 2BZJA 2QONA 3R04A 4EJNA 2CKOA 4OTQA 4AOJA 2HXQA 2JIIA 1U54A 2NRUA 4RSSA 4OTRA 3TNIA 4AFEA 4F99A 3IDBA 4O7LA 4G3EA 1AD5A 4FT9A 4JNWA 5GHVA 2QURA 1XH5A 3U87A 4O22A 4DH7A 4IX5A 2F9GA 5HU3A 4JRNA 4OTHA 2BZHB 3D0EA 4M69A 3ORPA 3FMEA 2E9UA 4YJSA 4MXZA 1OM1A 3FY2A 1P5EA 2G2IA 2DYLA 4CT2A 3PXZA 5C01A 1XHAA 3UNZA 4EORA 3VBVA 2VTHA 1E9HA 2IZSA 1WBOA 2YLFA 4MQ1A 1Q97A 3ZZEA 1WBNA 3KULA 2X9EA 2E9NA 4C3RA 3F3ZA 3ZFMA 1KSWA 3AC3A 3W55A 4ALUA 5LWNA 3V5WA 2XNBA 4BY9E 3CKXA 2PUPA 4YPSA 1Q8UA 3I4BA 4B4LA 2X6EA 5IEYA 2ZMDA 4PTEA 2GNLA 5HI2A 5IQDA 5E7RA 1URWA 3F2AA 3I5ZA 3LJ2A 1KE7A 4KS8A 3UOHA 2H96A 3QU0A 3IW4A 4QNAA 2CNUA 4F6UA 5CANA 4I5CA 3BLRA 4JDHA 3O8TA 4NK9A 4CZTA 4WA9A 2WU7A 2J2IB 1ZZ2A 4MWIA 3NUYA 3Q4CA 5DEWA 4PMSA 2ERKA 3VS2A 3MB7A 1NW1A 2ZDTA 3OHTA 5AP7A 3TEIA 4RQVA 4DGMA 3RNYA 3NSZA 3FE3A 3TZ9A 2C3IB 2EB2A 2WMWA 2YDKA 2VGPA 5HE0A 2W1DA 3GUBA 2VTLA 4AE9A 4ENXA 4LFIA 4FNZA 4J53A 3QQFA 4QP9A 5J8IA 3BPRA 2QOFA 4PMMA 5C8KA 2ZV9A 3JUHA 4FG9A 4Y5HA 4BVUA 2XS0A 5KMKA 3QTUA 1U5RA 4FKJA 4BDEA 4EOOA 4WUNA 4EH9A 2HXLA 2XUUA 5CNOA 3U4WA 3UC3A 2ETMA 2YJSA 4RX7A 5IUHA 3G15A 2Q0NA 3QD3A 4PPAA 2YLEA 2OF2A 3LFBA 2OKRA 4LI5A 4M8TA 2I0HA 4FIEA 4NEUA 4A9UA 4Y73A 5IQBA 4K33A 5DN3A 4O0RA 3UPZA 3KN5A 3V5PA 3ZEPA 3ALNA 2CPKE 3F69A 4PX6A 4IX6A 2JD5A 4CTCA 5CXZA 5A4TA 1JKSA 4LMUA 4I6FA 4NIFA 4EH2A 3O8UA 5IEXA 3DTCA 1OKWA 2HZ0A 4FV9A 5LQFA 2VTJA 1YQJA 5HNGA 3CGFA 4PWNA 3SDJA 4OAVB 2GDOA 2WELA 5J9LA 3LMHA 3R0TA 3KCKA 3MVMA 2WQBA 1F3MC 3JY0A 4FIHA 3OOMA 5HVYA 3CY2A 4I3ZA 3MBLA 4QYHA 4M3QA 2X7FA 2WQMA 1NA7A 2WO6A 4UALA 2Y4IC 4UN0C 3LMGA 4LOQA 3VF8A 2WFYA 2QO7A 4O38A 3RAHA 4CFUA 4FV5A 4L67A 4XUFA 4FOBA 5K4IA 3TNHA 5KMLA 3NUUA 4DGNA 2JFLA 3UP7A 5JRQA 2V0DA 2JGZA 3PIXA 4CGAA 3NAYA 4O1PA 3ZM9A 3BLQA 4FX3A 3DDQA 5LJJA 2C5VA 4IM3A 2B9JA 4NCTC 2Z7RA 2J5FA 3EQDA 4J7BA 5CF6A 3GNIB 5E90A 3JXWA 4D1SA 4FSUA 4FV8A 4AE6A 4QMNA 3KF7A 3SVVA 2X1NA 3TN8A 4EKLA 2B53A 3AT3A 3LCOA 2WMBA 2YZLA 1APME 4XP3A 5D41A 4MXAA 2GSFA 3V8WA 4HPUE 1PJKA 4BC6A 3U6IA 5EDQA 4I0RA 2R9SA 2Z02A 5A4QA 5G6VA 3OUKA 4YTHA 3ZMMA 5E1EA 4QMUA 3SOAA 2AYPA 3MYGA 3PWDA 3BQRA 3F88A 2GS2A 1Y6AA 1YWNA 2VO7A 2J0KA 2Y6MA 4DC2A 4UEUA 5EYDA 4EQUA 3D7TB 3GU8A 3WIGA 3G2FA 2JEDA 2ZAZA 4I4EA 5GZ8A 3I7BA 2UZDA 1FVVA 4BDFA 3RZBA 5K3YA 3UP2A 4JQEA 3ENMA 4RIOA 3PSBA 5CENA 4ALVA 3OBJA 5CYIA 2VZ6A 3HDMA 3LFDA 3LW0A 5ANEA 3UYTA 2W5AA 3OWKA 1JQHA 3S4QA 4O2ZA 3OUNB 4D4YA 4HYUA 3VS7A 4AA4A 1V0PA 5IA0A 4QOXA 1NT2A 5EQPA 2XBJA 1KUTA 5HX6A 3MH0A 2QD9A 1ZLTA 2W96B 5B2KA 4YURA 3G51A 4RX8A 3W2PA 3IKAA 4XP2A 4A4OA 2X4FA 1B38A 2CCHA 4D2WA 1GIHA 4DE4A 2WXVA 2YIYA 3SV0A 5AV3A 2ETKA 2R3OA 1TVOA 2W4JA 1YI6A 3OXZA 5CZIA 4O0VA 4DBXA 4RC3A 2I0YA 2X8IA 1H28A 3BKBA 3QQUA 1Q41A 3UIMA 3OOGA 4GIHA 1PKGA 4WNOA 3G9NA 5CEQA 5EW3A 4GV1A 1Z9XA 2VTMA 4HGTA 4RVLA 4ZJJA 3QQLA 4MF1A 4FKWA 5HBHA 2OBJA 4CQGA 4HVDA 4BZDA 5LVPA 2V22A 2PZIA 3MJ2A 3L9LA 3GGFA 1F0QA 2YJRA 4C0TA 2BTSA 2J50A 5M07A 2EU9A 4CVAA 5IQHA 4BDJA 2QC6A 4Y85A 2QLQA 4J98A 4O27B 4Q9SA 2O8YA 4RVTA 3BBWA 2WQOA 1BX6A 2XNEA 5M4IA 3QCYA 4KIKB 1XBCA 1CM8A 3GXLA 3AC4A 3O2MA 4IWDA 4L7SA 3KN6A 2CN8A 4YLLA 4I41A 3ZUTA 1IG1A 4FE2A 3RKBA 3TZ7A 3KRJA 1W83A 2HOGA 3I5NA 4YPDA 4I21A 4RIWB 5F95A 3UTOA 2B9IA 4GFMA 4I0SA 3M2WA 4QMYA 3BEAA 4C35A 4BIBA 4DG0E 3Q5IA 1PMUA 3T3UA 4O6LA 3ZLSA 4FEUA 3Q32A 2XIKA 3VS4A 5BVNA 3ZFYA 5JGDA 2A1AB 3VUIA 4FGBA 4LYNA 5EI2A 5CQUA 3MGYA 3GCVA 3O0GA 3W8LA 4C2VA 2R3MA 4EBVA 4HVHA 4I94A 3O71A 4GYIA 4FIIA 1YXTA 1YI3A 2QOBA 5EI6A 2OH4A 4B9DA 2NO3A 3A4OX 1OL5A 4R1YA 2G01A 3LPBA 4A9TA 4B6LA 4HGLA 4GFOA 4L52A 4ZXTA 4BDBA 2ETRA 1M14A 4TYIA 2B0QA 3VAPA 5EG3A 5C8NA 2GFCA 3GCQA 3GT8A 2O5KA 3VBYA 5LMBA 3H30A 2FUMA 3MFUA 3O51A 1G8SA 2VWBA 4BF2A 4D5HA 5M51A 3TWJA 5DEYA 4RA5A 5HLWA 3E62A 1WBSA 4RWLA 2XK9A 4UBAA 4EOKA 1JSTA 4IDVA 3COIA 3KVXA 3RINA 3EMGA 4TNDA 4ACHA 5HNIX 4DCAA 2WTWA 3SRVA 1ZAOA 3HP5A 5CY3A 3UO6A 1YXXA 2OJJA 4JR7A 1O9UA 3CGOA 5AUYA 5IF1A 5JH6A 3QCXA 2HELA 4W4WA 4BDIA 4WG4A 2OFUA 4L44A 3MB6A 4MKCA 3VBXA 3GCSA 3MSSA 2P0CA 2OIDA 3NUSA 4B7TA 4ACCA 2W4KA 5IG1A 3LCSA 4CFWA 4DFUA 