2Z8CA

Phosphorylated insulin receptor tyrosine kinase in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin-2-yl]amino}phenyl)acetic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
300
structure length
297
Chain Sequence
FVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin receptor
publication title Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 297
sequence length 300
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z8cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z8cA01
4IJ9A 1YXTA 4U3YA 5KBQA 5FRIA 2EXEA 2Y4IB 5DGZA 4YSMA 2F7ZE 4F1MA 4YURA 4KD1A 3PY3A 5J1WA 1PXOA 4YUQA 4NK9A 2HXLA 3HV3A 2ITXA 4DA5A 3P4KA 2YCRA 1GY3A 2I0YA 3NW6A 4OTWA 5FTQA 4OTPA 3RMFA 4K18A 3PJ2A 4X3FC 3DBCA 3AMAA 4I5HA 3DLSA 3RPRA 4JT3A 1OPKA 2A1AB 2ETRA 2XK4A 3GP0A 3MWUA 4N6YA 5FQDC 2X0GA 4ASEA 3AG9A 4JG6A 1IRKA 5IQDA 1Y57A 2PE1A 2ZJWA 2ITOA 1FGIA 5CAPA 1YW2A 3DPKA 4YNEA 3V8WA 5DEWA 3HAMA 4NH1A 5AP3A 5IQGA 3FY0A 4QT1A 3EQHA 4LRMA 2P4IA 2JGZA 5TF9A 2GTMA 1ZY5A 3MH0A 5HG8A 4D58A 1XH4A 4TNDA 3PFQA 3BYVA 3PZEA 5IEYA 4F99A 4FSWA 4X2KA 4EOQA 4Z3VA 3FE3A 4UWBA 3K54A 2CGUA 2JAVA 5M08A 2V55A 2O2UA 1WAKA 2C5NA 1XKKA 4UEUA 3NUXA 4TKSA 4EZ7A 3O50A 3UC3A 4H39A 5DOSA 4ACCA 3UQFA 4LI5A 4D2WA 4FSRA 3PLSA 4L3JA 2JDOA 3R83A 1JKKA 3AC4A 5E8WA 2OF4A 4BDIA 4CKJA 5EYDA 2ZB0A 5K0KA 2JD5A 4B8LA 5CANA 4R7HA 4B0GA 3BWJA 4YLKA 3UZTA 3A7FA 4IACA 3DTWA 3BKBA 1H0WA 2QOQA 4IX4A 2QOFA 3R1QA 1SVEA 3HMOA 4RJ6A 3UNKA 2X2MA 2OLCA 2DQ7X 4AP7A 5HTIA 4RIWA 2BALA 4TNBA 3TXOA 2WD1A 1CM8A 4DINA 3H9FA 4BWKA 3DCVA 3QXPA 5FP6A 3ULZA 3BGZA 2PSQA 3L8VA 3Q53A 5IUHA 4O38A 3D9VA 3PTGA 4QTCA 5JT2A 1Q8ZA 5HX6A 4AE9A 4TWNA 4P90A 3QTUA 4JR7A 4YC8A 3E5AA 5HNIX 4RMZA 3KULA 3OFMA 4QTAA 2ERZE 4Y73A 5E8UA 4HVSA 2JFMA 3TIZA 4RWKA 2WQMA 4O0VA 5EDPA 4I0SA 4JIAA 4C34A 3KK8A 5DR2A 1OL6A 3VBQA 2QCSA 4DLIA 2CGVA 4L7FA 4AF3A 3OP5A 4AZWA 3Q2MA 5FBNC 5JGAA 4V05A 2VGOA 3MN3A 4TYHB 1Q4LA 3FMJA 5G6VA 5BYLA 4F9AA 1YVJA 3S2PA 5KHXA 2JC6A 5IA4A 3OWKA 5HE3A 3DBEA 4LL5A 5C03A 4BWXA 4FIGA 4RX5A 2XYUA 4IBMA 1KSWA 3N51A 4KS8A 3TZ9A 5I9WA 2WIHA 4DITA 2YABA 1I44A 5D1JA 2SRCA 2W06A 2YM8A 3KF7A 3KRXA 3QA8A 4KIKA 3G6GA 4D4YA 4ACGA 4FTCA 2VX0A 4HYUA 1GZOA 3CBLA 3MVMA 2REIA 4XG3A 4CSVA 4YTFA 2YIRA 2J0MB 5CS6A 3BEAA 1UKHA 4I6QA 2OIDA 3TEIA 4FV3A 3R04A 3DXQA 2C5OA 2E9NA 3OCSA 4HPTE 4QNAA 3R7VA 3VUIA 3RK5A 4TT7A 4U5JA 4CYIA 4F9CA 5DPVA 3SGCA 3R7EA 4FTIA 3NIEA 2X9FA 4C33A 2XK3A 2Y6MA 