2Z60A

Crystal structure of the t315i mutant of abl kinase bound with ppy-a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
284
structure length
281
Chain Sequence
GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystal Structure of the T315I Mutant of Abl Kinase
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 281
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z60A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z60A01
3SX9A 4JIKA 3ORPA 3W32A 3QD3A 5KMLA 4IAIA 3JUHA 1P5EA 3QWJA 1TQIA 3ETAA 5F94A 2BALA 3ROCA 4ACCA 3VS7A 4QTDA 1U54B 4FZDB 3MN3A 1ZOEA 5FWKK 4ZLZA 4R8QA 5HICA 4UWBA 3ORXA 5A4EA 1ERKA 2ITPA 4X21A 4EWQA 2W0JA 4AA0A 5HG8A 2RSVA 3TNHA 3A4PA 2BUJA 2HZ4A 2XRUA 4Z3VA 5HORA 2W1GA 3WBLA 3QUPA 4AT3A 5HHWA 4J52A 5IQHA 4YLKA 3UBDA 5KCVA 3TTIA 3SOCA 3FPMA 4AGCA 3GVUA 3RP9A 5IMEA 3F2RA 1XH9A 4MWIA 3C0HA 3QU0A 1UU8A 3QQJA 5CVFA 5KKRB 2I7QA 5CF6A 5C1QB 3MYGA 1LP4A 4IVAA 5M07A 3V5QA 3FI2A 4FV5A 3FHRA 3S00A 3A8WA 5HO8A 3C7QA 2WMWA 3GOPA 3C4XA 4XRLA 2XKEA 5GNKA 5H9BA 5HLWA 4NK9A 2UZBA 4MBLA 5K3YA 3HRFA 1URCA 5FQDC 4OTRA 4EHEA 2Z7SA 1XH5A 3C51A 4USFA 2OIQA 3SW7A 5KMJA 3OROA 3SKCA 3PY0A 4FTLA 4BDHA 3VS4A 3BHUA 5J9ZA 3QCSA 4G31A 2C68A 5IQEA 1OIRA 3PZHA 4TWPA 3DBQA 2I0VA 4FYOA 4AAAA 4L42A 3TG1A 3NUAA 3O8PA 3KEXA 4O6EA 1W0XC 3LXKA 3C5UA 1PYXA 3NVKI 2V62A 3LJ2A 4ZY5A 2JAVA 3QKMA 3BU6A 4BZNA 2W05A 3RNIA 3D2KA 2YM3A 4IM0A 1FPUA 4FKRA 5I9ZA 5IMXA 4XV9A 4E7WA 3T9IA 2F7EE 3UVRA 4EBVA 3N4VA 5L2IA 4IH8A 1MUOA 5TT7A 3DFCB 4EKLA 1MRYA 5EW3A 5LVLA 2Q0BA 4IB1A 3VUTA 2GQSA 4K77A 3LFNA 2YIRA 3L9MA 2XEZA 3RHXA 2W1FA 3QQGA 1I44A 4UY9A 4BDDA 2VAGA 4IB3A 2O63A 1P4OA 3DBEA 3Q4TA 4HW7A 4FEVA 4LGHA 4WSYA 4GG5A 5B0XA 4EUUA 2QG7A 3C4EA 3KXMA 4AE6A 4ZTSA 2EB3A 4AP7A 2J9MA 3IK3A 2UUEA 3ENHA 3NYXA 3ORZA 4XBUA 3Q9WA 3R63A 3NNVA 1BI8A 4A9UA 2C4GA 3U55A 4YJNA 2YACA 4DG2E 5C4KA 4RBLA 3NSZA 3PZEA 4CKIA 3FLWA 2BRHA 4L01A 1YXXA 3TJCA 3OY1A 1UKHA 3OXTA 3KRXA 5C8NA 2OBJA 3LFCA 3COMA 3GU6A 2VTTA 3PXZA 3FC1X 4CD0A 3EQPA 5LMBA 4GU6A 1JLUE 3SQQA 4HVHA 3R8LA 3V8SA 3R1QA 4MBJA 4OAUC 4QTEA 5LWMA 5EQPA 3AC3A 5BVOA 4KUJA 3HV6A 4AF3A 3TKUA 2FSLX 3UIMA 1YWVA 1WAKA 2G15A 5I9UA 4YPSA 5K5XA 4C62A 1IA9A 2ZMDA 5J79A 5CNOA 2YWVA 2X7OA 4QMOA 2NO3A 3UYSA 3WZDA 5DT4A 2NPQA 2PMNX 4N6YA 3TZ7A 3CC6A 3FQHA 3VNTA 3W1FA 4YUQA 3V5TA 5J8IA 5LVNA 4QMVA 4IZ5A 1XR1A 5FP6A 3DKFA 4EH5A 3K5UA 4I1ZA 4BYJA 4JDIA 5BVNA 5HLNA 2I0YA 3MGYA 3B8RA 4G2FA 4F0GA 3QBNA 4XCUA 3FXZA 2OJ9A 4KIOA 3L9NA 4DEHA 2BFXA 1K3AA 4O84A 3HGKA 4MX9A 5IQBA 5HVKA 2PULA 3VVHA 2C69A 2W1IA 4O0RA 3A99A 2ITUA 2OZAA 4C38A 3FLZA 1JKLA 4V01A 2IVUA 3QQKA 5EI6A 5E8UA 1H08A 3GB2A 2HOGA 3AD5A 4CMTA 5JN2A 3RWQA 1PW2A 1GIJA 1H4LA 3RHKA 4FEXA 4J8NA 4ZMEA 2ZB0A 2GDOA 1G8SA 4D4SA 3A7HA 5D1JA 4D4VA 5CAOA 4F1OA 2DYLA 3LJ0A 1ZLTA 4L6QA 4LOQA 5IH5A 4ASDA 4UXLA 3TKIA 3NW5A 3TDWA 5AM7A 3EL8A 3FYJX 4MYGA 3KRJA 2QKRA 4IAAA 4IDVA 4QTCA 4GW8A 3BEAA 4TT7A 3TCPA 2XNPA 3BGZA 3DOGA 2EB2A 5IQCA 3H4JA 2YM6A 3H9OA 3Q32A 3QTUA 4O0XA 4U7ZA 4XP2A 5FDXA 3FMKA 4DFXE 2ESMA 4FKTA 4IJ9A 5KMOA 5E9EA 5IA3A 2P55A 4EOIA 4ZEGA 3TUBA 5AV4A 4QMXA 3BHYA 3QQLA 3BLRA 4LV5A 1OI9A 5AX9A 4QMWA 3CKXA 2E9NA 3E93A 3R8UA 3DNDA 3TIZA 2VZ6A 1WCCA 4BDIA 2F57A 4ZXTA 4GK2A 2QOBA 3D2IA 3N4UA 3NMUF 3LOKA 5M08A 4KIPA 3RPYA 4NYEA 4DYMA 4I20A 3LFBA 3KA0A 1HOWA 2YCFA 2QCSA 4PMPA 2PUPA 2CDZA 2XRWA 3OTVA 3GCQA 3DAEA 1DAWA 2ITYA 4BI1A 4TL0A 1TQPA 3MVLA 3DAKA 4P5QA 1OGUA 2VWYA 3ACJA 4ZP5A 3E62A 2GPHA 2HY0A 3U9NA 4JRVA 3FMHA 4BBMA 4LL0A 3QYWA 4AGWA 4B0GA 2RF9A 4FKIA 4CV8A 3F61A 3BZ3A 2HYYA 1OUKA 2QU5A 1STCE 4RMZA 1L3RE 3GCVA 3O23A 4O0VA 4QP8A 1PXMA 2VGOA 3IDCA 4RQKA 1YXUA 2XH5A 3EN7A 1YVJA 2Y4IB 3GQLA 4EK8A 3H0ZA 4HGTA 2ETRA 4O38A 3VBYA 4WUAA 2P4IA 2VTIA 2R64A 5KZIA 3UC3A 4YC6A 3ZLSA 4U41A 4BFMA 3ATTA 3HA8A 4DGNA 4KIQA 4WOVA 5BUJA 1UNHA 2UZTA 4CMUA 2ZV7A 4MHAA 2EU9A 4UALA 3L9PA 4F1TA 2Z02A 3BWJA 4R77A 5L6PA 2WO6A 2XBAA 4TNBA 2XIYA 4FIJA 4UV0A 1BMKA 4IACA 2R3OA 5L2SA 4NUSA 4WT6A 2IPXA 1UNGA 2YA9A 4APCA 2CCIA 3GFWA 2BRNA 1OUYA 4NIFA 3JVRA 4A06A 3ZSHA 4C4EA 5IH4A 2XNEA 3A62A 1M7NA 1OIYA 3DLSA 3EKKA 3PUPA 4P2KA 3I79A 5AR5A 5HLPA 4RX8A 3UC4A 1YQJA 3P0MA 1VYWA 4GT4A 3ZXTA 5J7HA 4AG8A 3R28A 3QYZA 3ZZWA 4CTBA 3QUEA 4UB7A 4CLJA 4C59A 2J7TA 4NKAA 3BYVA 2WMSA 3A8XA 2OJJA 4Y85A 3AGMA 4GKIA 2UW4A 3MVMA 2XEYA 4ZY6A 3R8VA 3EL7A 5IDPA 4YR8A 3ODZX 4CG8A 3FKOA 2XMYA 5CT0A 3QQHA 5FXQA 2VV9A 2BZKB 3OWLA 4IX5A 4E6QA 4HYUA 3MY1A 2IW6A 2UW7A 3FE3A 1GOLA 2X7GA 3ENMA 3FZTA 3GC7A 4D55A 3A7GA 4TWNA 1JKTA 3CR0A 3EQDA 4QP6A 2P3GX 2F49A 1VJYA 4OTHA 4HVSA 1Q3DA 3ZMMA 3S0OA 5L3AA 3G9NA 4NEUA 4IIRA 3AMBA 2YM7A 5CNNA 4GS6A 5HOAA 2OJGA 5HX8A 3QFVA 5TF9A 4J99A 4FZ7A 5CVHA 2OXYA 4MD9E 1JKKA 3FPQA 3TNPC 3SA0A 2B52A 3RK5A 4CMOA 4FTCA 4CZYB 3KREA 3NUUA 3NWWA 2WTWA 4D0XA 4I0RA 1XBCA 5EHOA 3TACA 3B2WA 3F82A 2JC6A 1H26A 3QTSA 4ANBA 4NKSA 4BHNA 3NVMB 3VUKA 4G1WA 2W1HA 4GT3A 4CZTA 2PL0A 3TV4A 5ACBC 1JSTA 2WMUA 2VTLA 3B2TA 3M11A 4DCEA 4ZZNA 5IEYA 5CU3A 3VBVA 2GNHA 4RVTA 1IAJA 2V7OA 2HY81 1QPEA 1ZYDA 4BC6A 3BYOA 4AZTA 