2Z60A

Crystal structure of the t315i mutant of abl kinase bound with ppy-a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
284
structure length
281
Chain Sequence
b'GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystal Structure of the T315I Mutant of Abl Kinase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 88
structure length 281
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z60A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z60A01
4I5PA 2VU3A 4PUZA 3RAHA 3LLTA 3MFSA 4IB3A 4JX3A 1R0EA 2HXQA 4HGTA 2C6LA 4HGLA 3D7ZA 4FIJA 3TKHA 5GJFA 5GZ9A 3PUPA 4L44A 1OITA 4AZEA 3Q32A 3GCPA 4C57A 4HOKA 4HPUE 3WYXA 2R0UA 1IA9A 5KMMA 3FMNA 5C01A 3VF9A 2UZUE 1JKSA 4L43A 3HV5A 3GENA 4E8AA 3V5LA 4I24A 4D5KA 2R64A 5C03A 4Z7GA 3SRVB 3HAMA 1YDSE 3ROCA 4YZDA 4IWPA 4CCBA 4WOVA 2XCHA 3KRJA 2EB2A 3PJ2A 4IIRA 4R1YA 2XKCA 5EI2A 3MWUA 4FT3A 3P1AA 2WPAA 2R0IA 4O83A 5FWKK 2XIRA 4CD0A 5CAOA 4CT1A 5K4JA 4ZOGA 2J0IA 3EL8A 4BTFA 3F2RA 3DFCB 5B7VA 5CI6A 1YHSA 4YJOA 5EW8A 4EK6A 3VBVA 2YAKA 5HIBA 4BCQA 1M7NA 4OT5A 3T3UA 3H9OA 3G33A 5DT4A 2YZAA 4CKRA 4TW9A 3VS1A 1J1BA 3OCTA 4FEWA 3WILA 3OWKA 2OXXA 2Z7LA 3ROYA 2WQOA 4M7IA 4BR3A 4HGSA 5HO6A 3IW7A 4ZSAA 2YIYA 1WVYA 4NU1A 3LFDA 4S32A 2BKZA 4X2GA 1H28A 4IXPA 5AUYA 2F4JA 3AC2A 3C0IA 1BMKA 2X0GA 3QRIA 4C59A 2QOCA 1YI6A 3UP7A 3ODYX 1QPJA 4XRJA 3ALNA 2PULA 2C3IB 2ITWA 3DXQA 4NFNA 3HV3A 5CEKA 2PVLA 4CFUA 5AR4A 4B6LA 4JG8A 4EH7A 4F0IA 3LFNA 4FTIA 4FV2A 4K33A 3FSFA 2A19B 3FY2A 4MEDA 4USDA 1PY5A 5T6KA 3OUNB 4YLLA 4C4HA 4CFVA 4AZSA 4CG8A 5B2KA 4QTBA 3W1FA 4WG5A 4FKJA 1QPDA 4E5WA 3WZDA 1M2PA 4LG4A 4XS2A 5IKWA 5LMBA 3U55A 2JDSA 3NVMB 3NUAA 3VS7A 1W7HA 3FC1X 3QFVA 3Q5ZA 3N4VA 4E6QA 4QRCA 2A1AB 3HA6A 5IDPA 1ZMUA 4RIOA 4RVLA 4FNWA 2VTAA 4M0ZA 2XYNA 2IZRA 3KB7A 4DG0E 4RVTA 5D12A 3FXZA 5AV2A 4FSWA 4X2KA 5DVRA 3LQ8A 5HOAA 4N0SA 4A06A 3JS2A 5TO8A 2FSMX 4O7TA 4U42A 1FPUA 3ERKA 3D5UA 2O63A 3S00A 2QO2A 3MB6A 3R9RA 2CKEA 3PIYA 4RX8A 5CQWA 1TKIA 3AMBA 3GP0A 4F1TA 2WMQA 3QRJA 1ZWSA 2CJMA 3PTGA 3QQJA 4G3FA 4I22A 3FMHA 2OZOA 3Q9XA 3KCKA 4ITJA 4PMSA 3UQGA 4R7BA 3HDNA 2QOLA 3R04A 3IGOA 3ALOA 3I7CA 4NJDA 4D2WA 4UN0C 4YNEA 1IG1A 1UNLA 4EH5A 4ZP5A 5DMZA 4WKQA 4ASDA 2HYYA 2XNNA 3NNWA 5I9VA 3O71A 2XJ1A 5CX9A 1YHWA 1E1XA 3D5WA 4YHFA 4RMZA 1F3MC 4MD8E 3PPJA 4XX9A 3FSKA 3TG1A 1WBPA 2F2UA 5CAQA 3QHRA 4TYHA 4Z3VA 4GT4A 3SGCA 2R3LA 3GCSA 2C6DA 4KKGA 2WELA 4EOSA 1WBNA 3UE4A 2X8EA 4U79A 2B0QA 4ASEA 5AV4A 5HE0A 4F9AA 1YW2A 5IQEA 3VN9A 5FEDA 4ZTMA 5BYLA 2QONA 4KKHA 4CMUA 5EM7A 1R78A 4IX6A 3E62A 5HE2A 3HUBA 3MH0A 1V1KA 4TXCA 4R3CA 4BDCA 4GL9A 1Q3WA 3RPVA 4KKEA 1PXOA 2R3RA 3MTLA 4WNOA 4D28A 3BE9A 4U3ZA 4GK2A 4R3RA 5CZHA 3M2WA 5H8EA 5AFVA 3H9FA 3E93A 2QO9A 1XBBA 3OW4A 4XG2A 4U40A 2Y4PA 4GVAA 2YEXA 3OF0A 1H01A 5ACBC 3TIYA 1B6CB 2R5TA 4D1ZA 3F6XA 5D7VA 3RCDA 3FMEA 1OKYA 3ET7A 3VULA 5GZ8A 4F99A 2VNYA 4YC6A 1U5RA 3QCSA 4AN3A 2R3PA 1Z57A 4PDOA 2R3FA 5J8IA 1F0QA 3R9HA 4EH8A 5IQDA 2XEYA 4AQCA 1MQ4A 3K2LA 2HOGA 4FKQA 1ZYJA 5KNJA 5M4FA 5CU3A 1Q8WA 1IR3A 1FGIA 2VWIA 1YRPA 2XRWA 4JS8A 4PDPA 3TNIA 4ARKA 3VHKA 3WIKA 4LOPA 4WIHA 4XV9A 3SV0A 3HMNA 1OPJA 3IECA 3UVRA 1RE8A 2GSFA 3BWFA 3FZRA 5D11A 4PNIA 4X7QA 4D4RA 1ZYDA 2G2FA 5C8KA 3Q4TA 4C4FA 2R3IA 5CASA 5HZNA 3LLAA 3ULIA 2B9HA 3FLQA 3DFAA 4TNBA 5E91A 4IDVA 3BPRA 2UZEA 5K4IA 4MTAA 3K54A 5FBNC 3QD3A 5CTPA 3ORIA 3DJ7A 3DXNA 4KIQA 1Q3DA 3GC0A 4E26A 3S95A 4LV5A 3M11A 5IA2A 3A62A 3UYTA 5EQPA 4FR4A 2PVYA 4DYMA 4QTEA 2ETRA 3I0QA 3I4BA 4A9RA 2WMSA 3BU6A 4NKAA 1CM8A 5EHYA 3HZTA 2W4JA 5G1XA 3KGAA 4V0GA 1ZYCA 2Y8OA 2H34A 4JR3A 4RFMA 4NW5A 2AC3A 3QA0A 3NCGA 4GS6A 3ZFYA 4BN1A 2XA4A 3OS3A 4FSRA 4MBJA 4U0IA 5A4EA 3GNIB 3QRTA 5CENA 3WF5A 3W18A 4ZLOA 5HI2A 4EH3A 3FMMA 2VTOA 2X8DA 4PDSA 3KXHA 2UZVA 4L8MA 3R8UA 4AGDA 4P4CA 2OI4X 4OTIA 3O8UA 4BI2A 1KE6A 2JAMA 4JR7A 3ZS5A 5JFWA 5LVOA 4ASZA 1VEBA 3A4PA 3BV3A 3DK7A 3HMOA 4FOCA 2J5FA 4PX6A 5BVFA 5H8BA 2CGVA 4L3LA 4W9WA 4YZBA 2W5AA 2RIOA 3P7AA 4DGOA 4FV5A 1REJA 2A2AA 4OTRA 3E7VA 4A9SA 4TYIA 2ONLA 2E9UA 3VUGA 3F66A 4YJNA 4YTIA 5D41A 4S33A 5AM6A 4R7IA 2VTTA 4IX3A 4WHZA 5JFXA 4W4VA 4FTCA 3PWDA 3UIMA 4FV1A 4IM3A 1A9UA 2VTQA 1ZAOA 2P33A 3L8XA 3MI9A 4OBOA 4FIHA 4IX4A 2VD5A 3NS9A 4FTLA 4LGDA 5K0KA 3MH2A 4CLJA 3CEKA 4RZWA 4X2FA 2QURA 4YGAA 2QOQA 5CF8A 4L6QA 1UV5A 2WMVA 5F4NA 2PY3A 4FGBA 3UZRA 2W99B 5IQCA 1NY3A 4WG4A 1GIJA 2BIYA 4WD5A 2WU6A 3DT1A 5CU4A 4N57A 4BKZA 3LKMA 4BVUA 5HE3A 4EBVA 2C3JA 2XM9A 3R02A 2I1MA 2A4LA 3MN3A 5A6OA 4MCVA 5ANKA 3F7ZA 3PY0A 5ANGA 3QKKA 4GVJA 4X6RA 2C6TA 4IC8A 2V62A 4GFMA 3UIBA 3ZUUA 2CKOA 3VUMA 3WARA 2GU8A 3IW4A 3H30A 3TI1A 1YDRE 3OHTA 5IUGA 3IW5A 4YUQA 2OF4A 2UV2A 2YWVA 4ZLZA 4RQVA 2BROA 3Q6UA 4NCTA 3TTJA 3TN8A 5HORA 1PXJA 2R7IA 5E8VA 5HGIA 2VGOA 4FSMA 4MNEB 2BRMA 5AV0A 5HIEA 2BAQA 4MQ1A 1PMEA 2P4IA 4UBAA 1H0VA 4XUFA 2BAJA 4KINA 3SW4A 5IA3A 1V0PA 4ZAUA 5FEEA 3ACJA 4LOOA 3MY5A 4AZVA 3Q4ZA 2JIUA 3FKNA 3MFUA 1UNGA 5CVFA 5KCVA 3PXQA 2W1IA 5AIKA 3UNKA 4EHGA 2W7XA 5CT0A 1PXNA 3P79A 4JDJA 4MXAA 4QYGA 4YPSA 4BHNA 1I44A 4FKLA 3NUYA 4AZFA 4C3PA 3V01A 5HNGA 