5ETAA 2WU6A 3C0GA 1GIIA 1YXUA 4UZDA 4RLKA 3V04A 3HAMA 1UU8A 2GNJA 5A4LA 3UG1A 2UW0A 3G5DA 3ZUVA 2J7TA 5AX9A 5C03A 2R3NA 4YO4A 4R5SA 1H1PA 3MWUA 4A9SA 1DS5A 5IKWA 3PRIA 4FEVA 5K0XA 5KMMA 5HX8A 3ZTXA 5AR7A 4RX5A 2PSQA 4BIEA 3HAVA 4FTNA 3E92A 4IWOA 4GMYA 4UWYA 3EKNA 5FD2A 4C8BA 3AQVA 3FPMA 4IFCA 4QT1A 3SC1A 2O65A 3B2WA 3DB6A 4KINA 1ZMUA 4BBEA 3KK8A 2VTPA 2OI4X 4LUEA 3RM7A 1Q61A 2X2LA 4YO6A 2UVZA 4QP7A 3I7CA 3BHHA 4NSTA 4PY1A 3KQ7A 4ZTSA 2CSNA 3C0IA 4P90A 2WGJA 4K8AA 1UNHA 2BHHA 3A99A 4CCUA 5CU3A 1JNKA 4F9WA 3TV4A 4AN2A 1RE8A 4IVDA 4U9AA 3FY0A 4V0GA 4I4FA 5AFVA 3ORZA 3HLLA 4AFJA 1EH4A 4EQCA 2XIZA 2X2MA 2YWPA 2PE2A 3O7LB 2IZUA 3FHRA 2JDVA 3QTXA 4A4LA 1P2AA 4Q2AA 1O6KA 3N4UA 3DQXA 4QP6A 2PZPA 5FEQA 3KXNA 3PSDA 2CMWA 4EOMA 5DA3A 2BMCA 5DFPA 5JSMA 3QA8A 4KKGA 2CGVA 4FNWA 1WVWA 3EL8A 4FV2A 4BCFA 4QYGA 4OT6A 3W18A 2IVTA 3FI4A 4E5AX 3DNDA 3FKNA 3KU2A 4I92A 5EDPA 2QNJA 1VJYA 3UQCA 3ZO3A 2BR1A 2BZKB 3FYKX 3Q4UA 4CTBA 5J95A 4B8MA 5BYLA 4BGQA 3FLWA 1JWHA 3JS2A 4QP2A 4XG4A 2PVKA 4BDGA 3QC4A 3L9NA 1XH9A 2PVHA 3NR9A 4ITIA 3JVRA 2V62A 3CSVA 4DAWA 5A14A 3CKWA 3BWFA 1LP4A 3BV2A 1JKTA 3FV8A 4FV6A 3VBWA 1ZMVA 3E7VA 5JGAA 5ANGA 5HBEA 3Q2JA 3DJ5A 5GIPE 4ZY4A 1U54B 3FMLA 4IAKA 1ZY4A 4U43A 3HUCA 3NPCA 4GK4A 2X8DA 1KOBA 2HAKA 4N70A 4U80A 3RPRA 4D4SA 4GUBA 4IZ7A 5BQ0A 3WI6A 3FLYA 1IA8A 4M69B 1Q8ZA 5M55A 2HWPA 3NVMB 2BZIB 3D2IA 4FTJA 3TTIA 4JJRA 1H1WA 5DRBA 3T9TA 3ATTA 3WZEA 2VD5A 3BE9A 1UKHA 4QP3A 4KIPA 4K9YA 3I60A 4NKSA 2PULA 4IZ5A 1BL7A 1YW2A 3BBTB 4OTPA 4D0WA 2C3JA 4FKTA 2BCJA 4EBWA 2BRHA 2ZM4A 2JKKA 2P3GX 3A7JA 3DDPA 4FL1A 3AMBA 3QGWA 3ZDIA 2R0IA 3DKFA 3QZFA 3PLSA 3NYVA 4IAIA 1NY3A 3TIZA 3PPKA 3TJDA 3RM6A 2UVYA 3ORXA 3ANQA 3NCZA 2C69A 3TKUA 4X6RA 2W05A 3HUBA 2OJIA 4QMOA 4BKYA 3FXZA 2XIYA 3GC7A 3MW1A 5BUJA 3RTPA 1SNXA 4X3FC 3VO3A 4C38A 3PDTA 2KTYA 3RPVA 5AR2A 1RW8A 1PXMA 3R1SA 2IZTA 4QNYA 4ZZMA 2QCSA 2CKQA 5IQAA 3MPTA 3IOPA 4I22A 5JRSA 5JFVA 1V1KA 2UZNA 5ACBC 4A9YA 4EONA 2QO9A 4UYAA 3U6JA 2P33A 2DUVA 2YAKA 4HJOA 5LMAA 3KVWA 2Y4PA 4FZFB 4O81A 4MXYA 4TL0A 3E5AA 5F20A 5CXHA 3H0YA 3CS9A 2PVNA 3QUDA 4FG7A 3F5PA 3MESA 3R9NA 3R8UA 4BBFA 4KB8A 5HIEA 2UUEA 1U46A 3R7EA 4MX9A 3DCVA 2ZV8A 2W1CA 5TR6A 3VHKA 3W2OA 3ZRKA 3HKOA 3BU6A 4AG8A 5IDPA 1L8TA 4O83A 3CP9A 3H9FA 5B2LA 3PPJA 3BI6A 3VRZA 3AXWA 5HZNA 3CJGA 1IAHA 3T8OA 4OTGA 3TNQB 4F6SA 2YM8A 3UZTA 1Y8YA 4DLJA 5C9CA 1I09A 3LQ3A 3TXOA 1LEZA 2IW6A 5CVFA 3ULZA 1UWJA 4LL5A 3FLQA 5ETCA 4YZBA 2NPQA 4G3GA 4DEBA 2VO3A 2W1ZA 2J51A 4FSYA 4EOPA 3B8RA 2QODA 4YTFA 3QQJA 4LG4A 3AMYA 2OJFE 2WOUA 4G1WA 4JBOA 4DEHA 3LLAA 3F7ZA 4NM5A 5ETFA 2VRXA 3K5VA 4H3PA 3UBDA 4BN1A 1PHKA 5F94A 4HVIA 2FGIA 2ITPA 2QHMA 5BYZA 4GVJA 3LCKA 1YHSA 4FNXA 3FKOA 4TTHB 1OL6A 3VS3A 3E8DA 1QPEA 2VTTA 5FBOA 5FTOA 4WOVA 3ALOA 5I9VA 3PVBA 4XMOA 4CZYB 1KV1A 2VTRA 4CEGA 2YABA 1H27A 4F9CA 3DGKA 2ZOQA 2VTSA 1QCFA 3EWHA 3GFEA 3IONA 4IWPA 3Q52A 4PNKA 4BWPA 5KUPA 2C5XA 3K5UA 3MPAA 4IVCA 4FT7A 2ZVAA 4R8QA 4USFA 3EQPA 1Z57A 3ZS5A 2FO0A 2YACA 2BKKA 3N4TA 2XNPA 4UV0A 5AM6A 2WOTA 5LOHA 3NUPA 4JG6A 3WIKA 2E9OA 4FYOA 4S2ZA 4ZEGA 3NNWA 3NS9A 1V0OA 3S2PA 2Y6OA 3Q9ZA 4EZ3A 3TG1A 5I3OA 3FQEA 3VHEA 3MY0A 5L6WL 3QL8A 2ITVA 5LARA 2C1AA 4NL0A 5I9ZA 2XK4A 1DAYA 3MVJA 3PUPA 4GUEA 3DAKA 5FWKK 4AGDA 4EOLA 5CF8A 5EHOA 3R7UA 3KXGA 4BBMA 4FA2A 1V0BA 2ITNA 4ZTHA 5HO7A 5KBRA 5FXRA 5M53A 4J95A 3UVRA 2XK3A 3QALE 3EFKA 4R3PA 1JOWB 5M56A 4G9RA 1XO2B 4XV3A 3FSFA 5CAUA 4C61A 4E4LA 2VWZA 4CQEA 1WFCA 2WQNA 3ORKA 4EH6A 5LVNA 2OG8A 3P78A 4QTDA 1Q3DA 4YLKA 4EH5A 4EYJA 2C6TA 3KXMA 3UGCA 5A4EA 2C6LA 1OMWA 2B9HA 3EKKA 3LZBA 2OXDA 2IVVA 4PDYA 4R1VA 3FMMA 2PZ5A 2WTDA 4RPVA 2QU6A 3PA3A 1A48A 2G2HA 3DLSA 4HZRA 4RVKA 2OWBA 4HYHA 5BPYA 3LQ5A 4GK2A 3CQUA 3E8EA 3GI3A 4M66A 3ZEWA 4R6VA 4AZTA 4D2RA 4BGHA 3HZTA 2RFSA 3MI9A 3ORIA 4RJ6A 2IWIA 2VU3A 2XJ1A 4IWQA 5CVHA 4U3YA 1QL6A 2R3FA 4FKSA 4H1JA 4NFNA 4TRLA 1YDRE 4UXQA 4XOYA 4ENYA 3R73A 5KHWA 3TKHA 3UNKA 2J9MA 2WKMA 3OEZA 1UU7A 1Y91A 4X2FA 5F4NA 4A07A 4O6EA 3U8WA 2EXMA 5DNRA 3VUDA 3DNEA 3QCSA 5FDPA 5AR5A 1Q5KA 2QVSE 4S32A 3ERKA 1SVHA 4AGUA 3QBNA 