2Z60A

Crystal structure of the t315i mutant of abl kinase bound with ppy-a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
284
structure length
281
Chain Sequence
GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystal Structure of the T315I Mutant of Abl Kinase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 88
structure length 281
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z60A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z60A01
3D83A 4U7ZA 2WAJA 2WTIA 1YHVA 2JFLA 2VTHA 2XEZA 4RA4A 3F3UA 1IRKA 2NNWB 4UN0C 5JQ5A 2BRMA 1PHKA 2IG7A 3AD6A 2GDOA 4RT7A 5KMLA 5HORA 2QOCA 2C6DA 1KOBA 2XM9A 3L9NA 3A99A 3CXWA 4EJNA 4D4YA 3NNXA 3M11A 4FTLA 4MKCA 2RFNA 1U54A 4QQJA 2QQ7A 5EI6A 1OPLA 3WIKA 3N9XA 4PP9A 4XH6A 4NM3A 1KV1A 4JX7A 2HIWA 5EQYA 1H4LA 4ITIA 5J5TA 3CTJA 3AD5A 5D11A 3FC1X 1UU7A 3BZ3A 4XRJA 5AP5A 3ROYA 2PK9A 3ZO1A 4KB8A 4C7TA 4O91A 5FTGA 1CM8A 2VX1A 3NCZA 2Y4PA 4C62A 3QXOA 4MXXA 3ZO4A 2OIQA 3VN9A 4S32A 5IA2A 1XHAA 2QC6A 1QPEA 4GIHA 5DG5A 2QOHA 4EH9A 5ICPA 5L3AA 3QALE 4ANQA 3F66A 4FZ6A 4KSQA 3EFKA 4NM0A 4OTWA 1VZOA 2HK5A 4FKLA 4GYIA 4NK9A 5B2KA 2V55A 3MFRA 4FK3A 4LGDA 5AX9A 5KX8A 5CAPA 2C6EA 5KNJA 4PDYA 3RWPA 5BVNA 4CV9A 4RC4A 3VAPA 3DAJA 5JFWA 2Y4IC 5JQ8A 3U51A 5HLWA 3GBZA 5KCVA 4C34A 4DH8A 2XRUA 2RG5A 3KXXA 1VYWA 4KS7A 2GNJA 1G5SA 2QD9A 3GU8A 2E2BA 2XKFA 4U97A 2DYLA 4H3QA 1W8CA 3H9RA 3R02A 3HUBA 4JBOA 4LUDA 1P2AA 3DZOA 5A14A 3DOGA 4F0IA 2WPAA 2XNEA 1FGKA 4NJDA 5M53A 2BALA 2ITQA 2B7AA 4I4FA 3FZPA 2G2IA 2ZJWA 2UW9A 2J0MB 2VNWA 4IJPA 5KMOA 5E8YA 2Y6MA 4I6HA 4L7FA 1V0OA 3R83A 4IWQA 3LXKA 4RJ5A 2NPQA 2PSQA 1BYGA 4CQEA 4YPDA 4APPA 5CQUA 5DN3A 5HO7A 3ORMA 1PYEA 2JDOA 4LM5A 4XG7A 2X9FA 4DH1A 3ORXA 4FUYA 3UMXA 3NX8A 3NRMA 2Z60A 4L3LA 3LM0A 3E8EA 3F2RA 1H0WA 1J3HA 3RMFA 3FMDA 5DR2A 4X2GA 1OB3A 2YCSA 3ATSA 4EEVA 3UIUA 3VUDA 4DEEA 4DAWA 3FLQA 3OOMA 4CSVA 3SAYA 3DK3A 3W8QA 4KWPA 1WBPA 3WF8A 1UU9A 5IQAA 2FGIA 2GU8A 3D9VA 3Q2MA 2VV9A 4JL9A 4U6RA 4MXZA 2RFDA 5HCXA 5BVEA 3BEGA 2A1AB 3C1XA 4FSUA 4N6YA 3PDTA 5TE0A 1YVJA 3LOKA 4ZLYA 2Z7SA 4BCIA 2BR1A 2ITTA 2YCQA 4FL1A 3SGCA 4L53A 3GCPA 3KVXA 1Z57A 4OGRA 3MH0A 1I09A 4FT0A 3ZFXA 1ZZ2A 3I4BA 2RKUA 4PQNA 3WYYA 3EFWA 3HEGA 4JG6A 3EYGA 2OGVA 1CKIA 4QP6A 3GB2A 3R1QA 4FKWA 3PZHA 5ACBC 3KK9A 3HRFA 3ZEWA 3FQSA 4LL0A 4NM5A 3CY2A 2OU7A 3KFAA 1S9IA 1KUTA 3TG1A 5EI8A 3BE9A 4Q9ZA 4E5WA 4JLCA 3S4QA 1MRVA 4S33A 1M17A 3KF4A 3FMKA 1Y57A 3L8XA 5CENA 1O6LA 1JBPE 2OZAB 5FP5A 3TUCA 5FDPA 1GZOA 5IMXA 4UZHA 4AZEA 3HA8A 4EH8A 4FZ7A 3FPQA 4AT5A 2UZTA 2RGPA 3ULIA 1WVXA 5AP1A 4ZY5A 5J7BA 3DBEA 4JRVA 4BKJA 4HOKA 1J1CA 1BUHA 4E4MA 4DBXA 2ETRA 2BZIB 2P3GX 3NUXA 4JRNA 3KXHA 4J53A 5EH0A 3R7IA 4N6ZA 5EDRA 3TUBA 3MGYA 4RIYA 4ZEGA 3GVUA 5FM3A 2BDWA 3L8SA 2ZOQA 2OKRA 3TZ7A 4QP2A 2J0KA 4AWIA 2PZPA 2YDIA 3AT4A 4JR7A 2KULA 5CF8A 3EQCA 5LQFA 2J9MA 5AJQA 2DQ7X 2R2PA 2WMQA 4DYMA 4Z55A 3B8QA 3MY5A 2AUHA 3EQIA 3OWJA 3CQWA 3P9JA 3POZA 2DS1A 2PE2A 3QA0A 1JPAA 3QXPA 4G31A 4O38A 3PZEA 3QWKA 1H01A 2Z2WA 1QPDA 3CQEA 3FPMA 4G5JA 3UOHA 3PFQA 3A4PA 3BYSA 2QR8A 1SMHA 5ANKA 3RPSA 4EONA 1ZMUA 3UNKA 4F99A 1RE8A 4ITJA 4UMQA 4BDKA 4QMTA 4ACGA 3PIXA 2VWVA 3BI6A 2WO6A 3LFQA 2X7GA 4PDSA 2X39A 4OTPA 4L3PA 4NIFB 3OWPA 2PVKA 3MJ1A 2HXLA 3OG7A 4FODA 4YLLA 4DTAA 3QGYA 5AUTA 4F6WA 2YM8A 3P7CA 3NPCA 4PWNA 1XH6A 4XMOA 2B54A 2VTMA 3QLFA 4B6LA 2YERA 4BYJA 5IU2A 3RTPA 5HLNA 1JKTA 4O0UA 1TQIA 5HBJA 2PHKA 5KKRB 4FKPA 2WTDA 4QMNA 3VQUA 1Y91A 1OUYA 4FSNA 4Y95A 2VO6A 3LLTA 3LAUA 3MPMA 4BTJA 3PIZA 4XLIA 3PJ1A 5KBQA 1OVEA 3I6UA 5JRSA 5C8KA 3V8TA 4RFZA 4G17A 4USFA 2Y8OA 4O6EA 4O1PA 5L8LA 3TNIA 3UJGA 4CKIA 5EG3A 2B9FA 2VN9A 4C2VA 5IH6A 1XR1A 3AC5A 5K3YA 3RGFA 5JT2A 4MQ2A 1OKWA 2R3IA 3DBCA 3I6WA 1TKIA 3R7YA 4PNKA 4NUSA 3QHRA 2EXMA 2YAKA 4ITHA 4O0XA 3V5WA 2OWBA 1K2PA 3FSKA 3NNWA 4DG3E 3DTWA 4TRLA 5GJDA 2C3IB 4AFJA 1Y8GA 2HAKA 3PP0A 4DTBA 3QWJA 4IB1A 3EWHA 4I93A 5AA8A 5DR6A 3U55A 3CTQA 5DR9A 2BIKB 4WUAA 3MH1A 2UZBA 3QQHA 4RFMA 3FXWA 2R3MA 2YZAA 5T6KA 2OH0E 5JFXA 1GOLA 2EWAA 4FNYA 4EHGA 3PA4A 4PNIA 3ZBXA 4EK4A 3ORIA 4JT3A 1XH4A 4F65A 3FBVA 1FMKA 4MWHA 4I22A 4CV8A 4GCJA 4Y8DA 4ZSAA 5IQIA 1Q4LA 2JAMA 2VWUA 3NUNA 3R1NA 3RK5A 4ANLA 5A6OA 3R73A 5KMMA 2BAKA 5J9YA 4YC3A 5I9ZA 4IMYA 5FWKK 4IVBA 4AGUA 2PU8A 1Q8TA 3ZTXA 3OVVA 4X3FB 3SV0A 2YLFA 4GL9A 2QG5A 4PMTA 3VS7A 5J95A 4NWMA 3R28A 3DKCA 4WRGA 2RSVA 4O84A 4K9YA 4P4CA 4U41A 1PF8A 2UZLA 2GMXA 5A3XA 5TKDA 2YIYA 1Q8ZA 4EI4A 4I6QA 4IFCA 1G8SA 2I0EA 2BFYA 3DK7A 1JSUA 4X6RA 4AA0A 3C0GA 2ZDUA 3LHJA 3R7GA 3NCGA 2BAQA 4RIYB 3C0IA 3QUPA 5AIRA 4AN3A 2PVMA 4ALUA 5CSXA 3K3IA 3KQ7A 3OWLA 4YTCA 4RFYA 4GJ3A 5FDXA 5HE1A 5LMAA 4O7TA 3C7QA 3G6GA 3ODZX 3VUGA 4TN6A 5KMKA 3ERKA 4RIOA 3PIYA 5DI1A 4DE4A 1PJKA 2XIKA 4EBVA 2WQBA 3QC4A 3FHRA 3LQ8A 3D4QA 2ITNA 2IVSA 5AP2A 2BHEA 4L67A 4FV2A 1FPUA 3AC3A 4I5HA 2IW8A 3LJ2A 5DMZA 3UO4A 4S34A 5HG9A 3FY0A 4C37A 3ORKA 4OTFA 5L6PA 4JBPA 4RX8A 5CZIA 4BDCA 5B2LA 2OI4X 4X0MA 3I5NA 2PY3A 4FIJA 3FMLA 3V04A 4JAJA 3GC9A 4M12A 4I0TA 4PY1A 4WG4A 2GTMA 3FJQE 4XG6A 4UZDA 3UNZA 3K54A 4E7WA 3UGCA 2EXEA 