1MRUA 3O96A 4I4FA 1OM1A 2XB7A 4QMUA 5CXHA 4CT2A 4D2RA 5HE1A 1ZY4A 3DDPA 3BU5A 3MV5A 4LYNA 4XMOA 4BIDA 4DFYA 5AA8A 3UPZA 3EQCA 2PE0A 3BRBA 3IONA 4BN1A 2C6MA 3FI4A 2Z7RA 2J0MB 3PXYA 2PTKA 4MNFA 3M2WA 2X7FA 3UZRA 5LJJA 4I5PA 4R3RA 5AJQA 5DI1A 5IEVA 2QLQA 3I60A 3OOMA 4QOXA 3AD6A 4QYEA 3RMFA 5DMZA 4O86A 4WNKA 1ZWSA 4ANOA 5HG7A 5LMKC 5AAFA 3MH3A 2FO0A 2ZM4A 3FSFA 4FKJA 3QAME 4KABA 5CEOA 3ORIA 5CF8A 4CTCA 3ZRMA 4HYIA 5GHVA 2RG6A 3CE3A 2PMOX 4G3FA 4GU9A 4K6ZA 3L9LA 2CNVA 3A2CA 5LVOA 3PXRA 4ANNA 3NDMA 5AP6A 1OL6A 4JOAA 4U3YA 2X6EA 3EQFA 4JJRA 3UGCA 3MFTA 1UWJA 4U6RA 2NRYA 2X4ZA 4FSRA 5DRBA 5E8XA 4LGDA 1FMKA 3R21A 3PIYA 4IX3A 3QZIA 1WZYA 3KC3A 2AC3A 4AACA 1H01A 3KULB 3CSVA 4W8DA 3G33A 4RIXA 4AN2A 2PZ5A 4FA2A 3NNUA 5E1EA 5AP7A 5DYJA 4DLIA 2VWVA 1IRKA 2WKMA 2IZUA 4LRKA 4ANQA 3LKMA 4JRNA 2IN6A 2JEDA 3U87A 1S9IA 3MJ1A 4OTQA 1LUFA 5HU9A 1VZOA 4F9AA 4L8MA 5AUWA 5JKGA 3UNKA 2BIKB 4FSWA 5TR6A 1H27A 2UVXA 3S1HA 4JQ7A 1XH6A 2R3QA 3RCJA 4N57A 3R9RA 4CKJA 2EXMA 4H39A 3FZPA 2WEIA 1ZMVA 4MF1A 3PRIA 1GIIA 5CY3A 3CTHA 3EMGA 3BPRA 4I24A 5HNGA 4ANLA 5HTIA 4O81A 4BB4A 5M44A 4S2ZA 4OGRA 2HAKA 3PJCA 3SW4A 4B8LA 4MD8E 4AFJA 5JGDA 1KOAA 1P14A 4TYGA 5A4CA 1JKSA 3P1AA 4B99A 1YHVA 3F5PA 4ZLYA 5AADA 3D7TA 4GSBA 4DT8A 4P4CA 3GI3A 3DKGA 4WG4A 4ZSGA 4CCUA 4O7RA 2VX0A 3QD0A 1W8CA 4G3GA 3ZRKA 4EQUA 2YZAA 4JVGA 4KD1A 3CPBA 4FL3A 3CGOA 1FVVA 4PMTA 3SXFA 5DWRA 4L52A 4EONA 1LPUA 2HXLA 5HEZA 2BIYA 4QO9A 4TNDA 4XJ0A 5AIRA 5AAEA 4O7SA 3NNWA 1H25A 5IQIA 2SRCA 3IW6A 4C4GA 4E5BA 4FBXA 3IOPA 3T3VA 4PMSA 4C8BA 3I7BA 4LGGA 3ZM4A 3FZOA 3CBLA 4QYGA 5EQYA 3UYTA 4AZSA 2W9FB 5EOLA 4O0WA 4FV3A 3DGKA 4NFMA 3BWFA 3D94A 2GCDA 4KIKA 3UP7A 4EHGA 3BGPA 4FV8A 1F5QA 4IZ7A 3CJFA 3O71A 3P9JA 3PXQA 4JG6A 5HE2A 4AZWA 4RQVA 5D9HA 4E20A 5J5TA 5BVKA 2YM4A 3SHEA 5CSXA 4HGEA 3HV3A 3PRFA 3LXLA 2LGCA 2WOUA 4C61A 4EOQA 4F9YA 3LXPA 4ZSJA 3VW8A 4MAOA 4QPAA 3EQIA 2WOTA 3QTQA 4CYIA 5EW8A 2I1MA 1W83A 2JKMA 3HX4A 3EZRA 2F9GA 3V5JA 4FKPA 1PF8A 2A27A 3PJ2A 2I0EA 5EKOA 2XZSA 4O2PA 3V8WA 3F5UA 3CP9A 3Q9YA 5KNJA 3AC5A 4EH7A 1Z57A 5EYKA 5CT7A 3UG1A 4U80A 3W16A 1ZYJA 5IISA 2WAJA 4EOSA 2ZV8A 3V04A 3HA6A 4FTNA 2OK1A 4YJPA 1WBOA 2Y9QA 5HCZA 4L44A 1REJA 3P5KA 4ERKA 2F2UA 4ZMFA 1WVYA 2VWWA 1SVGA 4Y8DA 3VRYA 4IBMA 4ASEA 4B9DA 2IZSA 3CGFA 3DKOA 2BAKA 3QRTA 3F7ZA 1WBNA 5AR3A 2BDFA 5AUVA 2ZV9A 4RIXB 1NVQA 2WIPA 3I5NA 5HE3A 3FHIA 4CNHA 4XG4A 4HNIA 4Z7HA 1R78A 4XOYA 3RAIA 5KMMA 3MW1A 2XK6A 5D10A 2RL5A 4XG6A 2X8IA 1AD5A 3QALE 4L53A 5BNJA 3D0EA 4XG3A 3RJCA 5JGAA 2CGXA 2UW5A 4E4NA 2YISA 4S34A 4BF2A 3LFEA 2XK9A 4FG7A 3VUDA 2QD9A 4NM3A 5CZHA 3VO3A 5F95A 1URWA 4FEQA 3ZM9A 3E64A 3IS5A 4GH2A 3E92A 3ZXZA 4BCMA 5IPJA 2YIXA 5CS6A 3Q52A 3MB7A 2GFSA 4MH7A 3PSDA 4M7IA 4FVQA 2HZNA 5F9EA 3NYNA 1PXNA 2OG8A 2R3PA 3LAUA 4AT4A 3Q60A 2WQEA 5J1WA 2E9UA 3HLLA 2YLEA 4Q9SA 1SVHA 5I5ZA 2BMCA 1PXPA 3U54A 3D7TB 2PUIA 1O6KA 2PVRA 1W82A 4FV6A 5HG9A 1V1KA 2BRMA 3VWAA 1A9UA 3AT4A 3I0QA 3KVWA 3HRCA 3SDJA 3HAMA 4MCVA 4Q2AA 3BEGA 5JFWA 4DT9A 4PRJA 2W99B 2XIXA 4UZHA 4PL5A 3UMWA 4KINA 2XK3A 2OJFE 2QOIA 3U6JA 5LWNA 4C7TA 4CYJA 3UQCA 1CTPE 4O7VA 2XJ0A 2F4JA 1ZYSA 3OD6X 3IW4A 2WXVA 3HRBA 4JQ8A 4F9WA 3S3IA 2UZLA 4C02A 2YZLA 3HP5A 2Z7QA 4KIKB 3ATSA 3TIYA 4U44A 2V55A 1UU9A 4E4LA 3SG9A 4OAVB 4BR3A 3CKWA 3JVSA 3CD3A 4PDSA 2HIWA 4AN3A 4ZJJA 2JIVA 5AV3A 1SVEA 2PVMA 3OZ6A 4CG9A 1PMNA 3ALOA 4O82A 4A07A 4HVGA 4J98A 3JY0A 3RVGA 2Y0AA 4BYIA 2E2BA 3PWYA 5HBJA 3D7ZA 4UMRA 4AZVA 4DEGA 2VTHA 2E9PA 3AC2A 2NP8A 3ZRLA 5IA1A 3TI1A 3DU8A 4PNKA 5JH6A 2XNOA 4ACMA 4OTFA 4BDKA 4ONAA 3PLAE 4ZTQA 4FTJA 4ERWA 4YTCA 3DV3A 5D11A 1BLXA 1M14A 1LR4A 2C6TA 2OF4A 3LCDA 4FV9A 3GU8A 3NIZA 5K9IA 4RFZA 5CALA 3CTQA 4QTBA 3V51A 3QZFA 1K9AA 4RZVA 3SVVA 1DI8A 3EQBA 1ZYLA 3KXXA 3QLGA 4RPVA 2WQMA 1O6YA 3TT0A 3W8QA 2YIYA 3I7CA 1NVRA 3WIKA 4AT5A 2BHEA 2X9EA 3BYUA 4P7EA 4Z16A 1YHWA 3UIBA 3BU3A 5CF5A 1TVOA 2HENA 4FKUA 1PXOA 4YGAA 4WA9A 5H8GA 5LARA 3MVHA 5E4HA 4YJUA 3DTWA 4JIAA 4UYNA 5DR6A 5M55A 5IQGA 3NS9A 4IQ6A 4M8TA 4FL1A 2C1AA 4HCVA 1Y91A 3PPKA 4BGGA 3FC2A 4TYHA 5AM6A 4KRCA 1PKGA 1YW2A 1M2QA 3R9HA 3AC4A 2QHMA 4XV3A 3Q53A 1U5QA 3QC9A 3QA0A 4UBAA 5L6WL 3RCDA 4W4XA 4NJ3A 3BHTA 2C6IA 3OXZA 1MP8A 1Y57A 3C9WA 4I21A 4OT5A 5BVWA 3ZO1A 2O64A 2J6MA 5K5NA 3GGFA 3C5IA 1UNLA 2R3RA 2PZPA 3RTPA 4BCGA 4AE9A 2GHLA 2R3FA 3Q9XA 2Q83A 5EKNA 2CNUA 4IVBA 4DE4A 4PL3A 4BL1A 2DUVA 4R1YA 3I5ZA 4BZOA 1YOMA 3W2SA 4CFVA 3LMGA 5CSWA 2ZM1A 3KRWA 5T3QA 1OB3A 3D4QA 3OVVA 3PSBA 4BTMA 3F5GA 2AUHA 1YKRA 4TYEA 5HU3A 1H1QA 1PXLA 4WD5A 2BRGA 3MBLA 3R04A 4B6LA 4AW5A 4NCTC 3KFAA 4BI0A 3SRVA 4EZ3A 5JFVA 4DEBA 2CN8A 2WTVA 4NM0A 3I6WA 1DI9A 3ZU7A 4XOZA 2VWXA 4YZ9A 5GINE 3AMYA 1BYGA 3ZEPA 3NLBA 1IG1A 4QP9A 4RC3A 3WZUA 3ZDIA 2J51A 3MH0A 3TZMA 3KGAA 4IWPA 3II5A 1REKA 2F2CB 2WMTA 4RJ3A 5E8VA 3ZTXA 1JBPE 3LZBA 1U5RA 4X3FC 1JAMA 5A46A 1IASA 5AUUA 4U43A 3D15A 4FL2A 4M69A 1XKKA 3R83A 1VYZA 5FTQA 4FX3A 5E92A 4XP3A 4WG3A 2VTPA 5CQWA 2JITA 3MIAA 2VTNA 1QMZA 4FK3A 3V5WA 4EOPA 2WQOA 3MESA 4AOJA 4UYAA 4QP3A 4IFCA 3E8DA 3LQ3A 2QNJA 3BHHA 5EI8A 4FG8A 3JR1A 3LHJA 