4CFFA 4FF8A 4X2JA 3FMDA 4PPCA 3ENHA 3SXRA 2RG5A 5JFXA 4H36A 5GNKA 3W1FA 4IAYA 2G1TA 4BR3A 4CKJA 4L7FA 4E20A 3LFSA 3R7VA 4NM3A 2HY0A 5B7VA 3B2TA 3PVWA 2CGWA 3BHUA 4G5JA 4MH7A 1CDKA 2R64A 4H1MA 4CD0A 2C30A 2OFVA 3R2YA 3TKIA 5TE0A 4G3CA 5LCKA 3I6WA 4EHEA 1YOLA 4L43A 3SGCA 2C6IA 4NCTA 4A06A 4BCNA 2C6OA 4S31A 3R9RA 1MQBA 3D5WA 1SVGA 2BHEA 1OKZA 3W16A 4E7WA 4TYHA 5EKNA 5E8WA 4FSQA 2ACXA 4GIIA 4BCGA 1NVQA 4JT3A 5I9XA 3JPVA 5HHWA 3CEKA 4DTBA 3E63A 4WSYA 4EWHA 3ZLXA 2C6DA 2WMRA 4BI0A 4IAZA 5CQWA 4CV8A 5HVJA 3V51A 3MVHA 3IW7A 3OF0A 4U79A 2R5TA 5IQIA 2VX0A 3PY1A 4S33A 4XG9A 4AF3A 4F7NA 1CKPA 4L3JA 4OBOA 4K11A 4YSJA 2W4OA 3GC8A 4W8EA 3ZU7A 3ZC6A 2C68A 4M67A 5ICPA 4AP7A 4DFNA 3SXFA 2PMLX 3HA8A 4Y8DA 2NNWB 3A8XA 4FZDB 4GYGA 5H9BA 2JLDA 3TZ8A 3QKMA 2JKMA 4F0FA 3DAEA 1OKVA 3KRLA 3KMMA 3ODZX 2GFSA 3OT8A 4ZS0A 4QMZA 4R3RA 5K5XA 3PPZA 3SQQA 4F7LA 4IBMA 5KO1A 2JKOA 2BDWA 5CALA 4M13A 4CG9A 3BYUA 3EN6A 3HV7A 4IC7A 5EQEA 4H3BA 3TTJA 3CIKA 3KA0A 4TKSA 4WIHA 3VC4A 2BAJA 4E93A 3PG3A 3QXOA 2HZNA 2F49A 2JBPA 4I93A 5L8LA 4G2FA 1CMKE 3G6GA 3HX4A 4AT5A 2OJGA 2QR7A 4FTOA 2JBOA 4FV4A 2H8HA 4FOCA 2UV2A 3SRVB 5EH0A 5LMKA 2PZYA 5EOLA 3SKCA 3GCPA 3LCDA 3PJCA 4XG6A 3AD6A 4QTCA 3VIDA 1SYKA 3TM0A 4XBUA 3UC4A 1ND4A 4UMQA 4R3CA 3OXTA 3GU4A 3SOCA 2GTMA 3A7IA 5JK3A 4AN9A 2VN9A 2IN6A 3HDNA 5H8EA 4F7SA 2XYUA 2XNNA 3NIEA 2HW7A 3MJ1A 3OT3A 3OS3A 1JPAA 3PE1A 3KMWA 3OFMA 4KBKA 4M12A 4AA5A 4C4GA 2AC3A 5IMXA 1H07A 4FTCA 4TW9A 3QTZA 5AIKA 4ANOA 3OTUA 2UW9A 3R8MA 5FLFA 3EIDA 2BFXA 2O63A 5L4QA 4L68A 4KBCA 4DFLA 3QAME 5KZIA 4IAFA 3P7BA 4PTCA 3PIYA 4ZOGA 1OUKA 1E1XA 3EQFA 3BZ3A 5HE2A 2WMQA 4TWOA 3EB0A 3PVGA 4AW5A 4AOTA 4QMWA 5AUWA 4YC6A 3POZA 4LGHA 4YHTA 1KE6A 4BHZA 3VBTA 1P4OA 4U40A 4WSQA 1UVRA 2Y8OA 4Y95A 5CZHA 2P55A 2O0UA 3PZEA 2W1GA 2XB7A 3FXXA 5CWZA 5EM7A 4BCKA 5KKRC 2C3LA 4RIYB 4BZNA 2CLQA 4YU2A 4GEOA 2R3HA 3ZRLA 5DHJA 2DS1A 4EUTA 2VNYA 2UW4A 1BYGA 2P2HA 3FZOA 3QQGA 3KF4A 3VQHA 3FZPA 4AAAA 2PTKA 3FLSA 4GJ3A 2YCQA 1YXSA 1ZZLA 4HNIA 1W84A 4K18A 3LM5A 4MXXA 1SZMA 4FGRA 3MDYA 4OGRA 2VTQA 3FI8A 1BI7A 4P7EA 2R3QA 3R00A 4L53A 3VS1A 4RJ3A 2IVUA 4HGSA 4RZWA 1W8CA 2XKCA 3LFEA 5CSVA 3SD0A 2BAKA 3FC1X 2UZEA 3FHIA 4IIRA 4AGCA 4D4VA 4EJ7A 3KKVA 2GNFA 4CRLA 5HD4A 3QZGA 5L2QA 4FBXA 3BWJA 3VRYA 3KXZA 2BTRA 4QYFA 3PE2A 4MD8E 3KRWA 4NZWB 3R7IA 4CFMA 4ITHA 4Z55A 3I79A 3NAXA 4BWXA 4XV1A 4MWHA 3TUCA 4M0YA 2VGOA 3N9XA 4U7ZA 5AA9A 5M4FA 3D83A 5H8BA 4BIDA 4YLJA 4MVFA 2UZOA 2R3RA 2YA9A 2ZM3A 4I20A 3WE8A 4GU6A 2UZUE 1XJDA 3IGOA 4RWKA 4EH4A 4XBRA 3L8XA 1YDSE 4EK6A 3FPQA 1I44A 3NIZA 5J1WA 4C58A 2EXEA 5AP0A 1P14A 4CXAA 1GNGA 4ZTNA 3ZSGA 4L00A 4CMOA 2R7BA 4NW6A 5L6PA 3ID6C 3Q96A 4L3LA 5M06A 4CFVA 4GH2A 2IG7A 3OD6X 3EFJA 2O3PA 3NX8A 2YERA 1PXPA 1ZYDA 2C1BA 2VTOA 3HV6A 3WOWA 5LMKC 1IEPA 1PXLA 2PVYA 4YP8A 3C9WA 5H8GA 1QMZA 3C4WA 1JSVA 3LCTA 2QOOA 2F57A 2I1MA 5JKGA 3WF8A 3MPMA 3E8NA 4Z7GA 2B7AA 4FKOA 4RZVA 2C4GA 2OLCA 1BKXA 1M2RA 2J0IA 4JIAA 3VW8A 4QO9A 2PUIA 4DFBA 5IQGA 3POOA 4J52A 3ZFXA 2OU7A 3IW5A 2WB8A 5EOBA 1AGWA 4EEVA 5C26A 2RSVA 4EZ7A 2CGUA 5CF4A 5DMZA 4FUXA 2J4ZA 2C5YA 1G5SA 2J0LA 4GU9A 1FQ1B 2I40A 3PY3A 4WKQA 2R2PA 5KMJA 1H4LA 3CY3A 4X0MA 4UMRA 4BCOA 4CLJA 4FSRA 5HCZA 5AAFA 3UIXA 3WYXA 4AWIA 4XOZA 2RG6A 2Z60A 4IX3A 1FGKA 1TKIA 4APPA 4BDKA 3FLNC 5C1QB 2RKUA 4JBVA 3II5A 5H2UA 4ERKA 4MNEA 5ANKA 5BUIA 3NW5A 4KKHA 2CLXA 1OBDA 3LKMA 1Q8TA 2ZJWA 3OWJA 5I4NA 2EVAA 4FVQA 3KXXA 1STCE 3OCBA 2XP2A 4DCEA 3ATSA 1UNLA 3I0OA 2B9FA 1QPJA 3MH3A 3QYZA 1R78A 2XK7A 3IDCA 3ROYA 3V5JA 4AGWA 3Q6UA 5CEMA 3QXPA 3SXSA 3THBA 4JS8A 3IGGA 4MBJA 4O84A 3OW3A 4QMVA 3U9NA 3KFAA 2JAVA 2VTAA 4DGLC 2YZAA 3F3UA 5CVGA 1GZOA 2YCRA 3R1QA 2A0CX 4W4YA 3ETAA 1YVJA 4FKQA 3FAAA 3C4FA 2Q0BA 3CQEA 4UMTA 3U6HA 5CU6A 3ITZA 3RPYA 4EC8A 2IO6A 2UZVA 4ZS4A 2VUWA 2CCIA 1ZYJA 4WNMA 3FC2A 5IU2A 4G5PA 3HMPA 4N0SA 4RFYA 3ORTA 2QLUA 4APCA 2ZYBA 3GEQA 4YC8A 4BGGA 5I9YA 1FVRA 4IZYA 4O0XA 3COMA 3EYHA 1Q3WA 2OJ9A 3O96A 3DBDA 3DKOA 4IVAA 4B8LA 5B2MA 2J5EA 5AV2A 4FTTA 4GFGA 2J90A 3FMJA 4IEBA 5FEEA 4MXOA 4ZTLA 4YJVA 2FH9A 4I6HA 2P4IA 3BU5A 1M52A 4UB7A 