3BCEA 5C8MA 4Y72A 4Z3VA 3FXZA 4NTSA 4QMWA 4CTBA 5K4JA 3H0YA 5LJJA 3MI9A 2OJJA 4FTJA 4WKQA 4E6CA 2BTRA 3SQQA 2WTWA 2PE1A 4BGGA 3P08A 4W8DA 4BI2A 3VS5A 1NW1A 1M2RA 4FG9A 3NNUA 3HAMA 2B55A 1H25A 5HQ0A 4ANSA 2W4JA 3MVMA 3QQFA 1K9AA 1YQJA 3H10A 4RIWA 3F61A 4ZZOA 4DT9A 4E5BA 3M42A 5JZNA 2WB8A 2CJMA 4FOBA 2QLQA 4WSQA 5B7VA 5K4IA 2WTKC 1IG1A 2G15A 2QU5A 3GOPA 4IM2A 5B0XA 4DEBA 1KSWA 3GENA 2OLCA 5M08A 3RCJA 5BUJA 3HRBA 3QTZA 1Q61A 1SZMA 2IZUA 1OPKA 1F3MC 3MY1A 5BVKA 2ITXA 5C9CA 2Z7LA 2QHMA 3GP0A 3E93A 1Q3WA 3QZIA 2BDJA 4U81A 3GCQA 2J51A 5DOSA 1LEZA 3TUDA 1PMNA 4KUJA 3DA6A 3O96A 4CYIA 4ID7A 2YFXA 4GKHA 5BYZA 4D0WA 3QX4A 4J52A 3BU6A 3Q4TA 3OUNB 4EOLA 3R9HA 2NRYA 2VAGA 4S2ZA 1UKIA 5EKNA 1QPCA 4DGGA 5CT0A 4AZFA 4GEOA 4D1XA 3DB6A 3HMIA 5E8SA 3UQFA 3F6XA 2CCHA 3AC8A 5M44A 4I0RA 1W83A 4QMUA 1Q5KA 2WU7A 2Y9QA 1BL6A 4AGWA 4BTMA 5HVKA 3MIYA 3MTLA 3D94A 5TR6A 3BU5A 5IEVA 3O7LD 4CCBA 4MXYA 1DAYA 1OL1A 1URWA 2C6LA 4GU9A 4APCA 5HNIX 2PVJA 2WTCA 3KXZA 4Q9SA 5LARA 2HZ4A 1SVEA 3Q3BA 2XP2A 3FHIA 4EWHA 4FTCA 3GEQA 5KO1A 2WD1A 3Q32A 2ZV7A 4O0TA 1WZYA 4IM0A 3O8TA 4AOIA 4E1ZA 3MA3A 4X7QA 3BBTB 3Q9YA 3UG1A 2ZMCA 2CMWA 3PSDA 4CZYB 3LMIA 3HL7A 4PMSA 2WQOA 4FV1A 1NVSA 2YA9A 5HICA 2YM6A 3BWJA 4DG2E 4F6UA 3Q4ZA 4IB5A 2XMYA 5KHWA 4C36A 3CSVA 3UVQA 3O7LB 5HKMA 4YURA 5HIEA 4DEIA 2Y6OA 4Z16A 3H4JA 2X4FA 3KF7A 2CDZA 5CLPA 3UO6A 3UQCA 3CQUA 4E20A 4IM3A 5CAQA 5H8BA 2JIUA 5ETCA 3ZM9A 4I0SA 1SM2A 2NRUA 3WIGA 2XA4A 2QOIA 3LXLA 3UMWA 4D2PA 1MRYA 1RJBA 4L46A 3OCTA 4QQCA 4JQ7A 4QTAA 4F1TA 4YNEA 4PF4A 2Y7JA 2O0UA 2XNBA 4CMUA 4TYHB 1UWHA 2PVHA 4RC3A 3RHXA 3UPZA 5ANOA 4V0GA 1WCCA 2J0IA 2W1IA 4IAFA 5I9XA 4O7RA 1A48A 3MB6A 2VGOA 1M2QA 1W98A 3LMGA 4TTHB 5CYIA 4G3DA 5H9BA 5KUPA 3QKKA 5CVGA 1H8FA 2W5AA 3ULZA 3KRRA 3ZLXA 4DCAA 4PUZA 2HW6A 2OK1A 5EYKA 4FSTA 2C4GA 4IXPA 5C27A 5FUTA 1H07A 4D0XA 4EZ7A 4PL4A 1H24A 1PY5A 1IEPA 3MH3A 3U87A 2BCJA 5FEQA 3EKNA 4WIHA 5AUWA 4Q5HA 5HZNA 3UOJA 5HG5A 3DAKA 1JWHA 3FI2A 3MFSA 3QFVA 3PWYA 3RVGA 5EOLA 4AN9A 5DA3A 2C5NA 3P7AA 5J9ZA 2R3JA 5CS6A 4D9TA 4PPCA 5AM7A 2NP8A 4AZSA 3JYAA 3UVRA 3L9LA 4O7YA 5GIPE 4O82A 5TO8A 3V5TA 4UWYA 1OZ1A 4BBMA 3TNWA 3ORPA 4ENXA 4M13A 2OXYA 3NVMB 4K2RA 4IX4A 3FLYA 2IVTA 4B0GA 2RF9A 4PTEA 4G34A 2RG6A 2I6LA 3HP5A 4GK2A 4QTEA 1VJYA 4NCTA 5CU3A 4EHVA 2QLUA 3LMHA 5DEYA 3TEIA 2I0YA 3VS6A 2XKEA 2HW7A 5E8ZA 4BCKA 3NW7A 4FVQA 2XJ2A 2R3PA 1PMVA 2WMRA 3OW4A 3KN6A 4QMLA 4ONAA 4EL9A 3L8PA 4GFGA 3C4FA 1NVQA 3KXNA 1YKRA 2VWYA 3THBA 3A7GA 3WZJA 4JJRA 1ZYCA 4M68A 3F3WA 5HLPA 4I21A 4IAZA 2WIHA 3NSZA 4E8AA 4PDOA 1Q8YA 5L2SA 4ZY6A 3EN6A 2JAVA 2E9UA 1E1XA 4BCMA 4BWKA 3TM0A 3MS9A 2C5OA 3KL8A 4BL1A 5K5XA 4EQCA 2J6MA 4GVJA 3ELJA 4Z7HA 5J1WA 5M06A 5AUZA 4XP0A 4AZVA 5I4NA 3SRVB 2E9OA 5F95A 4DC2A 3SG8A 3OZ6A 1B39A 1FBNA 2UW3A 5HIBA 4XOZA 4DH7A 4KKGA 3SXRA 5AM6A 3PA3A 3FLWA 2QURA 4YBJA 3DU8A 4ANOA 5EQEA 2O5KA 2XJ1A 1JNKA 3BHVA 4C02A 4FKIA 4NU1A 2C0TA 3ACJA 1J7IA 3BPRA 1QPJA 4FV8A 2FA2A 3D5VA 4QMYA 1H1SA 4D5KA 3LQ3A 3GC0A 4DA5A 1ZY5A 4C3FA 3GCUA 5IEXA 4GFOA 5BVWA 4EK8A 4GV1A 1S9JA 4DEGA 4MK0A 2B9IA 2V7AA 2X6EA 4ZTMA 3ZC6A 3RAWA 3CC6A 4GIIA 2DWBA 2PZIA 2WU6A 3L9MA 3ZEPA 4UB7A 1AQ1A 4FNWA 3DJ7A 4U8ZA 4EH2A 4MAOA 5BVOA 4EOSA 3ETAA 4I4EA 2ZM3A 5HX8A 4RBLA 4O7SA 2ETMA 5D12A 2QU6A 2QO7A 3R7OA 2YIRA 3TNQB 3PPZA 2G9XA 2JD5A 5CEMA 2JDSA 2R3KA 3II5A 3ORZA 5EK7A 3TZ9A 4BIDA 3UZPA 1OKZA 4M67A 2F49A 3VJNA 4DGNA 2XYNA 5IDNA 3Q4UA 4GW8A 3TXOA 5C01A 3W2QA 4DEDA 4J1RA 2IVVA 4M7IA 5DE2A 3U9NA 2VO0A 2GFSA 3QZFA 5BUEA 2CKOA 3VBTA 2WOUA 3UE4A 4B99A 3E8DA 3B2WA 3G90X 4JI9A 4FE2A 3ZYAA 3QTQA 3UIMA 2R5TA 4N4SA 5IMEA 4HNFA 3NEWA 3DT1A 2PMOX 3HZTA 3CKWA 3CY3A 2J50A 4QNAA 5EOBA 4E5AX 1E9HA 4QO9A 3UVPA 4O0YA 4XOYA 2ERKA 2JLDA 3KRWA 4DLJA 3VRZA 2BMCA 5LCJA 4I3ZA 5J9LA 3ZUTA 2VTTA 1ZOGA 4NM7A 3R30A 4FT5A 3Q5ZA 3EQBA 2QNJA 4RRVA 2O64A 1M2PA 3IG7A 2GQSA 3Q6WA 4DFNA 1EH4A 5FBNC 4GYGA 2JFMA 5I3OA 3CCNA 3VHEA 4I5CA 4UWCA 5DRBA 2QR7A 5IQGA 2XIRA 4YGAA 4E3CA 4FL2A 2X0GA 5L2IA 4OR5A 3IO7A 4LOOA 3PG3A 2YM4A 4XCUA 3RNYA 3MPAA 4FOCA 5E8WA 2V7OA 3VW6A 1J7UA 3Q04A 4ORKA 2BRGA 3FAAA 3TIZA 2VRXA 3GQLA 4AQCA 4NJ3A 5HD7A 2W9ZB 4LV5A 2UW7A 4V05A 4FSQA 4Y85A 4IFGA 3HV7A 3CE3A 2QOBA 1TQMA 3TV7A 5CAOA 2F2UA 1OKYA 1PYXA 3ZDUA 4CFVA 4DG0E 5I9YA 4MEDA 3IGGA 1V0PA 4WNKA 4EC9A 4PPAA 4AP7A 4AW0A 3FKNA 3A61A 3T3VA 3U4UA 4EWQA 4PTGA 3AG9A 3MYGA 4QYEA 4EK5A 1ATPE 3RALA 3UTOA 4WNPA 1KE9A 3ZXTA 3EQFA 2IZRA 3QAME 4AACA 2Z8CA 2JDRA 2C0OA 4A9UA 4QRCA 3JVSA 2W0JA 4HGEA 2XIYA 4XV1A 3WOWA 2FSMX 5CU4A 4F7LA 2C6MA 3BHUA 5H8GA 4BN1A 4M14A 3QD3A 5A6NA 3PUPA 4F70A 1WBSA 3G15A 3P0MA 2OZAA 4EH3A 2VO3A 3I60A 3OFMA 5E92A 3KULB 2OF2A 1UNLA 4XP2A 2CGXA 4H58A 1SNXA 2UVZA 3VUMA 1R3CA 2XK7A 3ACKA 3F9NA 3FI3A 3O17A 4PL5A 3OOGA 1YOLA 2A0CX 3WE4A 4TT7A 4C38A 3EL8A 3RNIA 3BGQA 4AT4A 4AS0A 3LJ0A 1NA7A 3PLSA 3SX9A 2XK3A 2BTSA 4KNBA 5C03A 2GNFA 5KMNA 4QP7A 1OMWA 4C33A 3PXRA 3EL7A 3EB0A 3UIBA 4CG8A 3F69A 4RJ4A 4R1YA 3O2MA 1HCKA 5DH3A 3S2PA 2C1BA 2W4KA 2JDVA 4AE6A 3DCVA 4OBPA 5CSHA 3RM7A 1WMKA 1W7HA 4QQTA 2BZJA 3EZVA 4FKOA 3KMMA 3F5XA 