4CFUA 1W8CA 3RAHA 4WNOA 5K5XA 3EL7A 4F4PA 4C4IA 4YU2A 5J9ZA 2UUEA 4YJVA 4YJRA 3ZZWA 4IIRA 4HZSA 3O8TA 3BQCA 3ORKA 3R7UA 4XHKB 4D4SA 4EI4A 4BDCA 4KIPA 2KTYA 1VR2A 4O2PA 5HLPA 1QPCA 3B8QA 4S34A 5LMAA 3W2OA 4A9TA 1KWPA 4QMNA 5CAUA 3DTCA 4JVGA 2QI8A 3BHHA 2BAQA 1L8TA 1FPUA 4D28A 3O0GA 4RX8A 1O6LA 2AC5A 4YJTA 1Y8GA 5H8EA 1CDKA 4EH3A 4ZJVA 1OB3A 4QMOA 4GSBA 4KSQA 5E7RA 2ONLA 4DH3A 4E6DA 3OBJA 2Z60A 3EH9A 4USEA 3G51A 3GT8A 1H8FA 2OH4A 4DEGA 3DKFA 3UQGA 3CQEA 3F5UA 3QRJA 1PXMA 3BELA 4IB0A 4F64A 4O7RA 2XBAA 5JEBA 3VC4A 1QPDA 1PXNA 5T6KA 3P08A 1LP4A 1FVTA 4LGDA 2BRGA 4Y95A 4DG3E 4EHVA 3FI4A 4I21A 3BHYA 4YJOA 3BHVA 5LVOA 2PUIA 3I5NA 3L9NA 4WSQA 4OTHA 3LCTA 5L2TA 2BTSA 3WBLA 1B38A 3A7JA 4FV9A 3SW7A 3KY2A 2J51A 3HMNA 4O86A 3GQLA 3E64A 4UZDA 4FSNA 4L6QA 2BMCA 1XH7A 4KIQA 3PYYA 4PMPA 4Q9ZA 2I7QA 5A4TA 5EH0A 5EOBA 5KMLA 5C4LA 5AP6A 1STCE 4GK3A 5DFPA 2IVTA 4BCOA 3ACJA 5A14A 3FMNA 3QTRA 4FYNA 4HOKA 4YZMA 1FMOE 2QOHA 5B2LA 2HXQA 3R00A 1U46A 4F9YA 3IS5A 3G9LX 2ZM3A 2FGIA 2X9EA 3OOGA 4M68A 4EK6A 1PKGA 3TUBA 3DAEA 4I6BA 1Q8TA 2IZRA 3NIZA 3QC9A 4HGSA 3SD0A 3ZMMA 4FNXA 3FZRA 3LFSA 4HYHA 3W32A 3L9MA 1JNKA 2LGCA 5DE2A 1XH9A 3S00A 3ZRLA 3DOGA 3UTOA 3BLHA 2VWVA 3UVQA 2ACXA 3QCSA 2YIWA 3C0IA 2W4KA 3FMLA 4L01A 3C4EA 3UIMA 4GH2A 4B9DA 4GJ3A 3PPJA 1O6YA 2WB8A 3COKA 5EYMA 3VRZA 3N4UA 1PHKA 2VWXA 4F7JA 4GUEA 3NMUF 3UMWA 3Q4TA 4UWYA 5AP7A 1J7IA 4X2NA 4UMUA 3FQSA 4J97A 2YCQA 4I93A 3UOJA 4K6ZA 4RGJA 5JN2A 3RNIA 4FTOA 4A9SA 4U44A 1U4DA 4O7LA 5J9YA 4BFMA 2UW8A 2XKDA 4QP8A 1F5QA 3OY3A 2PVJA 3C5UA 2UZWE 2WQOA 3HV5A 3RZBA 3Q60A 3OZ6A 4OTFA 4QO9A 3QTZA 2WPAA 1SNUA 4XS2A 4J96A 5DEYA 5BNJA 4EKLA 4YLLA 3Q9ZA 4ENYA 4C02A 4UMTA 5BMSA 2P33A 3RCDA 3BE2A 3IKAA 5EHLA 3PG1A 4FZAB 5IU2A 2PWLA 3E93A 4FL1A 1LPUA 5HHWA 3O71A 2C68A 4LV5A 5IDPA 5HG7A 3L8PA 4R5YA 4U40A 3R7IA 3HRFA 4MXZA 4APPA 3GU7A 2VTSA 3RAWA 1CKIA 3SXFA 1JKSA 2C6TA 5E1SA 3E7OA 1Q41A 3QBNA 3FI3A 3VF8A 5K0XA 3DDQA 5DRDA 4YZCA 3EZVA 4KINA 4XG9A 1MRUA 4CKRA 4EOPA 4IZ5A 2F9GA 2R3OA 3GCQA 4XMOA 4JRNA 2ZVAA 3O8PA 3NW7A 1A06A 3TNWA 4FKIA 4GJ2A 3UZPA 3TN8A 4RLKA 1NT2A 3RM6A 3W1FA 4E7WA 2JKQA 2BKKA 4EH9A 3I5ZA 2WZJA 4DGNA 2QOBA 5DNRA 4HGLA 1G3NA 2HOGA 4L46A 5CEPA 3FKOA 5HD7A 5EM8A 5EW8A 5M4FA 4OBOA 2GNJA 4ITJA 4RC4A 3JYAA 5E8TA 2QG5A 4FV6A 1ZMUA 1UA2A 4I4FA 4X2FA 2WQBA 4KRDA 3SLSA 4ACDA 3ZSHA 2ZM1A 3MIAA 1ZMWA 4FZ7A 5ETFA 5DYJA 4FODA 5DBXA 4OUCA 4O22A 2OIQA 3ANQA 5A4LA 3MS9A 3FMHA 3SDJA 4O0SA 3LFCA 