3E63A 4EZ5A 3FQEA 4G9CA 2Y4IB 4FEVA 2PE2A 1FVTA 5CEMA 3CE3A 2WMXA 2X2MA 2B54A 2J4ZA 2C6MA 1MP8A 2F7ZE 3E3BX 4G5JA 3H9RA 3MVMA 5K5XA 4PL5A 3SXRA 2XNPA 5M51A 2O0UA 4XV2A 4U7ZA 2AC5A 2PVHA 3KKVA 3MY0A 5JGAA 2XEZA 2W17A 3AOXA 1URCA 3G2FA 3NZ0A 2NRYA 2CKQA 3CC6A 4L7FA 2YA9A 3PSBA 4NYEA 5JFSA 5E8YA 1PKDA 2XBAA 3JY9A 4FEQA 4NUSA 5TT7A 4Y95A 3RAIA 3TACA 3VO3A 4MVFA 2OKRA 1BYGA 4AX8A 4DT8A 4HZSA 5C8MA 4BL1A 3MIYA 1P4FA 5FDXA 4JDKA 2R3KA 3FQSA 4L45A 2WOTA 3Q96A 1KE7A 1P5EA 1ZYLA 1KV2A 4GV1A 5IUHA 2IG7A 4WUNA 4AOTA 1CSNA 2VTJA 3L8SA 4D2PA 5GZAA 2I0EA 3MFTA 3OZ6A 1UU8A 3BHTA 4F70A 2RL5A 3RNYA 1JKKA 2VTHA 3JR1A 5CF5A 1PW2A 3R28A 3C7QA 3Q4CA 3TUBA 2QKWB 5DH3A 3PJ3A 3D7TA 1ZZLA 2BILB 1HCKA 1NA7A 4U9AA 5CU0A 5IH6A 4QP4A 2WMWA 4O27B 5C1QB 5HU9A 5I9WA 2VTRA 5JRSA 2A0CX 3R1NA 2DQ7X 3ZO2A 2PSQA 4EQCA 4UB7A 3ITZA 3MY1A 3R8MA 1ZZ2A 5DFPA 4MXZA 5EM6A 5B0XA 4DLIA 2PUNA 1H1PA 5FTOA 3MTFA 3GU7A 4NW6A 4PTCA 3BYSA 3L9NA 1Q24A 4JRVA 5M4IA 2YZLA 2HXLA 4FICA 4K9YA 4LOQA 4RWJA 2PMNX 4BDJA 2HWOA 3CY2A 2ZMDA 4O2ZA 3P08A 3PJ8A 4RVMA 4A4XA 3BRBA 2YLFA 1URWA 3JPVA 3EZRA 2PWLA 3E8EA 3VS0A 4CNHA 2BRNA 4M69A 1JQHA 2WMRA 5D1JA 4QP3A 2QOBA 3SX9A 2W1FA 4IVCA 4R1VA 3NUXA 3O8TA 3ZLWA 3LOKA 4G3DA 3WZUA 5ETCA 2C5XA 3DNEA 5IPJA 5BQ0A 2Z2WA 3PZHA 4FKPA 4FYNA 3QTWA 4OTWA 5EHOA 4MWHA 4FUYA 3LFEA 3OWPA 3UGCA 2UW6A 4ASXA 3R1SA 3E8NA 4FTAA 4F6SA 4C8BA 2OH4A 3GCVA 3POZA 3E92A 3QD0A 4JBPA 3T9IA 3VHEA 1IRKA 2OLCA 2CDZA 2BZJA 4BBMA 3C4FA 1Q61A 2BHEA 4F0GA 2C6OA 4DINA 3VQUA 3MVHA 1ZOGA 3EQGA 5C27A 2PL0A 4EHVA 5BUEA 3HECA 5EW3A 4C38A 5KMKA 2JDVA 4NL0A 2PMLX 5HKMA 3EN6A 1YXUA 4ANLA 4JNWA 4EH9A 5EQYA 5IA5A 1DAWA 3PE2A 3VUTA 4ORKA 3QKLA 3DGKA 4KIOA 3WF7A 4FIEA 4XP3A 3GU5A 3FLNC 4I6HA 3BEGA 3BV2A 4X6QC 4KBAA 5KMLA 1BUHA 1MQBA 5KMNA 1OIRA 4DN5A 1U46A 3ZM4A 4MXYA 4ACMA 4IANA 2FSTX 3R9NA 4TPTA 4CEGA 2ITOA 4RJ7A 4QMTA 3VUIA 3WE8A 1YOLA 2C1BA 2JFLA 4BTKA 5BUJA 4YNOA 4CV8A 2WTIA 3AC8A 3UDBA 1PMNA 2GNFA 2YCSA 4UEUA 5HCZA 3ELJA 3QQLA 3R8ZA 3NAYA 4QMLA 4ZTHA 4JI9A 2J9MA 5IQIA 4ENYA 3D9VA 4FV9A 3AC1A 4Y46A 4N70A 3A61A 3MBLA 3TJDA 4IVDA 3C4WA 4RC2A 2C0OA 4S34A 3KXMA 3VS3A 4QD6A 4KA3A 2J5EA 1OGUA 2YCQA 4DH5A 5EQEA 3DBFA 4HVHA 1FVVA 2BTSA 2BDJA 3CGOA 1M2RA 1M2QA 5CALA 3UMWA 3ORNA 4JJRA 1JKLA 3BWJA 2O2UA 4BZNA 3LFAA 2JC6A 1DI9A 3LMGA 5IQHA 2BZKB 5KKRB 2GHGA 4IBMA 5HICA 5IQGA 2W05A 2CCHA 3MW1A 4CYIA 5GJGA 4DAWA 2PVFA 2I40A 2KTYA 1W0XC 3BKBA 3VWAA 4C34A 5TR6A 3R1QA 2UW4A 5AIRA 4BBFA 2JDRA 2PZPA 3CQWA 3LCOA 4ZTSA 5FD2A 4P5ZA 4U80A 3ZEWA 1Y91A 3E8CA 5HCXA 4HJOA 4Z7HA 3KMMA 1ZY4A 4AW0A 2CKPA 4DEBA 5AX9A 1PJKA 2E2BA 2OH0E 3GQLA 4QMWA 4WUAA 3FZPA 4FG7A 4FOBA 2G1TA 4DFNA 5LXMA 4CSVA 4FTNA 4XCUA 2ZB1A 1SVEA 4FK6A 5A4QA 3BE2A 3JVRA 4FSYA 4CV9A 4FL2A 3A7FA 3ORPA 3RBWA 3NYOA 3DAKA 3QQFA 3VAPA 3BHUA 3KRRA 5EH0A 1JOWB 4XG7A 1E1VA 4Q5HA 3F69A 5HQ0A 1XH9A 1XR1A 4YR8A 4KS7A 3G6HA 4G1WA 3UG2A 4C2VA 3UMXA 3R7EA 3E3PA 4BDDA 4Y83A 1YWVA 2NP8A 1OIUA 4EZ7A 2C5OA 3W32A 2Z8CA 4V0GB 2GQSA 2PUIA 2CHLA 3WBLA 4ZSEA 3ATSA 5I3RA 2QOIA 3FI2A 4DFYA 2CN5A 4F9CA 2PUPA 1WCCA 5DI1A 3W8QA 4FNYA 4JQ8A 4GYGA 5DRDA 5DG5A 3ZLSA 4L53A 4EK5A 4TT7A 3NDMA 4AUAA 1KUTA 4L67A 4K11A 3UOJA 4IFGA 1Y6BA 3G6GA 2B7AA 3D83A 4ENXA 4YJRA 3DLZA 4P2KA 5AUVA 1K3AA 4O91A 4PTEA 1GZNA 3BIZA 3DBDA 5BYYA 5IEXA 4FSZA 2OXDA 2I7QA 3FI8A 4OAVB 3UC3A 4PPAA 4QYYA 3HAVA 3I5NA 2PVJA 3ACKA 1J3HA 3ZZEA 1NW1A 1QMZA 2C30A 4KRDA 3MYGA 4Y5HA 3KRWA 2ZOQA 5AR3A 2YM7A 3A99A 3IG7A 3LCSA 2GHLA 4U41A 3R7OA 2UVXA 4W8DA 4XG3A 1DS5A 3H4JA 3TDVA 2WTKB 5HTBA 2X4FA 4XG8A 3U87A 2OIQA 5AWMA 3QQUA 5M4CA 1XWSA 4BIBA 3UQCA 1OL5A 4QQ5A 5DE2A 1Q4LA 4DBXA 3EHAA 2VO0A 3BLQA 3QWKA 4RIWA 4M97A 2BFYA 4E20A 5LCKA 3IW8A 2Y9QA 3CKXA 3PIXA 4ACGA 5DIAA 3QXPA 4JX7A 4KB8A 4DH3A 2EB3A 4E93A 2WTDA 4V04A 2OXYA 2WQNA 2X7OA 3FL5A 3VF8A 4EOOA 3OWLA 4I20A 5HVKA 3UYSA 1JSVA 3GQIA 5HNBA 2GFSA 2VTIA 4IAAA 3RVGA 2G2HA 3OY3A 4XMOA 4EKLA 2RSVA 5L6PA 4IAKA 3COIA 5KMJA 3RNIA 4GG5A 3C9WA 4RSSA 3FWQA 4KIKA 1UU9A 4FKIA 3BEAA 3ZRKA 3QWJA 3BLRA 4YLJA 3VJNA 3BBWA 3BHYA 3LIJA 2CCIA 3T3VA 3V8WA 2BRHA 3KL8A 2P3GX 3OCBA 4LMUA 4ZTQA 5BVNA 1P2AA 3TV4A 3EQFA 2C5VA 3CP9A 4ZSGA 5FLFA 4D1SA 4FE2A 1OZ1A 4BZOA 4M12A 3KF7A 2XUUA 4XG9A 2YIWA 2XVDA 1GY3A 2OJFE 2C5YA 2X4ZA 5FTQA 5JRQA 4JDIA 3C51A 4L3JA 5CANA 3HMPA 3FLWA 1PXLA 4I6BA 3AC4A 4FTOA 5M08A 4NWMA 3QALE 3EYHA 4IACA 4IWDA 3BYVA 4J52A 4YP8A 1IASA 3SA0A 5EDQA 4A9UA 4ACHA 4JQEA 2QO7A 4A9YA 2IO6A 1PYEA 4JRNA 4YBJA 1IA8A 5HG8A 1U4DA 4ZEGA 3U6IA 1LPUA 4ZMEA 2XMYA 5DHJA 2LAVA 3OOGA 3VS4A 1PXPA 3KC3A 5DYJA 3U9CA 2GHMA 3GVUA 4JT3A 5E1SA 1A06A 1PF8A 4QYFA 4M68A 4ITHA 5I9YA 3KQ7A 2ZM1A 3LAUA 4K8AA 1GIHA 1VZOA 4O0TA 3QD2B 5CEPA 3LJ0A 4FEUA 2OO8X 3F3TA 5AP6A 4CFXA 5CU6A 4G3GA 5L2IA 5AAGA 3ENMA 5A3XA 4FEXA 4BTJA 4ZSJA 4DC2A 3FHIA 3EWHA 3WE4A 4BDKA 3DPKA 1UVRA 4FKWA 2QODA 2X81A 3EQDA 3QKMA 4DFZE 4OBQA 2ITTA 3H0YA 5BYZA 4AGCA 3PA4A 2JKQA 4TTHB 5AJQA 3RZFA 5E8ZA 3QGYA 3NSZA 1KV1A 2ITNA 3M42A 4O6LA 4RGJA 3QGWA 4Q9SA 4GKIA 3PG3A 3VNTA 4BCMA 1ZLTA 3FPMA 5F9EA 4KSQA 4RT7A 3AT4A 4FZ6A 3ZU7A 2PVMA 3VS2A 