3ZSIA 3D9VA 4BDAA 4B0GA 1VZOA 4K1BA 3E64A 2BUJA 3OCSA 3DFCB 4U8ZA 5AUXA 4IZAA 5ETIA 4K77A 3EZRA 1OIUA 2C3KA 2CJMA 3DLZA 3DT1A 2WMAA 5EW8A 5GJGA 5AV0A 3VNTA 3AGLA 4JLCA 4FK3A 2ESMA 3LJ1A 4QMMA 4AN3A 1SM2A 4GL9A 4PDPA 5E8SA 2XK6A 4YBKA 3WYYA 2WMUA 1A9UA 5D12A 1PYXA 3R01A 3ZO1A 5J87A 2OIQA 3TI1A 4LGGA 2XKDA 5CEKA 4MAOA 2F2UA 3O8PA 4BZOA 1SVEA 3R1NA 1YI4A 4S30A 3FMKA 4LM5A 2J0MB 1MUOA 3NNVA 4P2KA 3HGKA 3PWYA 1BUHA 4XG7A 3Q2MA 2PU8A 2ONLA 4D2TA 4G17A 4OBQA 5IH5A 4QP1A 3EQRA 1XR1A 3UO5A 3NGAA 2NRYA 4FNYA 4KS7A 4EOIA 3R9OA 1KWPA 4PPBA 4BYIA 4O1OA 2HCKA 5C4LA 3EL7A 2BFYA 3F66A 3PTGA 3Q53A 4JDKA 3C1XA 4W4VA 3ZCLA 2GTNA 2ITZA 2QR8A 2EWAA 2Z2WA 3F61A 3RMFA 4QTEA 3H10A 3IG7A 4O7NA 4TYJA 5E8XA 2UZWE 5HCYA 4C4IA 4D2SA 3UO4A 4U0IA 1PKDA 4X3FA 4D0XA 5J7BA 5CLPA 1MQ4A 3E88A 1J1CA 2FA2A 3HMNA 2EXCX 3FZ1A 3IECA 4FODA 4JBPA 3S00A 1FINA 5EQYA 4KAOA 1K3AA 2ZB1A 4RIXA 3RGFA 1HOWA 4AT4A 5HCXA 1ZYCA 5A3XA 2C47A 5AP3A 3W10A 3SW4A 5AP4A 3EQHA 3V5LA 1WBPA 4MD9E 3H3CA 4WG5A 5BYYA 2YM4A 3CJFA 3MA6A 3Q9WA 1OL7A 4PP9A 3HMOA 4GS6A 3CLYA 3K3JA 4XHKB 4NJ3A 4D5KA 1M7QA 4BDDA 4EOJA 3Q4TA 4QQJA 5EK7A 3G9LX 2OZOA 4C4JA 3ZLWA 4X6QC 3DV3A 3CPCA 4PDOA 5JZNA 2JC6A 5IH4A 3OROA 2XRWA 4KWPA 4HPTE 3W32A 5HKMA 2ERZE 4I0TA 4K0YA 2Y7JA 5AX3A 3GFWA 3E93A 4U97A 1Q62A 2CKPA 1OPJA 2F4JA 2FSTX 3UZRA 4M7IA 1T45A 3W33A 1TQPA 2WNTA 3W2RA 4IXPA 3BYMA 5J79A 3OY3A 3R7YA 5BVOA 3BU3A 5HORA 4QTAA 5CTPA 5E92A 4P5QA 5I3RA 2HIWA 2O64A 4Y83A 4FUYA 3DKGA 4C4EA 4GT5A 2WZJA 3MTFA 5HGIA 4C7TA 5J9YA 4F1TA 3AT4A 3BELA 2AC5A 2UW3A 2CNQA 2GQRA 3E3PA 3AD4A 5GINE 3PXKA 3QZIA 3AT2A 3HECA 2YISA 5L2WA 4ANBA 1ATPE 3PJ1A 2Y4IB 4JDJA 1NXKA 3F82A 3OZ6A 1AQ1A 5CNNA 3HV5A 3JVSA 3AC2A 1OIYA 3HL7A 4CYJA 4C36A 5IDNA 4CKRA 5BVFA 3VS6A 3FI2A 2UW7A 3A4PA 3QRIA 1ZOGA 3TDVA 2GS7A 2DWBA 4FL3A 3NW7A 1YKRA 3SG9A 2I0EA 4PQNA 1H1QA 1OIRA 2QOQA 2RGPA 3IK3A 5FUTA 4WT6A 4PP7A 4N57A 3P0MA 1PXNA 5J7HA 3U51A 1FMKA 2WMTA 3QLFA 3RPOA 1LEWA 4D58A 2YCFA 4FKGA 3CR0A 3R6XA 3ZLYA 1YXVA 4DEIA 3OC1A 2HW6A 3QKKA 5HO6A 2JITA 3RK5A 3FUPA 4XH6A 5DGZA 3BE2A 3QD0A 4QYEA 2OH0E 5EM6A 2A27A 2WMSA 3HMMA 4CZUA 4OBPA 4WNKA 4AU8A 3D7TA 5JGBA 3QQHA 4Q5HA 4C34A 3LFNA 4DYMA 3UOKA 3BYOA 3F3TA 3KULB 2CHLA 5JFSA 2V55A 3LIJA 3GCUA 3R83A 4JOAA 3ZC5A 4EH3A 3A7HA 4WD5A 3C5UA 4FKRA 2YCSA 2ONLC 3U55A 2OSCA 5K5NA 4FK6A 4EH7A 1YWRA 2G2FA 2JFMA 4O82A 1ERKA 4D4RA 4C02A 3U9CA 4FG8A 4KD1A 4EK4A 2QU5A 2RFDA 3O50A 4RA4A 4LOPA 1REKA 2PK9A 1J7LA 2XA4A 3AC1A 4FIJA 4OTIA 4ANMA 3A8WA 4LRKA 3GU5A 3MY1A 4CSVA 2F7EE 2BIYA 2OXXA 3DB8A 4RBLA 5AM7A 1UU9A 3EQIA 5L8KA 3E3BX 4FV7A 3CE3A 5E91A 3QHRA 4F64A 5AV1A 3NYNA 4QP8A 4MHAA 4CV9A 5BMMA 3BGPA 4LL0A 3PJ8A 4L3PA 3QWJA 3IW8A 5DR6A 5HG9A 3NEWA 2J6MA 4XEYA 1KOAA 4DH5A 3V8TA 2XMYA 4EUUA 4UWBA 4IMYA 3DTWA 3Q6WA 2B4SB 4FTLA 4RRVA 3ODYX 3ACKA 5CI7A 2HZ4A 5IA4A 1IA9A 1B39A 4F1MA 4F6WA 4ASZA 4JXFA 1IR3A 4EC9A 1PRYA 3TNPC 2ITOA 1SNUA 3CC6A 3PIZA 2HYYA 2UZBA 1GAGA 2H34A 2R3IA 3D5UA 4C4FA 3EHAA 2C0IA 3RBWA 3TT0A 3PP1A 3FKLA 3R7GA 4FSWA 3TV6A 2YIRA 4FZ6A 3DBFA 4NU1A 3ELJA 4QMPA 3MVLA 1H1SA 3K3IA 4DLIA 4FKVA 2GS6A 4QD6A 4NIFB 4WHZA 4ZTMA 3O23A 5CEIA 2OIBA 4ZP5A 2ITQA 2PHKA 3VW6A 4ANSA 3LLTA 4DTKA 2PUNA 1DI9A 2B55A 4G3FA 4IW0A 4GK3A 4RIWA 2W1IA 3QYWA 5CSHA 4ANNA 2J0JA 4FKUA 4FVPA 3HEGA 4MF0A 3VVHA 4AS0A 4TYGA 2GNGA 2P2IA 3FSKA 4OR5A 4USDA 4BTMA 5EFQA 5I9UA 2YFXA 3EZVA 4IACA 1E1VA 4TWNA 3R8VA 3NLBA 4KNBA 3PXRA 2BPMA 4BCJA 2VWUA 4F9AA 5HEZA 5KMOA 4ZTQA 3MIAA 4N6ZA 5AWMA 3RCJA 4O7TA 4DT8A 3UDBA 1FVTA 4HCVA 5CSWA 5CSPA 5HNBA 2SRCA 5IPJA 2UW8A 3HV3A 3UQFA 4I5MA 5EDRA 2YM3A 2F2CB 4DTAA 1JSUA 2FB8A 3VJNA 5KCVA 4WBOA 3NW6A 5HLNA 1ZOEA 4YGAA 3C4ZA 5E8VA 2VX1A 4MEDA 1FMOE 4JAIA 5KE0A 1CKIA 3R28A 4D2PA 1Q4LA 2YN8A 4LOOA 5CS6A 4PL3A 2YIXA 2XNGA 4H3QA 2W17A 3SHEA 2CKEA 2WD1A 2XJ2A 4H39A 4FKLA 3W2CA 3VUMA 5A54A 3FI3A 4ERWA 2ITTA 4M14A 4AT3A 2YDIA 5CT7A 4ZJIA 5L6OA 3WZUA 2W5BA 2WTJA 3RALA 3QLGA 3WBLA 5A4CA 2GPHA 5DYJA 4FYNA 3EJ1A 4AX8A 2XIRA 3R9HA 4BL1A 3DFAA 3PJ2A 2XK8A 3CPBA 4WG3A 4Z3VA 3DY7A 1TQMA 4IM0A 2Y0AA 3WF7A 3K54A 2W5HA 3P5KA 4MXCA 3NUXA 