4I5HA 4ZSLA 1R39A 5LVPA 4CV9A 5AUTA 5LVMA 3ZS5A 2ITQA 1PY5A 5DEYA 3TJDA 4BCPA 5H3QA 4TWOA 4GJ2A 4I0SA 4ALVA 4DH1A 5DGZA 3V5PA 1BL7A 2UW0A 2BKZA 4ZS4A 3SOAA 5FM3A 1UVRA 5DFPA 2X2KA 3OTUA 4FSZA 3D83A 3VQHA 4NSTA 4ZY4A 2QR8A 2QONA 2VTOA 3DNEA 5GZAA 4FKLA 4YURA 4ID7A 3WF6A 4E1ZA 3LW0A 3ZLWA 3Q5IA 4DAWA 4YTIA 5HNIX 3EFKA 1DS5A 4IFGA 2W96B 3HZTA 3O2MA 3RBWA 2QODA 3VS5A 2WHBA 4FIGA 4IM3A 4WNOA 3R7UA 2ETKA 1B6CB 4LUDA 3Q5ZA 4M0ZA 2GS6A 3KCFA 3GU4A 4QT1A 4FT9A 5IUIA 5FDPA 3RPVA 2DWBA 3EQRA 1I09A 3CD8A 4KKGA 2C30A 3FBVA 1BKXA 1OL1A 1CM8A 4IDTA 3VBQA 3W55A 5K4IA 3OWJA 1Q62A 5ANEA 4FKSA 4M68A 4TYIA 3MSSA 1YI6A 5TE0A 3EFLA 3QKLA 4ACHA 4AU8A 5KKRC 2J0IA 2GNJA 4GYIA 4UEUA 2XIKA 4MKCA 3RM6A 3WF5A 2VU3A 3P7BA 3QGWA 4O7ZA 4BIBA 4O1PA 4MXYA 4EORA 5A14A 1PHKA 4QYYA 4K18A 3WI6A 3EOCA 4FKVA 4GG7A 3WARA 4E73A 3OBGA 4HGLA 1PMVA 4K8AA 2JBPA 4BWPA 3AOXA 2FYSA 3ORKA 3DXPA 4D1XA 3HDNA 3FZSA 1CKPA 2WB8A 5HBHA 3PVWA 3GEQA 3GCPA 2RFEA 4WHZA 2HZIA 4AUAA 1H24A 2QOLA 2GU8A 3TKHA 4BTJA 4O7WA 1OKYA 4R78A 2HWPA 2ERZE 4WKQA 3SRVB 3DZQA 5HD7A 4DTBA 2YCRA 5GZ9A 4PTEA 2Z7LA 4PTCA 2V7AA 3LFAA 2BDWA 1OIUA 2W5AA 3ZFXA 2W4OA 4HPTE 2O8YA 2YWPA 2XA4A 5T68A 4EUTA 3QD4A 4UWCA 2LAVA 5I4NA 2JDSA 4YHFA 3FMEA 5C01A 1S9JA 3EHAA 3HMPA 5C8KA 1NVSA 5M4IA 3N9XA 3LFQA 3HYHA 5G6VA 4C4JA 1SYKA 2FUMA 5DG5A 4BVUA 3NNXA 2P2IA 4B7TA 3EIDA 4A4XA 2CSNA 2P0CA 4AQCA 4TPTA 3UTOA 4ZK5A 4U79A 2QO9A 3MVJA 4D9TA 3PIZA 4M69B 3RAKA 3TUCA 4AFEA 3LJ1A 1GZKA 5JQ5A 1PRYA 3C4ZA 2REIA 4DFZE 5HCXA 2XP2A 4QMNA 2WFYA 3ZYAA 5E8ZA 3PA4A 4DGGA 2W5BA 2Y6OA 2WMBA 5D41A 3WILA 4I5CA 2ZOQA 3H10A 4IB0A 4I93A 4U3ZA 4YBJA 1ZOGA 3L8SA 3EFWA 3ZOSA 3I1AA 4X2GA 4OUCA 5B2LA 2C5XA 2H6DA 4NTSA 3TNQB 4ASXA 2WELA 1Y6AA 2WTJA 3NUYA 5LMKA 4OTIA 4F70A 3MFSA 4RVMA 1PXKA 3EN5A 3UO5A 2RG5A 1GZOA 4GRBA 4RVLA 2WU6A 3U51A 4DTAA 4L3LA 5H8BA 4U81A 4EZ5A 4I0TA 2WQNA 2Y8OA 1O6LA 2IVSA 2X39A 5DH3A 4ENYA 1ZAOA 2O65A 2ZDUA 4DFLA 3HMIA 4O2ZA 4O0YA 4LFIA 4I23A 3F2AA 4OBOA 4Z55A 4UWYA 1XJDA 2X2MA 4RIWA 2C5YA 3G0EA 1J7LA 3P79A 5FGKA 1WBSA 4J96A 4MEDA 3A61A 2OWBA 1JPAA 4ZOGA 5CI6A 4S32A 5IEXA 4BKYA 5IU2A 5K0XA 4WG5A 2VTMA 2G01A 4PUZA 3NR9A 4W8EA 4FIHA 2JIIA 2BAQA 4QP4A 3NCZA 2IZRA 2YM8A 4FT0A 3BV3A 4JBOA 1GJOA 4XHKB 4F0FA 5ETCA 1T46A 2UW8A 3QRJA 4IX4A 1OL7A 4BKZA 4YZCA 4Z7GA 4Y5HA 4IC7A 2QO2A 3F3ZA 4ZAUA 4O7TA 5BVEA 4QMQA 3WF8A 2CKEA 3SC1A 3BKBA 4XX9A 3H9RA 5CU2A 1B38A 1MQBA 5HKMA 4CFFA 3BBTB 1Q4LA 3FMDA 3O7LB 3FLQA 3VS2A 4F63A 5CEMA 3NYOA 2FSOX 4OBQA 4QMYA 4CFXA 5DA3A 4L3JA 5ANJA 1YDTE 5AX3A 4DFBA 4X7QA 5BVDA 4O6LA 4FSUA 4F9CA 4PNIA 4QYHA 4EWHA 4JDJA 2OGVA 5HGIA 3ZLXA 4PMMA 4FICA 5BPYA 2X8DA 3IDBA 4LM5A 4YJSA 4RFYA 4JS8A 2H9VA 2RFNA 4YHTA 4PPBA 2VTRA 4F7LA 4FKOA 4USEA 4QQJA 1YDSE 3BQRA 3OBJA 4U0IA 3FL5A 4BCNA 4GFOA 4EOOA 5A6OA 4FI1A 4L00A 2Y4PA 3NAXA 4DH7A 2VTAA 1OBGA 2CGVA 4IM2A 2J5EA 1E1XA 5HCYA 4D2WA 3BE9A 2XYUA 2OH0E 4GK3A 1FBNA 4PDYA 3PY1A 2PU8A 3DS6A 3QLFA 2IZTA 4FV1A 3AT2A 4IWQA 4F65A 3R7IA 3LLAA 4FKGA 4FK6A 2OZAB 2VN9A 5FP5A 4GVJA 1OMWA 4Y46A 4I22A 4OT6A 3QA8A 4IC8A 3DY7A 5K0KA 3C0GA 1ZZLA 2R3JA 4NWMA 5AA9A 3Q4ZA 3SV0A 3FYKX 4E93A 4O7YA 4AS0A 1TKIA 4II5A 1KV1A 4BCJA 4BCQA 3QRKA 5I3RA 4FMQA 1SM2A 3E7OA 3KCKA 2JKQA 1TQMA 3R7OA 3RZFA 4CZUA 3RINA 4XV1A 4G34A 3D5WA 2UVZA 3G51A 3P7AA 3OFMA 3PY3A 3IKAA 2R5TA 5L2QA 3PVBA 5M4CA 4OTPA 2BTSA 2I40A 4FVPA 1J3HA 4QP2A 5HG5A 5KE0A 5J87A 3QUDA 4QQ5A 1ND4A 3OUNB 4RC2A 4IHPA 3CY3A 3PXKA 2EVAA 3QTXA 3RKBA 5AP1A 5E91A 3BYSA 5A9UA 3EN6A 1KWPA 4D2SA 5DVRA 3A7JA 1APME 1ZOHA 1H00A 4R7IA 4IZAA 3R0TA 3UG2A 4EYMA 3HEGA 5E1SA 5K4JA 1KE8A 4I41A 3LLTA 4H3QA 3UNJA 4EC8A 3DXNA 3BQCA 1KE7A 2VNWA 3QHRA 4DEDA 5M56A 4L3PA 4PQNA 4J71A 1YWRA 3KF4A 2BDJA 2HZ0A 2BZIB 2F7ZE 1OPJA 4FNWA 3QCQA 4N0SA 2QI8A 4YSMA 1H28A 4C57A 3HMNA 3UZTA 3F9NA 3WE8A 4RGJA 5AP3A 2WMAA 5AR4A 3M1SA 3SAYA 3TNWA 2YEXA 4G5JA 4QMZA 3FDNA 2PUNA 1WBTA 3SD0A 2NRUA 2EXCX 2Z2WA 2GNLA 4Z9LA 5M09A 2R3HA 3F3WA 5AEPA 3VUMA 3OMVA 1Q8WA 4YMJA 2OICA 4O0SA 1RE8A 5DPVA 4J95A 2XS0A 2JKKA 5F1ZA 1XH7A 1OVEA 3DBCA 1GIHA 2VO6A 5E8SA 4Y72A 4RG0A 3K3JA 3R7VA 3RPRA 5AFVA 3KXGA 4LRJA 3GCUA 3TV6A 5FUTA 3KXHA 5I9VA 2ITWA 2VTSA 4P90A 2RGPA 3ZSIA 4HJOA 1G3NA 3D9VA 3PVUA 3E8NA 4NZWB 5EYDA 1PYEA 4ZSEA 4A4OA 1W7HA 1YXSA 4X3JA 4E4MA 3FEGA 2WTDA 3ZO3A 3KU2A 5F20A 2FH9A 3TZ9A 3R7EA 4EQMA 2ONLC 4WBOA 5JT2A 2XNBA 3FAAA 1UU3A 4DF3A 4ACGA 4WNMA 5CVGA 2BHHA 4ZTHA 2WD1A 3H30A 2VNYA 2W17A 4FTRA 4MQ1A 3VHEA 4F6SA 2G2FA 4FSNA 4AWIA 4NIFB 4YJVA 2C3JA 2WPAA 2FGIA 4FSQA 3KQ7A 4G9CA 4EOJA 1SZMA 2BILB 4ZIMA 2BPMA 4AXAA 3E3PA 2GHGA 5AV0A 4XG9A 4I94A 2VD5A 3VBWA 4R5SA 1KOBA 5CSHA 3QCYA 5IA5A 1QPDA 1R3CA 2PHKA 4IAKA 2GNIA 4LOOA 3CCNA 2GNFA 4BGQA 3JYAA 4H3BA 2ITVA 3G9LX 2QURA 2C6KA 4F4PA 2OO8X 5E8TA 4YJOA 4KSQA 2IWIA 2P33A 1ZYCA 3PSCA 4OBPA 3W8LA 4J8MA 3FWQA 3FUPA 3MH2A 2OLCA 1DM2A 4QMLA 4HNFA 4YBKA 5B2KA 2X0GA 3FZ1A 3ERKA 2C0IA 2EWAA 4MTAA 4UN0C 1OBDA 3BE2A 3C0IA 2CGUA 4GEOA 4J53A 4R3CA 3QC4A 4PF4A 4C37A 2G2IA 5EHYA 5DBXA 4V04A 3FQEA 3QCXA 5DEWA 3R30A 3FZRA 1ZRZA 1YI3A 2A0CX 4D58A 2GS7A 3FJQE 