4AN9A 3G15A 3GT8A 2CLQA 3EN9A 2FO0A 1XKKA 2IPXA 2UW0A 3Q9ZA 3P9JA 4FK3A 2IWIA 1ZOEA 4YBKA 3LCDA 3LQ5A 2QG5A 3ZYAA 4CG9A 3KU2A 4M69B 2QVSE 3E8DA 4U45A 3S2PA 1FINA 5IQBA 3NMUF 3ZEPA 4ZIMA 1Q8ZA 3PXYA 3R2YA 3GI3A 3MDYA 3OC1A 4AW5A 4BCOA 3NLBA 1FOTA 2H9VA 2X6EA 1CDKA 3UIUA 5LOHA 4DE4A 2ZV8A 1OVEA 4YPDA 2VO3A 3VRZA 4B8LA 1Y8GA 1YWRA 5EDRA 4F1OA 4ALUA 4AN2A 2YM8A 5L2SA 5HLPA 5CAUA 1DAYA 3HNGA 4Z9LA 3VBYA 4HYSA 4HNIA 3GC8A 1YXSA 3LZBA 4DG2E 5J7BA 4F08A 3G9LX 4M3QA 4Z55A 3RAKA 4LRJA 2FSLX 5IUIA 3RK9A 1H26A 4D2SA 3E64A 3MFRA 4CFFA 3PE1A 1HOWA 3OVVA 4OBPA 5EYKA 2REIA 5M55A 4BCIA 5FRIA 3U4WA 1G5SA 2EXCX 4XBUA 2CGXA 2ERZE 4BRXA 2B9JA 2QU6A 2FH9A 4UYNA 2XBJA 5JFVA 2OW3A 2FA2A 4MKCA 4MXOA 4EBWA 3ZBXA 4UWYA 3R1YA 4DLJA 4PL3A 3F7WA 3QZIA 4NEUA 3KFAA 3IW6A 2RGPA 5HHWA 3SVVA 4QPAA 2VX0A 5M56A 5DT3A 3SHEA 5LCJA 2PPQA 3ORTA 2OZAB 2F2CB 2C3LA 1U5QA 2O8YA 2XKDA 2PZYA 4XYFA 4Q5EA 1PKGA 2GQRA 2X8IA 4PF4A 3WOWA 1W82A 5IQAA 4XV3A 2WMAA 5DWRA 3EN4A 4AW1A 4IVBA 3GCQA 3ZC6A 5HG9A 1PXKA 1RQQA 4RA5A 4HCVA 1PMUA 1J7UA 4K2RA 2VWWA 4U8ZA 3MPTA 2IVTA 2GS7A 5HEZA 3N51A 5K9IA 3QTSA 5DEWA 2OIDA 4EYMA 3F5PA 3CXWA 3B8QA 2PZRA 3ANRA 2CGUA 5LWMA 4KABA 3OXZA 4BF2A 4EONA 5BVDA 2GPHA 5E7RA 3HUCA 3FBVA 4MAOA 2XJ0A 3HV7A 4NIFA 4MXCA 5CT7A 3ORZA 1TQIA 1W84A 4W4XA 3RK5A 3SXFA 5J9LA 2R3JA 4R3PA 3Q6WA 1DM2A 3R30A 4M8TA 5GJDA 4IEBA 3DS6A 4JBVA 3R7YA 1KWPA 3QQKA 4NFMA 2YDJA 4UMQA 2OJGA 1GIIA 1O6LA 4JL9A 5AUXA 4O0WA 4ANSA 3TUCA 3FHRA 4NZWB 3R9DA 2OICA 3DK6A 3QBNA 3QCYA 4L3PA 2ESMA 5J7HA 2GQGA 4FSQA 4LI5A 3VBXA 4HCTA 5LVMA 3OROA 3A7HA 2WTJA 4K6ZA 3JYAA 4N6ZA 4RVKA 5H9BA 4C4GA 4E6AA 5JMSA 3D5XA 5J9ZA 3CBLA 2FB8A 4JQ7A 3FZTA 4HPTE 3ZXZA 2IJMA 4AE6A 5FXRA 3PWYA 4KBKA 4CTCA 4NH1A 4DEEA 4FKOA 1F5QA 3CTJA 4O81A 3P4KA 5AUTA 3OW3A 5E8XA 5A46A 3KXZA 5L8LA 2AYPA 4R78A 1OKWA 4IAIA 3WF8A 4RRVA 3CJFA 3PSDA 2CNUA 4AT5A 4UYAA 2PUUA 3FI3A 4I0SA 4TRLA 3GOPA 5L3AA 3CSVA 4FZFB 2IZTA 2RFSA 3F3UA 2XCKA 4TKSA 4X3JA 4EOMA 4GJ3A 3O8PA 3W2RA 3FXXA 4LM5A 4XV1A 5EKNA 4ZLYA 3PXZA 3W2QA 4MD9E 3RWQA 3AXWA 4QMVA 1YDTE 1IEPA 2ZMCA 2XNBA 3O7LD 4XOYA 2OG8A 4CMTA 2ZJWA 4FL1A 4BGQA 2UUEA 3S1HA 3ZXTA 3B2TA 4RWIA 3VVHA 1PRYA 2Y4IC 4TY1A 1GZ8A 2BDWA 3AC5A 3REPA 3OBGA 3TNHA 1UNHA 2RFEA 3HV6A 2E9OA 4V01A 5GNKA 4FNZA 3QRUA 5HU3A 4BFMA 2OFUA 5KBRA 2B4SB 1RJBA 3QAME 2WD1A 1UKIA 3IQ7A 4IFCA 5HD7A 4FMQA 4C4JA 3ZDIA 2JDTA 4MWIA 4XBRA 3QTIA 1UWHA 5FP6A 2YERA 4F64A 1MRUA 4YMJA 3ULZA 2BFXA 4BYIA 4DEDA 4BICA 4EEVA 1ZXEA 2BKKA 3OTVA 3EJ1A 3O17A 2PK9A 4FX3A 2BCJA 4EKKA 3L9MA 4CQGA 5EG3A 2EUFB 4BCHA 4E5BA 5BNJA 2YM6A 4DH1A 3WYYA 4BBEA 4DTKA 5I0BA 1XHAA 5CLPA 3VW8A 1YI3A 3MIAA 3UNJA 4EOLA 4G31A 4I3ZA 3TZ8A 3EQBA 1OBGA 3MH1A 4G3CA 1KOBA 3DB6A 3AG9A 4A4OA 2IVUA 2GMXA 2VWYA 4DEAA 4DEHA 2CNVA 3QTZA 4IVAA 4XG4A 3C4EA 3LPBA 2H96A 3QZFA 4FSTA 4AZWA 2VTPA 4FT7A 4O0XA 3MVJA 1M14A 3ZLXA 2QR8A 2W1DA 3BI6A 5JQ8A 3KULA 1PXIA 4L42A 3F82A 1OECA 1AD5A 3VBQA 3NWWA 3N4UA 4K1BA 4RLKA 5CXZA 3FYJX 2V0DA 3ZO1A 5K3YA 1K9AA 4M15A 4I5MA 5A14A 4DGLC 2XH5A 3NW6A 4M14A 4Y85A 4M84A 3MB7A 1IAJA 4IADA 3UVQA 5IEYA 2HY0A 5TF9A 3RZBA 3S0OA 4RIXA 2YJSA 5AR7A 4NTSA 2F7XE 5KHXA 4QYHA 3E87A 4GW8A 2HK5A 1M17A 4YURA 3SQQA 5LWNA 3PVWA 2JGZA 3BHVA 1BL6A 4TYGA 3I1AA 3UBDA 3EFLA 4C36A 1M52A 3LFCA 5IISA 5EK7A 2VAGA 3GCUA 4J53A 3SLSA 1APME 3CJGA 2XIZA 2VUWA 1NVSA 1H1SA 4FF8A 2WIPA 5CSHA 4YHTA 4QMQA 5M53A 2PZIA 3QUDA 4GMYA 5E4HA 4DGNA 3HDMA 4LL0A 2BZHB 1WBWA 3AMYA 2QOOA 3BHHA 3HVCA 4NT4A 3VBWA 4CZYB 3U6HA 5A4CA 2JLDA 5M07A 3S3IA 5ETFA 5B2MA 3QC4A 3V6SA 4D4SA 3LCKA 4EORA 4I6FA 4HZRA 4MXXA 4BDIA 3D14A 2JBOA 3OCGA 3TZMA 3TL8A 4PPCA 1YXXA 3D2KA 4WRSA 5J95A 1Y57A 4BB4A 3ZBFA 5IH4A 4QNYA 5GIOE 4EK3A 4FTTA 4FKGA 1LUFA 2WTWA 4MQ2A 1NXKA 3CKWA 4UXLA 3UPXA 3C0GA 4TWNA 4EUUA 3FMLA 5KMOA 2G2IA 4IQ6A 2XIYA 4ZY4A 4PMMA 2ZDUA 3W16A 1VR2A 5L6WL 5DPVA 1RDQE 1PHKA 4GU9A 4R6VA 5AMNA 4AGUA 3FEGA 1QL6A 2XNEA 5E90A 3GC9A 4WBBB 4QQTA 2F49A 3S4QA 5CWZA 1Z9XA 4CLIA 5E8TA 2W9ZB 4FTRA 5CSVA 4AG8A 3TKUA 4UWCA 3BQCA 4IE9A 1H1WA 5E8UA 3UVPA 2C0IA 2XNOA 3NUPA 3Q3BA 5LMAA 4F6WA 2XF0A 2XK8A 4YSMA 3QF9A 5HCYA 3PP1A 4H3BA 3NCZA 2UW3A 5DR2A 2FYSA 3QU0A 4TL0A 4APPA 2XRUA 3RAWA 4BCFA 2OK1A 4BIEA 2VTMA 5GHVA 4BDBA 1SZMA 4BDFA 4QTCA 4EQUA 4E6DA 4YJPA 4NJ3A 1OIQA 4PTGA 1KOAA 2VO6A 5LARA 3EYGA 2Z7RA 2IZUA 3T9TA 5KKRC 4FKTA 4ANMA 4CT2A 2X2LA 4D58A 3IDCA 4FC0A 2QHNA 4BWPA 4EH4A 3AC3A 3UOLA 3OG7A 4YTFA 2WTVA 2Y6MA 2HZIA 2C47A 2V7OA 2WQBA 4IZAA 4MX9A 4R7HA 3CPBA 3LMIA 3MV5A 2VWZA 2I0VA 3IKAA 5I3OA 4ZMFA 3FV8A 3OFMA 2OF2A 4NM0A 3UP2A 4BI0A 5J9YA 5A54A 3PPKA 4X0MA 2JKOA 3ZFMA 3SD0A 3OCSA 2WU7A 1Y8YA 3JUHA 4QMXA 2GFCA 3WZEA 3E7OA 2J0JA 4DFLA 1Q62A 4KAOA 5M09A 4GUBA 5K0XA 2BZIB 4CGAA 3UODA 4AZTA 5AM7A 3W10A 2RFNA 4JVGA 4FG8A 2X7FA 4IC7A 4EOKA 5JK3A 3D4QA 3PLAE 4GYIA 3TIZA 4WBOA 4MD7E 5ITAA 2ACXA 2PVRA 3NIEA 4AA0A 1OUYA 4UX9A 4AACA 2ETKA 3ZTXA 3CTHA 3Q52A 3EB0A 1YHVA 4B9DA 4ZSLA 5CS6A 1XBAA 5DT0A 2DS1A 3HRFA 4YZMA 1AQ1A 3A7GA 4YLKA 4RWKA 1S9IA 2H6DA 2YABA 3QHWA 4TYHB 5DEYA 5ANEA 3UNZA 2YIXA 4EJNA 5LMKC 3Q2JA 4KIPA 1UWJA 