1OECA 3PRFA 4IWPA 5CSVA 2IZTA 3VUIA 3FMNA 4Z7GA 2BPMA 4CKRA 4NIFA 3KC3A 2QOOA 1WBWA 3BGZA 4M66A 3I7BA 4GK4A 1R0EA 3GOKA 4BCJA 4RMZA 4GH2A 2WZJA 4NYEA 4GG7A 4D28A 3ZOSA 3HA6A 1OL2A 4PTCA 1NY3A 4ASZA 5E8UA 3UZTA 2FO0A 3O8UA 2RFEA 2GQGA 2YCFA 3PXZA 4M97A 3K5UA 2OZOA 4IADA 4MD7E 2Z7QA 4O96A 3GU5A 4R7HA 4KD1A 4K1BA 4JOAA 3PXYA 4D2SA 2W1HA 4HYHA 2CNQA 2GS2A 3SDJA 1FVRA 3KMWA 3CEKA 3IQ7A 1CKJA 1M7NA 2P4IA 5DRDA 4GFMA 4NFNA 3AMBA 3KEXA 1OI9A 1MRUA 3NNVA 5AEPA 2JBPA 3JY9A 3F5UA 4IBMA 2QOKA 4E4XA 4OBQA 5AP0A 3NAYA 3QTWA 2OIBA 1ZRZA 4I6FA 4R78A 3TDWA 4MCVA 4BIEA 3TI1A 4EOMA 2QG7A 4M15A 4K11A 3E64A 2CSNA 5C1QB 4RLKA 3PJCA 5HIDA 5M4FA 2XK4A 4QMZA 3TCPA 4RIXB 3IKAA 4WG5A 5CSWA 4JQEA 3ZRLA 1YXSA 3FC2A 1P5EA 4DGOA 3GCVA 4WHZA 4J71A 3NWWA 1JKSA 2OICA 4FEXA 2I0HA 3EN9A 2XK9A 4CFUA 4LOPA 4EK3A 1ZYSA 1B6CB 5ANGA 2XIZA 3EQGA 5KBRA 1SVHA 4KABA 5HESA 3N51A 3NYXA 4YJRA 1R78A 3V01A 1U4DA 2OH4A 4R1VA 4TXCA 4YJPA 3VQHA 4HGSA 3HECA 1JKKA 4FT7A 2O65A 4FV4A 3RAIA 3RK9A 3E87A 2CNVA 4K77A 4I24A 4LMNA 3PXFA 4NSTA 3OWKA 2YZLA 2YJRA 5L2QA 4CZTA 4O7VA 4JX3A 4X2FA 3LLAA 3ZO3A 2HWPA 2B52A 3LFSA 2VTLA 4K6ZA 3VW8A 4D5HA 4X3FA 5E8TA 3BLQA 1YRPA 3DDPA 1TQPA 5DFPA 1BKXA 3PRIA 4JVGA 4MWIA 2OSCA 2ITZA 4IANA 4G3FA 4O83A 3QUEA 3DDQA 1ZOEA 2VZ6A 3NGAA 2YIQA 4F1MA 3QU0A 3JVRA 3CKXA 2CKQA 2CN8A 2X6DA 4C35A 3OC1A 3LQ5A 2Y0AA 4ALVA 3Q52A 4AZWA 3OP5A 4QP9A 5EYMA 5IA5A 3DK6A 4KBKA 5DT4A 3KN5A 5DPVA 1J91A 4HVGA 4NH1A 2R3QA 3R8VA 3BELA 2WQMA 2B1PA 4FSZA 5EW3A 4F9AA 2CNUA 4J8NA 3V51A 2J5EA 2VUWA 2PUIA 1PXOA 3RAKA 1VEBA 3ZM4A 3DB8A 4C57A 4C61A 4RVLA 3SOAA 4WA9A 1H1QA 3FSFA 4USDA 3AXWA 3TTJA 4UMUA 2BIYA 1YHWA 2VX3A 4FKJA 2OJIA 3KGAA 4U3ZA 4YR8A 4JDIA 1PXMA 5ANJA 5E7RA 4FKQA 4WO5A 3R8ZA 1BI8A 4XG2A 2UZDA 3QBNA 5L6OA 4FEVA 4UXLA 4WG3A 5IA0A 4UYNA 4XHKB 3EN5A 4W4XA 4KKHA 5HO8A 4WD5A 3MVLA 1Y6BA 3CPBA 3ATTA 2R3LA 2R3HA 3CPCA 3FE3A 2HELA 2CGUA 3KMUA 5GNKA 3RI1A 4HW7A 3PVGA 3PLAE 4MF1A 4FICA 4FTUA 3HV4A 3EFJA 4A4OA 3C51A 2WTVA 5FEDA 5DIAA 4PX6A 1Q97A 3FL5A 4CFFA 5LVLA 4A9TA 4FTIA 4RWIA 3W16A 5CXHA 4ZLOA 2FUMA 3VJOA 3IDBA 2W1CA 2XNOA 1MUOA 4F0GA 3IOKA 2ZDTA 2PMNX 4Q2AA 3W55A 2XCHA 4CXAA 4YLJA 4FTAA 3COMA 2WKMA 5JN2A 2QCSA 3SXFA 1DI8A 1UVRA 3ZC5A 4JQ8A 5DNRA 3OTUA 3OT3A 4X21A 4IIRA 2HENA 1UU3A 5DT3A 3CJFA 1XBBA 3RPVA 2B0QA 3AOXA 4FG7A 2H8HA 1CKPA 3IOPA 2B9JA 4IZYA 1OIQA 4JIAA 4X6QC 3E8NA 1GZKA 4FIGA 3WZEA 5JZJA 4D1SA 3F3TA 2RIOA 3PE2A 2BZKB 3L1SA 3QLGA 3NMUF 3O51A 4FIHA 4O6LA 2PVFA 4H05A 3RP9A 3BX5A 4CRLA 2HZIA 4RPVA 4TYEA 4EOJA 4UXQA 4DT8A 3G9LX 4IAKA 2VWZA 4QTCA 1YI6A 3OT8A 2PMLX 4FTTA 4KAOA 5L6WL 4DFXE 3ZDIA 5HE2A 4OT6A 3I5ZA 4AU8A 2ZMDA 4F1OA 3VO3A 5CANA 4CCUA 2XK8A 4BR3A 4EOPA 4CLJA 1JLUE 4DCEA 3DXNA 5AFVA 3RHKA 4B7TA 2W7XA 5H2UA 5D7VA 2PULA 5CU2A 4ACDA 4L43A 4OUCA 5JFSA 2GTNA 4ZIMA 3WZUA 5CI6A 3C50A 4G3CA 4MBJA 3P4KA 4BGQA 2PTKA 3HUCA 3LCDA 2ZM1A 3NUSA 4IZAA 4L52A 4RQKA 4FEQA 4HCTA 5EFQA 4O86A 4XP3A 2XZSA 3F5PA 4DF3A 1FQ1B 1WVWA 1OIRA 1BX6A 3E62A 4XLVA 2CHLA 5GJGA 2YLEA 3BYOA 4G6OA 3WARA 3TKUA 2WQEA 2XBJA 3FMJA 5LMBA 4BKYA 1H1PA 5LOHA 4KRDA 4NZWB 1RW8A 3P78A 1J1BA 4MHAA 3IK3A 4ACCA 4BI0A 1P4FA 2SRCA 4C0TA 4ANMA 4GVAA 4CFNA 4AN2A 1OGUA 3FZSA 4QT1A 3UQGA 4R7IA 4JS8A 4HYUA 1KE6A 3VC4A 4ZAUA 3MB7A 5G1XA 5AR7A 3F3VA 2YIXA 3QQJA 3HX4A 4L7SA 5ETAA 3JS2A 4RWJA 2BRBA 1KWPA 2VTOA 4HCUA 4D2RA 3FMMA 3DQXA 3AD4A 3C4ZA 1H00A 3R7UA 5HVYA 1A06A 4XV3A 1PMEA 2WEIA 4KIQA 3S0OA 1GY3A 4TYHA 4DEAA 2R9SA 5AV1A 2W99B 3LJ1A 4MTAA 4IDVA 2H34A 3GGFA 4ANBA 5AP4A 3ENMA 5DHJA 5HEZA 5IQFA 1ZZLA 4XUFA 4FMQA 3R2BA 4ASXA 4D4SA 5AUVA 3SC1A 3VHKA 3V8SA 4AW5A 4C59A 3UC4A 5C8NA 2F9GA 4LGGA 4YC6A 3HYHA 2ERZE 5M4UA 4YZMA 4F4PA 4BCGA 3OTVA 2JKOA 4O0VA 4EH6A 4M84A 3Q4CA 3LM5A 2Q0BA 3C5UA 2BFXA 3HLLA 2R3OA 1ZMVA 4AXAA 1JKLA 2YDJA 4YHTA 3DKOA 3MPTA 5CY3A 3RK7A 2H6DA 2F7EE 3ZONA 2WELA 4L44A 3OS3A 4O7ZA 3DJ5A 2WTJA 4GS6A 3IW8A 3RZBA 4HVSA 1NXKA 3E88A 3TIYA 1LUFA 3U6JA 5TF9A 2ITUA 3WF5A 5CNNA 3U9CA 2XM8A 2BILB 2IJMA 3ZFMA 1V1KA 4ACMA 3B2TA 4HZSA 3UDBA 4EKKA 3UODA 4CT1A 2B53A 5GZAA 3ZHPC 4H1JA 3I0OA 4PRJA 5CAUA 2X8DA 2W96B 3TACA 2HZ0A 3FKOA 3QQUA 3ENHA 3NUPA 4DH3A 4AT3A 3P23A 5ANDA 2R7BA 3DNDA 4W9XA 3RBWA 3QKLA 4LRMA 4U40A 3GUBA 5L8KA 4QP3A 3O50A 3AC2A 3NLBA 2UZEA 4YPSA 2GNIA 4F63A 2A4LA 5LVMA 5HGIA 4I5MA 4ZTLA 4G1WA 3OHTA 2FH9A 1PXJA 1ZARA 4E4LA 1YDSE 4BDHA 3D7TB 4LMUA 2PPQA 4XG9A 4TW9A 3FZ1A 5BQ0A 2JDTA 1Q3DA 3C13A 3SRVA 2AYPA 3CP9A 3U6HA 4LV8A 3A7FA 4BTFA 3SW7A 1RDQE 2VO7A 1ZY4A 5A54A 1Q62A 3N4TA 4TZRA 4FT3A 4A06A 3EZRA 1DAWA 4ASDA 2H96A 2CPKE 1KOAA 4BBFA 5I9WA 4L01A 3K3JA 5JGDA 4MD9E 3FYJX 1FOTA 1LP4A 4GSBA 5FTQA 2ITYA 4E4NA 4YNOA 5T68A 2E9NA 4O22A 3BHYA 3QQGA 2F57A 3I7CA 5D41A 3P7BA 5JGAA 3BLHA 3C4EA 3PXQA 5AUYA 2PVLA 5ANEA 2UW4A 3Q9WA 2HY81 3CBLA 2UZOA 4GT3A 4NTTA 4N0SA 3GQIA 3TN8A 4HGTA 4FEWA 3ALNA 3PY1A 4NKAA 4EQUA 5KKRC 1DS5A 2P55A 3LZBA 3WI6A 5A4TA 2GS7A 5CQWA 1BLXA 4GUEA 5AAFA 4C58A 4UMRA 1OL7A 4EOOA 4QMVA 3A7IA 3MVJA 4BTKA 3QL8A 1ZYDA 2GHMA 4ZJVA 4R7BA 3O8PA 4FIFA 2Q0NA 1LR4A 3D2KA 4RSSA 1OITA 5BPYA 5JRQA 4L68A 