3DDQA 3PYYA 4WNPA 5ANIA 4DINA 1R0EA 3COKA 5CI7A 4FF8A 3PVGA 3OCTA 3RK9A 2CNQA 5IKWA 4EH2A 2ITOA 3HP2A 4JBPA 4JDHA 4V05A 2C6DA 3OT8A 3AT3A 3NAYA 4RLKA 1YI4A 4BWXA 3VJOA 3ORMA 4C34A 4FT7A 5KMIA 2WTKC 4RJ4A 4GUEA 2YDJA 5HIEA 3E3BX 4IADA 1LEWA 2OXDA 5AP4A 2PSQA 4YO6A 4A4LA 5EQEA 1Y8GA 2OU7A 5I3OA 1YWNA 2Z60A 2BCJA 4KSPA 2PZRA 2ACXA 3GENA 3UP2A 1HCKA 2FA2A 4IB5A 5M4FA 2XBJA 3E63A 3R73A 2UW6A 3QTRA 5DT0A 4C58A 2PYWA 5DRDA 3ODYX 1ATPE 4C2VA 4AZEA 5AP0A 4HZSA 4MNEA 2V5QA 3QKKA 3W2PA 5T6KA 4BDEA 3I0OA 3KF7A 4RA5A 4DGMA 5IZFA 2OI4X 4XP0A 4RX5A 2JFMA 1KE5A 5CWZA 3VUHA 1BUHA 3HNGA 3S2PA 3BX5A 5C27A 2JGZA 4DTKA 4MXCA 3GU7A 2VWBA 3FQSA 4CXAA 3KMUA 5AV1A 5C4LA 5JRSA 5J95A 4HVIA 4UXQA 1VEBA 3AC1A 4JAJA 4EEVA 2ZM3A 3B8QA 4B8MA 4PX6A 1PMEA 4E6AA 3VRZA 4NCTA 4O83A 3R6XA 4G6OA 4ALWA 2W9ZB 3LMHA 4PTGA 2QC6A 3RZBA 2CMWA 3EQGA 3HKOA 3W10A 3VQUA 2XK8A 3DQWA 4RIYA 3HV5A 2YAKA 4PDPA 4CT1A 5AMNA 4G3EA 2CLQA 4X2KA 5EDQA 4ITJA 2GNGA 2YJRA 4IVCA 4TW9A 3D14A 2X6DA 3Q4CA 2C6LA 4C4IA 3LM0A 3LQ8A 4U42A 4PDOA 5FEEA 4EH3A 3NPCA 3OOGA 3QD2B 4H1JA 4H1MA 5L2TA 3WF9A 5AR8A 3Q6WA 4D28A 4NTTA 1KSWA 4JX7A 3Q3BA 4X3FA 5E90A 5DLSA 4C3FA 4E4XA 3DJ5A 4ZTLA 4D5KA 5E7RA 5KX8A 1Q8ZA 2UZDA 4JL9A 5BUEA 2X9FA 2H96A 2XJ2A 4FTQA 3VS0A 4FUXA 3VUGA 5IF1A 4RT7A 2I0HA 5J5SA 2HELA 3WYXA 2OXXA 2O3PA 4RWKA 4ZZOA 3U6IA 1FMOE 1YXTA 2ITXA 5TO8A 3FSKA 3QTWA 4M66A 4UZDA 5FTGA 2CN5A 5CEQA 4AX8A 3F3UA 3K5VA 4JI9A 4V0GA 3IW7A 5GJGA 2YABA 3EN9A 4C3PA 4DFUA 2H34A 2VGPA 4CQEA 4IAFA 4FV7A 4WO5A 3KKVA 4BI2A 3GCSA 4JBQA 5IUGA 5CASA 4USDA 3NEWA 3IO7A 3P86A 5JK3A 2HWOA 4TWCA 4D0WA 5EH0A 3DB8A 3MA6A 3ZC6A 4RC4A 4BGHA 3R1SA 3O50A 1J1BA 1ZMWA 3FMJA 2ZV2A 5L6OA 4FIFA 3COIA 1NY3A 1AQ1A 3EFJA 3QRIA 4FV0A 4KS8A 5FXSA 4FG9A 2BR1A 3ULIA 5CEIA 3NUPA 3UQGA 4QMMA 5CF4A 4RFMA 2B1PA 4EK3A 4AGDA 4L7SA 3PFQA 2A2AA 4HGSA 4RJ5A 3OW3A 3UOLA 3ZZEA 1OECA 4LMUA 2XF0A 5M53A 3N51A 5HO7A 4FNXA 4UMQA 4CQGA 3FMMA 1F0QA 3FMLA 3PLSA 1YDRE 2EXEA 1WBWA 3E5AA 5FBNC 3DZOA 3ZUTA 3LMIA 2R3KA 2I6LA 2ZYBA 2A4LA 3TNIA 4K33A 4QQCA 1H1SA 2GMXA 2B4SB 4GUBA 4JDKA 3EKNA 3DK7A 4RA4A 3UE4A 4ZLOA 5JEBA 1IR3A 5A3XA 2R3GA 5IDNA 5A4QA 3LCSA 4X6QC 2WNTA 4IWDA 4LQMA 4MXXA 5DN3A 1ZY5A 3FKNA 3BLHA 2VTQA 2ZDTA 3JS2A 3PG3A 3POOA 5E8YA 5HO6A 3ZBFA 2QG5A 4B4LA 3KN6A 3EYGA 1FQ1B 5FEDA 4FTOA 3VJNA 2PE1A 4C35A 4BDBA 3C4WA 2H8HA 3FKLA 3NGAA 3VW6A 4F7JA 4NFNA 4HCTA 4DEEA 3DXQA 3EN4A 3W2QA 3GUBA 5I9WA 5GZ8A 3PPJA 4YJRA 1NXKA 4DBNA 1ZZ2A 2C3IB 3VN9A 3OEFX 1H07A 3MI9A 2XCHA 4NH1A 4XBRA 2ZMCA 5DOSA 2GSFA 2HW6A 1YHSA 2QKWB 3I6UA 3I4BA 3V6RA 4RIYB 1OIQA 1P4FA 3WYYA 2AC5A 3ET7A 4E3CA 4FKQA 2J2IB 4WSQA 3AGLA 4QP1A 4RWIA 3VF8A 3WE4A 1E9HA 3WOWA 4OW8A 2QOCA 3KRLA 3LXNA 4F7NA 4XRJA 4BCOA 1WVXA 4KB8A 2CJMA 4L67A 2ETMA 5DNRA 4DHFA 3G6GA 1GNGA 4U9AA 4X3FB 4EK4A 4FT3A 4A9TA 4M97A 2R0UA 1JSVA 4F6WA 4FKWA 3QQFA 5C9CA 5AAGA 2IW8A 2PPQA 1NA7A 4W4VA 4XH6A 4UMUA 4TZRA 4KBAA 4RJ7A 2P2HA 3L8XA 4BICA 2B9JA 2FSMX 2C0OA 5LOHA 4V0GB 5CU6A 4J7BA 4ZTNA 4D2PA 5HZNA 5CEKA 4AA5A 4RRVA 3R00A 4L9IA 1UU7A 2YIWA 4U45A 2E9VA 3GC8A 4JT3A 4NU1A 4ZS0A 2VX1A 5ACKA 3R8PA 5M51A 1O9UA 4AOTA 4YC3A 4O7LA 2YN8A 3CLYA 3ZLYA 1H0WA 3OT3A 4NM5A 4TN6A 4GKHA 1Q3WA 2XUUA 1M7QA 3ELJA 2ZAZA 4MWHA 3R9OA 4BTFA 5B2MA 5KHWA 2XKDA 2YFXA 5JZNA 4F08A 5L8JA 3ORTA 2OH4A 3TWJA 2A19B 2UZWE 4ITHA 5KUPA 4BCKA 1J1CA 3WIGA 1J7UA 2A1AB 5ANGA 1KE6A 4D9UA 4GL9A 5A6NA 2RKUA 3LCOA 4K1BA 2R7IA 2PVJA 2HCKA 3PA3A 4LOPA 5EW9A 1PKDA 3DKCA 5LQFA 4U5JA 4FC0A 3QX2A 4ZTMA 1EH4A 4Q9ZA 4MVFA 4O91A 5BX0A 4R7HA 4TKSA 3H9FA 3UPXA 3W2RA 2KTYA 3F2NA 5EDRA 4O27B 5C26A 4GV1A 4G6NA 3V01A 2YM5A 5CAUA 3Q6UA 5J7BA 2BAJA 4DH8A 2IO6A 3HDMA 4PPCA 2E9OA 1U59A 1P2AA 3KMMA 4J97A 3DQXA 3FLNC 2EUFB 3GNIB 2JDTA 4GT5A 5DHJA 4BDFA 3QRUA 3S95A 3TL8A 2XIZA 3CTJA 1KE9A 1CMKE 4S31A 4D4RA 1OKZA 2Q0NA 4IEBA 2WTCA 2JD5A 3UVQA 5CANA 3HUCA 1KV2A 3R8ZA 3EB0A 1G8AA 4GFMA 3FXXA 3LCKA 4IX6A 4PP9A 4WUNA 4XEYA 3OUKA 3BLQA 2PMLX 4FTUA 4GJ3A 2CKPA 1Y6BA 1JSUA 2OKRA 2ZVAA 3IGGA 1XO2B 4I6BA 3TZ8A 2JDRA 3FI8A 3V6SA 4BWKA 5FBOA 5J9YA 3I81A 4G9RA 1UV5A 3TXOA 5HD4A 3LVPA 3LFDA 5EM6A 2GTMA 1CDKA 3EWHA 1HCLA 3PXFA 5CU0A 2F7XE 5KHXA 4BDAA 3RNYA 4EJNA 4CVAA 2BKKA 5HIDA 1WVWA 2IVVA 3KXNA 3MPMA 3UJGA 3HAVA 4GFGA 5FG8A 5BMSA 3CIKA 3ZFMA 4RJ8A 3VAPA 4JQEA 5IH6A 4IW0A 4ALUA 2WMXA 3Q2MA 3BYMA 4RWJA 3U8WA 2IVTA 4FSYA 1GZNA 4TYHB 5LMAA 3TN8A 1GAGA 2B55A 2PVKA 3QXPA 3W18A 5CAPA 2GHMA 3DJ6A 3REPA 1M2RA 2B54A 2UZNA 1XBAA 3LIJA 4AGUA 4N70A 5CLPA 4YZMA 2R9SA 3MWUA 3C4CA 3CQEA 1IA8A 3G90X 4NM7A 1JWHA 3LCTA 1QPJA 4IWOA 4WIHA 4E5AX 3DBDA 3DT1A 4FOBA 5AUZA 1H0VA 4I5MA 3P4KA 4BY9E 2XCKA 3NRMA 4D2VA 5BYLA 2VWIA 3GC9A 3HMMA 4JG7A 2HW7A 5CAQA 4L43A 5IG1A 3KB7A 3P23A 3BI6A 2O2UA 3H3CA 4ORKA 2Z8CA 3O17A 4WRSA 3ZO4A 2B0QA 1FOTA 4I92A 5BUIA 4X2JA 3ZHPC 4MF0A 4NL0A 1U4DA 1XH4A 4BIEA 4EKKA 1ZMUA 3R8MA 2YDKA 1WBVA 3IW8A 2AYPA 2HXQA 4L46A 2CLXA 2W1DA 4FYNA 4HZRA 4MXAA 4QYFA 5AP5A 4C0TA 3RAHA 2CKQA 2X2LA 2YITA 5CEPA 4CFUA 2C5VA 3LQ5A 2J5FA 3L8VA 2J0JA 4M15A 4PV0A 3RPOA 5IA4A 5AR2A 1QL6A 3OXIA 2OFUA 2QR7A 3UMXA 2ITNA 