5LVNA 4EUTA 3A8WA 4H39A 4L52A 4O0SA 3UG1A 4M0YA 3E5AA 4MHAA 4FG9A 5J79A 3MA3A 4ZTLA 4ZTNA 3PA5A 3VW6A 1M7QA 4OR5A 4OTHA 3UOKA 3MESA 4QOXA 3HA8A 5CY3A 3L8VA 5A9UA 3AQVA 4FTJA 4GT3A 3DOGA 3W8LA 4EH2A 5CAVA 3KMWA 4GT5A 2W5HA 2JITA 5DN3A 3AD4A 4ZJIA 2YFXA 3UO6A 2ONLC 4YJTA 4GIIA 2J6MA 4FKRA 3UOHA 4F4PA 4PMPA 2ZM3A 3W2CA 2W1ZA 4MH7A 2QR7A 4D0XA 4FT0A 2H8HA 1WMKA 4RC3A 1U54A 3QC9A 4O22A 4TWCA 2WOUA 4X3FC 5J1WA 3Q9YA 4BKJA 1T46A 4USFA 3TNPC 2G01A 4FL3A 3P78A 2Z7SA 3EQPA 2GCDA 3PJCA 4OT6A 3I0OA 1H0WA 3AD6A 3ZDUA 3C4ZA 3ZMMA 3OMVA 4U43A 1OM1A 1QCFA 2CGWA 5CNOA 2ZDTA 2ITZA 2UZLA 3A60A 1JKTA 1W98A 2WTKC 4QQJA 1EH4A 5CSWA 5AP1A 3TCPA 5KHWA 2C69A 2X2KA 2JDOA 1YXVA 3KXNA 4ZS0A 3HYHA 3R71A 5IZFA 3QYWA 4NKSA 4H05A 5HG5A 3ZRLA 4BDHA 4S31A 4K77A 5FEQA 4FT9A 3ZFXA 2E9VA 5HO8A 3VIDA 1J7LA 3RI1A 4IB0A 2ZV9A 3ZH8A 3C4XA 1FMOE 5CYIA 4BCNA 3R8PA 3F61A 2ITPA 5L2QA 4RA4A 4D4VA 2E9PA 2QLQA 4V05A 4YJQA 2XS0A 2F57A 3LFBA 2YM3A 5FXSA 4IHPA 3ZRMA 4RJ3A 4EWHA 1X8BA 5M4UA 2W4OA 5EDPA 4D55A 5L2TA 4FKUA 5AA8A 3PSCA 2R7BA 2R4BA 4ZZMA 3D5VA 2PMOX 1R3CA 2JAVA 3R00A 2QI8A 1I09A 4W4YA 4CZUA 2IW6A 3MH3A 3NNXA 3VC4A 3PIZA 1ZY5A 2ZAZA 5AX3A 2UW5A 2ITUA 3BYUA 4L68A 5EYMA 4EOPA 2J2IB 1SM2A 3FLSA 4RX9A 5D10A 5IEVA 2GS2A 3HKOA 3AT3A 2EVAA 3JVSA 1JSTA 5DA3A 2WQMA 3EMGA 1ZYSA 2XIKA 4GSBA 1P4OA 4RZVA 3RK7A 4BGHA 2W06A 4BI1A 4ERWA 5C26A 2BRBA 3KXGA 4BC6A 1S9JA 3CY3A 2YHVA 3AMAA 4J97A 4CKJA 3R83A 2VWXA 2NO3A 4G6NA 3UPZA 4LV8A 1OIYA 1JWHA 3N9XA 5CEQA 2JBPA 5AR5A 4LGGA 4WG3A 2ZVAA 3EQHA 4OTFA 3U51A 2O3PA 3F2AA 3LM0A 3NPCA 3KN5A 1JBPE 2QOKA 3OUKA 3EFJA 3O23A 4ITIA 3TDWA 1WBTA 2WB8A 4FTKA 4IZ5A 4AF3A 1GAGA 1GNGA 3NNVA 4I93A 3P86A 4L01A 3SXSA 3V51A 4TN6A 3R73A 3C5IA 2J7TA 2RG5A 3IOKA 5M06A 2EWAA 2ITQA 2R3OA 4J98A 3PP0A 4R8QA 3I6UA 4RX7A 4YZCA 5AV1A 5HBJA 5C4KA 5T3QA 4IB5A 3Q9WA 3V6RA 4WRGA 2PHKA 3K5VA 5L6OA 5E1EA 5HD4A 3D0EA 4LYNA 4E4MA 2C4GA 2BDFA 5FG8A 5GIPE 4E4XA 4FNXA 3LQ3A 3FE3A 3WF6A 5BVKA 4X2JA 2QCSA 2B55A 4BHZA 4D5HA 5K5NA 3NGAA 4H1JA 4XJ0A 5EM5A 2Y6OA 3Q53A 5HVJA 2DYLA 1XH4A 1IAHA 2WZJA 3HRCA 4D2TA 1A48A 1R0PA 1JVPP 3HP2A 4J7BA 5FDPA 5C4LA 2R3QA 3R0TA 5CZIA 2E9NA 4KBCA 5DRBA 2GNHA 4MNFA 3TNQB 4JDHA 3A4OX 3BCEA 4O7SA 3EH9A 2C1AA 4WA9A 5DR6A 3ZCLA 4G34A 4O0YA 5CI7A 1WZYA 1JNKA 4O38A 2XB7A 4FSUA 3ZUTA 2G9XA 2CMWA 1H24A 1P14A 2DUVA 3DTCA 4KRCA 4DG3E 1OPKA 3BGQA 4ACDA 3P7CA 4GFOA 5KE0A 3OT3A 5HESA 2YITA 4DFXE 1H4LA 3GXLA 3TKIA 3TV7A 4IH8A 4IZ7A 5FM3A 5IH5A 3QA8A 1NVRA 4A9TA 1CTPE 4RWLA 2JKKA 4LL5A 5L2WA 1ND4A 4DCEA 4PL4A 4XH6A 4UMPA 3PYYA 4JAIA 3RINA 2Z02A 4EJ7A 1JPAA 4FA2A 3LJ2A 4I41A 4YSJA 2ITVA 3I5ZA 2ITXA 4RG0A 1BL7A 1VYZA 3W2SA 4UMUA 3MVLA 1UU7A 3LE6A 2X39A 4BKYA 1J91A 2UZTA 5HBHA 3HL7A 2VTNA 4EYJA 3ZHPC 4A07A 2Q0BA 3NAXA 4F7NA 4ZK5A 4HVDA 2QOHA 3ZC5A 2XM8A 2VTSA 3IK3A 3DZOA 5J1VA 2RKUA 5F20A 2O5KA 2EXEA 3TNWA 4QPMA 3DBEA 2NRUA 4MNEA 2YJRA 3DKCA 4QP9A 2UZWE 1H1RA 3JY0A 5CSXA 2JFMA 3U6JA 4AP7A 3QLFA 3OEFX 3ZSGA 5BVOA 5CSPA 2BRGA 1Q8UA 4LFIA 3LFSA 1OMWA 5LVPA 4FZDB 2PTKA 1KSWA 1YOMA 3CIKA 3R21A 1H27A 4ALVA 4F09A 5ANIA 3G51A 3TZ9A 3PZEA 1VJYA 1KE9A 1W83A 3O2MA 4JBOA 3NIZA 4TWPA 5BVEA 3V8SA 5JSMA 3KCFA 4NSTA 3DB8A 2OSCA 2YM4A 2SRCA 2PE1A 4GH2A 1ZMVA 1CKPA 3V5TA 2JD5A 2BMCA 4XLVA 5EHLA 4Y73A 2XK3A 3VQHA 4KNBA 2WHBA 3OEZA 5TKDA 1O6YA 4UY9A 1MRYA 2BR1A 2XP2A 2R3MA 5EOLA 5FBOA 3SW7A 3F3WA 3VS5A 5JZJA 1R1WA 2XJ2A 4O1PA 5DOSA 5HIDA 2GNGA 4AOIA 3RALA 4D0WA 3O7LB 2VV9A 3FMDA 3ZUVA 3O50A 1TQPA 3DU8A 4O0UA 1OI9A 3NUSA 4DFUA 4OTGA 3D7TB 2C6EA 2VN9A 1Q41A 4X21A 2JIIA 2BIKB 1SVGA 3PXRA 4BYJA 3N4TA 2B52A 3DKFA 3I6WA 5H2UA 3DCVA 4IW0A 4BCJA 4GIHA 3I60A 4I5CA 3QUPA 3G9NA 4ALWA 5IF1A 3QZHA 3V04A 4WNKA 5CQUA 4LGHA 2RF9A 1PXMA 2WXVA 3CD3A 1YWNA 4OAUC 5I9XA 3BLHA 2VWVA 4J95A 4EOIA 5BMSA 1H25A 4YJSA 1JAMA 4G2FA 3NUNA 4QMZA 4E7WA 2IVVA 3O0GA 3DV3A 3QUEA 3CPCA 3R8VA 2HZNA 4CCUA 1XQZA 2J0MB 2BUJA 4ANNA 4BCKA 4F1MA 3FC2A 2ZB0A 3V8TA 2PZ5A 2XK4A 5LVLA 5HBEA 4ERKA 2P55A 3DJ6A 4OLIA 5HG7A 4I0TA 3RPRA 4DA5A 3AT2A 4P7EA 4LQMA 2C68A 2W5BA 4AS0A 1Y6AA 4CXAA 4QMNA 4S2ZA 1G8AA 4GU6A 4RQKA 3WI6A 2R3NA 1G3NA 5BVWA 5E9EA 4FKVA 4TWOA 2XKFA 3LXKA 3QQHA 3OTUA 3CLYA 3DTWA 4GFGA 4GRBA 4EH6A 5JEBA 5CEOA 4YC8A 5D9HA 4C2WA 4I4EA 1WVWA 2AUHA 4D4YA 2V22A 2CN8A 3DBCA 3K3IA 4QMOA 4C37A 5DBXA 4ZZNA 4O7LA 2NNWB 1BI8A 4USEA 4QP7A 5ETAA 3H3CA 4O96A 2R3GA 3H10A 3R7IA 3RGFA 3UJGA 4M66A 2UZOA 3V5WA 4AOJA 4EC8A 2OIBA 3DAJA 3ZSHA 5C8NA 3BQRA 4BZDA 5KMIA 3NYXA 2BPMA 5L8JA 4PDYA 3OWJA 3F5GA 3CGFA 3KRXA 4CFMA 2YWPA 4AA4A 4RX5A 5HTIA 4DEGA 5GINE 4J8MA 2YDKA 2QOFA 2O64A 4MYGA 2C0TA 3EN7A 2W4KA 3PA3A 4FIFA 4QMUA 1CKIA 4D2VA 4RPVA 3RWPA 3G5DA 4FVRA 2PMIA 2R3HA 4BWKA 2BALA 4LRKA 1H07A 3SKCA 3NRMA 3FQHA 4BTMA 3OBJA 3G0FA 3BGPA 5HVYA 3TXOA 3KXXA 4QMPA 4C02A 3VJOA 3FMKA 4CTBA 3LCTA 4RIYA 4TYJA 3RMFA 2C3KA 4QTAA 4F63A 4PNKA 4ZY5A 1NT2A 3TJCA 5KUPA 3OT8A 4FGRA 2P2IA 4WT6A 3BGZA 2J0LA 4DITA 2UVYA 3VS6A 3QXOA 3EQIA 1FMKA 5AP7A 2HW6A 2OWBA 4U6RA 3UZPA 2B9IA 2W96B 3DAEA 1SNUA 2JKMA 4R5YA 2JIVA 4KSPA 5FUTA 1U54B 3CS9A 5KZIA 1PYXA 4CZTA 4F65A 