4DT8A 4J8NA 4ZTLA 3O8UA 3NAXA 4GKHA 3GGFA 4IVCA 5EKOA 5IQHA 5JFVA 4C38A 2I40A 3TUCA 5HVYA 4WO5A 3FXXA 2IG7A 4QMXA 3RCJA 4V04A 1M52A 2JIUA 3QQHA 3R63A 4YZ9A 5GIPE 5EI2A 4QP2A 2BRBA 4GIHA 3VUMA 4QYFA 4X7QA 3F5GA 1E1XA 3KA0A 4J95A 3NSZA 2O65A 2YM5A 3ZLSA 4A06A 3VBTA 5IZFA 5AIKA 4WA9A 2XH5A 4XV2A 3QZFA 3TKUA 3AD5A 4E6AA 4RJ4A 1H01A 3N9XA 4DCEA 5CALA 4EL9A 2DS1A 2ETKA 3GC0A 1Y8YA 1UNHA 5IUIA 3CCNA 5DHJA 3OXIA 1GIJA 3F3UA 3VS3A 4LOPA 2WEIA 4TRLA 2A4LA 1X8BA 4ZLZA 2VX3A 5BVKA 4ZAUA 2IZSA 1UWHA 3FHRA 5IKWA 3T9IA 5JMSA 2UZLA 4YC6A 5CNOA 3HP2A 4BCHA 1WCCA 2VNYA 4TW9A 3R30A 4UZHA 2J90A 2BCJA 4HVGA 3SKCA 4BCKA 3OWPA 2PMIA 2OW3A 3VUKA 4AZSA 3QHRA 4RQKA 5CVGA 4ZTHA 4QPMA 3MTFA 4GMYA 1O6KA 3MH1A 4G1WA 4DGGA 4F7LA 4C37A 3AT3A 3TIYA 3QALE 4RC3A 5IMEA 4R78A 5T68A 4QP7A 5CI6A 2QNJA 4AFEA 3DJ5A 4PP9A 3U6HA 1OGUA 3F3TA 2UW0A 3DZOA 1GZ8A 4ARKA 4E1ZA 4YZBA 5IQEA 4FIIA 1WBTA 3F69A 4U41A 4QTEA 2UW6A 2CKQA 3PP1A 5AR4A 3MY5A 4BDBA 2WAJA 3KVXA 4M8TA 5ICPA 4GVJA 5M55A 3C9WA 4II5A 3KMUA 4XRLA 1G8SA 3JUHA 5M06A 3R01A 4QRCA 4EOKA 1PF8A 4D2VA 5I5ZA 3KXGA 3AXWA 2BRHA 2B9FA 3AD4A 3QCYA 4QMTA 3ZO3A 2XNNA 2OFVA 4KKHA 4L9IA 3FLQA 1ZARA 5J95A 1YRPA 4F6SA 2ZDTA 2R7BA 4YTIA 3T8OA 3EFJA 3RPYA 5KMKA 3NR9A 1IAHA 3T3VA 3FSFA 1YOMA 1IA8A 5BVDA 2Q0BA 4JOAA 3VHEA 4GUBA 4GS6A 5BUIA 3E3BX 4IFCA 3BPRA 4L43A 2G1TA 5ETAA 5LMBA 4EQUA 3BU5A 4ZJIA 3UYTA 2XK6A 4S33A 1H25A 3M11A 3NCGA 3P79A 2XMYA 4WUAA 3MVHA 3QD3A 3COHA 4CV8A 4JQ8A 2WFYA 4G3CA 2R4BA 1GJOA 4EHEA 4O7SA 5IH4A 1CTPE 4PY1A 2NNWB 5A6OA 4H58A 4FICA 4RC2A 3L8SA 4Z7GA 4FKGA 4ZS4A 5A4CA 5CENA 2YEXA 3E7VA 3GQIA 1M2PA 4IX5A 2YACA 3U6IA 2QD9A 4TYGA 4RBLA 3L8XA 4G9CA 5AV0A 4FGBA 2W9ZB 2UZVA 3T9TA 4W9XA 3VBWA 1GAGA 2WMAA 1URCA 4FUYA 1YHVA 4L3LA 5AP2A 3P9JA 3R9HA 2WGJA 3ZS5A 4DN5A 1PXPA 2FO0A 4FOBA 4GG5A 4O7YA 5BVWA 4JJRA 3LXKA 4KS7A 5KUPA 1XH6A 3QRTA 4FKQA 2ITUA 3LVPA 2ITPA 4QTDA 1YDRE 3NZ0A 3QLGA 4FKOA 4XP0A 5EM6A 4QP6A 3TKIA 4BDHA 1PXIA 3ZFMA 3V5QA 5ANGA 3TKHA 4I5CA 1Q62A 2EB2A 4MQ2A 4OGRA 4BICA 2R5TA 4J52A 4B99A 2IW9A 3ZO4A 1OIUA 4E6QA 3FZSA 4GK4A 2HIWA 1GZNA 3BHTA 2CJMA 4JDHA 2C5YA 3OBGA 5J8IA 4BCJA 3Q4CA 3R02A 4IWQA 5GZ9A 3KCFA 4EUUA 1T46A 5AADA 5L3AA 4KNBA 4U42A 4Y46A 1OL5A 3FZ1A 3NX8A 2E9OA 3VS2A 4F9BA 1JSUA 2I0VA 3MFTA 4PPBA 4XYFA 3OT3A 3S1HA 5EYKA 2VWYA 1Y6AA 1UU3A 3ZYAA 3RPVA 3V5JA 4AN2A 4LM5A 4OBQA 4YPSA 4A9UA 5HD4A 5ACKA 4R7IA 4JX7A 2UV2A 3PE1A 2Z7RA 4QMUA 5E8SA 1YI3A 4IAZA 4RVKA 5AX9A 