4UMPA 1CKJA 5DWRA 3VF9A 5TF9A 2XKFA 2JDOA 2E9PA 4E8AA 3F3WA 4NWMA 1O6YA 2JDTA 4E6DA 4F1OA 3IQ7A 2WEIA 3QTRA 4W9XA 4O7YA 5CEOA 4AQCA 4QPMA 1H25A 4CFNA 5JMSA 3OG7A 1QPDA 4C33A 5HTCA 3ZO4A 4MD7E 5DT0A 4RGJA 2EB3A 4X2KA 4ZSJA 5EW9A 1Y8GA 4RJ4A 3FMNA 3R8ZA 2ZV2A 4IH8A 1WMKA 1XBBA 2BVAA 4FIGA 2B52A 4W8DA 3QHWA 1YHWA 2GHLA 4DFYA 4OAUC 4WUAA 3F6XA 5AP6A 2OW3A 1BL6A 2XCKA 4KABA 4ACGA 3DK6A 3O7LD 5DR2A 4LQMA 2PYWA 4NFMA 3QKLA 2BIKB 5AP5A 5IA5A 3UE4A 2OXYA 4N6YA 4AA0A 4EK3A 3MH2A 2X81A 5T3QA 3KB7A 5DT4A 4DT9A 3NMUF 4DEGA 4P4CA 5HQ0A 1O6LA 4XLIA 3FZSA 1GOLA 3LXNA 3WZJA 3UNJA 1HCKA 2QOHA 3BIZA 5AP1A 4U3ZA 5IQFA 1PYEA 1Q8WA 4MTAA 4HGEA 3ZO2A 4O21A 4O7VA 4KBAA 4CRSA 4ZJVA 5T68A 4AOIA 4DH3A 1ZOHA 4C3PA 2XZSA 3GQIA 3UMXA 3VBQA 1PW2A 4EHGA 3S0OA 4RFMA 3COKA 5DE2A 4DH8A 3EQBA 3QA0A 1JKLA 4DEAA 3RHKA 4M97A 4E6CA 3AC5A 3GENA 4FV0A 4CT1A 4E5BA 1URCA 4F09A 3LM0A 3D15A 3VUKA 2GU8A 4FVRA 4MNEB 3WF5A 2VWWA 3OXIA 3P23A 3RAWA 5E4HA 4FEWA 5IQEA 3A61A 5I0BA 3MFSA 3BHVA 3A7FA 5ACKA 3AGMA 2ITXA 3LVPA 4QMTA 1U5QA 1BLXA 4DBNA 4GSBA 4CG8A 3ORMA 3Q9YA 4YJRA 4JR3A 4BI1A 5D1JA 3T3VA 4EWQA 4KSPA 3DXNA 2UVXA 3PXYA 5DRDA 3R21A 5C8MA 2XEYA 4UXLA 4R5YA 4ZSLA 4NM7A 3CD8A 3DPKA 4WO5A 4AW0A 1H0VA 3LFFA 3UQGA 3V01A 3P9JA 4UZHA 4BYJA 4MQ2A 5KNJA 4EL9A 4F9YA 4GCJA 3RWPA 2Z7SA 3WE4A 1OBGA 4YJPA 3BHTA 4USEA 3C51A 2H9VA 3OW4A 1ZYLA 5FP6A 4F4PA 3FL5A 3S95A 1BI8A 3UZPA 5HOAA 3I6UA 3A62A 2BRNA 2W1HA 4X3JA 3TUBA 4J8MA 5HE3A 5FGKA 3OY1A 4DINA 3GBZA 3OEFX 3DA6A 1PY5A 2UZLA 2R0UA 5EKOA 4ID7A 5GZ9A 2JIVA 1W0XC 4BKZA 3VWAA 2ITYA 3RWQA 1VYWA 2Z8CA 4HCUA 4PTGA 4DG2E 4NKAA 2OGVA 3Q9XA 3L9PA 1R0EA 2BROA 3CTJA 3F2NA 4FZ7A 4Z7HA 4UYNA 2HY81 5FXQA 4BCPA 5LCJA 1M2PA 4M68A 3H9OA 4ONAA 2W1FA 2W7XA 3E8CA 5HG5A 4M15A 1A06A 3I0QA 1H8FA 3PA5A 3TL8A 3FMHA 4TY1A 3ZDUA 4LV5A 2V5QA 4FEQA 1IASA 3RAIA 1M2QA 3QRUA 1KE9A 2R3JA 4HNFA 4FSZA 3E7OA 4L46A 1LPUA 3I81A 4ACDA 4BCHA 1XBAA 4BFMA 3AG9A 3BRBA 5DPVA 4G31A 5ANOA 3HVCA 3V3VA 1UV5A 3V6RA 3WZDA 1IRKA 5BUEA 1R0PA 4G16A 5GJDA 4AZSA 5AIRA 2W1EA 3PY0A 1ZXEA 4XS2A 4TXCA 3D14A 2XKEA 4XRJA 4X21A 3VJOA 3D94A 4CFXA 3NVKI 3HRFA 3HYHA 4V04A 2WIPA 4FTKA 4AZFA 1UWHA 2RFEA 3CTQA 3UPXA 4DITA 5KMNA 3MY5A 3FYJX 3OBGA 1UU3A 4O7RA 4II5A 1J1BA 3PLAE 5DG5A 2XNMA 2XVDA 4JIKA 4X3FB 5IUIA 3IDPA 4FSMA 4IVBA 5LXMA 4RJ5A 2R7IA 2I7QA 2W0JA 4OW8A 3VN9A 4KIQA 5HESA 3C13A 5FQDC 2REIA 4GVAA 4RIXB 5BNJA 3CXWA 3MTLA 1XH4A 1WVXA 4C37A 5JEBA 4DFXE 4NT4A 5ANDA 5JQ5A 4A4XA 5IISA 4FT3A 4DEDA 1VEBA 4IJ9A 1KE5A 1WVYA 4HW7A 2PE0A 2VAGA 2VV9A 3P1AA 5CAQA 1OL1A 1J7IA 2RF9A 3KY2A 5EYKA 4F65A 4RT7A 3IW6A 2VWVA 4V0GB 3VS0A 4FMQA 2C5OA 3LXKA
chains in the Genus database with same CATH superfamily
1JVPP 4LV8A 3M1SA 1R39A 3UYSA 5AEPA 4NYEA 4FV1A 2GCDA 5HIBA 5D11A 4QYYA 3D2KA 3LXLA 4Y5QA 5GIOE 3NWWA 1H00A 2ZM1A 3DS6A 5AR4A 1REJA 4HYSA 2OICA 2XAOA 4D2VA 3NRMA 2C0TA 4JI9A 4R7HA 4HVSA 3LMIA 3W0RA 5E8ZA 4FTRA 2QQ7A 4DF3A 3QD2B 2F7XE 5BMSA 2OZAA 3OWPA 3ANRA 2XIXA 4PDSA 3ORNA 4ALWA 4D55A 4D1XA 3KXHA 3E87A 3R8LA 5DLSA 4RWIA 3WF6A 3UG2A 4O0UA 5HU9A 3QF9A 1MRVA 4C62A 4NW5A 3KC3A 3DK3A 5FG8A 3QCQA 2VO0A 4EOQA 3ZONA 2FSOX 4BKJA 5IA3A 4Q9ZA 3DXQA 2F7ZE 3L8PA 3IO7A 3CD3A 4L01A 2JDSA 3HRCA 4U5JA 5CEPA 3BLHA 4PMTA 4QQTA 4ZAUA 1GY3A 2XJ0A 4BI2A 3GU7A 3RP9A 4ZMFA 4E4MA 4YSMA 4ZK5A 3K2LA 5DBXA 2YM7A 4IB1A 3RK9A 4RLLA 4R7BA 3ULIA 4O0YA 1BMKA 4XCUA 1XH8A 1ZMWA 4IB5A 1H0WA 5J1VA 4QMXA 3ZH8A 3C50A 3CQWA 1U59A 5M4CA 4RG0A 5HICA 3RK7A 5KBQA 5AUZA 1F5QA 3PG1A 4MCVA 4ZLZA 1FBNA 2WMXA 4CMUA 3W0QA 1PXJA 3BCEA 1PMEA 4YJNA 5IEVA 3SA0A 3LXPA 3R22A 3UJGA 3F5XA 3UIBA 3DKCA 4FTAA 4IJPA 4L45A 3C7QA 3PJ3A 1RJBA 4E3CA 4L9IA 3D7ZA 3AKJA 3L1SA 3OCTA 4FR4A 4ARKA 2WTKB 2PMOX 3QX2A 1YDTE 2LGCA 4PMPA 5HE1A 5JN2A 1OITA 3MH1A 2A4LA 4BICA 2BRMA 3GQLA 1WCCA 1PXIA 5AA8A 4PL4A 1S9JA 4OLIA 4KRCA 3EFWA 4DGGA 1YOMA 4H05A 1CSNA 3SG8A 3WARA 4U44A 2WTVA 2XEZA 3EN7A 3LJ0A 3GC9A 1L3RE 4QMLA 4TN6A 3GB2A 2PY3A 3EYGA 1YOJA 2GQGA 4HYIA 2XM8A 4IFGA 2YM6A 4MBIA 3TIYA 3VULA 4DN5A 3MA3A 4DEEA 5FP5A 3S3IA 3L9MA 4QQ5A 3B8QA 4C2WA 5T6KA 3C4EA 3NNUA 4EH8A 4F08A 