3OCGA 3EJ1A 3ACKA 4IJPA 3GOKA 4QPMA 2W7XA 3C50A 4NT4A 4EHVA 4DH5A 4A9RA 1V0OA 2CCHA 4LG4A 3DK6A 3WZJA 3L8PA 5M4UA 1JOWB 4RZWA 4XYFA 2X4FA 3BV2A 3IECA 4YLJA 3DFAA 2UZOA 4BZDA 3OP5A 5A4LA 2WMQA 3D5VA 2R3MA 3BGQA 4GIHA 5D7AA 5EFQA 1IEPA 4HPUE 2QVSE 3R22A 4QNAA 3WZKA 4IXPA 3IDPA 5GIPE 4QRCA 1FINA 1OL2A 2J90A 5CENA 4KBCA 3F66A 1Q5KA 4F64A 4D4YA 3HV4A 3CY2A 3IQ7A 1FVTA 2WEVA 4FNYA 4C3RA 3PA5A 4M12A 2VTJA 3W2OA 4AZFA 4KKEA 3TV7A 3OY3A 4M67A 4OTGA 4FGBA 4RX7A 5HX6A 4FTIA 1SMHA 2PE2A 3EZVA 3ANQA 2YERA 3MIYA 4JG8A 5AP2A 5TOZA 3VS6A 4EH9A 4EQCA 2PMIA 2OFVA 3SLSA 4FT5A 2OW3A 4Y95A 5CXZA 3F5XA 3NZ0A 3HVCA 4G5PA 2ONLA 3QWKA 3R9DA 1Y8YA 4O1OA 3QX4A 4YNOA 4ZSAA 3LFFA 5BVFA 4RIOA 1Q8UA 3DCVA 3ZBXA 4EYJA 3TDVA 1XWSA 3V5LA 3VHKA 3RGFA 3IOKA 4WBBB 4PWNA 3QQUA 4LUEA 1VR2A 2UZVA 3VBTA 1GY3A 3UQFA 2B9IA 2J50A 3O8TA 4KBKA 2PZYA 5DT3A 4D1ZA 3MFRA 3QGYA 1XQZA 3GBZA 4RJ6A 4E26A 3Q04A 3R02A 4NJDA 2PY3A 3ZC5A 5AR7A 2VO7A 4F9BA 5HNBA 4A9YA 3OWPA 3KXZA 2J0KA 4EHZA 3KVXA 3PP0A 2CKOA 3O7LD 4KAOA 3EYHA 4C36A 4QMTA 3DK3A 2C6OA 1PXIA 4FSMA 1RJBA 2QU6A 4JBVA 3THBA 4YHJA 3VF9A 4DEIA 4E8AA 1YOJA 4RWLA 3T8OA 3RK7A 2C1BA 2BZHB 4DLJA 3FY2A 4E6CA 1FVRA 5CQUA 3FLSA 3HECA 5JZJA 4DG3E 2HK5A 3NYVA 4IAZA 4CFWA 5AIKA 3ZUVA 5L4QA 5AV2A 4K2RA 4FNZA 2XVDA 3KN5A 2W5HA 5EHLA 4ZJIA 2YLFA 5CSVA 3KK9A 1R1WA 1QPCA 2FVDA 3R2YA 4X2FA 4FE2A 4EOLA 3C1XA 4D1SA 3PPZA 3CXWA 2BZJA 5IUHA 4ASZA 4EI4A 1T45A 4J1RA 1PXJA 5CTPA 3K3IA 5D7VA 4DG0E 3LE6A 4U8ZA 3JY9A 3UO6A 4CEGA 4FZFB 4M13A 2WIHA 3QTZA 2JDOA 3LPBA 4AW1A 2PVFA 2VX3A 4MK0A 5IA0A 4DC2A 2J4ZA 3PJ3A 5E8WA 5GJDA 1J7IA 1Q8YA 5FRIA 3AC8A 3ID6C 4F7SA 1M2PA 4ACDA 2RFDA 4YJQA 1L8TA 3AXWA 2XK7A 3JPVA 4I3ZA 3E88A 4FEWA 3CJGA 4I6HA 4DA5A 2JIUA 1Q24A 4EJ7A 3ZO2A 3MY0A 5B7VA 3UO4A 3ZUUA 4YTFA 4YLLA 4GIIA 2BFYA 3NIEA 4IANA 4QPSA 2BRBA 3OS3A 4FOCA 2FB8A 4JR3A 3RI1A 3S4QA 4AOIA 2X8EA 3AMAA 3WZEA 4FV2A 5HBEA 3KULA 4R3PA 4QTAA 4D2TA 4PY1A 3QTIA 2ITZA 3W2CA 3UZPA 4N6ZA 5D12A 3A60A 2PZIA 4W9WA 3ANRA 5FXRA 2NNWB 3HMOA 2WU7A 5H8EA 3BELA 2W06A 4ZZMA 2BROA 4HOKA 3L1SA 3UOKA 4BDCA 3V3VA 4HVDA 2WMRA 1U46A 4JX3A 4XLVA 5BQ0A 1B39A 1FGIA 5ETIA 3ZSGA 5EM8A 3BHVA 4LV8A 3COHA 3OCBA 1PMUA 3RWPA 2G1TA 4RIWB 3O51A 3Q96A 1JNKA 3PDTA 3G6HA 2ERKA 5ANOA 4AA4A 2PVLA 4FR4A 5EYMA 5ITAA 4FIIA 2R3IA 4YZBA 4Q5HA 2Y4IC 2G2HA 5L8KA 5LXMA 1YXVA 2YIQA 1LEZA 3CQUA 4JLCA 4M84A 4OLIA 3TTJA 5L2WA 4R7BA 2IJMA 4F09A 4DN5A 4KKHA 3OEZA 4BRXA 1G5SA 3FXWA 4Q5EA 3UIXA 3HV7A 3OF0A 4A7CA 4F99A 3F6XA 4C4FA 2GQGA 3QZHA 1Z5MA 4TY1A 5LCJA 4FODA 3ORLA 2WGJA 3RAWA 4LI5A 1SNXA 2FSTX 1Z9XA 2YCSA 4ITIA 1OKWA 1BL6A 4H05A 4ENXA 2XYNA 2PVNA 4BHZA 2VO3A 4FUYA 5BYYA 2B53A 3DA6A 4YSJA 4R1VA 4IE9A 4YP8A 4FIEA 2X1NA 2UW9A 4YC8A 4YJTA 3GU5A 5EG3A 4DGLC 3AG9A 5KBRA 4Y73A 5CSPA 1IAHA 2GTNA 2XIRA 2DQ7X 5BYZA 2QLUA 3VS3A 4CFMA 4GYGA 1V0BA 3GXLA 4CGAA 1M52A 4U97A 4M0YA 3O0GA 1BX6A 2JDVA 2XKFA 2XK4A 5EI2A 5EYCA 3NW6A 4FGRA 2ITTA 5GJFA 3RPSA 1MRVA 2VWUA 3ITZA 3O8UA 3UVPA 4EH6A 5CAVA 2QOKA 4X6RA 1YRPA 1X8BA 2RIOA 2YCQA 2BTRA 4FTTA 4TRLA 4YZDA 4NW5A 4DCAA 5JRQA 1ZARA 4EL9A 3R7YA 3E8CA 4G3CA 4XNEA 4XS2A 3T9TA 1YOLA 5L8LA 1GZ8A 2VRXA 3A7FA 3PIXA 3CS9A 4UMTA 2OIDA 4GMYA 5CX9A 2WTKB 4DGOA 4EK6A 3GC0A 3PWDA 5EDPA 4XG2A 1QCFA 4KWPA 4BCHA 3SGCA 1V0PA 4PL4A 5I9YA 4F0IA 5ETAA 3ALNA 4PPAA 4NW6A 1R0PA 3U4WA 3FY0A 3QL8A 4XV2A 5CYIA 3MTLA 4FTKA 4MXZA 3K2LA 3UOHA 1A48A 4EOKA 4O21A 1RDQE 2VUWA 4O7NA 4O0TA 3C4FA 3DTCA 2G9XA 4LRMA 2XNMA 1OITA 3F88A 4JR7A 2ZB1A 2XKCA 5HVYA 5DR2A 2BVAA 4K9YA 5EK7A 4KNBA 1H1WA 2VWZA 2V22A 2XM8A 5C8MA 3SXRA 3QHWA 3UOJA 3OCSA 2XJ1A 4XG8A 5HTBA 3F7WA 3TM0A 3FMNA 4K0YA 5FD2A 5DR9A 4Y83A 3FLYA 4QNYA 5FEQA 3DPKA 2CHLA 4KS7A 3OW4A 4MBIA 5EOBA 2PWLA 4GVAA 1BI7A 1OL5A 4E6DA 4WRGA 4MXOA 4AN9A 1OZ1A 3M42A 3NUNA 5I0BA 5CU4A 4TXCA 5I9XA 4HCUA 3WF7A 2V0DA 2JLDA 2JAMA 3D5UA 5ANDA 4H58A 2IW9A 3V8TA 4FTAA 3MPAA 5ICPA 4QMPA 5HQ0A 4EOMA 3OWKA 3MH1A 4YTHA 1DAYA 4ANSA 1MQ4A 1UWHA 4F6UA 3R9NA 4ZJVA 2OSCA 5KBQA 3OC1A 3PTGA 3H0YA 1Q8TA 4BDGA 2B7AA 4YU2A 1OPLA 4ANMA 1M17A 5TKDA 5KMNA 2R3NA 3G5DA 5J9LA 3IW5A 4EK5A 1RQQA 3A7IA 2YJSA 3GP0A 3MJ2A 2XNGA 5HVJA 4W4WA 3MTFA 4BBFA 1JVPP 2O5KA 4LL5A 2GS2A 4C4HA 4QQTA 5GIOE 3VBXA 2CGWA 3PP1A 3DJ7A 5H2UA 5C03A 4L45A 5A4TA 4H36A 2C3KA 2GFCA 5FTOA 2Y6MA 3T3UA 1W84A 2X81A 4TYJA 4U40A 5DIAA 3Q2JA 1NW1A 2PVHA 2JBOA 3UODA 4C2WA 1OKVA 3RALA 2C47A 2VO0A 4S30A 2C5NA 4CFNA 4CSVA 3CPCA 3UIUA 5JQ8A 2UZEA 3VC4A 3BIZA 1CSNA 5ANKA 4OR5A 5EM7A 4EH4A 2O0UA 3FI3A 3VULA 4CKRA 3NX8A 4FSTA 3E87A 1NT2A 3OHTA 2UW3A 3DB6A 5EM5A 4D5HA 4R5YA 4KRDA 4O22A 3SG8A 3R7GA 5KO1A 4CRLA 4UX9A 3F69A 3KMWA 2R3LA 5IA2A 1CKJA 2C3LA 3AQVA 4G3DA 4GCJA 4LMNA 2XNNA 1A06A 5HESA 1WMKA 4S33A 4N4SA 2C5OA 3P08A 2Y7JA 5IQFA 3IG7A 3R1YA 4O0UA 3QZGA 4HYSA 2OZOA 4QD6A 3NUSA 5JGBA 4X2NA 4JXFA 4E5WA 3R1NA 4AW0A 4MQ2A 4L7FA 1OPKA 4I6FA 4MD7E 1Q61A 4OTWA 4EBWA 5AUYA 3F3TA 1J91A 3IGOA 2UVYA 3P78A 4FVRA 4QP7A 2C6EA 3BCEA 2WQBA 3IPHA 3EH9A 1Q99A 2R4BA 4DFNA 3JXWA 2QOFA 3QF9A 5DE2A 3TEIA 3ZFYA 4F1MA 4ZTRA 3ORNA 5LCKA 2W4KA 4DH3A 3FV8A 3PJ1A 