1R39A 3GU8A 2I0YA 2W1EA 4FV7A 4C3FA 4OW8A 2OJ9A 5HNIX 5AP4A 3ORKA 3BZ3A 4YJVA 5IA4A 3HX4A 4B8MA 4F9WA 3ZM9A 4IM0A 5AEPA 3EFWA 3QTXA 4GCJA 3C13A 2UZDA 4F7LA 1FBNA 3QX2A 5HO7A 1FQ1B 3BELA 3P7BA 4D1XA 2WTCA 2XZSA 2WAJA 2WNTA 5L8KA 3SG9A 4KS8A 5EW9A 5AV3A 1BKXA 2YAAA 4GEOA 1CKJA 3EOCA 4GG7A 4BY9E 1STCE 2LGCA 3V5PA 4DFBA 2OFVA 5IA0A 1REKA 1ZARA 4YZ9A 1BI7A 2VNWA 3EQCA 3MPMA 3NVKI 5E8WA 5EKOA 5H3QA 3EIDA 4J1RA 4AXAA 3V5QA 4E1ZA 4YU2A 5JT2A 2QNJA 4OTPA 5F94A 4FVQA 5BMMA 5CNNA 4EQMA 4ANBA 1V0BA 3RM6A 2W1HA 4UALA 2HCKA 1MRVA 4FV6A 5E92A 2X6DA 3L1SA 3FZ1A 3Q5IA 3FAAA 2J90A 1XH7A 3EFKA 3R2BA 4HNFA 1U59A 3NYVA 1XBCA 2Q83A 2NPQA 1AGWA 2FVDA 1OBDA 3FY0A 1YVJA 3DDQA 3DKOA 4D9UA 3PRIA 2GDOA 3F2NA 4QP6A 3AGLA 4ZTRA 4IJPA 4IMYA 5EI8A 2X9EA 2UW7A 3MGYA 3GUBA 2R9SA 4PWNA 4RJ5A 4NM3A 2J50A 4F9YA 4CFNA 3WIGA 1Q8TA 4XP2A 4HVIA 2GNLA 3IDPA 1HCLA 3RHXA 3SG8A 4ANQA 3R63A 2HENA 3FZOA 4X2NA 5EOBA 2BVAA 2W0JA 1Q97A 4NM7A 3TM0A 4FSNA 3ORXA 1OL1A 4G6OA 3DKGA 3HRBA 1VYWA 3AD5A 2OBJA 3U4UA 4FV8A 4MK0A 5LMKA 2IN6A 1WBVA 2ZYBA 4HYUA 1H00A 1LEZA 2Y7JA 4L00A 3T8OA 2BAKA 4XG6A 4D2RA 5TOZA 3QLGA 1O6KA 4RJ8A 2HZ0A 3THBA 4QP2A 5AUWA 3VBTA 3ATTA 3FLZA 4N4SA 3TTIA 3AGMA 3D15A 3L9LA 4J96A 5C9CA 4F0FA 4QP8A 3GB2A 4O2PA 5F1ZA 4E73A 5HLWA 4WO5A 3P0MA 4AWIA 4IZYA 2ZM4A 3FUPA 3LHJA 3OY1A 3L8PA 3SOAA 2WMBA 5HE1A 5CF6A 5KBQA 5CF4A 4FVPA 4Y5QA 2HZ4A 1GJOA 1GZOA 2WEIA 2RG6A 4DCAA 5AP2A 4FIIA 2J51A 3U8WA 3U9NA 5CXHA 4H36A 3KEXA 2P2HA 1GZKA 3ETAA 3KRLA 2G15A 3LFFA 3MA6A 3EKNA 3QZGA 4P90A 4QTDA 1SYKA 3R9OA 3UO4A 2XK9A 3W33A 4J99A 4X3FA 5AADA 4PP9A 1T45A 4CQEA 4BGGA 4RIWB 4YHJA 3D2IA 3NR9A 4KUJA 3DK3A 4HYIA 5FXQA 4FUXA 2W1CA 4JG6A 2OU7A 5IMEA 3SDJA 2XNGA 3VUHA 4YO6A 3WZJA 3CQEA 3ORLA 3LXNA 3JXWA 2HY81 3IOPA 4O6EA 2X1NA 5DGZA 3ID6C 4FI1A 3GFEA 4II5A 1BX6A 3FMJA 5E8SA 3LM5A 5IMXA 3KF4A 4G17A 1FGKA 4E6CA 4RFZA 3M1SA 4TNDA 4O7RA 3CTQA 4O0VA 3R8LA 3WF9A 2VWBA 4IWOA 2YDIA 3UIXA 2BTRA 3QRKA 4KIKB 2VTLA 3HGKA 4QPSA 4AAAA 2ETMA 2PVNA 4CFWA 3RPYA 4UZHA 4UMRA 4FTQA 2Z7QA 5H8GA 4R77A 4PPBA 3RM7A 5EYCA 4OGRA 1WVXA 4HVSA 2XK7A 3E88A 4DH7A 4YO4A 3UQFA 2OGVA 3PFQA 4IAZA 4W8EA 4I1ZA 1UU3A 2YLEA 1SNXA 2B9FA 4ACCA 5ANDA 2W1GA 3RHKA 3TUDA 1SVHA 5T68A 3EQRA 2EU9A 4EOJA 5HX6A 4DTAA 4JOAA 4CKIA 4OUCA 4HYHA 4LUDA 3IONA 4CRLA 4EWQA 5M57A 2HW7A 5FP5A 4GK3A 4GUEA 5A4LA 2C6IA 3UO5A 4XLIA 4JG7A 2VWUA 3NEWA 2XKEA 3EN5A 3R7VA 3SRVA 5JGDA 4FZAB 3QCQA 2WQEA 5EYDA 1CMKE 4ZJVA 4Y72A 3MPAA 1ZRZA 3O96A 1V0OA 4JXFA 5ICPA 1SMHA 2R2PA 4E3CA 3A7JA 3F9NA 4U5JA 2XYUA 3ZO3A 2VX3A 2HELA 3DY7A 5J5TA 4CVAA 1RW8A 3C1XA 3PJ1A 3Q2MA 1ERKA 4DBNA 4XOZA 3LW0A 4N6YA 3W2PA 2B53A 3ORMA 5I4NA 5AP3A 2IW8A 4LMNA 3QTRA 4FTMA 4G3EA 4IJ9A 1H1QA 4RJ4A 3HMMA 2HAKA 2UZBA 5M44A 4OTQA 2X9FA 2UW8A 2OJIA 4DT9A 4EK8A 4Q9ZA 4DH8A 4O84A 4O82A 3K5UA 4I4FA 3V3VA 3ENHA 4FODA 2WO6A 4I6QA 4O0RA 3KK8A 3PDTA 1YOJA 5IG1A 2CLXA 3DDPA 2YIRA 4JIKA 4W9XA 4AT4A 3LFQA 4H1MA 3A8XA 4C4IA 3C4CA 2QLUA 3MJ2A 5AAFA 5AA9A 3H0ZA 3QYZA 1XJDA 4FTUA 4LUEA 3PVGA 4O21A 3UTOA 4HVGA 4O7NA 4ANOA 5I9UA 1ZOHA 4WSYA 1MUOA 3KVWA 3TEIA 1L8TA 3F5XA 2VGPA 4L9IA 4E4LA 5TE0A 4O7VA 2GNIA 3I79A 4G5PA 3PVBA 2J0KA 2WGJA 2IVSA 4HGEA 3A2CA 3EZVA 3P23A 5FQDC 4C7TA 4G9RA 3VRYA 3NYNA 3KREA 4C58A 2O65A 2VZ6A 4OTDA 4C62A 1K2PA 4KWPA 3MJ1A 4ZXTA 4CRSA 1W8CA 4DGGA 4F7SA 3FXWA 5AUUA 4ZS4A 3EKKA 4AFJA 4U81A 1OL2A 3F3ZA 4O86A 4O7WA 4QMMA 4UWBA 4XEYA 3ZSIA 5F95A 4P5QA 1QPCA 2WMUA 3IDBA 3KK9A 1E9HA 2V7AA 1L3RE 3I81A 4Y8DA 2YN8A 5LQFA 1OB3A 5CVGA 4WNPA 3R7UA 3KA0A 3DLSA 4YZNA 3B2WA 5JZNA 1ZMWA 3B8RA 4RJ6A 4IAFA 4AE9A 2BHHA 5A6NA 3Q04A 3R01A 4APCA 5ANJA 5ANOA 3QCXA 4BDGA 3FKOA 5IDNA 4CMOA 1OUKA 3OD6X 4BDEA 4B0GA 2QKRA 3NX8A 5DR9A 4I92A 3COHA 4I21A 2WKMA 3POOA 1B39A 3LVPA 2PE0A 3ZONA 4IM2A 4EL9A 3CCNA 3F3VA 1UKHA 3K3JA 4UV0A 5KX8A 3HP5A 1B38A 4C4EA 4QT1A 2DWBA 3ODZX 5JQ5A 4MBLA 1YXTA 4GJ2A 3IO7A 3NW7A 4G6LA 2PU8A 4XNEA 3DNDA 3SAYA 3L9PA 3MSSA 3PXFA 3ZZWA 4KD1A 3IS5A 5IQFA 3R6XA 3PPZA 4ZJJA 4BCPA 1H08A 3QD4A 1DI8A 4TZRA 3GOKA 2F9GA 3DXPA 4RIYB 2IW9A 1YKRA 4NM5A 4YJUA 2V55A 3UC4A 4PRJA 4MF1A 2A27A 4QNAA 3COKA 4TYEA 4B7TA 4BDAA 1KE8A 4WSQA 2GS6A 2JEDA 3BU3A 5HX8A 5J5SA 2EXMA 2OZAA 3BU5A 3KY2A 3Q4UA 4B4LA 4C3RA 1OL7A 5LJJA 3GBZA 5CAPA 4NIFB 3VUDA 3GU6A 1H8FA 2GTNA 3FJQE 2FGIA 3BYOA 4D9TA 5HLNA 1O9UA 5BX0A 3DQWA 2PYWA 4HCUA 1JSUA 2UVZA 5AR2A 4QMYA 1FVRA 4AU8A 2VRXA 4M67A 5B2LA 4IDTA 5CVHA 3IPHA 3DA6A 3RPOA 3TWJA 3ZO4A 5ACKA 1JLUE 4MBIA 4EHEA 3II5A 4J71A 3TV6A 4F7JA 4F6UA 1OKZA 2YIQA 2WMTA 2CNQA 3R7GA 3Q60A 3KMUA 5CEIA 2ERKA 3QX4A 4LRMA 4S30A 5D7AA 3SOCA 4ZZOA 2GTMA 3RTPA 4C33A 3OP5A 4L7SA 3QTUA 1UA2A 4FYOA 5FTGA 1G8SA 5J87A 4DTBA 4IB1A 1Z5MA 1ATPE 1XH8A 4C0TA 4EZ3A 1WAKA 3VUKA 3GC7A 4GKHA 3IGGA 3HLLA 3COMA 4NCTC 3PLSA 3P5KA 4PMTA 3GGFA 4M13A 4PQNA 4RLLA 4U97A 4XP0A 2GNJA 5AR8A 4FV4A 2ZV7A 2QG7A 3LXLA 2VX1A 4H3QA 5IA1A 4ID7A 4PY1A 3PVUA 5DNRA 3DZQA 1KE5A 4FT5A 4PV0A 3FPQA 4ONAA 4UXQA 1J7IA 5JH6A 2B1PA 2XK6A 3ANQA 3QQGA 5FM2A 3FL4A 4FZ7A 3R22A 4K18A 2YACA 3GEQA 4C61A 4RBLA 5AAEA 4U44A 2WFYA 5JN2A 3DBQA 3PY3A 