3OUKA 5GINE 4D2TA 4AOJA 4R5SA 2ZDUA 2VO6A 4BBEA 2YCFA 4NUSA 2OXYA 3I6UA 5HICA 4D9TA 5L2SA 5LVMA 3LLAA 4JL9A 2F2UA 2J2IB 2B53A 2R3NA 2XNMA 3QA0A 3ZONA 3BX5A 2Z2WA 4E5WA 1YKRA 5E4HA 3C50A 3QKLA 2RIOA 3CQWA 5A3XA 3V6RA 2XNPA 4G3FA 4ITIA 4Y83A 5KZIA 1H27A 4ZSAA 4FNWA 3NLBA 2VD5A 5E9EA 2CLQA 2R3IA 2J5FA 1TKIA 2RGPA 2X6DA 2AC3A 4ASZA 2C1BA 4BTKA 1P4FA 3RGFA 2WNTA 4EJNA 2WQNA 4QMYA 1ND4A 3ZO1A 2GNFA 1UU7A 3P23A 4EJ7A 2QKRA 3ZFYA 5F9EA 2O5KA 3KXMA 5CYIA 2QOIA 2CKPA 4LMUA 4FF8A 4AS0A 4EWHA 1Z57A 2XNGA 4N0SA 2JDVA 4AUAA 3QX2A 3SC1A 3DKGA 3V6SA 5KKRC 3PPZA 2YM7A 5CASA 3E8EA 5L8KA 5IQFA 1J7LA 1AGWA 3MA3A 1PXKA 4PNIA 3EL8A 4EOJA 5DI1A 5BVNA 3ZRMA 1P14A 3ORXA 4Y5QA 2YLEA 3EQDA 3R21A 3FYJX 4Y85A 5CEIA 4IB5A 3U6JA 3DY7A 5GJGA 2WTKC 4AA0A 2X7OA 3EQIA 4IC8A 5TR6A 2XBJA 4BWPA 5LJJA 3W10A 3LFBA 3QQFA 4HCTA 1H1RA 4Z16A 3QZGA 4C2WA 4X21A 4BN1A 5LVNA 4PX6A 2CCIA 2G9XA 5EI6A 5L6WL 4R3RA 4OTRA 4Q5HA 1NVSA 3TNHA 3VAPA 1R39A 3EHAA 4A9RA 4D4RA 3TZMA 2I0HA 3QQUA 4MNEA 3KK9A 3F82A 4I41A 3U9NA 3NNVA 4DH7A 3H4JA 4EH7A 3IW8A 3P0MA 4G2FA 4MXOA 4ZEGA 2OJIA 1W82A 5GNKA 2PVMA 2QOLA 3EFLA 4TXCA 5L2IA 4UN0C 3EFKA 3MTLA 3D0EA 4IFGA 3CQUA 3JS2A 4S32A 5CEMA 3NNWA 2W5BA 2W17A 2W1ZA 3PXZA 4M12A 4BGQA 3OOMA 3QYWA 2HELA 4YC3A 1W98A 2IPXA 4ZXTA 1HCKA 1Q3DA 4XOZA 5LARA 3VQUA 3OTUA 4M84A 4RJ5A 5K4JA 2YERA 3SX9A 1WBSA 2F7EE 4YSJA 1YXVA 3VS6A 4BKJA 3P5KA 5H3QA 3ZXZA 3IDPA 1YWRA 4MX9A 4XG8A 5HVJA 4EQCA 3LFDA 4JBVA 1SM2A 2R64A 4I22A 1WZYA 4RA4A 4U9AA 2RG5A 1YHSA 4ZSEA 3WF5A 3CPCA 3ZZEA 3EB0A 3QRIA 5CX9A 3KGAA 2W0JA 3OF0A 4C62A 1H0VA 4DGMA 2VRXA 3LM0A 2OIBA 5A4QA 5C4KA 1KV1A 3RM7A 4B8MA 3OTVA 3GENA 2JITA 4BYIA 2XVDA 4TWOA 4L00A 4PPAA 4P4CA 2X4ZA 2C47A 4AACA 3CY2A 3HAVA 1W7HA 4PNKA 4MD8E 2QO7A 3PVBA 1H1SA 3H9OA 4WNKA 2BTRA 3RI1A 1YHWA 3OT8A 4U81A 2JAMA 4FT3A 3UO4A 1U5QA 1RJBA 3NRMA 2AYPA 2Y6OA 1OIYA 4YBJA 5CY3A 3WZKA 4OAUC 3E88A 3BHUA 2ITTA 3ODZX 5L4QA 3SW4A 3U4WA 2VTLA 3KFAA 3SXSA 3D15A 5C8NA 4F63A 3MYGA 3R8ZA 3AC1A 2B55A 2JKOA 5EG3A 1ERKA 5KNJA 2OZAA 3AMBA 4JAJA 4GKIA 4AW0A 3CD8A 4FT5A 1XBAA 2X81A 4IAFA 2IVVA 3F3ZA 5HE2A 4ALVA 3G33A 4EWQA 5LWNA 2OZAB 1WVWA 3GCSA 4D1SA 1KE7A 2UW7A 5AP0A 4RFZA 3RVGA 4CCBA 2P55A 3VULA 3HEGA 5ANOA 4QMVA 1YI6A 4NJ3A 3ZRKA 4A9YA 4M13A 5BYYA 1M17A 1UWJA 3QCQA 1AD5A 2FSTX 2P3GX 2VO7A 1L3RE 2XCKA 3V3VA 4OTGA 3NVKI 3HUBA 5JFWA 5ANDA 4CLIA 1ZOGA 5HG9A 3ZC6A 2J9MA 3KN5A 3QTWA 3BEGA 3RTPA 2J6MA 3R6XA 4RLLA 4EK3A 4UBAA 3MPTA 4GCJA 