4XG3A 5IUIA 2JEDA 4CLIA 3GNIB 2YHVA 3R22A 3PSBA 2UZWE 4IB0A 1LEWA 5DBXA 5FQDC 4QD6A 2J0JA 3HKOA 2WXVA 3ODYX 4TYGA 3E5AA 3IW4A 4RLLA 1UV5A 4F7SA 5FXRA 4U44A 2QVSE 4HPTE 4YO4A 2GSFA 4L6QA 1H1WA 2EU9A 3GU6A 5DEWA 4AF3A 5E91A 4ZTSA 3D5XA 4BCOA 1W84A 3AQVA 3LCSA 3P79A 3PPJA 3Q9ZA 3QRUA 4QOXA 4X2NA 4YZBA 4FTMA 2F7XE 4YTHA 2QODA 3W10A 3QRTA 4BY9E 5L8JA 2WHBA 3T8OA 4EBWA 5M4IA 5F94A 3LVPA 5EM5A 1WAKA 3NDMA 5AP3A 1KE7A 2PVRA 4YHJA 3ZLWA 3OXZA 2C3LA 2Y4IB 3R7EA 3AT3A 4RVTA 3N4UA 2XJ0A 4W9WA 4DFUA 5GHVA 3HDMA 1ZXEA 3D5WA 4PMMA 3FQHA 3LFAA 5HG8A 3D0EA 4O0WA 4J8MA 3FEGA 4M69B 5FLFA 1WBOA 3PVBA 4TNDA 1J7LA 4WUNA 1SYKA 4HVIA 2JKQA 1IA9A 2W1GA 3PVWA 4FV7A 4BDEA 3QX2A 2W1DA 3R21A 2IN6A 4FTQA 4X3FC 3R9RA 2C0IA 4EOQA 1IAHA 2C6OA 4LGHA 4YHFA 3ZFYA 2A27A 2B4SB 2XF0A 2XUUA 1UKHA 3KXGA 4TPTA 4J98A 3IONA 4QPAA 4AGDA 2BUJA 5LXMA 4FR4A 5EM6A 4ASEA 3G6HA 4HNIA 5DYJA 3BEAA 4LYNA 5AUUA 4OTIA 4P5QA 3QCYA 2IO6A 2XB7A 2F2CB 5IQBA 4Y73A 4XG8A 2W05A 5IF1A 4IDTA 4I94A 5E1EA 3FKLA 4BHZA 1CTPE 2J90A 1TVOA 2X4ZA 1YI3A 3B8RA 3F88A 4R5YA 5AP6A 3EQDA 2GNHA 3UYTA 2QOLA 3C4CA 4F0FA 3QD0A 3EH9A 2PUNA 2UW5A 2ZYBA 3H3CA 3D14A 4FKUA 4YZNA 1UNHA 2V5QA 3R2YA 4QP1A 3V5PA 3R1YA 4ZLZA 3K5VA 5EDPA 3KULA 4UALA 4O7NA 2ONLA 3MH2A 4R3CA 5JSMA 3DXQA 5I9UA 1OUKA 4BDJA 5H3QA 1T46A 5FGKA 3ZCLA 5F4NA 4O7WA 1YDTE 4OTHA 5EHYA 2IW9A 1IAJA 1L8TA 1BL7A 4F9BA 3BBWA 3Q60A 3ZUVA 2CGWA 2GNLA 1H28A 4MYGA 2DUVA 3IS5A 4CKJA 5D1JA 3CR0A 3KXMA 4P90A 4R5SA 2ZV8A 3EN4A 4FNZA 5HHWA 4PMPA 2GFCA 3KKVA 1JQHA 3SW4A 3LCKA 5IISA 5M57A 3ANQA 4U45A 4ENYA 3DZQA 2JBOA 2B9HA 3JUHA 5H8EA 3REPA 3UC3A 3O23A 3RPRA 3VNTA 3TV6A 4QNYA 2XYUA 4V04A 4QTDA 5CZHA 5EYDA 1YOMA 4F9CA 4YMJA 1PKGA 5J87A 3UP7A 3W2PA 4LFIA 4G2FA 4ARKA 3TL8A 1Q8UA 5AV2A 3CJGA 3DBQA 3O71A 4RC2A 2C5XA 4YC8A 4O2ZA 3R63A 4AOTA 5EQPA 4ZTRA 5CXZA 3C4XA 4NT4A 5EDQA 4FSYA 2PE0A 3BRBA 3SG9A 4EHZA 2KTYA 2BZHB 4IAAA 4BF2A 4FKGA 4G6LA 5HO6A 3F5GA 3UG2A 4NKSA 4J97A 5F20A 2QI8A 3PP1A 4DGLC 5B2MA 2QKRA 4J96A 4EC8A 4YP8A 3ORLA 3ZMMA 4U5JA 1U5RA 2X2LA 4BDIA 3GFWA 2E9VA 3R9DA 5M56A 5K0XA 3BV3A 3R0TA 3V8WA 3ZSHA 3PA5A 1OIUA 3PJ2A 4Y46A 1O6KA 5FM2A 3MDYA 5J8IA 2QOFA 3CTHA 4U80A 2J2IB 2BKKA 3HMPA 4IC8A 4CNHA 4A9SA 4FSRA 4EKLA 3NIZA 4EOIA 4CVAA 1W0XC 4H39A 4ZSLA 2Z7RA 2W1ZA 5ETFA 5CALA 1AD5A 3FZRA 2BVAA 1FVTA 3PSCA 5AV0A 5AP7A 4BYIA 2ITOA 3V5LA 4Y5QA 3CS9A 2FSLX 4B4LA 2ZAZA 3LXPA 3COIA 4O1OA 5K0KA 5IQCA 2OJGA 4QQ5A 4BDFA 1A9UA 3HRCA 3NYNA 4D2TA 3E63A 4F9WA 2HYYA 2JKMA 2YISA 3FMHA 4HCVA 4JDHA 4RIXA 4F08A 4I1ZA 4FGBA 4UEUA 2X8IA 3IW5A 3LFFA 4A07A 3LKMA 4D9UA 3F82A 4YBKA 4X3JA 3DTCA 4RX5A 4DFBA 1H27A 3V5QA 4QMSA 5GIOE 1DM2A 3EMGA 1R39A 1CMKE 3QD4A 5HE0A 3VUTA 5BNJA 4MD8E 4XRLA 3OUKA 5A4CA 3U8WA 3A4OX 4BDDA 1H26A 3DJ6A 4II5A 3A8XA 4F7JA 4L9IA 1GZNA 2X8EA 4E73A 3SKCA 3DY7A 4D55A 1YXVA 2GHGA 2WMVA 3FUPA 4JG7A 2WIPA 2J0LA 4EZ3A 5JEBA 3G9NA 4YJTA 2WQNA 3L9PA 4QYGA 3RWQA 2W1EA 4WBOA 3WE8A 1CDKA 2WFYA 3D7ZA 3QQKA 3OF0A 4OTQA 3V6SA 4EK6A 5I0BA 4KS8A 3H30A 4MNEA 3LCTA 3R7VA 4O81A 5BUIA 2R3NA 3F7ZA 3VRYA 5E8XA 4AUAA 3GC7A 4ZZMA 2X2MA 2PMIA 3OY1A 5CI7A 4BC6A 2GQRA 2XK6A 4GMYA 1QL6A 3ZSGA 3WYXA 4G3GA 2IW6A 5HBHA 3MFTA 3QC9A 2BROA 4FV3A 4RWKA 3VBVA 3C4WA 3DAEA 1NVRA 3EN7A 3OCBA 5FP6A 3H0ZA 1GIIA 4FYOA 4BB4A 4TWPA 3FLNC 5A46A 5TOZA 4AFEA 2XEYA 4O0SA 3SLSA 2A2AA 4PV0A 4QYYA 3F3ZA 2GPHA 4FGRA 3OW3A 3KA0A 4UWBA 4KIKB 1F0QA 4O0RA 5EYCA 3G0FA 5EM8A 3SXSA 3ITZA 1Q99A 1ZOHA 2W1FA 3COHA 1QCFA 3IW6A 3QQLA 2XKDA 4OW8A 4C3PA 2VNYA 2V0DA 4QP4A 2ACXA 4LOQA 4EYMA 3KB7A 2ITPA 4YJSA 2I7QA 1Q8WA 4BICA 4JIKA 1SVGA 3EHAA 4WBBB 4A4LA 4LG4A 5BYYA 2R4BA 1UU8A 5CWZA 5KZ0A 3JPVA 4FZDB 2P2IA 3NYVA 4FKSA 3E3PA 2G1TA 4MH7A 5M09A 2R0IA 3VBYA 3OCSA 4GRBA 3ZS5A 1BI7A 4YJOA 4U9AA 3HDNA 3FMEA 3PJ8A 5HVJA 3GXLA 3MJ2A 3N4VA 3P1AA 4D4RA 4OAVB 2Q83A 5E8VA 1PXPA 2YM3A 2IZSA 4RGJA 4QYHA 1O9UA 5IQEA 5JFVA 1Z5MA 5CU0A 4C4HA 4JXFA 1P4OA 3KU2A 1F5QA 3Q96A 4AG8A 2C6KA 3OXTA 2UZVA 5ANIA 1PXNA 2YN8A 4FKTA 2C6IA 4D4VA 1HCLA 2W5HA 5EW8A 4Z9LA 3PY3A 5CVHA 4FV9A 4G9RA 4QMQA 4B8LA 4M0ZA 4DGMA 5IH4A 1PRYA 3LFBA 3MIAA 5AIKA 2V22A 3DFCB 3MSSA 4I41A 4W4WA 4YZ9A 3VUKA 3DNEA 3S1HA 5BX0A 4G16A 3R04A 4U42A 3DPKA 2XH5A 3KY2A 5L4QA 2O2UA 3LIJA 2AC5A 5JKGA 3R00A 4K33A 3D15A 4S30A 2UW6A 3G0EA 3Q2JA 4MBLA 3ZRMA 1GNGA 4LUEA 4OTRA 5AR2A 3KVWA 3QA8A 4U3YA 4RG0A 3PTGA 4XG4A 2YJSA 2WGJA 3UOKA 3A7HA 2PUUA 3QGWA 4FIIA 4AOJA 5AR3A 4IX6A 4ZS0A 5AMNA 1M7QA 1XKKA 5IA3A 1YDRE 2YITA 4CGAA 5HCZA 2YDKA 2LAVA 2X7OA 5IDPA 3WILA 4BZDA 4TWOA 2PZRA 3ZLYA 5IZFA 4ZP5A 2JITA 3PE1A 3DKGA 4C3RA 1H1RA 3W2SA 1VYZA 5DLSA 5GZ9A 4IZ7A 5BYLA 2WTKB 4M8TA 2R0UA 1KE8A 2CN5A 3T9TA 4N70A 3TKHA 4GU6A 3RPYA 3QCQA 2VWWA 5AX3A 4NL0A 1IR3A 4G9CA 4MNEB 2NO3A 1U54B 5AAEA 4TL0A 3A8WA 4DINA 1GIJA 3VS4A 5HD4A 3HMMA 3E3BX 4EUTA 1HOWA 2YABA 4C4IA 3MA6A 3FLZA 4J7BA 4WNOA 3BYMA 5HNBA 4M3QA 3LCOA 3NZ0A 4KRCA 5KMJA 2VTPA 4PL3A 5LVOA 4EJ7A 2ETKA 4GUBA 5KZIA 2JKKA 5CAVA 2GNGA 3A2CA 3G2FA 3HMOA 2WMXA 3BV2A 3QTXA 4W8EA 4YZCA 3H9FA 3RM6A 2W4OA 1ZWSA 2R3RA 1URCA 5AUXA 3LFEA 3S00A 2HCKA 3DBDA 3R01A 