3ZH8A 2YDIA 5JMSA 4A9SA 1PJKA 3K54A 2UV2A 2R0IA 4HYHA 4L68A 4RX9A 2W1EA 5G1XA 4DEAA 3KY2A 5IQDA 2GQRA 4IVDA 4QMSA 2WTIA 2YHVA 2ZJWA 4BKJA 2QOQA 4AW2A 4APPA 4IMYA 3W33A 4FZ6A 1XH8A 4BCFA 3PE2A 2UZUE 3QXOA 3MS9A 2W1CA 3BBWA 4FV4A 2WMVA 3GQIA 3CEKA 4XUFA 1U54A 5M57A 3POZA 3HUBA 4UMPA 4GK4A 3P7CA 3MDYA 3KK8A 4OTDA 2B9HA 2PK9A 4W9XA 4Y5QA 4G17A 5ETFA 1H1PA 4CLIA 2QHNA 5F4NA 3DAJA 2KULA 4YZNA 3Q4UA 5IQAA 3GFEA 3U6HA 4TTHB 3R71A 1JQHA 3FL4A 5HE0A 2QOOA 3RM7A 4G16A 4BBEA 3NCGA 1WBPA 1H1RA 4C33A 3KL8A 4MNEB 5JSMA 3G2FA 2C0TA 3ULZA 3LFSA 4W4YA 2R2PA 4IAYA 3MA3A 1WFCA 2RFSA 3KRRA 2QO7A 1Q97A 3SXSA 1W98A 2QOHA 5BMMA 3MFUA 1FGKA 4DITA 3CQWA 4YPDA 3U9CA 3EQHA 4P5ZA 4BDJA 5JFXA 4YO4A 4M14A 3PJ8A 5FM2A 5KZ0A 3LM5A 2B9FA 3MPTA 3F3VA 2W1ZA 4O96A 1UA2A 4CCBA 1XHAA 1H8FA 4IZYA 3A4OX 5HTCA 5M06A 4XLIA 4K11A 3E7VA 5J1VA 4XG7A 2IG7A 4DBXA 1Q41A 2PVYA 2OJIA 4FTMA 2XM9A 2OIBA 4I4EA 4BTKA 4PP7A 3U4UA 3R01A 2OF2A 2R7BA 3G15A 5CZIA 3PE1A 3ZEWA 3E8EA 2J0LA 3G0FA 4YNEA 3VS1A 2CPKE 4FEUA 5A54A 5AWMA 1E1VA 3R2BA 5JFSA 1XBBA 3ROYA 5HIBA 2YAAA 2JFLA 1K2PA 3VUIA 2WZJA 3DBFA 2PUUA 3NW7A 4RVKA 3GT8A 3UNZA 3C13A 5AUXA 3VIDA 1ZXEA 3N4TA 3PG1A 1RW8A 2QQ7A 3MB6A 3ZONA 1AGWA 4EC9A 4EH8A 4ARKA 3UDBA 5KMKA 5HI2A 2W4JA 2DS1A 3HL7A 4JNWA 3DLZA 1SNUA 3Q9ZA 4G6LA 3NUXA 5FLFA 4CRSA 4I6QA 4RLLA 3TUDA 4R6VA 4EZ7A 4JAIA 3MY5A 3OG7A 4M3QA 1F3MC 1CKIA 4RSSA 3AD4A 3ZCLA 3ZDUA 4FZAB 4KA3A 3D5XA 4X0MA 4H3PA 1KUTA 1UKIA 2JKOA 4BCIA
chains in the Genus database with same CATH superfamily
3SX9A 4JIKA 3ORPA 3W32A 3QD3A 5KMLA 4IAIA 3JUHA 1P5EA 3QWJA 1TQIA 3ETAA 5F94A 2BALA 3ROCA 4ACCA 3VS7A 4QTDA 1U54B 4FZDB 3MN3A 1ZOEA 5FWKK 4ZLZA 4R8QA 5HICA 4UWBA 3ORXA 5A4EA 1ERKA 2ITPA 4X21A 4EWQA 2W0JA 4AA0A 5HG8A 2RSVA 3TNHA 3A4PA 2BUJA 2HZ4A 2XRUA 4Z3VA 5HORA 2W1GA 3WBLA 3QUPA 4AT3A 5HHWA 4J52A 5IQHA 4YLKA 3UBDA 5KCVA 3TTIA 3SOCA 3FPMA 4AGCA 3GVUA 3RP9A 5IMEA 3F2RA 1XH9A 4MWIA 3C0HA 3QU0A 1UU8A 3QQJA 5CVFA 5KKRB 2I7QA 5CF6A 5C1QB 3BL9A 3MYGA 1LP4A 3P5JC 4IVAA 5M07A 3V5QA 3FI2A 4FV5A 3FHRA 3S00A 3A8WA 5HO8A 3C7QA 2WMWA 3GOPA 3C4XA 4XRLA 2XKEA 5GNKA 5H9BA 5HLWA 4NK9A 2UZBA 4MBLA 5K3YA 3HRFA 1URCA 5FQDC 4OTRA 4EHEA 2Z7SA 1XH5A 3C51A 4USFA 4JMQA 2OIQA 3SW7A 5KMJA 3OROA 2X0PA 3SKCA 3PY0A 4FTLA 4BDHA 3VS4A 3BHUA 5J9ZA 3QCSA 4G31A 2C68A 5IQEA 1OIRA 3PZHA 4TWPA 3DBQA 2I0VA 4FYOA 4AAAA 4L42A 3TG1A 3NUAA 3O8PA 3KEXA 4O6EA 1W0XC 3LXKA 3C5UA 1PYXA 3NVKI 2V62A 3LJ2A 4ZY5A 2JAVA 3QKMA 3BU6A 4BZNA 2W05A 3RNIA 3D2KA 2YM3A 4IM0A 1FPUA 4FKRA 5I9ZA 5IMXA 4XV9A 4E7WA 3T9IA 2F7EE 3UVRA 4EBVA 3N4VA 5L2IA 4IH8A 1MUOA 5TT7A 3DFCB 4EKLA 1MRYA 5EW3A 5LVLA 2Q0BA 4IB1A 3VUTA 2GQSA 4K77A 3LFNA 2YIRA 3L9MA 2XEZA 3RHXA 2W1FA 3QQGA 1I44A 4UY9A 4BDDA 2VAGA 4IB3A 2O63A 1P4OA 3DBEA 3Q4TA 4HW7A 4FEVA 4LGHA 4WSYA 4GG5A 5B0XA 4EUUA 2QG7A 3C4EA 3KXMA 4AE6A 4ZTSA 2EB3A 4AP7A 2J9MA 3IK3A 2UUEA 3ENHA 3NYXA 3ORZA 4XBUA 3Q9WA 3R63A 3NNVA 1BI8A 4A9UA 2C4GA 3U55A 4YJNA 2YACA 4DG2E 5C4KA 4RBLA 3NSZA 3PZEA 4CKIA 3FLWA 2BRHA 4L01A 1YXXA 3TJCA 3OY1A 1UKHA 3OXTA 3KRXA 5C8NA 2OBJA 3LFCA 3COMA 3GU6A 2VTTA 3PXZA 3FC1X 4CD0A 3EQPA 5LMBA 4GU6A 1JLUE 3SQQA 4HVHA 3R8LA 3V8SA 3R1QA 4MBJA 4OAUC 4QTEA 5LWMA 5EQPA 3AC3A 5BVOA 4KUJA 3HV6A 4AF3A 3TKUA 2FSLX 3UIMA 1YWVA 1WAKA 2G15A 5I9UA 4YPSA 5K5XA 4C62A 1IA9A 2ZMDA 5J79A 5CNOA 2YWVA 2X7OA 4QMOA 2NO3A 3UYSA 3WZDA 5DT4A 2NPQA 2PMNX 4N6YA 3TZ7A 3CC6A 3FQHA 3VNTA 3W1FA 4YUQA 3V5TA 5J8IA 5LVNA 4QMVA 4IZ5A 1XR1A 5FP6A 3DKFA 4EH5A 3K5UA 4I1ZA 4BYJA 4JDIA 5BVNA 5HLNA 2I0YA 3MGYA 3B8RA 4G2FA 4F0GA 3QBNA 4XCUA 3FXZA 2OJ9A 4KIOA 3L9NA 4DEHA 2BFXA 1K3AA 4O84A 3HGKA 4MX9A 5IQBA 5HVKA 2PULA 3VVHA 2C69A 2W1IA 4O0RA 3A99A 2ITUA 2OZAA 4C38A 3FLZA 1JKLA 4V01A 2IVUA 3QQKA 5EI6A 5E8UA 1H08A 3GB2A 2HOGA 3AD5A 4CMTA 5JN2A 3RWQA 1PW2A 1GIJA 1H4LA 3RHKA 4FEXA 4J8NA 4ZMEA 2ZB0A 2GDOA 1G8SA 4D4SA 3A7HA 5D1JA 4D4VA 5CAOA 4F1OA 2DYLA 3LJ0A 1ZLTA 4L6QA 4LOQA 5IH5A 4ASDA 4UXLA 3TKIA 3NW5A 3TDWA 5AM7A 3EL8A 3FYJX 4MYGA 3KRJA 2QKRA 4IAAA 4IDVA 4QTCA 4GW8A 3BEAA 4TT7A 3TCPA 2XNPA 3BGZA 3DOGA 2EB2A 5IQCA 3H4JA 2YM6A 3H9OA 3Q32A 3QTUA 4O0XA 4U7ZA 4XP2A 5FDXA 3FMKA 4DFXE 2ESMA 4FKTA 4IJ9A 5KMOA 2XALA 5E9EA 5IA3A 2P55A 4EOIA 4ZEGA 3TUBA 5AV4A 4QMXA 3BHYA 3QQLA 3BLRA 4LV5A 1OI9A 5AX9A 4QMWA 3CKXA 2E9NA 3E93A 3R8UA 3DNDA 1XMMA 3TIZA 2VZ6A 1WCCA 4BDIA 2F57A 4ZXTA 4GK2A 2QOBA 3D2IA 3N4UA 3NMUF 3LOKA 5M08A 4KIPA 3RPYA 4NYEA 4DYMA 4I20A 3LFBA 3KA0A 1HOWA 2YCFA 2QCSA 4PMPA 2PUPA 2CDZA 2XRWA 3OTVA 3GCQA 3DAEA 1DAWA 2ITYA 4BI1A 4TL0A 1TQPA 3MVLA 3DAKA 4P5QA 1OGUA 2VWYA 3ACJA 4ZP5A 3E62A 2GPHA 2HY0A 3U9NA 4JRVA 3FMHA 4BBMA 4LL0A 3QYWA 4AGWA 3PFYA 4B0GA 2RF9A 4FKIA 4CV8A 3F61A 3BZ3A 2HYYA 1OUKA 2QU5A 1STCE 4RMZA 1L3RE 3GCVA 3O23A 4O0VA 4QP8A 2A98A 1PXMA 2VGOA 3IDCA 4RQKA 1YXUA 2XH5A 3EN7A 1YVJA 2Y4IB 3GQLA 4EK8A 3H0ZA 4HGTA 2NYAA 2ETRA 4O38A 3VBYA 4WUAA 2P4IA 2VTIA 2R64A 5KZIA 3UC3A 4YC6A 3ZLSA 4U41A 4BFMA 3ATTA 3HA8A 4DGNA 4KIQA 4WOVA 5BUJA 1UNHA 2UZTA 4CMUA 2ZV7A 4MHAA 2EU9A 4UALA 3L9PA 4F1TA 2Z02A 3BWJA 4R77A 5L6PA 2WO6A 1W2FA 2XBAA 4TNBA 2XIYA 