1ZYJA 3R9OA 2GFCA 3DFCB 4WG4A 1FMKA 3ENHA 5AUTA 5HCXA 4EHGA 3UP2A 5LVLA 1W83A 2H8HA 3LFEA 3SRVB 4ZMFA 3KMWA 5CTPA 3PDTA 2XNBA 2CNQA 4IDTA 1K9AA 3F7ZA 2IZTA 4EUTA 3D2KA 1FOTA 3TG1A 2J0IA 3FYKX 3LAUA 4ZTSA 5DMZA 3WF9A 3ELJA 2UZEA 3EFWA 3DA6A 2WXVA 3DS6A 4GFOA 2XJ2A 5IF1A 1XHAA 3HZTA 2GS2A 4G5JA 5I9ZA 1OL1A 3HV6A 4I4EA 5FXSA 3V5WA 3EN6A 3QUDA 3LFFA 4DEAA 4AZFA 3A99A 4BKYA 4MF1A 1PXJA 4IZ7A 2QU6A 4MHAA 5EM7A 3CKXA 4OT5A 4GYIA 5GJDA 2QVSE 3VS0A 2YZLA 1M14A 3OCBA 3QTSA 3KF4A 1R0EA 2R3KA 2LAVA 4O27B 2YWPA 4O0XA 4D5HA 5KKRB 4R7BA 2YAKA 1WMKA 3QLFA 4HCVA 2EWAA 2NRUA 3RP9A 3BU3A 2QQ7A 3COMA 4FBXA 3VWAA 3UO5A 2FSLX 2WMXA 1YWNA 3LQ5A 4FKRA 4DG0E 3IO7A 2HW7A 2X8DA 3RINA 3FI8A 1UU9A 4YMJA 3LXNA 4FK3A 5ANKA 4GU9A 3TV4A 5M07A 3CPBA 1OL2A 4BCIA 4TYHA 4CXAA 3KEXA 3MGYA 2W5AA 2DWBA 1DI8A 5CSXA 5GHVA 4CFWA 4U45A 4KAOA 1KE6A 4FMQA 2QODA 4FT7A 1SNXA 3BI6A 1Z9XA 5M4IA 3NWWA 4TY1A 2I0EA 2B9HA 3W2SA 5K3YA 2JLDA 3Q6UA 3RK7A 5LMKA 3KRLA 4U97A 5M4UA 1H24A 1H1WA 2XEYA 4HGEA 4FOCA 2VO3A 4U0IA 4IMYA 4MVFA 1H1QA 5HI2A 1BYGA 4AGWA 4YPDA 1B6CB 2YDJA 2RFNA 3MBLA 4O21A 1OPJA 4V0GB 3OMVA 4JR3A 4AT3A 5TE0A 2YDIA 2C4GA 1PKDA 3LM5A 5FEEA 3JY9A 2F7XE 3CP9A 4JBQA 4O6LA 5TOZA 3ZM4A 5AFVA 5E8YA 4ZTQA 2WKMA 5AV2A 2Y0AA 4YO6A 3FKNA 4CFMA 5EHYA 4BCFA 1P4OA 3UIXA 5KMMA 3QCXA 2RSVA 4GK2A 4IM2A 3GBZA 4BCMA 1REJA 3Q4UA 1M7NA 5L6PA 3NYNA 2X8EA 4Y8DA 2EUFB 2J4ZA 2OG8A 2R3PA 4DE4A 4D5KA 3HX4A 4F65A 1ZAOA 2NO3A 2XIZA 3I4BA 3C13A 3PXYA 3MFSA 4GRBA 4HNIA 4LGGA 2RFSA 2YLFA 4GFMA 5FM2A 5KZ0A 4D2SA 3BBTB 4QNYA 3OCGA 3FLZA 3UYSA 5DWRA 3ID6C 3OXZA 4U3ZA 1EH4A 4RG0A 4EK4A 3FSKA 4CV9A 2HAKA 4D1XA 3HECA 5GZAA 3FAAA 4NL0A 4C35A 3E3PA 3FZPA 3M2WA 4C3RA 1ZOEA 2W96B 4FV1A 4L42A 3TJCA 3AGLA 3Q5IA 4AW1A 3N4TA 3HA6A 5AR8A 3HP5A 4IEBA 2W1DA 5H8BA 4E4LA 5BQ0A 1J3HA 2ESMA 2J7TA 2PMOX 3LQ3A 2BILB 2BR1A 5FXRA 2RFDA 5DN3A 2V22A 1A48A 3LMHA 4WRSA 3NUNA 2CN5A 3PRIA 2XB7A 3C7QA 4DFLA 4KUJA 2A27A 4ZSGA 3O51A 1F0QA 3GB2A 4EC9A 2R0IA 2PVRA 3C4WA 4TZRA 3RZFA 4KRCA 3SOAA 4CFXA 4DH1A 4X3FB 3FUPA 2Y8OA 4W8DA 3IOPA 3CGOA 3O17A 3FV8A 2C5XA 2EXCX 2HK5A 1DM2A 3LJ2A 5C8MA 3OXTA 2G2FA 3PXFA 4CZYB 3VN9A 4C0TA 4TWPA 1XQZA 1W0XC 3DAKA 2B9IA 4FK6A 3UMXA 3R0TA 2RL5A 3NW5A 3G90X 3W18A 3FPQA 3JR1A 5IDNA 1REKA 5LVPA 2C6OA 4IVDA 2DYLA 3UZRA 3FQHA 3V8SA 3W16A 3E8CA 4AFJA 4AOTA 3G5DA 4LYNA 5IQIA 3H0YA 2XKFA 1JSTA 5HU9A 2H6DA 3OW3A 4XV1A 3DU8A 3LCDA 4IB1A 2CKOA 3TI1A 5AAGA 4HVIA 5AEPA 5DT3A 4LUDA 4AN3A 