3PXKA 3RP9A 5KO1A 4DF3A 4A7CA 3RCJA 4EOQA 3F5UA 3ZOSA 3OXTA 4WNMA 5EI6A 1OKVA 3W2OA 5I5ZA 3UZTA 3C50A 3QL8A 2Z60A 2XNMA 1Q5KA 3I7BA 4UZDA 2QU5A 4IWQA 2P0CA 2KULA 1XH5A 4Z16A 4AA5A 2V5QA 5A4TA 2Q0NA 4Q2AA 4EHZA 2RFDA 2UW9A 5AP5A 4YTHA 3BYMA 3NW5A 4AGWA 3W55A 4GK4A 4QQCA 4JIAA 2IZSA 3OOMA 4ZY6A 3DQXA 1Q99A 1WFCA 4FKSA 1J1CA 3MS9A 4JLCA 4FV0A 1OL6A 5EM8A 3A7IA 4J8NA 3LJ1A 4EK4A 4QO9A 3CQUA 4B99A 5I9ZA 2HIWA 4H3PA 2CSNA 3FDNA 2QQ7A 3HEGA 4EI4A 2UZNA 2WIHA 4CYJA 5JGBA 2ITYA 4MF0A 3HMIA 2F7EE 4RFYA 4O7ZA 1LP4A 2ZV2A 4BCGA 4NK9A 4YTCA 3O51A 1YQJA 2Y0AA 4I23A 1TVOA 1XO2B 3FI4A 2I6LA 3C0HA 5KZ0A 4FIGA 4O1OA 2VO7A 3SC1A 5JKGA 3D94A 3F88A 4IAYA 4EC9A 2YCRA 4IX5A 2I0HA 2FUMA 2OJJA 3BX5A 3NUUA 5AP0A 3RKBA 2HWPA 3EL7A 3GU4A 3PY1A 4FV3A 4DEIA 2W9FB 5FGKA 5BPYA 5BUIA 3FKLA 4QMSA 3U54A 4O7YA 3RJCA 4X3FB 4QP1A 1LR4A 1BLXA 3KULB 4I0RA 3BBTB 4NTTA 3V5JA 2FSOX 4A4LA 4AT3A 1PMVA 2YM5A 4K0YA 4PP7A 4C35A 2CPKE 3TT0A 2QHMA 3FLYA 2C5NA 3FZSA 5IU2A 4U3YA 3OXIA 3CR0A 3HV4A 4W4WA 3QTQA 1OPLA 1LEWA 3NNUA 4F9BA 3FYKX 4AW2A 5EFQA 3PG1A 5L4QA 3DJ5A 1XH6A 3GFWA 4RIXB 4AFEA 4JAJA 5HTCA 1GOLA 3LXPA 4UMTA 3KN6A 4XRLA 5ETIA 2PVKA 2QC6A 4FBXA 4R5SA 2X7GA 4I94A 2QD9A 2XIXA 5G6VA 3G0EA 4L46A 2C6KA 4DHFA 4G16A 4E4NA 4E5AX 1YI4A 4HW7A 3C5UA 4BIDA 1Q8YA 3PRFA 4DGMA 3TZ7A 2WEVA 5CU2A 4QYEA 4XHKB 3LMHA 1TQMA 3ZLYA 3CD8A 1NVQA 4BWXA 3KVXA 2YISA 3RPSA 4I5HA 2YCFA 3G90X 4JBQA 4H58A 5DLSA 5AUZA 4RC4A 3WZKA 1WBSA 1WBOA 1QPEA 4YC3A
chains in the Genus database with same CATH superfamily
4I5PA 2VU3A 4PUZA 3RAHA 3LLTA 3MFSA 4IB3A 4JX3A 1R0EA 2HXQA 4HGTA 2C6LA 4HGLA 3D7ZA 4FIJA 3TKHA 5GJFA 5GZ9A 3PUPA 4L44A 1OITA 4AZEA 3Q32A 3GCPA 4C57A 3UDTA 4HOKA 4HPUE 3WYXA 2R0UA 1IA9A 1ST4A 5KMMA 3FMNA 5C01A 3VF9A 2UZUE 1JKSA 4L43A 3HV5A 3GENA 4E8AA 3V5LA 4I24A 4D5KA 2R64A 5C03A 4Z7GA 3SRVB 3HAMA 1YDSE 3ROCA 4YZDA 4IWPA 4CCBA 4WOVA 2XCHA 3KRJA 2EB2A 3PJ2A 4IIRA 4R1YA 2XKCA 5EI2A 3MWUA 4FT3A 3P1AA 2WPAA 2R0IA 4O83A 5FWKK 2XIRA 4CD0A 5CAOA 4CT1A 5K4JA 4ZOGA 2J0IA 3EL8A 4BTFA 3F2RA 3DFCB 5B7VA 5CI6A 1YHSA 4YJOA 5EW8A 4EK6A 3VBVA 2YAKA 5HIBA 4BCQA 1M7NA 4OT5A 3T3UA 3H9OA 3G33A 5DT4A 2YZAA 4CKRA 4TW9A 3VS1A 1J1BA 3OCTA 4FEWA 3WILA 3OWKA 2OXXA 2Z7LA 3ROYA 2WQOA 4M7IA 4BR3A 4HGSA 5HO6A 3IW7A 4ZSAA 2YIYA 1WVYA 4NU1A 3LFDA 4S32A 2BKZA 4X2GA 1H28A 4IXPA 5AUYA 2F4JA 3AC2A 3C0IA 1BMKA 2X0GA 3QRIA 4C59A 2QOCA 1YI6A 4DDGA 3UP7A 3ODYX 1QPJA 4XRJA 3ALNA 2PULA 2C3IB 2ITWA 3DXQA 4NFNA 3HV3A 5CEKA 2PVLA 4CFUA 5AR4A 4B6LA 4JG8A 4EH7A 4F0IA 3LFNA 4FTIA 4FV2A 4K33A 3FSFA 2A19B 3FY2A 4MEDA 3KIOC 4USDA 1PY5A 5T6KA 3OUNB 4YLLA 4C4HA 4CFVA 4AZSA 4CG8A 5B2KA 4QTBA 3W1FA 4WG5A 4FKJA 1QPDA 4E5WA 2A98A 1M2PA 4LG4A 4XS2A 5IKWA 3WZDA 5LMBA 3U55A 2JDSA 3NVMB 3NUAA 3VS7A 1W7HA 3W0PA 3FC1X 3QFVA 3Q5ZA 3N4VA 4E6QA 4QRCA 2A1AB 3HA6A 5IDPA 1ZMUA 4RIOA 4RVLA 4FNWA 2VTAA 4M0ZA 2XYNA 2IZRA 3KB7A 4FRFA 4DG0E 4RVTA 5D12A 3FXZA 3P5JC 5AV2A 4FSWA 4X2KA 5DVRA 3LQ8A 5HOAA 4N0SA 4A06A 3JS2A 5TO8A 2FSMX 3W0MA 4O7TA 4U42A 1FPUA 3ERKA 3D5UA 2O63A 3S00A 2QO2A 3MB6A 3R9RA 2CKEA 3PIYA 4RX8A 5CQWA 1TKIA 3AMBA 3GP0A 4F1TA 2WMQA 3QRJA 1ZWSA 2CJMA 3PTGA 3QQJA 4G3FA 4I22A 3FMHA 2OZOA 3Q9XA 3KCKA 4ITJA 4PMSA 3UQGA 4R7BA 3HDNA 2QOLA 3R04A 3IGOA 3ALOA 3I7CA 4NJDA 4D2WA 4UN0C 4YNEA 1IG1A 1UNLA 4EH5A 4ZP5A 5DMZA 4WKQA 4ASDA 2HYYA 2XNNA 3NNWA 5I9VA 3O71A 2XJ1A 4O4CA 1W2FA 1E1XA 1YHWA 3D5WA 4RMZA 1F3MC 4MD8E 3PPJA 4XX9A 3FSKA 4YHFA 3TG1A 1WBPA 2F2UA 5CAQA 3QHRA 4TYHA 4Z3VA 4GT4A 3SGCA 2R3LA 3GCSA 2C6DA 4KKGA 2WELA 4EOSA 1WBNA 3UE4A 2X8EA 4U79A 2B0QA 4ASEA 5AV4A 5HE0A 4F9AA 1YW2A 5IQEA 3VN9A 5FEDA 4ZTMA 5BYLA 2QONA 4KKHA 4CMUA 5EM7A 1R78A 4IX6A 3E62A 5HE2A 3HUBA 3MH0A 1V1KA 4TXCA 4R3CA 4BDCA 4GL9A 1Q3WA 3RPVA 4KKEA 1PXOA 2R3RA 3MTLA 4WNOA 4D28A 3BE9A 4U3ZA 4GK2A 4R3RA 5CZHA 3M2WA 5H8EA 5AFVA 2X0OA 3E93A 2QO9A 3H9FA 1XBBA 3UDSA 3OW4A 4XG2A 4U40A 2Y4PA 4GVAA 2YEXA 3OF0A 1H01A 5ACBC 3TIYA 1B6CB 2R5TA 4D1ZA 3F6XA 5D7VA 3RCDA 3FMEA 1OKYA 3ET7A 3VULA 5GZ8A 4F99A 2VNYA 4YC6A 1U5RA 3QCSA 4AN3A 2R3PA 1Z57A 4PDOA 2R3FA 5J8IA 1F0QA 3R9HA 4EH8A 5IQDA 2XEYA 4AQCA 1MQ4A 3K2LA 2HOGA 4FKQA 1ZYJA 5KNJA 5M4FA 5CU3A 1Q8WA 1IR3A 1FGIA 2VWIA 1YRPA 2XRWA 4JS8A 4PDPA 3TNIA 4ARKA 3VHKA 3WIKA 4LOPA 4WIHA 4XV9A 3SV0A 3HMNA 1OPJA 3IECA 3UVRA 1RE8A 2GSFA 3BWFA 3FZRA 5D11A 4PNIA 4X7QA 4D4RA 1ZYDA 2G2FA 5C8KA 3Q4TA 4C4FA 2R3IA 5CASA 5HZNA 3LLAA 3ULIA 2B9HA 3FLQA 3DFAA 4TNBA 5E91A 4IDVA 3BPRA 2UZEA 5K4IA 4MTAA 3K54A 5FBNC 3QD3A 5CTPA 3ORIA 3DJ7A 3DXNA 4KIQA 1Q3DA 3GC0A 4E26A 3S95A 4LV5A 3M11A 5IA2A 3A62A 3UYTA 5EQPA 4FR4A 2PVYA 4O4BB 4DYMA 4QTEA 2ETRA 3I0QA 3I4BA 4A9RA 2WMSA 3BU6A 4NKAA 1CM8A 5EHYA 3HZTA 2W4JA 5G1XA 3KGAA 4V0GA 1ZYCA 2Y8OA 2H34A 4JR3A 4RFMA 4NW5A 2AC3A 3QA0A 3NCGA 4GS6A 3ZFYA 4BN1A 2XA4A 3OS3A 4FSRA 4MBJA 4U0IA 5A4EA 3GNIB 3QRTA 5CENA 3WF5A 3W18A 4ZLOA 5HI2A 4EH3A 3FMMA 2VTOA 2X8DA 4PDSA 3KXHA 2UZVA 4L8MA 3R8UA 4AGDA 4P4CA 3AKKA 2OI4X 4OTIA 3O8UA 4BI2A 1KE6A 2JAMA 4JR7A 3ZS5A 5JFWA 5LVOA 4ASZA 1VEBA 3A4PA 3BV3A 3DK7A 3HMOA 4FOCA 2J5FA 4PX6A 5BVFA 5H8BA 2CGVA 4L3LA 