3QUDA 4I5PA 5EHOA 2R3FA 4TY1A 4YU2A 4MXAA 4ERWA 1XJDA 4FEUA 4EH4A 3IPHA 4FG8A 4FTOA 5FD2A 5FRIA 3NYOA 4R6VA 3QTSA 4JR3A 4IVAA 5ITAA 1MQ4A 5FBOA 4E6DA 4CFMA 3SA0A 4G5PA 1APME 4CT2A 4HPUE 3BIZA 3GFEA 3EQRA 4BZOA 4F09A 2BHHA 1B38A 2XCKA 2JC6A 5J5SA 3RZFA 4O2PA 4GKIA 1REKA 3DGKA 4YJQA 3OEFX 4JDJA 4R77A 1R0PA 4MVFA 4FA2A 1KV2A 5CEKA 5IUHA 3VF8A 1U46A 4FVPA 2C3JA 2EVAA 2YWPA 1CSNA 3OROA 1XH7A 4YJUA 1W82A 2VWBA 2YM7A 4WNMA 4NCTC 5AR5A 4DFLA 4YZDA 2VU3A 3ZSIA 4RVKA 3BWFA 4UYAA 4ZTQA 3RCDA 1ZYLA 4IC7A 3DBFA 3W2RA 3BYVA 4IH8A 5IEYA 1H0VA 4IE9A 4FX3A 3HGKA 3W18A 4DTKA 1JSTA 4RA5A 2UVXA 2OW3A 3QYZA 1FMOE 3MWUA 2ZV2A 2C1AA 2FB8A 3FQEA 3MVHA 3PPKA 4IJ9A 4J99A 4MBIA 3LFNA 4FKRA 4FC0A 4HJOA 5EKOA 4DITA 5IQHA 1G8AA 4ZJJA 3I1AA 3VF9A 2XKCA 4EYJA 5GINE 4FTKA 3BE2A 3FLSA 4S31A 3ZZEA 3FWQA 4FF8A 1G3NA 4A9RA 3U54A 5HE3A 4XX9A 4ZSEA 3R71A 2PVYA 3TZMA 2C47A 4I92A 5E1SA 2O3PA 3QHWA 2CKPA 1WFCA 4ZS4A 3MN3A 4FTNA 1SNUA 4F7NA 4FL3A 2J7TA 3Q9XA 4L3JA 2BDFA 4FSMA 5FG8A 3E7VA 4AX8A 5CF5A 1OL5A 2HOGA 1U5QA 4R3RA 2IWIA 2CLXA 1IASA 2ONLC 2WMBA 4QMMA 3NW5A 1MQBA 4YTIA 4EH7A 4CFXA 4L42A 4EOKA 3GCSA 5HBEA 3QTUA 5JK3A 3DFAA 3LFDA 4QMPA 4QMOA 4XV9A 3KK8A 3RINA 4XEYA 4CFWA 2X9EA 3BLRA 4BHNA 5L2TA 4MQ1A 5CEOA 5AV4A 3R8UA 2PL0A 3HAVA 3MESA 3SHEA 3LW0A 1I44A 4C4GA 1PW2A 3QTIA 4YJNA 4L8MA 4CTCA 2UZNA 5LMKA 2OIDA 3D7TA 4RX9A 4UMPA 4A9YA 4IZ5A 3G51A 5L2WA 2OJFE 4BDAA 5KE0A 2PYWA 4P5ZA 4YSMA 3SOCA 5HU9A 3QTRA 4OT5A 4TNBA 4ZTHA 4E93A 3R6XA 4C8BA 4FKVA 3G33A 1L3RE 4MNFA 2WMAA 2YM5A 1XBCA 4BCNA 4NEUA 5DGZA 4BCHA 1PXIA 3VUHA 4RZVA 4EQMA 5CT7A 2CLQA 1O6YA 3UBDA 4JDKA 2QOQA 3CGOA 5IUGA 1RQQA 3FZOA 2EXCX 3ZO2A 2I0VA 2C6TA 3Q5IA 3TNPC 1MP8A 4C4FA 3JR1A 2XIXA 2OF4A 3EFLA 5AADA 5GJFA 3EOCA 2VTJA 4OLIA 3GU4A 3VBXA 1BMKA 3QRJA 4WOVA 3ZLSA 5IA1A 2XNPA 4E6AA 4BIBA 3AMAA 4TWCA 5TT7A 3VS2A 3ET7A 5F1ZA 5C4LA 2BKZA 2W17A 4KKEA 4XV2A 5HU3A 2XS0A 3QYWA 4IEBA 5BVDA 1VR2A 3PG1A 3K2LA 3R8LA 2EB2A 1YWVA 1UNGA 1ZMWA 3GU7A 4ZK5A 1WBNA 3I79A 1FGIA 4XJ0A 5FTOA 3EKKA 4FYNA 4GT5A 5F9EA 4ZSGA 2VTQA 5IG1A 4OTDA 4U0IA 3TDVA 5HTCA 3UZRA 1OBGA 1OL6A 4UBAA 4YUQA 4FBXA 5A4LA 3AMYA 2ZB1A 3OY3A 5FXSA 4P7EA 4CMOA 1STCE 1YXUA 3ANRA 2X2KA 1IA8A 2VTSA 5I9VA 3UO5A 2QKWB 4K8AA 1FVVA 3QRIA 4JBVA 5CNOA 2OJ9A 2VWXA 4D1ZA 4RJ3A 2ZM4A 2WEVA 4KBAA 4IWOA 4B8MA 3PXKA 4PPBA 3EJ1A 3EQPA 4M0YA 1XQZA 3R8MA 5CSPA 3UIXA 3OD6X 4RQVA 2J5FA 4RX7A 1OIYA 1Y8YA 2P0CA 4RZWA 4ZOGA 4IVDA 4ACHA 2VTIA 4XYFA 2J4ZA 1YXTA 4R3PA 1OM1A 1YWRA 4FI1A 2YAAA 5DVRA 3MV5A 3FV8A 2FSOX 5HCYA 5CEIA 2A19B 1QMZA 1XBAA 2R64A 5CEPA 5LWMA 4BWXA 2QHNA 4UY9A 4M69A 4ZTNA 1T45A 1WVYA 2WNTA 4KSPA 3UP2A 4AZTA 1ND4A 4FUXA 3AT2A 3W1FA 2X1NA 4E6QA 5HNGA 5AWMA 5ETIA 4MX9A 4GG5A 5D7AA 4HVHA 5J7HA 3JY0A 3OEZA 2R7IA 4CRSA 4IVCA 2WMUA 4QTBA 3FZTA 4LQMA 1NT2A 2HXQA 4H3BA 4DFYA 4DEHA 3DXPA 1XH5A 2ZV9A 3HV5A 3G5DA 4JAIA 4F6SA 2YACA 4YO6A 1AGWA 2FVDA 3BHHA 3RAHA 3ZRKA 4AGCA 1XH8A 3CGFA 3JXWA 2C68A 3BHTA 4KBCA 5EHLA 4DHFA 3PY0A 1U59A 1YOJA 4O21A 3R9OA 4KA3A 3W8LA 2LGCA 4XS2A 3WBLA 4QP8A 3TJDA 2EB3A 1M52A 3EQHA 2OXXA 3UNJA 5I5ZA 3VS3A 5IA4A 3BYUA 1OBDA 1K3AA 3BQCA 4OTGA 3IGOA 3KRJA 4FVRA 4BRXA 2Z02A 3KRXA 4Y83A 4I23A 4I20A 3SD0A 4HVDA 5LWNA 4X2KA 4C4EA 1JAMA 3WF6A 3DQWA 4LRKA 2XRWA 4KINA 2CCIA 2HZNA 3PYYA 1V0BA 2ESMA 3NAXA 2OBJA 3R1SA 4IB3A 2OG8A 3OBJA 4BCQA 1M14A 3ROCA 3ZXZA 1Y6AA 1Z9XA 4IW0A 2C5VA 1OPJA 2XBAA 5J79A 3LFCA 3OXIA 1PXKA 1GIHA 5CTPA 1FINA 1OKVA 2VWIA 3BGPA 4FZAB 5JMSA 3MTFA 5I3RA 4DBNA 4USEA 4FSWA 2RFSA 2XVDA 3D5UA 5EW9A 5T3QA 2PZYA 3IDCA 4DH5A 4JBQA 5JGBA 2GS6A 5AR8A 5LCKA 1WBTA 4IAIA 3NUYA 3MY0A 2XNNA 2WMTA 4QYFA 4HZRA 3F7WA 3Q6UA 4IAYA 1P14A 3ZU7A 4JNWA 3WF7A 2REIA 4QMXA 5A9UA 4LI5A 5HG7A 3QZHA 1REJA 1PMUA 2E9PA 3D2IA 3KCFA 3TNHA 4IACA 4HYIA 2PUPA 3NS9A 5DWRA 4FIEA 3UYSA 3GC8A 5AR4A 4P2KA 3LPBA 4AAAA 5M4CA 4F9YA 3ORTA 1JSVA 4ERKA 3KRLA 1ERKA 3FL4A 4BKZA 4AA4A 5D9HA 4E26A 5HTIA 2VTRA 3OCGA 3R9NA 4X2JA 1YWNA 4AW2A 1LPUA 5C26A 2PWLA 3TJCA 3A62A 4NW5A 3T9IA 3U6IA 3ZH8A 2BRHA 4G3EA 4L45A 4O7LA 2R3GA 2JIVA 4B9DA 4BCPA 3U4WA 2HWOA 2VD5A 2YEXA 3S95A 3QKMA 4Y5HA 3QD2B 3DLSA 4CZUA 2G2HA 3IECA 2W9FB 5C4KA 4GK3A 2G2FA 4XBRA 3VBQA 4LRJA 5K5NA 2W5BA 3OMVA 4CEGA 2IVUA 4GJ2A 3F2AA 4I6BA 3A60A 4BVUA 5AA9A 4MXOA 4UX9A 4C4JA 5LVPA 3Q53A 3EIDA 3LXNA 4H3PA 3ZBFA 4A4XA 4D58A 2BRNA 5BVFA 1XO2B 2OXDA 4IQ6A 5ACKA 3R8PA 2F7ZE 5IH5A 1H08A 3POOA 4RIWB 3E8CA 4IWDA 3ZUUA 2UZUE 2RL5A 3BKBA 4EUUA 2YIWA 3WZKA 4MF0A 4FTRA 2X81A 5HX6A 5A4QA 3F2NA 5JH6A 2PVNA 4R8QA 3KREA 3DV3A 3H9OA 2HY0A 2ITVA 2UV2A 3M2WA 3V3VA 3TTIA 3E7OA 3IW7A 2C5YA 1XWSA 2JIIA 1DI9A 4NFMA 4BCFA 4BZNA 3W2OA 4ZZNA 2X7FA 4ZSJA 1YW2A 4ZXTA 4BWPA 2AC3A 3COKA 5HTBA 2P2HA 2UW8A 4CQGA 3A7JA 2UUEA 5CX9A 3IDPA 2P33A 1GZ8A 5M51A 3HV3A 4AE9A 2C69A 1GJOA 4KIPA 2I40A 5KHXA 4RWLA 2OFUA 4Q5EA 5GZ8A 2VGPA 5E4HA 3UOLA 3AGMA 3C0HA 3VULA 3LE6A 3O0GA 4FNXA 4BBEA 3TWJA 4PDPA 5DT0A 3MFUA 3T3UA 3C9WA 4F64A 2V62A 4DLIA 3WF9A 2FYSA 2H9VA 3M1SA 4FV5A 4BDGA 2O8YA 3WZDA 3EYHA 5D10A 4OBOA 4EZ5A 4G6NA 2ZB0A 4L00A 4NW6A 3W33A 5AAGA 4LL5A 5J1VA 3FI8A 