5KCVA 3RALA 5AUUA 3HNGA 5DR9A 5EDQA 3BLRA 4BZOA 4LGHA 4M0YA 3LW0A 2IZUA 3PA5A 4EONA 1JPAA 3IW6A 4K77A 5HNGA 2W05A 5CXZA 2ITYA 3QD0A 5EFQA 2OJGA 4ACMA 5M51A 3ULIA 4EH2A 2O3PA 2CNVA 4C4GA 2QLUA 3QRKA 4M69B 4BZDA 1SVGA 2EVAA 4J8MA 4NW5A 4ITHA 5G1XA 4CFNA 2G15A 5IQBA 1UU8A 1H08A 3EQBA 2XK8A 2R3GA 1A9UA 2PK9A 4QOXA 4BDGA 3SOCA 2OH0E 2UW5A 1WBWA 3DZQA 2X2LA 4M7IA 4MNFA 5KMNA 2BROA 5F94A 3PWDA 3R71A 3UNJA 2P2IA 4ZSJA 4ZJJA 4X0MA 2CLXA 2WHBA 2WU7A 5CT7A 3RWPA 3SAYA 3V04A 5M4CA 5JRSA 5HCZA 4CFVA 4EK5A 2QO2A 1YDSE 2CGXA 1CMKE 5J1VA 2J0KA 4Y72A 1R1WA 3QRUA 3TV7A 2XUUA 2ZV2A 3KXZA 1ZYLA 5M53A 1JSVA 4AGUA 4DGOA 4EH4A 1IAJA 3CGFA 3SVVA 3DJ6A 3GNIB 2Z7SA 2BFXA 1KE9A 2WEVA 2WTVA 3RHXA 4H3PA 4ZLOA 1WVXA 2UVXA 3MY1A 2DUVA 2PMNX 4ANMA 2B4SB 4EH8A 1FVRA 5ANEA 3ORZA 1K2PA 5TT7A 5FBOA 1TQPA 2YIYA 2GPHA 2C0IA 1Q3WA 2WTWA 2G01A 4CRLA 3MVJA 2JDSA 4PL5A 5IA2A 4DEEA 2PHKA 2XM8A 4KKGA 3RPSA 4CZUA 3AOXA 1KOAA 1OVEA 4WBBB 2PL0A 3D5UA 2PZIA 3EN9A 3TDVA 3QQKA 5E8VA 4DCAA 1V0BA 2Z8CA 5HCYA 4YO4A 1G5SA 3C4CA 1KE8A 5DA3A 4BDKA 3IGGA 3OG7A 4AG8A 4NIFB 3PXQA 4N70A 5CSHA 4DEHA 1G8AA 3K5UA 3Q9YA 2V0DA 5IUGA 4CMUA 4I0TA 3PIXA 1PYXA 3VBXA 5EKNA 1MQBA 4HW7A 4PQNA 2XS0A 5IA5A 5ETCA 3NS9A 4JRVA 3Q5ZA 4XOYA 4O7NA 2VGPA 2NRYA 4IAIA 3I0OA 2R3HA 1E1VA 5D12A 1W84A 4KA3A 1Z5MA 3UOKA 4MBLA 4UMQA 2WMUA 1H26A 5AV3A 3UVPA 3RBWA 2HZNA 3D5WA 2XK7A 4KBAA 2ZB1A 3WE8A 4CGAA 4WT6A 4XEYA 4DF3A 3CKWA 1QPEA 2UVYA 1JAMA 4I24A 2VV9A 4C3PA 3KXXA 4JQEA 4JBOA 2XKCA 2PU8A 4O0UA 2C3IB 3HGKA 3NNUA 3QWJA 4C57A 4WHZA 4FTJA 3V01A 3LKMA 2BZIB 3FHIA 3HV4A 1RE8A 4BGGA 2VWZA 3IK3A 1S9JA 4MH7A 4UALA 4X2GA 3LZBA 2UZTA 3ERKA 1XO2B 3G9NA 5FEQA 3WYXA 2VN9A 1CSNA 4F08A 5FUTA 4IAKA 5HO8A 3OROA 4BF2A 2AUHA 3ZCLA 2CCHA 1YXXA 4M15A 5CVFA 2HW6A 5GIOE 4QP3A 1DI9A 4RA5A 2F4JA 4U80A 3TNPC 4L8MA 4FT9A 5IEXA 2UW3A 3W33A 4E8AA 4FTUA 1DAWA 2PZRA 3QL8A 4C2VA 1UKIA 3C0HA 3ORLA 3ZDIA 1H07A 3A7HA 3OWJA 2XEZA 4J99A 4C59A 3SV0A 1JOWB 5I9UA 4FIEA 2JFLA 3PZHA 2QOOA 2GNIA 1OPLA 2W4OA 3DK3A 4ZMEA 3WZDA 4A4XA 2BVAA 5JGBA 3DDPA 3DJ7A 1OL7A 2BZHB 3O96A 4EBWA 4O2ZA 3AC5A 4IVAA 5L6OA 4FIHA 3A4PA 4YLJA 3ZU7A 4G16A 5LCKA 2WU6A 3A8XA 4NCTC 2B52A 2GNHA 5CVHA 1RQQA 5KHWA 3QTIA 3SG8A 3FY2A 3EZRA 3IPHA 4E4NA 3W8LA 3ATSA 3F2NA 5CSWA 3H0ZA 4EZ5A 3PWYA 1J91A 1H1PA 2BFYA 2FYSA 2C6EA 2YM6A 3AC8A 1IEPA 3BV3A 3LMGA 3NUSA 1ZLTA 3MVLA 3NCZA 3F61A 1UVRA 3WZUA 1FQ1B 3FC2A 4U6RA 4BVUA 5CEOA 3LFNA 4LL0A 4O1PA 5FM3A 4ZSLA 4ANOA 