4W9WA 4YZBA 2W5AA 2RIOA 3P7AA 4DGOA 4FV5A 1REJA 2A2AA 4OTRA 3E7VA 4A9SA 4TYIA 2ONLA 4AAYA 2E9UA 3VUGA 3F66A 4YJNA 4YTIA 5D41A 4S33A 5AM6A 4R7IA 2VTTA 4IX3A 4WHZA 5JFXA 4W4VA 4FTCA 3PWDA 3UIMA 4FV1A 4IM3A 1A9UA 2VTQA 1ZAOA 2P33A 3L8XA 3MI9A 4OBOA 4FIHA 4IX4A 2VD5A 3NS9A 4FTLA 4LGDA 5K0KA 3MH2A 4CLJA 3CEKA 4RZWA 4X2FA 2QURA 4YGAA 2QOQA 5CF8A 4L6QA 1UV5A 2WMVA 5F4NA 2PY3A 4FGBA 3UZRA 4AXCA 2W99B 5IQCA 1NY3A 4WG4A 1GIJA 2BIYA 4WD5A 2WU6A 3DT1A 5CU4A 4N57A 4BKZA 3LKMA 4BVUA 5HE3A 4EBVA 2C3JA 2XM9A 3R02A 2I1MA 2A4LA 3MN3A 5A6OA 4MCVA 5ANKA 3F7ZA 3PY0A 5ANGA 3QKKA 4GVJA 4X6RA 2C6TA 4IC8A 2V62A 4GFMA 3UIBA 3ZUUA 2CKOA 3VUMA 3WARA 2GU8A 3IW4A 3BL9A 3H30A 3TI1A 1YDRE 3OHTA 5IUGA 3IW5A 4YUQA 2OF4A 2UV2A 2YWVA 4ZLZA 4FJVA 4RQVA 2BROA 3Q6UA 4NCTA 3TTJA 3TN8A 5HORA 1PXJA 2R7IA 5E8VA 5HGIA 2VGOA 4FSMA 4MNEB 2BRMA 5AV0A 5HIEA 2BAQA 4MQ1A 1PMEA 2P4IA 4UBAA 1H0VA 4XUFA 2BAJA 4KINA 3SW4A 5IA3A 1V0PA 4ZAUA 5FEEA 3ACJA 4LOOA 3MY5A 4AZVA 3Q4ZA 2JIUA 3FKNA 3MFUA 2XAMA 1UNGA 5CVFA 5KCVA 3PXQA 2W1IA 5AIKA 3UNKA 4EHGA 2W7XA 5CT0A 1PXNA 3P79A 4JDJA 4MXAA 4QYGA 4YPSA 4BHNA 1I44A 4FKLA 3NUYA 4AZFA 4C3PA 3V01A 5HNGA 3E63A 4EZ5A 3FQEA 4G9CA 2Y4IB 4FEVA 2PE2A 1FVTA 5CEMA 3CE3A 2WMXA 2X2MA 2B54A 2J4ZA 2C6MA 1MP8A 2F7ZE 3E3BX 4G5JA 3H9RA 3MVMA 5K5XA 4PL5A 3SXRA 2XNPA 5M51A 2O0UA 4XV2A 4U7ZA 2AC5A 2PVHA 3KKVA 3MY0A 5JGAA 2XEZA 2ZFYA 2W17A 4AXFA 3AOXA 1URCA 3G2FA 3NZ0A 2NRYA 2CKQA 3CC6A 4L7FA 2YA9A 3PSBA 4NYEA 5JFSA 5E8YA 1PKDA 2XBAA 3JY9A 4FEQA 4NUSA 5TT7A 4Y95A 3RAIA 3TACA 3VO3A 4MVFA 2OKRA 1BYGA 4AX8A 4DT8A 4HZSA 5C8MA 4BL1A 3MIYA 1P4FA 5FDXA 4JDKA 2R3KA 3FQSA 4L45A 2WOTA 3Q96A 1KE7A 1P5EA 1ZYLA 1KV2A 4GV1A 5IUHA 2IG7A 4WUNA 4AOTA 1CSNA 2VTJA 3L8SA 4D2PA 5GZAA 2I0EA 3MFTA 3OZ6A 1UU8A 3BHTA 4F70A 2RL5A 3RNYA 1JKKA 2VTHA 3JR1A 5CF5A 1PW2A 3R28A 3C7QA 3Q4CA 3TUBA 2QKWB 5DH3A 3PJ3A 3D7TA 1ZZLA 2BILB 1HCKA 1NA7A 4U9AA 5CU0A 5IH6A 4QP4A 2WMWA 4O27B 5C1QB 5HU9A 5I9WA 2VTRA 5JRSA 2A0CX 3R1NA 2DQ7X 3ZO2A 2PSQA 4EQCA 4UB7A 3ITZA 3MY1A 3R8MA 1ZZ2A 5DFPA 4MXZA 5EM6A 5B0XA 4DLIA 2PUNA 1H1PA 5FTOA 3MTFA 3GU7A 4NW6A 4PTCA 3BYSA 3L9NA 1Q24A 4JRVA 5M4IA 2YZLA 2HXLA 4FICA 4K9YA 4LOQA 4RWJA 2PMNX 4BDJA 2HWOA 3CY2A 2ZMDA 4O2ZA 3P08A 3PJ8A 3PFYA 4RVMA 4A4XA 3BRBA 2YLFA 1URWA 3JPVA 2XARA 3EZRA 2PWLA 3E8EA 3VS0A 4CNHA 2BRNA 1XMMA 4M69A 1JQHA 2WMRA 5D1JA 4QP3A 2QOBA 3SX9A 2W1FA 4IVCA 4R1VA 3NUXA 3O8TA 3ZLWA 3LOKA 4G3DA 3WZUA 5ETCA 2C5XA 3DNEA 5IPJA 5BQ0A 2Z2WA 3PZHA 4FKPA 4FYNA 3QTWA 4OTWA 5EHOA 4MWHA 4FUYA 3NFFB 3LFEA 3OWPA 3UGCA 2UW6A 4ASXA 3R1SA 3E8NA 4FTAA 4F6SA 4C8BA 2OH4A 3GCVA 3POZA 3E92A 3QD0A 4JBPA 3T9IA 3VHEA 1IRKA 2OLCA 2CDZA 2BZJA 4BBMA 3C4FA 1Q61A 2BHEA 4F0GA 2C6OA 4DINA 3VQUA 3MVHA 1ZOGA 3EQGA 5C27A 2PL0A 4EHVA 5BUEA 3HECA 5EW3A 4C38A 5KMKA 2JDVA 4NL0A 2PMLX 5HKMA 3EN6A 1YXUA 4ANLA 4JNWA 4EH9A 5EQYA 5IA5A 1DAWA 3PE2A 3VUTA 4ORKA 3QKLA 3DGKA 4KIOA 3WF7A 4FIEA 4XP3A 3GU5A 3FLNC 4I6HA 3BEGA 3BV2A 4X6QC 4KBAA 5KMLA 1BUHA 1MQBA 5KMNA 1OIRA 4DN5A 1U46A 3ZM4A 4MXYA 4ACMA 4IANA 4I6LA 2FSTX 3R9NA 4TPTA 4CEGA 2ITOA 4RJ7A 4QMTA 3VUIA 3WE8A 1YOLA 2C1BA 2JFLA 4BTKA 5BUJA 4YNOA 4CV8A 2WTIA 3AC8A 3UDBA 1PMNA 2GNFA 4LV7A 2YCSA 4UEUA 5HCZA 3ELJA 3QQLA 3R8ZA 3NAYA 4QMLA 4ZTHA 4JI9A 2J9MA 5IQIA 4ENYA 3D9VA 4FV9A 3AC1A 4Y46A 4N70A 3A61A 3MBLA 3TJDA 4IVDA 3C4WA 4RC2A 2C0OA 4S34A 3KXMA 3VS3A 4QD6A 4KA3A 2J5EA 1OGUA 2YCQA 4DH5A 5EQEA 3DBFA 4HVHA 1FVVA 2BTSA 2BDJA 3CGOA 1M2RA 1M2QA 5CALA 3UMWA 3ORNA 4JJRA 1JKLA 3BWJA 2O2UA 4BZNA 3LFAA 2JC6A 1DI9A 3LMGA 5IQHA 2BZKB 5KKRB 2GHGA 4IBMA 5HICA 5IQGA 2W05A 2CCHA 3MW1A 4CYIA 5GJGA 4DAWA 2PVFA 2I40A 2KTYA 1W0XC 3BKBA 3VWAA 4C34A 5TR6A 3R1QA 2UW4A 5AIRA 4O4FA 4BBFA 2JDRA 2PZPA 3CQWA 3LCOA 4ZTSA 5FD2A 4P5ZA 4U80A 3ZEWA 1Y91A 3E8CA 5HCXA 4HJOA 4Z7HA 3KMMA 1ZY4A 4AW0A 2CKPA 4DEBA 5AX9A 1PJKA 2E2BA 2OH0E 3GQLA 4QMWA 4WUAA 3FZPA 4FG7A 4FOBA 2G1TA 4DFNA 5LXMA 4CSVA 4FTNA 4XCUA 2ZB1A 1SVEA 4FK6A 5A4QA 3BE2A 3JVRA 4FSYA 4CV9A 4FL2A 3A7FA 3ORPA 3RBWA 3NYOA 3DAKA 3QQFA 3VAPA 3BHUA 3KRRA 5EH0A 1JOWB 4XG7A 1E1VA 4Q5HA 3F69A 5HQ0A 1XH9A 1XR1A 4YR8A 4KS7A 3G6HA 4G1WA 3UG2A 4C2VA 3UMXA 3R7EA 3E3PA 4BDDA 4Y83A 1YWVA 2NP8A 1OIUA 4EZ7A 2C5OA 3W32A 2Z8CA 4V0GB 2GQSA 2PUIA 2CHLA 3WBLA 4ZSEA 3ATSA 5I3RA 2QOIA 3FI2A 4DFYA 2CN5A 4F9CA 2PUPA 1WCCA 5DI1A 3W8QA 4FNYA 4JQ8A 4GYGA 5DRDA 5DG5A 3ZLSA 4L53A 4EK5A 4TT7A 3NDMA 4AUAA 1KUTA 4L67A 4K11A 3UOJA 4IFGA 1Y6BA 3G6GA 2B7AA 3D83A 4ENXA 4YJRA 3DLZA 4P2KA 5AUVA 1K3AA 4O91A 4PTEA 1GZNA 4MUQA 3BIZA 3DBDA 5BYYA 5IEXA 4FSZA 2OXDA 2I7QA 3FI8A 4OAVB 3UC3A 4PPAA 4QYYA 3HAVA 3I5NA 2PVJA 3ACKA 1J3HA 3ZZEA 1NW1A 1QMZA 2C30A 4KRDA 3MYGA 4Y5HA 3KRWA 2ZOQA 5AR3A 2YM7A 3A99A 3IG7A 3LCSA 2GHLA 4U41A 3R7OA 2UVXA 4W8DA 4XG3A 1DS5A 3H4JA 3TDVA 2WTKB 5HTBA 2X4FA 4XG8A 3U87A 2OIQA 5AWMA 3QQUA 5M4CA 1XWSA 4BIBA 3UQCA 1OL5A 4QQ5A 5DE2A 1Q4LA 4DBXA 3EHAA 2VO0A 3BLQA 3QWKA 4RIWA 4M97A 2BFYA 4E20A 5LCKA 3IW8A 2Y9QA 3CKXA 3PIXA 4ACGA 5DIAA 3QXPA 4JX7A 4KB8A 4DH3A 2EB3A 4E93A 2WTDA 4V04A 2OXYA 2WQNA 2X7OA 3FL5A 3VF8A 4EOOA 3OWLA 4I20A 5HVKA 3UYSA 