3NCGA 4MBLA 3G0EA 4YC3A 3H0ZA 1K2PA 4DG3E 5JT2A 3LFAA 3MV5A 4XV9A 4YNEA 3RAKA 3Q4ZA 4CLIA 2PWLA 4FT5A 1JAMA 2QKRA 4QP4A 4ASEA 4CKIA 3GVUA 3R63A 5EYMA 4J96A 3OCGA 2GHMA 4QRCA 3F7WA 4IHPA 4W9WA 2X39A 2PVLA 1MP8A 4ZSEA 4I6LA 1X8BA 2WQEA 2WMVA 4FSNA 4JG7A 5FEDA 2CDZA 4M84A 2H6DA 5FM2A 4HVGA 4PUZA 1IAJA 3VUGA 5CU4A 3TYKA 5BVWA 2OK1A 1GIJA 2R3PA 4V01A 5CF5A 5TO8A 4X2GA 2HENA 4FTUA 3QX4A 5CASA 3PUFC 3P7CA 4IE9A 1W98A 4OUCA 3C4XA 3IOKA 4G6OA 4KUJA 3CTHA 2HWOA 4JRVA 4XYFA 1M7NA 3Q3BA 3D4QA 4KSQA 2BRBA 3QQKA 3ZUUA 2PPQA 1KV2A 2QG7A 4IADA 4YJQA 4FEXA 2KULA 2W99B 2AQXA 4O96A 1DI8A 5DVRA 5J5TA 5CU2A 3C5IA 4F70A 3ZBXA 3NZ0A 2A2AA 5KX8A 5ANJA 4OT5A 5AMNA 3PSCA 4FC0A 4ZZOA 1XMMA 5D7AA 2QOCA 5AUTA 1R3CA 4FSTA 4F0IA 3BYVA 4E26A 2BRGA 4FTMA 5IA2A 3D5VA 2QOKA 5FBNC 4JQ7A 3H4JA 1XKKA 2ZV7A 4PRJA 4O7ZA 4WRSA 5L3AA 1M17A 5ITAA 5L2SA 4QMSA 3W2QA 4XNEA 4U81A 3FZTA 3KRRA 1XWSA 4G9CA 3RPSA 2C6MA 4E4NA 3BX5A 4EQMA 5K4JA 4JBQA 5L2TA 3QUPA 4YZ9A 5AJQA 4AZEA 2RL5A 5EI8A 4F0GA 4W4XA 4AACA 3PA4A 5EM5A 5KHXA 3N51A 3QFVA 4MNFA 5A46A 1WBTA 4AUAA 2HK5A 3P7AA 2VWXA 1VR2A 4BB4A 4EK5A 2QHNA 4JVGA 1WZYA 3QC9A 3R2BA 1KE8A 2RIOA 4QQCA 4IB0A 2B54A 4DGOA 3PVUA 2C6KA 4BHNA 1J7UA 3M11A 4IB3A 3DJ6A 5HTIA 3QGYA 4YZDA 5HIDA 4ANQA 2PVRA 2ITWA 5GJFA 4DA5A 5F9EA 3DBCA 5A6NA 4AZWA 3M42A 4FL2A 3NYXA 3L8SA 3W8QA 1ST4A 3LQ8A 2X4ZA 1Q24A 4ITJA 1Y57A 3SLSA 4E5WA 2PVJA 3TNWA 2C6EA 1OPLA 4Z16A 1G3NA 4RX9A 4PNIA 4J97A 4TNBA 4FICA 4EOSA 5JFWA 3LAUA 3ZYAA 1CTPE 4EI4A 3GC0A 3V8SA 3FBVA 5FTGA 3PXQA 4NJDA 4YNOA 4YHJA 3OWLA 4A7CA 2X8EA 4FKIA 4FV3A 3BQCA 3DJ7A 1LR4A 1XQZA 5CAOA 2FYSA 1K9AA 3KREA 5A9UA 4DH1A 4L6QA 5HD7A 4EYMA 3F9NA 4TWPA 3TV7A 2GMXA 2YAAA 3G6HA 4CNHA 3G0FA 2JAMA 4IM2A 3GP0A 2OF4A 4HOKA 1GZNA 5DR9A 3LE6A 3ZZWA 4E1ZA 3KL8A 1JBPE 3O17A 5M44A 1Q8YA 1LUFA 2VWIA 2JIUA 4RIYA 3ZHPC 5DI1A 3RHXA 2BAQA 2PZRA 4I24A 4O91A 5AAGA 3PFYA 2V7OA 4RC4A 5IA1A 4IANA 4C59A 2VNWA 4H58A 3V6SA 5LVMA 2IW9A 1RDQE 3PYYA 3EQCA 5EM8A 4YTCA 4V05A 4JAJA 4F63A 3A2CA 4RQKA 3QZHA 4A9RA 4XX9A 3CCNA 4XJ0A 5HVKA 3KRXA 4ZY6A 3F3VA 1GZKA 1H01A 3EQGA 4GG5A 3R30A 5AR8A 5C27A 2WIHA 4AXAA 4DFZE 2GHGA 5KKRB 5I9WA 2OO8X 4XG3A 4G6LA 4BCIA 4XG2A 4GKHA 2XF0A 4ANLA 4BRXA 3ORLA 2VTNA 1H08A 3QTQA 3TACA 1OGUA 4JQ8A 4C4HA 1DM2A 1PXKA 2WAJA 2X0GA 4RJ8A 4YBJA 1OIQA 3NDMA 5HG7A 3NUAA 4YMJA 3FQSA 4FTQA 5AV4A 3UOLA 5M09A 4LMNA 1ZARA 4J71A 5K0KA 4EHVA 1YHVA 4Y72A 2BDJA 2XBAA 4TYHB 4I6QA 5C4KA 2Z7LA 4BTJA 4YZMA 4EHZA 3QD4A 4K2RA 3EH9A 2WTIA 5IMEA 3KCFA 4PL5A 5H3QA 5GZAA 5LVLA 3V5TA 1UA2A 4BJJA 4QPAA 4IC8A 4CYIA 4RWJA 4D1ZA 5TT7A 4ZMEA 1H24A 2PMNX 5D10A 3AMAA 3RCDA 4GJ2A 4GKIA 3ZBFA 2ITUA 1TQIA 3COHA 4JG8A 5DIAA 2WTCA 4ASXA 3S1HA 3FZRA 1OZ1A 3DOGA 2A98A 3FLZA 3PP0A 1Z5MA 3Q60A 4S34A 3MFRA 2XM9A 1J91A 4YR8A 4MUQA 4F7JA 4L42A 1PMVA 2I0VA 4YJTA 4O0WA 5IQCA 4P5ZA 4GW8A 4U45A 4D9UA 5K9IA 4QTBA 3R02A 5BVKA 3CBLA 2XANA 3ZXTA 3P86A 2AUHA 2PVFA 4I5HA 2DQ7X 5DT3A 4K6ZA 5CX9A 3D5XA 2IZRA 3LFCA 4IDTA 2WPAA 3DXPA 4NTTA 1Y6BA 2W9ZB 4I6BA 4F9BA 1OPKA 3R71A 3LOKA 3BEGA 3DQWA 4IAAA 4YZCA 5E8YA 5HO8A 4QMQA 2R3GA 3U4UA 2X2KA 4G3DA 4G34A 2XCHA 1G8KA 2BKZA 1W7HA 4XV2A 3WF9A 3SW7A 4TT7A 2FSMX 2RFNA 4LRJA 3SAYA 2X7OA 3OVVA 5D9HA 4RFZA 2YWVA 2C0OA 3SX9A 1NVSA 2BILB 1YRPA 2IW8A 3U54A 3R8PA 3BHYA 2QKWB 3Q5ZA 3ZSHA 4YUQA 4KRDA 3HRBA 4O86A 5E8TA 4YTIA 4UY9A 4BWKA 3BL9A 1PXOA 3EN4A 2ZMCA 3FQHA 2WEVA 3FDNA 5I5ZA 2EUFB 5HG8A 4CCBA 5JQ8A 1W2DA 2QO2A 4ZZNA 3IS5A 1SMHA 5KMIA 2G9XA 2XH5A 1JLUE 2A19B 5CSXA 1B6CB 2XNOA 3HMIA 2PUUA 4UWCA 4G6NA 4AAYA 2X9FA 4E6AA 4MK0A 4KIKA 3IPHA 4Z9LA 4X7QA 4JX3A 5J5SA 5KZ0A 3VQUA 1R1WA 4I23A 2R3LA 4L8MA 4XLVA 4B99A 2E9VA 2R3KA 1YWVA 4TYEA 4R7IA 5F1ZA 1ZRZA 5TOZA 5BX0A 5IZFA 2NP8A 3REPA 3C4CA 1DAWA 3KK9A 3QTWA 4LRMA 2YITA 2YIQA 1J3HA 3DBEA 2UW6A 4NH1A 3HV4A 3QTSA 1OL2A 1JKKA 4FKPA 4XP0A 4OTFA 2XRUA 3AD5A 3H9RA 4U42A 5E1SA 4ZTRA 2YDJA 1U4DA 3EN9A 4QPSA 4NTSA 3RI1A 3TZMA 2ZB0A 2IPXA 3N4VA 4GT4A 3OMVA 3KMUA 4MYGA 5HLPA 4NUSA 4AW2A 4UX9A 4R77A 4WNPA 3UIUA 3P4KA 4U6RA 4ZY5A 1H1RA 4AZVA 3NNXA 3ACJA 4Q5EA 3W2SA 5A6OA 4AW1A 2GQSA 