4LOQA 2ZV7A 4M66A 3C4FA 1BI8A 2GHGA 4ZZOA 3UIBA 2ZOQA 5CXHA 2WMSA 4TL0A 5IG1A 2P2HA 1Q97A 3BYUA 4FZDB 3R9RA 2X6EA 2VWWA 3THBA 3GC8A 4E5BA 4RSSA 3ZUVA 1PY5A 4L67A 4PTEA 3Q2JA 4MWHA 2R3MA 4J71A 2BIYA 1OZ1A 4YJUA 5I3RA 4CD0A 2C0TA 4FV2A 5LCJA 4CEGA 2X8IA 4R8QA 3ZEWA 4FSUA 4AXAA 4UXLA 4BTFA 3D7TB 2W4JA 2ITNA 1U54B 4G5PA 1BMKA 1I09A 5A46A 3HL7A 2GSFA 4FEXA 3TWJA 4XJ0A 3A7GA 3EN7A 3JY0A 3FKLA 4R1VA 3EYGA 4GYGA 3JXWA 5HIBA 3S95A 3QKKA 3LFAA 3CTHA 5K5NA 3KB7A 3KREA 1BL7A 3WZEA 4E4MA 1U5RA 3R9NA 3VS4A 4EEVA 5JQ8A 2BUJA 3EQGA 5FWKK 3VIDA 2OO8X 3ALNA 3PJ1A 4XP3A 5FDPA 3BV2A 2R9SA 2W1GA 4R77A 1ZYSA 4W4WA 3EKNA 4R6VA 5AP5A 4RVMA 3BZ3A 3MW1A 4BDFA 3LLTA 5LXMA 4QMZA 4AT5A 4NTSA 5ITAA 5F20A 5FG8A 4WD5A 5J5TA 5L8LA 4I6HA 3UP7A 4RVTA 3NPCA 4G34A 2YISA 3SXRA 2Y9QA 2X4FA 3AT2A 4DEIA 3C5IA 3ATTA 2J50A 3KQ7A 2GNGA 2BIKB 4FSMA 1IA9A 2KULA 3R28A 4W8EA 2Y4IC 3DLZA 4CMOA 4S2ZA 4N57A 3RAIA 1P5EA 3K3JA 3I7BA 4UMPA 3GOPA 4IAYA 4X6RA 4K0YA 2FVDA 3FMEA 4FTAA 5JQ5A 1VJYA 4UB7A 1VYWA 4C61A 3PJ3A 3FBVA 2X39A 3FL4A 4MQ1A 4WRGA 3EQFA 3GU8A 4NM5A 3W2PA 3WF7A 4AAAA 4C58A 3A2CA 2OI4X 3T3UA 3TZ7A 2BRMA 2GNLA 3DQXA 5KMIA 2YZAA 1Q5KA 2ZV9A 3NNXA 3CTJA 3OW4A 5B7VA 3GFWA 4PMTA 2VTAA 1T45A 3MJ1A 2CDZA 2J0JA 3ZDUA 2HCKA 3I6WA 3MH3A 3QUPA 5AR7A 4FV5A 3VUDA 5HNBA 4AZEA 2XNOA 4AOIA 2W7XA 3QTXA 4BDJA 3QFVA 5FLFA 5HBHA 1YXUA 3TZ8A 3NEWA 3Q3BA 4I3ZA 5CNNA 3W2CA 2Y7JA 2X2KA 4NM7A 3ZXTA 4H1JA 3UQCA 4QMQA 4ZY6A 5L8JA 3ENMA 3O7LD 4N6ZA 3RAKA 1OECA 4RIYA 3ORTA 4WG5A 3DBFA 4P2KA 3OC1A 3ZO2A 4A07A 4UY9A 4OW8A 3LPBA 4C7TA 4PP7A 2XP2A 3ZLXA 4UWCA 4RIYB 4BCGA 3TACA 2E9VA 1OITA 2C6KA 2OF2A 2QKWB 5AR5A 4I0RA 3W55A 2PULA 3LMIA 4I5MA 4YJPA 3FXZA 4ASXA 2R0UA 4MTAA 1R0PA 3I7CA 3QGWA 4O6EA 4IWDA 1MRVA 1ZZ2A 4FKPA 4RPVA 4L3PA 4R3PA 5C01A 4UYAA 4EQMA 2O8YA 1OIQA 4DC2A 2XA4A 3F2AA 3QGYA 3WF6A 4EZ3A 3VS5A 3EQCA 1E9HA 3DKCA 4LFIA 2BDWA 2WOUA 3CR0A 1CKJA 1TVOA 5KBRA 3GU4A 2C6IA 2HYYA 1K3AA 5LQFA 4FIJA 1KUTA 5HIDA 3W8QA 3PP0A 4MYGA 2JKKA 5EW3A 1M2RA 3R7YA 2B0QA 3FDNA 3DK7A 5CLPA 3H3CA 3ZHPC 1LR4A 2IW6A 3FMMA 3LJ0A 3Q9XA 2R3QA 2WQEA 3LCSA 3UVRA 3F66A 5FTOA 4D0WA 4ZK5A 4CTBA 4ENXA 3R8MA 1PMUA 1WBVA 4JG7A 4QTBA 5CU0A 1PJKA 4D9UA 1KE5A 4BI0A 2UZBA 4RIOA 2ZYBA 4HYSA 4BCQA 4FSQA 4HVHA 3ZH8A 2IVSA 1GZKA 4FI1A 4NW6A 3QHWA 5E8XA 5IPJA 3TDWA 2ZMCA 3GC7A 3PA3A 4GG7A 4R3CA 4ORKA 3PG3A 4BIBA 3GCUA 5CZIA 3ORPA 3GXLA 1YDTE 1LUFA 3OCTA 3WE4A 4RJ8A 4O1OA 4DH5A 4QYYA 5DRBA 3S4QA 2XZSA 