1ZAOA 4ZMFA 4DN5A 1WBVA 4K18A 2C3KA 3QRKA 4W4VA 4IX3A 3ID6C 4PP7A 1Q41A 2G01A 1Q24A 2QO9A 2ZVAA 4DFZE 1XH9A 1ZYJA 2UW0A 4BFMA 4YTFA 1X8BA 1YXXA 3CIKA 5EM7A 4QPMA 4A7CA 3V5JA 5FEEA 4BI1A 4KIKA 5IPJA 4C2WA 2CKEA 4TWNA 5LVNA 2WOTA 3OBGA 4WSYA 2F4JA 5HOAA 3DS6A 2QONA 5BMSA 1R1WA 4ALWA 2VX0A 2BAJA 4IX5A 4EORA 3VIDA 4ZMEA 3NUUA 2C30A 4IHPA 3ZZWA 3QF9A 5CASA 4QPSA 1YHSA 4TYIA 4TKSA 3PWDA 3PVUA 3BQRA 5BMMA 3QCXA 1PKDA 4EH5A 4N57A 4D2WA 4GT4A 4FV6A 2GHLA 4RJ7A 3DKFA 1UA2A 4YLKA 5M55A 4YSJA 4V0GB 2QO2A 3NR9A 4FV0A 4H36A 3W2CA 1UWJA 4BDBA 5K9IA 4D2VA 2O63A 2IPXA 4XNEA 3DLZA 3FI4A 4JG8A 3I0QA 1ZLTA 4FT9A 3S3IA 4AA5A 3HMNA 3MBLA 4ZJIA 3FDNA 3TV4A 2YWVA 1PXLA 2VTAA 3GI3A 4ZY4A 3VWAA 3C5IA 2W06A 3HV6A 3QCSA 3VBWA 2VTNA 3RKBA 3KCKA 5AV3A 3VS0A 4UMTA 4CG9A 3P5KA 3TZ8A 1E1VA 4UV0A 4FZFB 4W4YA 3RJCA 5FXQA 5CEQA 4CMTA 4HYSA 3BU3A 5M07A 3NIEA 3P86A 4CYJA 1KE5A 5CF4A 3AC4A 3MW1A 4HGLA 5CVFA 3NW6A 5KMIA 4OAUC 3NUAA 4K0YA 4RJ6A 3VS1A 3NVKI 3UPXA 3TT0A 3AC1A 3FYKX 4TYJA 3QZGA 2FSTX 3FY2A 3HVCA 3I81A 2GCDA 4KIOA 5CU6A 5G6VA 4BGHA 2YCRA 5EI2A 3CD3A 5LMKC 4O27B 5E90A 3L8VA 1YI4A 2OO8X 4ANNA 3PJ3A 2EUFB 2XNGA 3RPOA 5CF6A 3AGLA 2I1MA 2CGVA 3ORNA 4RVMA 2ITWA 5IQDA 5HI2A 5A4EA 5E9EA 2OFVA 1JOWB 4V01A 4EHEA 4FK6A 1JVPP 3CD8A 3E92A 2PZ5A 4CD0A 3HNGA 2XNMA 3GT8A 3HP2A 3CLYA 4WRSA 4XBUA 4H1MA 3W32A 3V6RA 4RJ8A 5IKWA 2UVYA 3ALOA 1GAGA 2JGZA 4U43A 3TKIA 4AW1A 3SVVA 2WMSA 3VVHA 4MXCA 4YJVA 4J95A 2WMWA 4WT6A 3FXXA 4U79A
chains in the Genus database with same CATH superfamily
3D83A 4U7ZA 2WAJA 2WTIA 1YHVA 2JFLA 2VTHA 2XEZA 4RA4A 3F3UA 1IRKA 2NNWB 4UN0C 5JQ5A 2BRMA 1PHKA 2IG7A 3AD6A 2GDOA 4RT7A 5KMLA 5HORA 2QOCA 2C6DA 1KOBA 2IEWA 2XM9A 3A99A 3CXWA 3L9NA 4D4YA 3NNXA 4EJNA 3M11A 4FTLA 4MKCA 2RFNA 1U54A 4QQJA 2QQ7A 5EI6A 1OPLA 3WIKA 3N9XA 4PP9A 4XH6A 4NM3A 1KV1A 4JX7A 2HIWA 5EQYA 1H4LA 4ITIA 5J5TA 3CTJA 3AD5A 5D11A 3FC1X 1UU7A 3BZ3A 4XRJA 5AP5A 3ROYA 2PK9A 3ZO1A 4KB8A 4C7TA 4O91A 5FTGA 1CM8A 2VX1A 3NCZA 2Y4PA 4C62A 3QXOA 4MXXA 3ZO4A 2OIQA 3VN9A 4S32A 5IA2A 1XHAA 2QC6A 1QPEA 4GIHA 5DG5A 2QOHA 4EH9A 5ICPA 5L3AA 3QALE 4ANQA 3F66A 4FZ6A 4KSQA 3EFKA 4NM0A 4OTWA 1VZOA 2HK5A 4FKLA 4GYIA 4NK9A 5B2KA 2V55A 3MFRA 4FK3A 4LGDA 5AX9A 5KX8A 5CAPA 2C6EA 5KNJA 4PDYA 3RWPA 5BVNA 4CV9A 4RC4A 3VAPA 3DAJA 5JFWA 2Y4IC 5JQ8A 3U51A 5HLWA 3GBZA 5KCVA 4C34A 4DH8A 2XRUA 2RG5A 3KXXA 1VYWA 4KS7A 2GNJA 1G5SA 2QD9A 3GU8A 2E2BA 2XKFA 4U97A 2DYLA 4H3QA 1W8CA 3H9RA 3R02A 3HUBA 4JBOA 4LUDA 1P2AA 3DZOA 5A14A 3DOGA 4F0IA 2WPAA 2XNEA 1FGKA 4NJDA 5M53A 3W0NA 2BALA 2ITQA 2B7AA 4I4FA 3FZPA 2G2IA 2ZJWA 2UW9A 2J0MB 2VNWA 4IJPA 5KMOA 5E8YA 2Y6MA 4I6HA 4L7FA 1V0OA 3R83A 4IWQA 3LXKA 4RJ5A 2NPQA 2PSQA 1BYGA 4CQEA 4YPDA 4APPA 5CQUA 5DN3A 5HO7A 3ORMA 1PYEA 2JDOA 4LM5A 4XG7A 2X9FA 4DH1A 3ORXA 4FUYA 3UMXA 3NX8A 3NRMA 2Z60A 4L3LA 3LM0A 3E8EA 3F2RA 1H0WA 1J3HA 3RMFA 3FMDA 5DR2A 4X2GA 1OB3A 2YCSA 3ATSA 2X0PA 4EEVA 3UIUA 3VUDA 4DEEA 4AAYA 4DAWA 3FLQA 3OOMA 4CSVA 3SAYA 3DK3A 3W8QA 4KWPA 1WBPA 3WF8A 4AQKA 1UU9A 5IQAA 2FGIA 2GU8A 3D9VA 3Q2MA 2VV9A 4JL9A 4U6RA 4MXZA 2RFDA 5HCXA 5BVEA 3BEGA 2A1AB 3C1XA 4FSUA 4N6YA 3PDTA 5TE0A 1YVJA 3LOKA 4ZLYA 2Z7SA 4BCIA 2BR1A 2ITTA 2YCQA 4FL1A 3SGCA 4L53A 3GCPA 3KVXA 1Z57A 4OGRA 3MH0A 1I09A 4FT0A 3ZFXA 1ZZ2A 3I4BA 2RKUA 4PQNA 3WYYA 3EFWA 3HEGA 4JG6A 3EYGA 2OGVA 1CKIA 4QP6A 3GB2A 3R1QA 4FKWA 3PZHA 5ACBC 3KK9A 3HRFA 3ZEWA 3FQSA 4LL0A 4NM5A 3CY2A 2OU7A 3KFAA 1S9IA 1KUTA 3TG1A 5EI8A 3BE9A 4Q9ZA 4E5WA 4JLCA 3S4QA 1MRVA 4S33A 1M17A 3KF4A 3FMKA 1Y57A 3L8XA 5CENA 1O6LA 1JBPE 2OZAB 5FP5A 3TUCA 5FDPA 1GZOA 5IMXA 4UZHA 4AZEA 3HA8A 4EH8A 4FZ7A 3FPQA 4AT5A 2UZTA 2RGPA 3ULIA 1WVXA 5AP1A 4ZY5A 5J7BA 3DBEA 3W0SA 4JRVA 4BKJA 4HOKA 1J1CA 1BUHA 4E4MA 4DBXA 2ETRA 2BZIB 2P3GX 3NUXA 4JRNA 3KXHA 4J53A 5EH0A 3R7IA 4N6ZA 5EDRA 3TUBA 3MGYA 4RIYA 4ZEGA 3GVUA 5FM3A 2BDWA 3L8SA 2ZOQA 2OKRA 3TZ7A 4QP2A 2J0KA 4AWIA 2PZPA 2YDIA 3AT4A 4JR7A 2KULA 5CF8A 3EQCA 5LQFA 2J9MA 5AJQA 2DQ7X 2R2PA 2WMQA 4DYMA 4Z55A 3B8QA 3MY5A 2AUHA 3EQIA 3OWJA 3CQWA 3P9JA 3POZA 2DS1A 2PE2A 3QA0A 1JPAA 3QXPA 4G31A 4O38A 3PZEA 3QWKA 1H01A 2Z2WA 1QPDA 3CQEA 3FPMA 4G5JA 3UOHA 3PFQA 3A4PA 3BYSA 2QR8A 1SMHA 5ANKA 3RPSA 4EONA 1ZMUA 3UNKA 4F99A 1RE8A 4ITJA 4UMQA 4BDKA 4QMTA 4ACGA 3PIXA 2VWVA 3BI6A 2WO6A 3LFQA 2X7GA 4PDSA 2X39A 4OTPA 4L3PA 4NIFB 3OWPA 2PVKA 3MJ1A 2HXLA 3OG7A 4FODA 4YLLA 4DTAA 3QGYA 5AUTA 4F6WA 2YM8A 3P7CA 3NPCA 4PWNA 1XH6A 4XMOA 2B54A 2VTMA 3QLFA 4B6LA 2YERA 4BYJA 5IU2A 3RTPA 5HLNA 1JKTA 4O0UA 1TQIA 5HBJA 2PHKA 5KKRB 4FKPA 2WTDA 4QMNA 3VQUA 1Y91A 1OUYA 4FSNA 4Y95A 2VO6A 3LLTA 3LAUA 3MPMA 4BTJA 3PIZA 4XLIA 3PJ1A 5KBQA 1OVEA 3I6UA 5JRSA 5C8KA 3V8TA 4RFZA 4G17A 4USFA 2Y8OA 4O6EA 4O1PA 5L8LA 3UDTA 3TNIA 3UJGA 4CKIA 5EG3A 2B9FA 2VN9A 4C2VA 5IH6A 1XR1A 3AC5A 5K3YA 3RGFA 5JT2A 4MQ2A 1OKWA 2R3IA 3DBCA 3I6WA 1TKIA 3R7YA 4PNKA 4NUSA 3QHRA 2EXMA 2YAKA 4ITHA 4O0XA 3V5WA 2OWBA 1K2PA 3FSKA 3NNWA 4DG3E 3DTWA 4TRLA 5GJDA 2C3IB 4AFJA 1Y8GA 2HAKA 3PP0A 4DTBA 3QWJA 4IB1A 3EWHA 4I93A 5AA8A 4BJJA 5DR6A 3U55A 3CTQA 5DR9A 2BIKB 4WUAA 3MH1A 2UZBA 3QQHA 4RFMA 