4FIJA 4UV0A 1BMKA 4IACA 2R3OA 5L2SA 4NUSA 4WT6A 2IPXA 1UNGA 2YA9A 4APCA 2CCIA 3GFWA 2BRNA 1OUYA 4NIFA 3JVRA 4A06A 3ZSHA 4C4EA 5IH4A 2XNEA 3A62A 1M7NA 1OIYA 3DLSA 3EKKA 3PUPA 4P2KA 3I79A 5AR5A 5HLPA 4RX8A 3UC4A 1YQJA 3P0MA 1VYWA 4GT4A 3ZXTA 5J7HA 4AG8A 3R28A 3QYZA 3ZZWA 4CTBA 3QUEA 4UB7A 4CLJA 4C59A 2J7TA 4NKAA 3BYVA 2WMSA 3A8XA 2OJJA 4Y85A 3AGMA 4GKIA 2UW4A 3MVMA 2XEYA 4ZY6A 3R8VA 3EL7A 5IDPA 4YR8A 3ODZX 4CG8A 3FKOA 2XMYA 5CT0A 3QQHA 5FXQA 2VV9A 2BZKB 3OWLA 4IX5A 4E6QA 4HYUA 3MY1A 2IW6A 2UW7A 3FE3A 1GOLA 2X7GA 3ENMA 3FZTA 3GC7A 4D55A 3A7GA 4TWNA 1JKTA 4AQKA 3CR0A 3EQDA 4QP6A 2P3GX 2F49A 1VJYA 4OTHA 4HVSA 1Q3DA 3ZMMA 3S0OA 5L3AA 3G9NA 4NEUA 4IIRA 3AMBA 2YM7A 5CNNA 4GS6A 2IEWA 2OJGA 5HOAA 5HX8A 3QFVA 5TF9A 4J99A 4FZ7A 5CVHA 2OXYA 4MD9E 1JKKA 3FPQA 3TNPC 3SA0A 2B52A 3RK5A 4CMOA 4FTCA 4CZYB 3KREA 3NUUA 3NWWA 2WTWA 4D0XA 4I0RA 1XBCA 5EHOA 3TACA 3B2WA 3F82A 2JC6A 1H26A 3QTSA 4ANBA 4NKSA 4BHNA 3NVMB 3VUKA 4G1WA 2W1HA 4GT3A 4CZTA 2PL0A 3TV4A 5ACBC 1JSTA 2WMUA 2VTLA 3B2TA 3M11A 4DCEA 4ZZNA 5IEYA 5CU3A 3KIOC 3VBVA 2GNHA 4RVTA 1IAJA 2V7OA 2HY81 1QPEA 1ZYDA 4BC6A 3BYOA 4AXFA 4AZTA 1MRUA 3O96A 4I4FA 1OM1A 2XB7A 4QMUA 5CXHA 4CT2A 4D2RA 5HE1A 1ZY4A 3DDPA 3BU5A 3MV5A 4LYNA 4XMOA 4BIDA 4DFYA 5AA8A 3UPZA 3EQCA 2PE0A 3BRBA 3IONA 4BN1A 4DHIB 2C6MA 3FI4A 2Z7RA 2J0MB 3PXYA 2PTKA 4MNFA 3M2WA 2X7FA 3UZRA 5LJJA 4I5PA 4R3RA 5AJQA 5DI1A 5IEVA 2QLQA 3I60A 3OOMA 4QOXA 3AD6A 4QYEA 3RMFA 5DMZA 4O86A 4WNKA 1ZWSA 4ANOA 5HG7A 5LMKC 5AAFA 3MH3A 2FO0A 2ZM4A 3FSFA 4FKJA 3QAME 4KABA 5CEOA 3ORIA 5CF8A 4CTCA 3ZRMA 4HYIA 5GHVA 2RG6A 3CE3A 2PMOX 4G3FA 4GU9A 4K6ZA 3L9LA 2CNVA 3A2CA 5LVOA 3PXRA 4ANNA 3NDMA 5AP6A 1OL6A 4JOAA 4U3YA 2X6EA 3EQFA 4JJRA 3UGCA 3VONA 3MFTA 1UWJA 4U6RA 2NRYA 2X4ZA 4FSRA 5DRBA 5E8XA 3UDTA 4LGDA 1FMKA 3R21A 3PIYA 4IX3A 3QZIA 1WZYA 3KC3A 2AC3A 4AACA 1H01A 3KULB 3CSVA 4W8DA 3G33A 4RIXA 4AN2A 2PZ5A 4FA2A 3NNUA 5E1EA 5AP7A 5DYJA 4DLIA 2VWVA 1IRKA 2WKMA 2IZUA 4LRKA 4ANQA 3LKMA 4JRNA 2IN6A 2JEDA 3U87A 1S9IA 3MJ1A 4OTQA 1LUFA 5HU9A 1VZOA 4F9AA 4L8MA 5AUWA 5JKGA 3UNKA 2BIKB 4FSWA 5TR6A 1H27A 2UVXA 3S1HA 4JQ7A 1XH6A 2R3QA 3RCJA 4N57A 3R9RA 4CKJA 2EXMA 4H39A 3FZPA 2WEIA 1ZMVA 4MF1A 3PRIA 1GIIA 5CY3A 3CTHA 3EMGA 3BPRA 4I24A 5HNGA 4ANLA 5HTIA 4O81A 4BB4A 5M44A 4S2ZA 3NFGB 4OGRA 2HAKA 3PJCA 3SW4A 4B8LA 4MD8E 4AFJA 5JGDA 1KOAA 1P14A 4TYGA 5A4CA 1JKSA 3P1AA 4B99A 1YHVA 3F5PA 4ZLYA 5AADA 3D7TA 4GSBA 4DT8A 4P4CA 3GI3A 3DKGA 4WG4A 4ZSGA 4CCUA 4O7RA 2VX0A 3QD0A 1W8CA 4G3GA 3ZRKA 4EQUA 2YZAA 4JVGA 4KD1A 3CPBA 4FL3A 3CGOA 1FVVA 4PMTA 3SXFA 5DWRA 4L52A 4EONA 1LPUA 2HXLA 5HEZA 2BIYA 4QO9A 4TNDA 4XJ0A 5AIRA 5AAEA 4O7SA 3NNWA 1H25A 5IQIA 2SRCA 3IW6A 4C4GA 4E5BA 4FBXA 3IOPA 3T3VA 4PMSA 4C8BA 3I7BA 4LGGA 3ZM4A 3FZOA 3CBLA 4QYGA 5EQYA 3UYTA 4AZSA 2W9FB 5EOLA 4O0WA 4FV3A 3DGKA 4NFMA 3BWFA 3D94A 2GCDA 4KIKA 3UP7A 4AAYA 4EHGA 3BGPA 4FV8A 1F5QA 4IZ7A 3CJFA 3O71A 3P9JA 3PXQA 4JG6A 5HE2A 4AZWA 4RQVA 5D9HA 4E20A 5J5TA 5BVKA 2YM4A 3SHEA 5CSXA 4HGEA 3HV3A 3PRFA 3LXLA 2LGCA 2WOUA 4C61A 4EOQA 4F9YA 3LXPA 4ZSJA 3VW8A 4MAOA 4QPAA 3EQIA 2WOTA 3QTQA 4CYIA 5EW8A 2I1MA 1W83A 2JKMA 3HX4A 3EZRA 2F9GA 3V5JA 4FKPA 1PF8A 2A27A 3PJ2A 2I0EA 5EKOA 2XZSA 4O2PA 3V8WA 3F5UA 3CP9A 3Q9YA 5KNJA 3AC5A 4EH7A 1Z57A 5EYKA 5CT7A 3UG1A 4U80A 3W16A 1ZYJA 5IISA 2WAJA 4EOSA 2ZV8A 3V04A 3HA6A 4FTNA 2OK1A 4YJPA 1WBOA 2Y9QA 5HCZA 4L44A 1REJA 3P5KA 4ERKA 2F2UA 3BLAA 3W0RA 4ZMFA 1WVYA 2VWWA 1SVGA 4Y8DA 3VRYA 4IBMA 4ASEA 4B9DA 2IZSA 3CGFA 3DKOA 2BAKA 3QRTA 3F7ZA 1WBNA 5AR3A 2BDFA 5AUVA 2ZV9A 4RIXB 1NVQA 2WIPA 3I5NA 5HE3A 3FHIA 4CNHA 4XG4A 4HNIA 4Z7HA 1R78A 4XOYA 3RAIA 5KMMA 3MW1A 2XK6A 5D10A 2RL5A 4XG6A 2X8IA 1AD5A 3QALE 4L53A 5BNJA 2X0QA 3D0EA 1W2CA 4XG3A 3RJCA 5JGAA 2CGXA 2UW5A 4E4NA 2YISA 4S34A 4BF2A 3LFEA 2XK9A 4FG7A 3VUDA 2QD9A 4NM3A 5CZHA 3VO3A 5F95A 1URWA 4FEQA 3ZM9A 3E64A 3IS5A 3PUFC 4GH2A 3E92A 3ZXZA 4BCMA 5IPJA 2YIXA 5CS6A 3Q52A 3MB7A 2GFSA 4MH7A 3PSDA 4M7IA 4FVQA 2HZNA 5F9EA 3NYNA 1PXNA 2OG8A 2R3PA 3LAUA 4AT4A 3Q60A 1ST0A 2WQEA 5J1WA 2E9UA 3HLLA 2YLEA 4Q9SA 1SVHA 5I5ZA 2BMCA 1PXPA 3U54A 3D7TB 2PUIA 1O6KA 2PVRA 1W82A 4FV6A 5HG9A 1V1KA 2BRMA 3VWAA 1A9UA 3AT4A 3I0QA 3KVWA 3HRCA 3SDJA 3HAMA 4MCVA 4Q2AA 3BEGA 5JFWA 4DT9A 4PRJA 2W99B 2XIXA 4UZHA 4PL5A 3UMWA 4KINA 2XK3A 2OJFE 2QOIA 3U6JA 5LWNA 4C7TA 4CYJA 3UQCA 1CTPE 4O7VA 2XJ0A 2F4JA 1ZYSA 3OD6X 3IW4A 2WXVA 3HRBA 4JQ8A 4F9WA 3S3IA 2UZLA 4C02A 2YZLA 3HP5A 2Z7QA 4KIKB 3ATSA 3TIYA 4U44A 2V55A 1UU9A 4E4LA 3SG9A 4OAVB 4BR3A 3CKWA 3JVSA 3CD3A 4PDSA 2HIWA 4AN3A 4ZJJA 2JIVA 5AV3A 1SVEA 2PVMA 3OZ6A 4CG9A 1PMNA 3ALOA 1ST4A 4O82A 4A07A 4HVGA 4J98A 3JY0A 3RVGA 2Y0AA 4BYIA 2E2BA 3PWYA 5HBJA 3D7ZA 4UMRA 4AZVA 4DEGA 2VTHA 2E9PA 3AC2A 2NP8A 3ZRLA 5IA1A 3TI1A 3DU8A 4PNKA 5BV3A 5JH6A 2XNOA 4ACMA 4OTFA 4BDKA 4ONAA 3PLAE 4ZTQA 4FTJA 4ERWA 4YTCA 3DV3A 5D11A 1BLXA 1M14A 1LR4A 2C6TA 2OF4A 3LCDA 4FV9A 3GU8A 3NIZA 5K9IA 4RFZA 5CALA 3CTQA 4QTBA 3V51A 3QZFA 1K9AA 4RZVA 3SVVA 1DI8A 3EQBA 1ZYLA 3KXXA 3QLGA 4RPVA 2WQMA 1O6YA 3TT0A 3W8QA 2YIYA 3I7CA 1NVRA 3WIKA 4AT5A 2BHEA 2X9EA 