1MRUA 2I6LA 3KGAA 3A60A 4XG8A 1WBWA 4GT3A 4KA3A 4RVMA 5FM3A 2LAVA 4E4XA 4KKEA 4WRGA 3G90X 4OTDA 3Q04A 2FSLX 5DOSA 4ZLYA 4BDHA 2IJMA 5HTBA 3EOCA 3DU8A 3PZHA 4ACMA 2JKQA 4BTFA 5BVEA 3A7GA 3HP2A 3VUHA 2B1PA 3LHJA 2C5NA 2CGXA 5AUVA 1FGIA 4TWCA 3F5GA 4JL9A 2UW5A 4X2NA 1Q99A 1ZYSA 1OECA 4CMTA 2G15A 3ZOSA 4F78A 4E73A 5BVDA 1NVRA 2OZAB 4I1ZA 4O2PA 3MN3A 1ZWSA 4TZRA 3QTIA 4BDCA 4FZAB 2W06A 4RJ7A 4BCMA 5M08A 1QPCA 1UNGA 2IVSA 3DK7A 4PF4A 4WBBB 2GNIA 3G33A 5FRIA 2PMIA 4TPTA 5AAEA 5IH6A 4C3FA 2CN5A 5AADA 5CAVA 1P4FA 3BGQA 5EHLA 1TZDA 3L8VA 2R4BA 3PRFA 4O0TA 3FXWA 3ZXZA 4D9TA 4EZ5A 5EHYA 2VO6A 1PF8A 4FT0A 1PMNA 3OTVA 3MFTA 3UVQA 2YM5A 4NM0A 1WAKA 2QOLA 2X6DA 4KIOA 5B0XA 3P79A 3TJCA 5LWMA 3PXFA 5HBJA 2VX3A 3EFLA 3FJQE 3NUNA 3ET7A 4O7WA 3HNGA 1RQQA 2YHVA 4JDIA 1GZ8A 2W9FB 3GOKA 3NYOA 3F5UA 4ZIMA 2PE1A 3BGZA 4YJOA 4R78A 1S9IA 2YEXA 2QI8A 2Z7QA 2PL0A 3DBQA 4LGDA 3R9DA 3ZM4A 4PV0A 5G1XA 3R1YA 4LUDA 3JY9A 2JDRA 3RVGA 1HCLA 4ORKA 1W82A 3UVPA 1OUYA 2E2BA 3AOXA 4N4SA 3RJCA 3BYSA 5M57A 1GJOA 3UOJA 4XRLA 3O5AA 1OVEA 4M0ZA 5CAPA 2Q83A 2WTKC 5E9EA 2QOIA 2IF8A 2XYNA 2V7AA 3ROCA 4DHFA 4UMUA 3KEXA 3QWKA 4RC2A 4GG7A 1OI9A 3TUDA 4AXCA 5J9ZA 5JZJA 5DH3A 1XH7A 3I1AA 3R7OA 3OP5A 4GRBA 3V5QA 4EK8A 5L8JA 3BV3A 4ZSAA 3PFQA 4HCTA 1WBVA 4FJVA 1UKIA 2HZIA 2VTIA 3DZOA 4O0SA 4Y46A 3JR1A 3AC8A 5AP2A 1MRYA 3HA6A 5CT0A 4FI1A 4C57A 5IUGA 3FL4A 3MIYA 2X7GA 2FVDA 3DAJA 3MS9A 3VS5A 5FDXA 5CU0A 2WHBA 5AR3A 4ZLOA 2UZTA 5E8UA 5TKDA 4O4FA 3F2RA 1OKYA 1OB3A 3QRJA 2BALA 3VUTA 1TFFA 4HZSA 3UODA 4U41A 2BDFA 4FIFA 5FTQA 4EKKA 4O7SA 2Y9QA 1ZY5A 5CI6A 2GNHA 4FTIA 4J99A 3QRTA 3WILA 2VWYA 4BCQA 3QUEA 5M4UA 3GU6A 3LFQA 4J1RA 5D7VA 4J8NA 4BTKA 3TDWA 3P08A 1XH6A 4D28A 4ZSGA 5ANIA 2QG5A 3T9IA 3RZFA 4ASDA 2PVMA 4YHFA 4E6QA 3TCPA 1VYZA 4YZNA 1FOTA 4OTWA 4I5PA 2YIWA 3C0HA 3EN5A 4IX4A 1FPUA 5L2IA 3WZKA 3FEGA 2ZDUA 3RNIA 3ZRMA 2CNVA 4JX7A 5EYCA 3QRKA 3JYAA 2O2UA 5FXSA 3UMWA 3FWQA 4RMZA 5AUUA 5LVOA 1G8AA 1H26A 3DZQA 4IQ6A 3GOPA 4YJUA 1T46A 2BZJA 2QONA 3R04A 4EJNA 2CKOA 4OTQA 4AOJA 2HXQA 2JIIA 1U54A 2NRUA 4RSSA 4OTRA 3TNIA 4AFEA 4F99A 3IDBA 4O7LA 4G3EA 4FRFA 1AD5A 4FT9A 4JNWA 5GHVA 1ST0A 2QURA 1XH5A 3U87A 4O22A 4DH7A 4IX5A 2F9GA 5HU3A 4JRNA 4OTHA 2BZHB 3D0EA 4M69A 3ORPA 3FMEA 2E9UA 4YJSA 4MXZA 1OM1A 3FY2A 1P5EA 2G2IA 2DYLA 4CT2A 3PXZA 5C01A 1XHAA 3UNZA 4EORA 3VBVA 2VTHA 1E9HA 2IZSA 1WBOA 2YLFA 4MQ1A 1Q97A 3ZZEA 1WBNA 3KULA 2X9EA 2E9NA 4C3RA 3F3ZA 3ZFMA 1KSWA 3AC3A 3W55A 4ALUA 5LWNA 3V5WA 2XNBA 4BY9E 3CKXA 2PUPA 4YPSA 1Q8UA 4O4DA 3I4BA 4B4LA 2X6EA 5IEYA 2ZMDA 4PTEA 2GNLA 5HI2A 5IQDA 5E7RA 1URWA 3F2AA 4AXDA 3I5ZA 3LJ2A 1KE7A 4KS8A 3UOHA 2H96A 3QU0A 3IW4A 4QNAA 2CNUA 4F6UA 5CANA 4I5CA 3BLRA 4JDHA 3O8TA 4NK9A 4CZTA 4WA9A 2WU7A 2J2IB 1ZZ2A 4MWIA 3NUYA 3Q4CA 5DEWA 4PMSA 2XARA 2ERKA 3VS2A 2NYAA 3MB7A 1NW1A 2ZDTA 3OHTA 5AP7A 3TEIA 4RQVA 4DGMA 3RNYA 3NSZA 3FE3A 3TZ9A 2C3IB 2EB2A 2WMWA 2YDKA 2VGPA 5HE0A 2W1DA 3GUBA 2VTLA 4AE9A 2XAMA 4ENXA 4LFIA 4FNZA 4J53A 3QQFA 4QP9A 3W0OA 5J8IA 3BPRA 2QOFA 4PMMA 5C8KA 2ZV9A 3JUHA 4FG9A 4Y5HA 4BVUA 2XS0A 5KMKA 3QTUA 1U5RA 4FKJA 4BDEA 4EOOA 4WUNA 4EH9A 2HXLA 2XUUA 5CNOA 3U4WA 3UC3A 2ETMA 2YJSA 4RX7A 5IUHA 3G15A 2Q0NA 3QD3A 4PPAA 2YLEA 2OF2A 3LFBA 2OKRA 4LI5A 4M8TA 2I0HA 4FIEA 4NEUA 4A9UA 4Y73A 5IQBA 4K33A 5DN3A 4O0RA 3UPZA 3KN5A 3V5PA 3ZEPA 3ALNA 2CPKE 3F69A 4PX6A 4IX6A 2JD5A 4CTCA 5CXZA 5A4TA 1JKSA 4LMUA 4I6FA 4NIFA 4EH2A 3O8UA 5IEXA 3DTCA 1OKWA 2HZ0A 4FV9A 5LQFA 2VTJA 1YQJA 5HNGA 3CGFA 4PWNA 3SDJA 4OAVB 2GDOA 2WELA 5J9LA 3LMHA 3R0TA 3KCKA 3MVMA 2WQBA 1F3MC 3JY0A 4FIHA 3OOMA 5HVYA 3CY2A 4I3ZA 3MBLA 4QYHA 4M3QA 2X7FA 2WQMA 1NA7A 2WO6A 4UALA 2Y4IC 4UN0C 3LMGA 4LOQA 3VF8A 2WFYA 2QO7A 4O38A 3RAHA 4CFUA 4FV5A 4L67A 4XUFA 4FOBA 5K4IA 3TNHA 5KMLA 3NUUA 4DGNA 2JFLA 3UP7A 5JRQA 2V0DA 2JGZA 3PIXA 4CGAA 3NAYA 4O1PA 3ZM9A 3BLQA 4FX3A 3DDQA 5LJJA 2C5VA 4IM3A 2B9JA 4NCTC 2Z7RA 2J5FA 3EQDA 4J7BA 5CF6A 3GNIB 5E90A 3JXWA 4D1SA 4FSUA 4FV8A 4AE6A 4QMNA 3KF7A 3SVVA 2X1NA 3TN8A 4EKLA 2B53A 3AT3A 3LCOA 2WMBA 1G8JA 2YZLA 1APME 4XP3A 5D41A 4MXAA 2GSFA 3V8WA 4HPUE 1PJKA 4BC6A 3U6IA 