3FXWA 2R3MA 2YZAA 5T6KA 2OH0E 5JFXA 1GOLA 2EWAA 4FNYA 4EHGA 3PA4A 3NFFB 4PNIA 3ZBXA 4EK4A 3ORIA 4JT3A 1XH4A 4F65A 3FBVA 1FMKA 4MWHA 4I22A 4CV8A 4GCJA 4Y8DA 4ZSAA 5IQIA 1Q4LA 2JAMA 2VWUA 3NUNA 3R1NA 3RK5A 4ANLA 5A6OA 3R73A 4AXCA 5KMMA 2BAKA 5J9YA 4YC3A 5I9ZA 4IMYA 5FWKK 4IVBA 4AGUA 2PU8A 1Q8TA 3ZTXA 3OVVA 4X3FB 3SV0A 2YLFA 4GL9A 2QG5A 4PMTA 3VS7A 5J95A 4NWMA 3R28A 3DKCA 4WRGA 2RSVA 4O84A 4K9YA 4P4CA 4U41A 1PF8A 2UZLA 2GMXA 5A3XA 5TKDA 2YIYA 1Q8ZA 4EI4A 4I6QA 4IFCA 1G8SA 2I0EA 2BFYA 3DK7A 1JSUA 4X6RA 4AA0A 3C0GA 2ZDUA 3LHJA 3R7GA 3NCGA 2BAQA 4RIYB 3C0IA 3QUPA 5AIRA 4AN3A 2PVMA 4ALUA 5CSXA 3W0OA 3K3IA 3KQ7A 3OWLA 4YTCA 4RFYA 4GJ3A 5FDXA 5HE1A 5LMAA 4O7TA 3C7QA 3G6GA 3ODZX 3VUGA 4TN6A 5KMKA 3ERKA 4RIOA 3PIYA 5DI1A 4DE4A 1PJKA 3W0MA 2XIKA 4EBVA 2WQBA 3QC4A 3FHRA 3LQ8A 3D4QA 2ITNA 2IVSA 5AP2A 2BHEA 4L67A 4FV2A 1FPUA 3AC3A 4I5HA 2IW8A 3LJ2A 5DMZA 3UO4A 4S34A 5HG9A 3FY0A 4C37A 3BL9A 4F78A 3ORKA 4OTFA 5L6PA 4JBPA 4RX8A 5CZIA 4BDCA 5B2LA 2OI4X 4X0MA 3I5NA 2PY3A 4FIJA 4DHJA 3FMLA 3PFYA 3V04A 4JAJA 3GC9A 4M12A 4I0TA 4PY1A 4WG4A 2GTMA 3FJQE 4XG6A 4UZDA 3UNZA 3K54A 4E7WA 3UGCA 2EXEA 3BCEA 5C8MA 4Y72A 4Z3VA 3FXZA 4NTSA 4QMWA 4CTBA 5K4JA 3H0YA 5LJJA 3MI9A 2OJJA 4FTJA 4WKQA 4E6CA 2BTRA 3SQQA 2WTWA 2PE1A 4BGGA 3P08A 4W8DA 4BI2A 3VS5A 1NW1A 1M2RA 4FG9A 3NNUA 3HAMA 2B55A 1H25A 5HQ0A 4ANSA 2W4JA 3MVMA 3QQFA 1K9AA 1YQJA 3H10A 4RIWA 3F61A 4ZZOA 4DHZA 4DT9A 4E5BA 3M42A 5JZNA 2WB8A 2CJMA 4FOBA 2QLQA 4WSQA 5B7VA 5K4IA 2WTKC 1IG1A 2G15A 2QU5A 3GOPA 4IM2A 5B0XA 4DEBA 1KSWA 3GENA 2OLCA 5M08A 3RCJA 5BUJA 3HRBA 3QTZA 1Q61A 1SZMA 2IZUA 1OPKA 1F3MC 3MY1A 5BVKA 2ITXA 5C9CA 2Z7LA 2QHMA 3GP0A 3E93A 1Q3WA 3QZIA 2BDJA 4U81A 3GCQA 2J51A 5DOSA 1LEZA 3TUDA 1PMNA 1G8JA 4KUJA 3DA6A 3O96A 4CYIA 4ID7A 2YFXA 4GKHA 5BYZA 4D0WA 3QX4A 4J52A 3BU6A 3Q4TA 3OUNB 4EOLA 3R9HA 2NRYA 2VAGA 4S2ZA 1UKIA 5EKNA 1QPCA 4DGGA 5CT0A 4AZFA 4GEOA 4D1XA 3DB6A 3HMIA 5E8SA 3UQFA 3F6XA 2CCHA 3AC8A 5M44A 4I0RA 1W83A 4QMUA 1Q5KA 2WU7A 2Y9QA 1BL6A 4AGWA 4BTMA 5HVKA 3MIYA 3MTLA 3D94A 5TR6A 3BU5A 5IEVA 3O7LD 4CCBA 4MXYA 1DAYA 1OL1A 1URWA 2C6LA 4GU9A 4APCA 5HNIX 2PVJA 2WTCA 3KXZA 4Q9SA 2AEGA 5LARA 2HZ4A 1SVEA 3Q3BA 2XP2A 3FHIA 4EWHA 4FTCA 3GEQA 5KO1A 2WD1A 3Q32A 2ZV7A 4O0TA 1WZYA 4IM0A 3O8TA 4AOIA 4E1ZA 3MA3A 4X7QA 3BBTB 3Q9YA 3UG1A 2ZMCA 2CMWA 3PSDA 4CZYB 3LMIA 3HL7A 4PMSA 2WQOA 4FV1A 1NVSA 2YA9A 5HICA 2YM6A 3BWJA 4DG2E 4F6UA 3Q4ZA 4IB5A 2XMYA 5KHWA 4C36A 3CSVA 3UVQA 3O7LB 5HKMA 4YURA 5HIEA 4DEIA 2Y6OA 4Z16A 3H4JA 2X4FA 3KF7A 2CDZA 5CLPA 3UO6A 3UQCA 3CQUA 4E20A 4IM3A 5CAQA 5H8BA 2JIUA 5ETCA 3ZM9A 4I0SA 1SM2A 2NRUA 3WIGA 2XA4A 2QOIA 3LXLA 3UMWA 3AKLA 4D2PA 3W0PA 1MRYA 1RJBA 4L46A 3OCTA 4QQCA 4JQ7A 4QTAA 4F1TA 4YNEA 4PF4A 2Y7JA 2O0UA 2XNBA 4CMUA 4TYHB 1UWHA 2PVHA 3TYKA 4RC3A 3RHXA 3UPZA 5ANOA 4V0GA 1WCCA 2J0IA 2W1IA 4IAFA 5I9XA 4O7RA 1A48A 3MB6A 2VGOA 1M2QA 1W98A 4QEBA 3LMGA 4TTHB 5CYIA 4G3DA 5H9BA 5KUPA 3QKKA 5CVGA 1H8FA 2W5AA 3ULZA 3KRRA 3ZLXA 4DCAA 4PUZA 2HW6A 2OK1A 5EYKA 4FSTA 2C4GA 4IXPA 5C27A 5FUTA 1H07A 4D0XA 4EZ7A 4PL4A 1H24A 1PY5A 1IEPA 3MH3A 3U87A 2BCJA 5FEQA 3EKNA 4WIHA 5AUWA 4Q5HA 5HZNA 3UOJA 5HG5A 3DAKA 1JWHA 3FI2A 3MFSA 3QFVA 3PWYA 3RVGA 5EOLA 4AN9A 5DA3A 2C5NA 3P7AA 5J9ZA 2R3JA 5CS6A 4D9TA 4PPCA 5AM7A 2NP8A 4AZSA 3JYAA 3UVRA 3L9LA 4O7YA 5GIPE 4O82A 5TO8A 3V5TA 4UWYA 1OZ1A 4BBMA 3TNWA 3ORPA 4ENXA 4M13A 2OXYA 3NVMB 4K2RA 4IX4A 3FLYA 2IVTA 4B0GA 2RF9A 4PTEA 4G34A 2RG6A 2I6LA 3HP5A 4GK2A 4QTEA 3UDZA 1VJYA 4NCTA 5CU3A 4EHVA 2QLUA 3LMHA 5DEYA 3TEIA 2I0YA 3VS6A 2XKEA 2HW7A 5E8ZA 4BCKA 3NW7A 4FVQA 2XJ2A 2R3PA 1PMVA 2WMRA 3OW4A 3KN6A 4QMLA 4ONAA 4EL9A 3L8PA 4GFGA 3C4FA 1NVQA 3KXNA 1YKRA 2VWYA 3THBA 3A7GA 3WZJA 4JJRA 1ZYCA 4M68A 2X0QA 3F3WA 5HLPA 4I21A 4IAZA 2WIHA 3NSZA 4E8AA 4PDOA 1Q8YA 5L2SA 4ZY6A 3EN6A 2JAVA 2E9UA 1E1XA 4BCMA 4BWKA 3TM0A 3MS9A 2C5OA 3KL8A 4BL1A 5K5XA 4EQCA 2J6MA 4GVJA 3ELJA 4Z7HA 5J1WA 5M06A 5AUZA 4XP0A 4AZVA 5I4NA 3SRVB 2E9OA 5F95A 4DC2A 3SG8A 3OZ6A 1B39A 1FBNA 2UW3A 5HIBA 4XOZA 4DH7A 4KKGA 3SXRA 5AM6A 3PA3A 3FLWA 2QURA 4YBJA 3DU8A 4ANOA 5EQEA 2O5KA 2XJ1A 1JNKA 3BHVA 4C02A 4FKIA 4NU1A 2C0TA 3ACJA 1J7IA 3BPRA 1QPJA 4FV8A 2FA2A 3D5VA 4QMYA 1H1SA 4D5KA 3LQ3A 3GC0A 4DA5A 1ZY5A 4C3FA 3GCUA 5IEXA 4GFOA 5BVWA 4EK8A 4GV1A 1S9JA 4DEGA 4MK0A 2B9IA 2V7AA 2X6EA 4ZTMA 3ZC6A 3RAWA 3CC6A 4GIIA 2DWBA 2PZIA 2WU6A 3L9MA 3ZEPA 4UB7A 1AQ1A 4FNWA 3DJ7A 4U8ZA 4EH2A 4MAOA 5BVOA 4EOSA 3ETAA 4I4EA 2ZM3A 5HX8A 4RBLA 4O7SA 2ETMA 5D12A 2QU6A 2QO7A 3R7OA 2YIRA 3TNQB 3PPZA 2G9XA 2JD5A 5CEMA 2JDSA 2R3KA 3II5A 3ORZA 5EK7A 3TZ9A 4BIDA 3UZPA 1OKZA 4M67A 2F49A 3VJNA 4DGNA 2XYNA 5IDNA 3Q4UA 4GW8A 3TXOA 5C01A 3W2QA 4DEDA 4J1RA 2IVVA 4M7IA 5DE2A 3U9NA 2VO0A 2GFSA 3QZFA 5BUEA 2CKOA 3VBTA 2WOUA 3UE4A 4B99A 3E8DA 3B2WA 3G90X 4JI9A 4FE2A 3ZYAA 3QTQA 3UIMA 2R5TA 4N4SA 5IMEA 4HNFA 3NEWA 3DT1A 2PMOX 3HZTA 3CKWA 3CY3A 2J50A 4QNAA 5EOBA 4E5AX 4LDTA 1E9HA 4QO9A 3UVPA 4O0YA 4I6LA 4XOYA 2ERKA 2JLDA 3KRWA 4DLJA 3VRZA 2BMCA 5LCJA 4I3ZA 5J9LA 3ZUTA 2VTTA 1ZOGA 4NM7A 3R30A 4FT5A 3Q5ZA 3EQBA 2QNJA 4RRVA 2O64A 1M2PA 3IG7A 