3BYUA 4P7EA 4Z16A 1YHWA 3UIBA 4AXCA 3BU3A 5CF5A 1TVOA 2HENA 4FKUA 1PXOA 3W0SA 4YGAA 4WA9A 5H8GA 5LARA 3MVHA 5E4HA 4YJUA 3DTWA 4JIAA 4UYNA 5DR6A 5M55A 5IQGA 3NS9A 4IQ6A 4M8TA 4FL1A 2C1AA 4HCVA 1Y91A 3PPKA 4BGGA 2XANA 3FC2A 4TYHA 5AM6A 4KRCA 1PKGA 1YW2A 1M2QA 3R9HA 3AC4A 2QHMA 4XV3A 3Q53A 1U5QA 3QC9A 3QA0A 4UBAA 5L6WL 3RCDA 4W4XA 4NJ3A 3BHTA 2C6IA 3OXZA 1MP8A 1Y57A 3C9WA 4I21A 4OT5A 5BVWA 3ZO1A 2O64A 2J6MA 5K5NA 3GGFA 3C5IA 1UNLA 2R3RA 2PZPA 3RTPA 4BCGA 4AE9A 2GHLA 2R3FA 3Q9XA 2Q83A 5EKNA 2CNUA 4IVBA 4DE4A 4PL3A 4BL1A 2DUVA 4R1YA 3I5ZA 4BZOA 1YOMA 3W2SA 4CFVA 3LMGA 5CSWA 2ZM1A 3KRWA 5T3QA 1OB3A 3D4QA 3OVVA 3PSBA 4BTMA 3F5GA 2AUHA 1YKRA 4TYEA 5HU3A 1H1QA 1PXLA 4WD5A 2BRGA 3MBLA 3R04A 4B6LA 4AW5A 4NCTC 3KFAA 4BI0A 3SRVA 4EZ3A 5JFVA 4DHZA 4DEBA 2CN8A 2WTVA 4NM0A 3I6WA 1DI9A 3ZU7A 4XOZA 2VWXA 4YZ9A 5GINE 3AMYA 1BYGA 3ZEPA 3NLBA 4LDTA 1IG1A 4QP9A 4RC3A 3WZUA 3ZDIA 2J51A 3MH0A 3TZMA 3KGAA 4IWPA 3II5A 1REKA 2F2CB 2WMTA 4RJ3A 5E8VA 3ZTXA 1JBPE 3LZBA 1U5RA 4X3FC 1JAMA 5A46A 1IASA 5AUUA 4U43A 3D15A 4FL2A 4M69A 1XKKA 2XAOA 3R83A 1VYZA 5FTQA 4FX3A 5E92A 4XP3A 4DHJA 4WG3A 2VTPA 5CQWA 2JITA 3MIAA 2VTNA 1QMZA 4FK3A 3V5WA 4EOPA 2WQOA 3MESA 4AOJA 4UYAA 4QP3A 4IFCA 3E8DA 3LQ3A 2QNJA 3BHHA 5EI8A 4FG8A 3JR1A 3LHJA 4I5HA 4ZSLA 1R39A 5LVPA 4CV9A 5AUTA 5LVMA 3ZS5A 2ITQA 1PY5A 5DEYA 3TJDA 4BCPA 5H3QA 4TWOA 4GJ2A 4I0SA 4ALVA 4DH1A 5DGZA 3V5PA 1BL7A 2UW0A 2BKZA 4ZS4A 3SOAA 5FM3A 1UVRA 5DFPA 2X2KA 3OTUA 4FSZA 3D83A 3VQHA 4NSTA 4ZY4A 2QR8A 2QONA 2VTOA 3DNEA 5GZAA 4FKLA 4YURA 4ID7A 3WF6A 4E1ZA 3LW0A 3ZLWA 3Q5IA 4DAWA 4YTIA 5HNIX 3EFKA 1DS5A 4IFGA 2W96B 3HZTA 3O2MA 3RBWA 2QODA 3VS5A 2WHBA 4FIGA 4IM3A 4WNOA 3R7UA 2ETKA 1B6CB 4LUDA 3Q5ZA 4M0ZA 2GS6A 3KCFA 3GU4A 4QT1A 4FT9A 5IUIA 5FDPA 3RPVA 2DWBA 3EQRA 1I09A 3CD8A 4KKGA 2C30A 3FBVA 1BKXA 1OL1A 1CM8A 4IDTA 3VBQA 3W55A 5K4IA 3OWJA 1Q62A 5ANEA 4FKSA 4M68A 4TYIA 3MSSA 1YI6A 4O4CA 3EFLA 3QKLA 5TE0A 4ACHA 4AU8A 5KKRC 2J0IA 2GNJA 4GYIA 4UEUA 2XIKA 4MKCA 3RM6A 3WF5A 2VU3A 3P7BA 3QGWA 4O7ZA 4BIBA 4O1PA 4MXYA 4EORA 5A14A 1PHKA 4QYYA 4K18A 3WI6A 3EOCA 4FKVA 4GG7A 3WARA 4E73A 3OBGA 4HGLA 1PMVA 4K8AA 2JBPA 4BWPA 3AOXA 2FYSA 3ORKA 3DXPA 4D1XA 3HDNA 3FZSA 1CKPA 2WB8A 5HBHA 3PVWA 3GEQA 3GCPA 2RFEA 4WHZA 2HZIA 4AUAA 1H24A 2QOLA 2GU8A 3TKHA 4BTJA 4O7WA 1OKYA 4R78A 2HWPA 2ERZE 4WKQA 3SRVB 3DZQA 5HD7A 4DTBA 2YCRA 5GZ9A 4PTEA 2Z7LA 4PTCA 2V7AA 3LFAA 2BDWA 1OIUA 2W5AA 3ZFXA 2W4OA 4HPTE 2O8YA 2YWPA 2XA4A 5T68A 4EUTA 3QD4A 4UWCA 2LAVA 5I4NA 2JDSA 4YHFA 3FMEA 5C01A 1S9JA 3EHAA 3HMPA 5C8KA 1NVSA 5M4IA 3N9XA 3LFQA 3HYHA 5G6VA 4C4JA 1SYKA 2FUMA 5DG5A 4BVUA 3NNXA 2P2IA 4B7TA 3EIDA 4A4XA 2CSNA 2P0CA 4AQCA 4TPTA 3UTOA 4ZK5A 4U79A 2QO9A 3MVJA 4D9TA 3PIZA 4M69B 3RAKA 3TUCA 4AFEA 3LJ1A 1GZKA 5JQ5A 1PRYA 3C4ZA 2REIA 4DFZE 5HCXA 2XP2A 4QMNA 2WFYA 3ZYAA 5E8ZA 3PA4A 4DGGA 2W5BA 2Y6OA 2WMBA 5D41A 3WILA 4I5CA 2ZOQA 3H10A 4IB0A 4I93A 4U3ZA 4YBJA 1ZOGA 3L8SA 3EFWA 3ZOSA 3I1AA 4X2GA 4OUCA 5B2LA 2C5XA 2H6DA 4NTSA 3TNQB 4ASXA 2WELA 1Y6AA 2WTJA 3NUYA 5LMKA 4OTIA 4F70A 3MFSA 4RVMA 1PXKA 3EN5A 3UO5A 2RG5A 1GZOA 4GRBA 4RVLA 2WU6A 3U51A 4DTAA 4L3LA 5H8BA 4U81A 4EZ5A 4I0TA 2WQNA 2Y8OA 1O6LA 2IVSA 2X39A 5DH3A 4ENYA 1ZAOA 2O65A 2ZDUA 4DFLA 3HMIA 4O2ZA 4O0YA 4LFIA 4I23A 3F2AA 4OBOA 4Z55A 4UWYA 1XJDA 2X2MA 4RIWA 2C5YA 3G0EA 1J7LA 3P79A 3TMOA 5FGKA 1WBSA 4J96A 4MEDA 3A61A 2OWBA 1JPAA 4ZOGA 5CI6A 4S32A 5IEXA 4BKYA 5IU2A 5K0XA 4WG5A 2VTMA 2G01A 4PUZA 3NR9A 3W0NA 4W8EA 4FIHA 2JIIA 2BAQA 4QP4A 3NCZA 2IZRA 2YM8A 4FT0A 3BV3A 4JBOA 1GJOA 4XHKB 4F0FA 1W2DA 5ETCA 1T46A 2UW8A 3QRJA 4IX4A 1OL7A 4BKZA 4YZCA 4Z7GA 4Y5HA 4IC7A 2QO2A 3F3ZA 4ZAUA 4O7TA 5BVEA 4QMQA 3WF8A 2CKEA 3SC1A 3BKBA 4O4FA 3H9RA 4XX9A 1B38A 1MQBA 5CU2A 5HKMA 4CFFA 3BBTB 1Q4LA 3FMDA 3O7LB 3FLQA 3VS2A 4F63A 5CEMA 3NYOA 2FSOX 4OBQA 4QMYA 4CFXA 5DA3A 4L3JA 5ANJA 1YDTE 5AX3A 4DFBA 4X7QA 5BVDA 4O6LA 4FSUA 4F9CA 4PNIA 4QYHA 4EWHA 4JDJA 2OGVA 5HGIA 3ZLXA 4PMMA 4FICA 5BPYA 2X8DA 3IDBA 4LM5A 4YJSA 4RFYA 4JS8A 2H9VA 2RFNA 4YHTA 4PPBA 2VTRA 4F7LA 4FKOA 4USEA 4QQJA 1YDSE 3BQRA 3OBJA 4U0IA 3FL5A 4BCNA 4GFOA 4EOOA 5A6OA 4FI1A 4L00A 2Y4PA 3NAXA 4DH7A 2VTAA 1OBGA 2CGVA 4IM2A 2J5EA 1E1XA 5HCYA 4D2WA 3BE9A 2XYUA 2OH0E 4GK3A 1FBNA 4PDYA 3PY1A 2PU8A 3DS6A 3QLFA 2IZTA 4FV1A 3AT2A 4IWQA 4F65A 3R7IA 3LLAA 4FKGA 4FK6A 2OZAB 2VN9A 5FP5A 4GVJA 1OMWA 4Y46A 4I22A 4OT6A 3QA8A 4IC8A 3DY7A 5K0KA 3C0GA 1ZZLA 2R3JA 4NWMA 5AA9A 3Q4ZA 3SV0A 3FYKX 4E93A 4O7YA 4AS0A 1TKIA 4II5A 1KV1A 4BCJA 4BCQA 3QRKA 5I3RA 4FMQA 1SM2A 3E7OA 3KCKA 2JKQA 1TQMA 3R7OA 3RZFA 4CZUA 3RINA 4XV1A 4G34A 3D5WA 2UVZA 4BJJA 3G51A 3P7AA 3OFMA 3PY3A 3IKAA 2R5TA 5L2QA 3PVBA 5M4CA 4OTPA 2BTSA 2I40A 4FVPA 1J3HA 4QP2A 5HG5A 5KE0A 5J87A 3QUDA 4QQ5A 1ND4A 3OUNB 4RC2A 4IHPA 3CY3A 3PXKA 2EVAA 3QTXA 3RKBA 5AP1A 5E91A 3BYSA 5A9UA 3EN6A 1KWPA 4D2SA 5DVRA 3A7JA 1APME 1ZOHA 1H00A 4R7IA 4IZAA 3R0TA 3UG2A 4EYMA 3HEGA 5E1SA 5K4JA 1KE8A 4I41A 3LLTA 4H3QA 3UNJA 4EC8A 3DXNA 3BQCA 1KE7A 2VNWA 3QHRA 4DEDA 5M56A 4L3PA 4PQNA 4J71A 1YWRA 3KF4A 2BDJA 2HZ0A 2BZIB 2F7ZE 1OPJA 4FNWA 3QCQA 4N0SA