5EDQA 4I0RA 2R9SA 2Z02A 5A4QA 5G6VA 3OUKA 4YTHA 3ZMMA 5E1EA 4QMUA 3SOAA 2AYPA 3MYGA 3PWDA 3BQRA 3F88A 2GS2A 1Y6AA 1YWNA 2VO7A 2J0KA 2Y6MA 4DC2A 4O4EA 4UEUA 5EYDA 4EQUA 3D7TB 3GU8A 3WIGA 3G2FA 2JEDA 2ZAZA 4I4EA 5GZ8A 3I7BA 2UZDA 1FVVA 2X0PA 4BDFA 3RZBA 5K3YA 3UP2A 4JQEA 3ENMA 4RIOA 3PSBA 5CENA 4ALVA 3OBJA 5CYIA 2VZ6A 3HDMA 3LFDA 3LW0A 5ANEA 3UYTA 2W5AA 3OWKA 1JQHA 3S4QA 4O2ZA 3OUNB 4D4YA 4HYUA 3VS7A 4AA4A 1V0PA 5IA0A 4QOXA 1NT2A 5EQPA 2XBJA 1KUTA 5HX6A 3MH0A 2QD9A 1ZLTA 2W96B 5B2KA 4YURA 3G51A 4RX8A 3W2PA 3IKAA 4XP2A 4A4OA 2X4FA 1B38A 2CCHA 4D2WA 1GIHA 4DE4A 2WXVA 2YIYA 3SV0A 5AV3A 2ETKA 2R3OA 1TVOA 2W4JA 1YI6A 3OXZA 5CZIA 4O0VA 4DBXA 4RC3A 2I0YA 2X8IA 1H28A 3BKBA 3QQUA 1Q41A 3UIMA 3OOGA 4GIHA 4QDVA 1PKGA 4WNOA 3G9NA 5CEQA 5EW3A 4GV1A 1Z9XA 2VTMA 4HGTA 4RVLA 4ZJJA 3QQLA 4MF1A 4FKWA 5HBHA 2OBJA 4CQGA 4HVDA 4BZDA 5LVPA 2V22A 2PZIA 3MJ2A 3L9LA 3GGFA 1F0QA 2YJRA 4C0TA 2BTSA 2J50A 5M07A 2EU9A 4CVAA 5IQHA 4BDJA 2QC6A 4Y85A 2QLQA 4J98A 4O27B 4Q9SA 2O8YA 4RVTA 3BBWA 2WQOA 1BX6A 2XNEA 5M4IA 3QCYA 4KIKB 1XBCA 1CM8A 3GXLA 3AC4A 3O2MA 4IWDA 4L7SA 3KN6A 3UDZA 2CN8A 4YLLA 4I41A 3ZUTA 1IG1A 4FE2A 4AQKA 3RKBA 3TZ7A 3KRJA 1W83A 2HOGA 3I5NA 4YPDA 4I21A 4RIWB 5F95A 3UTOA 2B9IA 4GFMA 4I0SA 3M2WA 4QMYA 3BEAA 4C35A 4BIBA 4DG0E 3Q5IA 1PMUA 3T3UA 4O6LA 3ZLSA 4FEUA 3Q32A 2XIKA 3VS4A 5BVNA 3ZFYA 5JGDA 2A1AB 3VUIA 4FGBA 4LYNA 5EI2A 5CQUA 3MGYA 3GCVA 3O0GA 3W8LA 4C2VA 2R3MA 4EBVA 4HVHA 4I94A 3O71A 4GYIA 4FIIA 1YXTA 1YI3A 2QOBA 5EI6A 2OH4A 4B9DA 2NO3A 3A4OX 1OL5A 4R1YA 2G01A 3LPBA 4A9TA 4B6LA 4HGLA 4GFOA 4L52A 4ZXTA 4BDBA 2ETRA 1M14A 4TYIA 2B0QA 3VAPA 5EG3A 5C8NA 2GFCA 3GCQA 3GT8A 2O5KA 3VBYA 5LMBA 3H30A 2FUMA 3MFUA 3O51A 1G8SA 2VWBA 4BF2A 4D5HA 5M51A 3TWJA 5DEYA 4RA5A 5HLWA 3E62A 1WBSA 4LV7A 4RWLA 2XK9A 4UBAA 4EOKA 1JSTA 4IDVA 3COIA 2X0QA 3KVXA 3RINA 3EMGA 4TNDA 4ACHA 5HNIX 4DCAA 2WTWA 3SRVA 1ZAOA 3HP5A 5CY3A 3UO6A 1YXXA 2OJJA 4JR7A 1O9UA 3CGOA 5AUYA 5IF1A 5JH6A 3QCXA 2HELA 4W4WA 4BDIA 4WG4A 2OFUA 4L44A 3MB6A 4MKCA 3VBXA 3GCSA 3MSSA 2P0CA 2OIDA 3NUSA 4B7TA 4ACCA 2W4KA 5IG1A 3LCSA 4CFWA 4DFUA 5ETAA 2WU6A 3C0GA 1GIIA 1YXUA 4UZDA 4RLKA 3V04A 3HAMA 1UU8A 2GNJA 5A4LA 3UG1A 2UW0A 3G5DA 3ZUVA 2J7TA 5AX9A 5C03A 2R3NA 4YO4A 4R5SA 1H1PA 3MWUA 4A9SA 1DS5A 5IKWA 3PRIA 4FEVA 5K0XA 5KMMA 5HX8A 3ZTXA 5AR7A 4RX5A 2PSQA 4BIEA 3HAVA 5BV3A 4FTNA 3E92A 4IWOA 4GMYA 4UWYA 3EKNA 5FD2A 4C8BA 3AQVA 3FPMA 4IFCA 4QT1A 3SC1A 2O65A 3B2WA 3DB6A 4KINA 1ZMUA 4DHZA 4BBEA 3KK8A 2VTPA 2OI4X 4LUEA 3RM7A 1Q61A 2X2LA 4YO6A 2UVZA 4QP7A 3I7CA 3BHHA 4NSTA 4PY1A 3KQ7A 4DDIA 4ZTSA 2CSNA 3C0IA 4P90A 2WGJA 4K8AA 1UNHA 2BHHA 3A99A 4CCUA 5CU3A 1JNKA 4F9WA 3TV4A 4AN2A 1RE8A 4IVDA 4U9AA 3FY0A 4V0GA 4I4FA 5AFVA 3ORZA 3HLLA 4AFJA 1EH4A 4EQCA 2XIZA 2X2MA 2YWPA 2PE2A 3O7LB 2IZUA 3FHRA 2JDVA 3QTXA 4A4LA 1P2AA 4Q2AA 1O6KA 3N4UA 3DQXA 4QP6A 2PZPA 5FEQA 3KXNA 3PSDA 2CMWA 4EOMA 5DA3A 2BMCA 5DFPA 5JSMA 3QA8A 4KKGA 2CGVA 4FNWA 1WVWA 3EL8A 4FV2A 4BCFA 4QYGA 4OT6A 3W18A 2IVTA 3FI4A 4E5AX 3DNDA 3FKNA 3KU2A 4I92A 5EDPA 2QNJA 1VJYA 3UQCA 3ZO3A 2BR1A 2BZKB 3FYKX 3Q4UA 4CTBA 5J95A 4B8MA 5BYLA 4BGQA 3FLWA 1JWHA 3JS2A 4QP2A 4XG4A 2PVKA 4BDGA 3QC4A 3L9NA 1XH9A 2PVHA 3NR9A 4ITIA 3JVRA 2V62A 3CSVA 4DAWA 5A14A 3CKWA 3BWFA 1LP4A 3BV2A 1JKTA 3FV8A 4FV6A 3AKKA 3VBWA 1VLRA 1ZMVA 3E7VA 5JGAA 5ANGA 5HBEA 3Q2JA 3DJ5A 5GIPE 4ZY4A 1U54B 3FMLA 4IAKA 1ZY4A 4U43A 3HUCA 3NPCA 4GK4A 2X8DA 1KOBA 2HAKA 4N70A 4U80A 3RPRA 4D4SA 4GUBA 4IZ7A 5BQ0A 3WI6A 3FLYA 4DHIB 1IA8A 4M69B 1Q8ZA 5M55A 2HWPA 3NVMB 2BZIB 3BLAA 3D2IA 4FTJA 3TTIA 4JJRA 1H1WA 5DRBA 3T9TA 3ATTA 3WZEA 2VD5A 3BE9A 1UKHA 4QP3A 4KIPA 4K9YA 3I60A 4NKSA 2PULA 4IZ5A 1BL7A 1YW2A 3BBTB 4OTPA 4D0WA 2C3JA 4FKTA 2BCJA 4EBWA 2BRHA 2ZM4A 2JKKA 2P3GX 3A7JA 3DDPA 4FL1A 3AMBA 3QGWA 3ZDIA 2R0IA 3DKFA 3QZFA 3PLSA 3NYVA 4IAIA 1NY3A 3TIZA 3PPKA 3TJDA 3RM6A 2UVYA 3ORXA 3ANQA 3NCZA 2C69A 3TKUA 4X6RA 2W05A 3HUBA 2OJIA 4QMOA 4BKYA 3FXZA 2XIYA 3GC7A 3MW1A 5BUJA 3RTPA 2AEGA 1SNXA 4X3FC 3VO3A 4C38A 3PDTA 2KTYA 3RPVA 5AR2A 2XALA 1RW8A 1PXMA 3R1SA 2IZTA 4QNYA 4ZZMA 2QCSA 2CKQA 5IQAA 3MPTA 3IOPA</