2GQSA 3Q6WA 4DFNA 1EH4A 5FBNC 4GYGA 2JFMA 5I3OA 3CCNA 3VHEA 4I5CA 4UWCA 5DRBA 2QR7A 5IQGA 2XIRA 4YGAA 4E3CA 4FL2A 2X0GA 5L2IA 4OR5A 3IO7A 4LOOA 3PG3A 2YM4A 4XCUA 3RNYA 3MPAA 4FOCA 5E8WA 2V7OA 3VW6A 1J7UA 3Q04A 4ORKA 2BRGA 3FAAA 3TIZA 2VRXA 3GQLA 4AQCA 4NJ3A 5HD7A 2W9ZB 4LV5A 2UW7A 4V05A 4AXFA 4FSQA 4Y85A 4IFGA 3HV7A 3CE3A 2QOBA 1TQMA 3TV7A 5CAOA 2F2UA 1OKYA 1PYXA 3ZDUA 4CFVA 4DG0E 5I9YA 4MEDA 3IGGA 1V0PA 4WNKA 4EC9A 4PPAA 4AP7A 4AW0A 3FKNA 3A61A 3T3VA 3U4UA 4EWQA 4PTGA 3AG9A 3MYGA 4QYEA 4EK5A 1ATPE 3RALA 3UTOA 4WNPA 1KE9A 3ZXTA 3EQFA 2IZRA 3QAME 4AACA 4MUQA 2Z8CA 2JDRA 2C0OA 4A9UA 4QRCA 3JVSA 2W0JA 4HGEA 2XIYA 4XV1A 3WOWA 2FSMX 5CU4A 4F7LA 2C6MA 3BHUA 5H8GA 4BN1A 4M14A 3QD3A 5A6NA 3PUPA 4F70A 1ST0A 1WBSA 3G15A 3P0MA 2OZAA 4EH3A 2VO3A 3I60A 3OFMA 5E92A 3KULB 2OF2A 1UNLA 4XP2A 2CGXA 4H58A 1SNXA 2UVZA 3VUMA 1R3CA 2XK7A 3ACKA 3F9NA 3FI3A 3O17A 4PL5A 3OOGA 1YOLA 2A0CX 3WE4A 4TT7A 4C38A 3EL8A 3RNIA 3BGQA 4AT4A 4AS0A 3LJ0A 1NA7A 3PLSA 3SX9A 2XK3A 2BTSA 4KNBA 4DHIB 5C03A 2GNFA 5KMNA 4QP7A 1OMWA 4C33A 3PXRA 3EL7A 3EB0A 3UIBA 4CG8A 3F69A 4RJ4A 4R1YA 3O2MA 1HCKA 5DH3A 3S2PA 2C1BA 2W4KA 2JDVA 4AE6A 3DCVA 4OBPA 5CSHA 3RM7A 1WMKA 1W7HA 4QQTA 2BZJA 3EZVA 4FKOA 3KMMA 3F5XA 1OECA 3PRFA 4IWPA 5CSVA 2IZTA 3VUIA 3FMNA 4Z7GA 3AKJA 2BPMA 4CKRA 4NIFA 3VONA 3KC3A 2QOOA 1WBWA 3BGZA 4M66A 3I7BA 4GK4A 1R0EA 3GOKA 4BCJA 4RMZA 4GH2A 2WZJA 4NYEA 4GG7A 4D28A 3ZOSA 3HA6A 4QDEA 1OL2A 4PTCA 1NY3A 4ASZA 5E8UA 3UZTA 2FO0A 3O8UA 2RFEA 2GQGA 2YCFA 3PXZA 4M97A 3K5UA 2OZOA 4IADA 4MD7E 2Z7QA 4O96A 3GU5A 4R7HA 4KD1A 4K1BA 4JOAA 3PXYA 4D2SA 2W1HA 4HYHA 2CNQA 2GS2A 3SDJA 1FVRA 2XARA 3KMWA 3CEKA 3IQ7A 1CKJA 1M7NA 2P4IA 5DRDA 4GFMA 4NFNA 3AMBA 3KEXA 1OI9A 1MRUA 3NNVA 5AEPA 2JBPA 3JY9A 3F5UA 4IBMA 2QOKA 4E4XA 4OBQA 5AP0A 3NAYA 3QTWA 2OIBA 1ZRZA 4I6FA 4R78A 3TDWA 4MCVA 4BIEA 3TI1A 4EOMA 2QG7A 4M15A 4K11A 3E64A 2CSNA 5C1QB 4RLKA 3PJCA 5HIDA 5M4FA 2XK4A 4QMZA 3TCPA 4RIXB 3IKAA 4WG5A 5CSWA 4JQEA 3ZRLA 1YXSA 3FC2A 1P5EA 4DGOA 3GCVA 4WHZA 4J71A 3NWWA 1JKSA 2OICA 4FEXA 2I0HA 3EN9A 2XK9A 4LV7A 4CFUA 4LOPA 4EK3A 1ZYSA 1B6CB 5ANGA 2XIZA 3EQGA 5KBRA 3W0QA 1SVHA 4KABA 5HESA 3N51A 3NYXA 4YJRA 1R78A 3V01A 1U4DA 2OH4A 4R1VA 4TXCA 4YJPA 3VQHA 4HGSA 3HECA 1JKKA 4FT7A 2O65A 4FV4A 3RAIA 3RK9A 3E87A 2CNVA 4K77A 4I24A 4LMNA 3PXFA 4NSTA 3OWKA 2YZLA 2YJRA 5L2QA 4CZTA 4O7VA 4JX3A 4X2FA 3LLAA 3ZO3A 2HWPA 2B52A 3LFSA 3ML1A 2VTLA 4K6ZA 3VW8A 4D5HA 4X3FA 5E8TA 3BLQA 2IF8A 1YRPA 3DDPA 1TQPA 5DFPA 1BKXA 3PRIA 4JVGA 4MWIA 2OSCA 2ITZA 4IANA 4G3FA 4O83A 3QUEA 3DDQA 1ZOEA 2VZ6A 3NGAA 2YIQA 4F1MA 3QU0A 3JVRA 3CKXA 2CKQA 2CN8A 2X6DA 4C35A 3OC1A 3LQ5A 2Y0AA 4ALVA 3Q52A 4AZWA 3OP5A 4QP9A 5EYMA 5IA5A 3DK6A 4KBKA 5DT4A 3KN5A 5DPVA 1J91A 4HVGA 4NH1A 2R3QA 3R8VA 3BELA 2WQMA 2B1PA 4FSZA 5EW3A 4F9AA 2CNUA 4J8NA 3V51A 4DDGA 2J5EA 2VUWA 2PUIA 1PXOA 3RAKA 1VEBA 3ZM4A 3DB8A 4C57A 4C61A 4RVLA 3SOAA 4WA9A 1H1QA 3FSFA 4USDA 3AXWA 3TTJA 4UMUA 2BIYA 1YHWA 2VX3A 4FKJA 2OJIA 3KGAA 4U3ZA 4YR8A 4JDIA 1PXMA 5ANJA 5E7RA 4FKQA 4WO5A 3R8ZA 1BI8A 4XG2A 2UZDA 3QBNA 5L6OA 4FEVA 4UXLA 4WG3A 5IA0A 4UYNA 4XHKB 3EN5A 4W4XA 4KKHA 5HO8A 4WD5A 3MVLA 1Y6BA 3CPBA 3ATTA 2XALA 2R3LA 2R3HA 3CPCA 3FE3A 2HELA 2CGUA 3KMUA 5GNKA 3RI1A 4HW7A 3PVGA 3PLAE 4MF1A 4FICA 4FTUA 3HV4A 3EFJA 4A4OA 3C51A 2WTVA 5FEDA 5DIAA 4PX6A 1Q97A 3FL5A 4CFFA 5LVLA 4A9TA 4FTIA 4RWIA 3W16A 5CXHA 4ZLOA 2FUMA 3VJOA 3IDBA 2W1CA 2XNOA 1MUOA 4F0GA 3IOKA 2ZDTA 2PMNX 4Q2AA 3W55A 2XCHA 4CXAA 4YLJA 4FTAA 3COMA 2WKMA 5JN2A 2QCSA 3SXFA 1DI8A 1UVRA 3ZC5A 4JQ8A 5DNRA 3OTUA 3OT3A 4X21A 4IIRA 2HENA 1UU3A 5DT3A 3CJFA 1XBBA 3RPVA 2B0QA 3AOXA 4FG7A 2H8HA 1CKPA 3IOPA 2B9JA 4IZYA 1OIQA 4JIAA 4X6QC 3E8NA 1GZKA 4FIGA 3WZEA 5JZJA 4D1SA 3F3TA 2RIOA 3PE2A 2BZKB 3L1SA 3QLGA 3NMUF 3O51A 4FIHA 4O6LA 2PVFA 4H05A 3RP9A 3BX5A 4CRLA 2HZIA 4RPVA 4TYEA 4EOJA 4UXQA 4DT8A 3G9LX 1W2FA 4IAKA 2VWZA 4QTCA 1YI6A 3OT8A 2PMLX 4FTTA 4KAOA 5L6WL 4DFXE 3ZDIA 5HE2A 4OT6A 3I5ZA 4AU8A 2ZMDA 4F1OA 3VO3A 5CANA 4CCUA 2XK8A 4BR3A 4EOPA 4CLJA 1JLUE 4DCEA 3DXNA 5AFVA 3RHKA 4B7TA 2W7XA 5H2UA 5D7VA 2PULA 5CU2A 4ACDA 4L43A 4OUCA 5JFSA 2GTNA 4ZIMA 3WZUA 5CI6A 3C50A 4G3CA 4MBJA 3P4KA 4BGQA 2PTKA 3HUCA 3LCDA 2ZM1A 3NUSA 4IZAA 4L52A 4RQKA 4FEQA 4HCTA 5EFQA 4O86A 4XP3A 2XZSA 3F5PA 4DF3A 1FQ1B 1WVWA 1OIRA 1BX6A 3E62A 4XLVA 2CHLA 5GJGA 2YLEA 3BYOA 4G6OA 3WARA 3TKUA 2WQEA 2XBJA 3FMJA 5LMBA 4BKYA 1H1PA 5LOHA 4KRDA 4NZWB 1RW8A 3P78A 1J1BA 4MHAA 3IK3A 4ACCA 4BI0A 1P4FA 2SRCA 4C0TA 4ANMA 4GVAA 4CFNA 4AN2A 1OGUA 3FZSA 4QT1A 3UQGA 4R7IA 4JS8A 4HYUA 1KE6A 3VC4A 4ZAUA 3MB7A 5G1XA 3W0RA 5AR7A 3F3VA 2YIXA 3QQJA 3HX4A 4L7SA 5ETAA 3JS2A 4RWJA 2BRBA 1KWPA 2VTOA 4HCUA 4D2RA 3FMMA 3DQXA 3AD4A 3C4ZA 1H00A 3R7UA 5HVYA 1A06A 4XV3A 3AKKA 1PMEA 2WEIA 4KIQA 3S0OA 1GY3A 4TYHA 4DEAA 2R9SA 5AV1A 2W99B 3LJ1A 4MTAA 4IDVA 2H34A 3GGFA 4ANBA 5AP4A 3ENMA 5DHJA 5HEZA 5IQFA 1ZZLA 4XUFA 4FMQA 3R2BA 4ASXA 4D4SA 5AUVA 3SC1A 3VHKA 3V8SA 4AW5A 4C59A 3UC4A 5C8NA 2F9GA 4LGGA 4YC6A 3HYHA 2ERZE 5M4UA 4YZMA 4F4PA 4BCGA 3OTVA 2JKOA 4O0VA 4EH6A 4M84A 3Q4CA 3LM5A 2Q0BA 3C5UA