1JSVA 3GQIA 5HNBA 2GFSA 2VTIA 4IAAA 3RVGA 2G2HA 3OY3A 4XMOA 4EKLA 2RSVA 5L6PA 4IAKA 3COIA 5KMJA 3RNIA 4GG5A 3C9WA 4RSSA 3FWQA 4KIKA 1UU9A 4FKIA 3BEAA 3ZRKA 3QWJA 3BLRA 4YLJA 3VJNA 3BBWA 3BHYA 3LIJA 2CCIA 3T3VA 3V8WA 2BRHA 3KL8A 2P3GX 3OCBA 4LMUA 4ZTQA 5BVNA 1P2AA 3TV4A 3EQFA 2C5VA 3CP9A 4ZSGA 5FLFA 4D1SA 4FE2A 1OZ1A 4BZOA 4M12A 3KF7A 2XUUA 4XG9A 2YIWA 2XVDA 1GY3A 2OJFE 2C5YA 2X4ZA 5FTQA 5JRQA 4JDIA 3C51A 4L3JA 5CANA 3HMPA 3FLWA 1PXLA 4I6BA 3AC4A 4FTOA 5M08A 4NWMA 3QALE 3EYHA 4IACA 4IWDA 3BYVA 4J52A 4YP8A 1IASA 3SA0A 5EDQA 4A9UA 4ACHA 4JQEA 2QO7A 4A9YA 2IO6A 1PYEA 4JRNA 4YBJA 1IA8A 5HG8A 1U4DA 4ZEGA 3U6IA 1LPUA 4ZMEA 2XMYA 5DHJA 2LAVA 3OOGA 3VS4A 1PXPA 3KC3A 5DYJA 3U9CA 2GHMA 3GVUA 4JT3A 5E1SA 1A06A 1PF8A 4QYFA 4M68A 4ITHA 5I9YA 3KQ7A 2ZM1A 3LAUA 4K8AA 1GIHA 1VZOA 4O0TA 3QD2B 5CEPA 3LJ0A 4FEUA 2OO8X 3F3TA 5AP6A 4CFXA 5CU6A 4G3GA 5L2IA 5AAGA 3ENMA 5A3XA 4FEXA 4BTJA 4ZSJA 4DC2A 3FHIA 3EWHA 3WE4A 4BDKA 3DPKA 1UVRA 4FKWA 2QODA 2X81A 3EQDA 3QKMA 4DFZE 4OBQA 2ITTA 3H0YA 5BYZA 4AGCA 3PA4A 2JKQA 4LDTA 4TTHB 5AJQA 3RZFA 5E8ZA 4QEBA 3QGYA 3NSZA 1KV1A 2ITNA 3M42A 4O6LA 4RGJA 3QGWA 4Q9SA 4GKIA 3PG3A 3VNTA 4BCMA 1ZLTA 3FPMA 5F9EA 4KSQA 4RT7A 3AT4A 4FZ6A 3ZU7A 2PVMA 3VS2A 4AN9A 3G15A 3GT8A 2CLQA 3EN9A 2FO0A 1XKKA 2IPXA 2UW0A 3Q9ZA 3P9JA 4FK3A 2IWIA 1ZOEA 4YBKA 3LCDA 3LQ5A 2QG5A 3ZYAA 4CG9A 3KU2A 4M69B 2QVSE 3E8DA 4U45A 3S2PA 1FINA 5IQBA 3NMUF 3ZEPA 4ZIMA 1Q8ZA 3PXYA 3R2YA 3GI3A 3MDYA 3OC1A 4AW5A 4BCOA 3NLBA 1FOTA 2H9VA 2X6EA 1CDKA 3UIUA 5LOHA 4DE4A 2ZV8A 1OVEA 4YPDA 2VO3A 3VRZA 4B8LA 1Y8GA 1YWRA 5EDRA 4F1OA 4ALUA 4AN2A 2YM8A 5L2SA 5HLPA 5CAUA 1DAYA 3HNGA 4Z9LA 3VBYA 4HYSA 4HNIA 3GC8A 1YXSA 3LZBA 4DG2E 5J7BA 4F08A 3G9LX 4M3QA 4Z55A 3RAKA 4LRJA 2FSLX 5IUIA 3RK9A 1H26A 4D2SA 3E64A 3MFRA 4CFFA 3PE1A 1HOWA 3OVVA 4OBPA 5EYKA 2REIA 5M55A 4BCIA 5FRIA 3U4WA 1G5SA 2EXCX 4XBUA 2CGXA 2ERZE 4BRXA 2B9JA 2QU6A 2FH9A 4UYNA 2XBJA 5JFVA 2OW3A 2FA2A 4MKCA 4MXOA 4EBWA 3ZBXA 4UWYA 3R1YA 4DLJA 4PL3A 3PUFC 3F7WA 3QZIA 4NEUA 3KFAA 3IW6A 2RGPA 5HHWA 3SVVA 4QPAA 2VX0A 5M56A 5DT3A 3SHEA 5LCJA 2PPQA 3ORTA 2OZAB 2F2CB 2C3LA 1U5QA 2O8YA 2XKDA 2PZYA 4XYFA 4Q5EA 1PKGA 2GQRA 2X8IA 4PF4A 3WOWA 1W82A 5IQAA 4XV3A 2WMAA 5DWRA 3EN4A 4AW1A 4IVBA 3GCQA 3ZC6A 5HG9A 1PXKA 1RQQA 4RA5A 4HCVA 1PMUA 1J7UA 4K2RA 2VWWA 4U8ZA 3MPTA 2IVTA 2GS7A 5HEZA 3N51A 5K9IA 3QTSA 5DEWA 2OIDA 4EYMA 3F5PA 3CXWA 3B8QA 2PZRA 3ANRA 2CGUA 5LWMA 4KABA 3OXZA 4BF2A 4EONA 5BVDA 2GPHA 5E7RA 3HUCA 3FBVA 4MAOA 2XJ0A 3HV7A 4NIFA 4MXCA 5CT7A 3ORZA 1TQIA 1W84A 4W4XA 3RK5A 3SXFA 5J9LA 2R3JA 4R3PA 3Q6WA 1DM2A 3R30A 4M8TA 5GJDA 4IEBA 3DS6A 4JBVA 3R7YA 1KWPA 3QQKA 4NFMA 2YDJA 4UMQA 2OJGA 1GIIA 1O6LA 4JL9A 5AUXA 4O0WA 4ANSA 3TUCA 3FHRA 4NZWB 3R9DA 2OICA 3DK6A 3QBNA 3QCYA 4L3PA 2ESMA 5J7HA 2GQGA 4FSQA 4LI5A 3VBXA 4HCTA 5LVMA 3OROA 3A7HA 2WTJA 4K6ZA 3JYAA 4N6ZA 4RVKA 5H9BA 4C4GA 4E6AA 5JMSA 3D5XA 5J9ZA 3CBLA 2FB8A 4JQ7A 3FZTA 4HPTE 3ZXZA 2IJMA 4AE6A 5FXRA 3PWYA 4KBKA 4CTCA 4NH1A 4DEEA 4FKOA 1F5QA 3CTJA 4O81A 3P4KA 4F78A 5AUTA 4DHIB 3OW3A 5E8XA 5A46A 3KXZA 5L8LA 2AYPA 4R78A 1OKWA 4IAIA 3WF8A 4RRVA 3CJFA 3PSDA 2CNUA 4AT5A 4UYAA 2PUUA 3FI3A 4I0SA 4TRLA 3GOPA 5L3AA 3CSVA 4FZFB 2IZTA 2RFSA 3F3UA 2XCKA 4TKSA 4X3JA 4EOMA 4GJ3A 3O8PA 3W2RA 3FXXA 4LM5A 4XV1A 5EKNA 4ZLYA 3PXZA 3W2QA 4MD9E 3RWQA 3AXWA 4QMVA 1YDTE 1IEPA 2ZMCA 2XNBA 3O7LD 4XOYA 2OG8A 4CMTA 3W0QA 2ZJWA 4FL1A 4BGQA 2UUEA 3S1HA 3ZXTA 3B2TA 4RWIA 3VVHA 1PRYA 2Y4IC 4TY1A 1GZ8A 2BDWA 3AC5A 3REPA 3OBGA 3TNHA 1UNHA 2RFEA 3HV6A 2E9OA 4V01A 5GNKA 4FNZA 3QRUA 5HU3A 4BFMA 2OFUA 5KBRA 2B4SB 1RJBA 3QAME 2WD1A 1UKIA 3IQ7A 4IFCA 5HD7A 4FMQA 3ML1A 4C4JA 3ZDIA 2JDTA 4MWIA 4XBRA 3QTIA 1UWHA 5FP6A 2YERA 4F64A 1MRUA 4YMJA 2X0PA 3ULZA 2BFXA 4BYIA 4DEDA 5BV3A 4BICA 4EEVA 1ZXEA 2BKKA 3OTVA 3EJ1A 3O17A 2PK9A 4FX3A 2BCJA 4EKKA 3L9MA 4CQGA 5EG3A 2EUFB 4BCHA 4E5BA 5BNJA 2YM6A 4DH1A 3WYYA 4BBEA 4DHZA 4DTKA 5I0BA 1XHAA 5CLPA 3VW8A 1YI3A 3MIAA 3UNJA 4EOLA 4G31A 4I3ZA 3TZ8A 3EQBA 1OBGA 3MH1A 4G3CA 1KOBA 3DB6A 3AG9A 4A4OA 2IVUA 2GMXA 2VWYA 4DEAA 4DEHA 2CNVA 3QTZA 4IVAA 4XG4A 3C4EA 3LPBA 2H96A 3QZFA 4FSTA 4AZWA 1OGYA 2VTPA 4FT7A 4O0XA 3MVJA 1M14A 3ZLXA 2QR8A 2W1DA 3BI6A 3W0SA 5JQ8A 3KULA 1PXIA 4L42A 3F82A 1OECA 1AD5A 3VBQA 3NWWA 3N4UA 4K1BA 4RLKA 5CXZA 3FYJX 2V0DA 3ZO1A 5K3YA 4QDEA 1K9AA 4M15A 4I5MA 5A14A 4DGLC 2XH5A 3NW6A 4M14A 4Y85A 4M84A 3MB7A 1IAJA 4IADA 3UVQA 5IEYA 2HY0A 5TF9A 3RZBA 3S0OA 4RIXA 2YJSA 5AR7A 4NTSA 2F7XE 5KHXA 4QYHA 3E87A 4GW8A 2HK5A 1M17A 4YURA 3SQQA 5LWNA 3PVWA 2JGZA 3BHVA 4DDIA 1BL6A 4TYGA 3I1AA 3UBDA 3EFLA 4C36A 1M52A 3LFCA 5IISA 5EK7A 2VAGA 3GCUA 4J53A 3SLSA 1APME 3CJGA 2XIZA 2VUWA 1NVSA 1H1SA 4FF8A 2WIPA 5CSHA 4YHTA 4QMQA 5M53A 2PZIA 3QUDA 4GMYA 5E4HA 4DGNA 3HDMA 4LL0A 2BZHB 1WBWA 3AMYA 2QOOA 3BHHA 3HVCA 4NT4A 3VBWA 4CZYB 3U6HA 5A4CA 2JLDA 5M07A 3S3IA 5ETFA 5B2MA 3QC4A 3V6SA 4D4SA 3LCKA 4EORA 4I6FA 4HZRA 4MXXA 4BDIA 3D14A 2JBOA 3OCGA 3AKJA 3TZMA 3TL8A 4PPCA 1YXXA 3D2KA 4WRSA 5J95A 1Y57A 4BB4A 3ZBFA 5IH4A 4QNYA 5GIOE 4EK3A 4FTTA 4FKGA 1LUFA 2WTWA 4MQ2A 1NXKA 3CKWA 4UXLA