4YTCA 3IG7A 2W5HA 4EC8A 2ZMDA 4I6FA 3DGKA 3FJQE 3Q96A 4DYMA 1KV2A 4K9YA 3CE3A 3D83A 4XX9A 3V5PA 1QCFA 1PXLA 3ROYA 4JS8A 2QO9A 1XJDA 5AUXA 3U8WA 2PZYA 4E93A 4EYJA 2GMXA 2IO6A 3BLQA 4DEBA 3AMYA 3VBVA 3B2TA 4D55A 4DFUA 2VZ6A 5HO6A 3FMDA 5I9XA 2VWIA 3TNQB 4PMSA 4ANBA 3II5A 5F4NA 4PF4A 2NP8A 2IW8A 3UO6A 4CT2A 3P7BA 4HGTA 3MB7A 2RF9A 5AAFA 4FEQA 4TPTA 4ACHA 2YHVA 2Q83A 1IR3A 4MXCA 3IOKA 2WTCA 4FG8A 4G9RA 2F49A 4AGCA 5IEVA 3MH2A 4FV4A 4NFNA 4XG2A 4NYEA 4O81A 3FZTA 5IQCA 4ONAA 2PE2A 5J7HA 1SVHA 4QQCA 4I5PA 2JEDA 2C69A 4GT3A 2EU9A 2XIRA 5IA0A 3KXHA 5JH6A 3FLWA 3UIUA 3CY3A 4AW5A 4A4OA 5CF4A 4RJ7A 3EWHA 1BX6A 3G2FA 4O0RA 4PTCA 4J1RA 3TV6A 5HEZA 4FVQA 2ONLC 4FTQA 5CWZA 3VUHA 4LRKA 4FZ6A 3TM0A 4Z7HA 1ZMVA 4ZS0A 3HRCA 2XYNA 3I0QA 3PSDA 5CU6A 3U51A 4O82A 4PL3A 4UYNA 2ITQA 2IVUA 4PWNA 3SRVA 2WTDA 3NUAA 3L9LA 3AQVA 1ZYDA 1BLXA 3G15A 1YQJA 2WMVA 3FEGA 1UNLA 2C30A 5C1QB 2B7AA 2HZ0A 3QKMA 5BVEA 4C4EA 3CJGA 4IAAA 3DQWA 2VTRA 5HE0A 4AQCA 3MSSA 3TUDA 3ETAA 4XBRA 2HY0A 5JFXA 1Q8YA 4FTNA 4PUZA 4W4XA 3OD6X 4BHNA 3TTIA 4JDKA 4IJPA 3KXNA 4PTGA 4YBKA 5HVKA 4FL2A 4QQTA 4QP1A 4YHJA 1RDQE 2FB8A 3KU2A 3F5XA 4GIIA 1AQ1A 1VYZA 2E9UA 2FUMA 3DB6A 4IW0A 4XUFA 4AX8A 4MWIA 3PJCA 4H36A 3PA4A 4I20A 2JIIA 2WMTA 4K8AA 3ORIA 4XG6A 5E92A 1JKTA 4YJQA 3EIDA 3MPAA 4FA2A 2B9JA 1Q8WA 4F7NA 3B2WA 4TYJA 4DLJA 4EKKA 1MUOA 3P7AA 4AA4A 5F95A 4F0IA 3F9NA 4F1TA 4BDEA 1JQHA 4C4HA 2BZKB 2QHMA 3DBQA 4M14A 5HG5A 2ITZA 3CC6A 1P2AA 3IQ7A 4YGAA 3AC2A 5J5SA 4G6LA 4DH8A 5JZNA 2WMQA 2XIXA 3PVGA 3NUUA 5KMOA 3PLAE 4W4VA 1OM1A 4NM3A 5BPYA 4O7ZA 4HPUE 4KBCA 4QMMA 2WTKB 2QHNA 4IX3A 5HLWA 4MD9E 5EDRA 4WOVA 5D9HA 2YWVA 2O0UA 1QPJA 4CTCA 2C6MA 2A0CX 3ZUTA 3E87A 4O84A 3FWQA 2ERKA 3LE6A 4KBKA 4OBPA 4BDDA 3MB6A 5DT4A 4EOLA 1QMZA 1OBDA 2BKZA 2UZNA 2GQRA 3GFEA 3LJ1A 3KN6A 4CNHA 2OU7A 2XF0A 4E6CA 2JBPA 5C27A 2JDTA 3G0EA 2B1PA 1V0OA 4QYHA 4R1YA 5CAQA 1OIRA 4QP4A 3QAME 2VAGA 4O0WA 2EB3A 3Q52A 3R2YA 4RIWB 5HTBA 4QP9A 3C0GA 3UG2A 4UV0A 3VS1A 4IVBA 1NW1A 4V0GA 1VZOA 3QD2B 2BHHA 5TO8A 4P7EA 4OTQA 2QURA 4YP8A 3ZOSA 4E73A 5A6NA 2IJMA 5CEQA 3KULB 5DG5A 3BU6A 3B8RA 4YZNA 4F0FA 1FBNA 2UW4A 2QOCA 5TKDA 5M09A 4EHZA 3IECA 5AAEA 2W1HA 3PXKA 4I23A 5FD2A 3EQRA 2WIPA 4ERKA 4IE9A 2W1CA 1VEBA 3EN4A 4BKZA 3RPOA 4GT4A 3UDBA 4MAOA 2G2IA 5EW9A 4PDYA 3ZEPA 4FTRA 2ITWA 3O2MA 3ROCA 1UNGA 1U59A 3PE2A 3QF9A 2A2AA 4H3QA 1OKVA 1SYKA 2YM4A 4U43A 2C3LA 5CU3A 4BI2A 2JKMA 3CLYA 5I3OA 4FEVA 4GVAA 3VS7A 3ALOA 2R3JA 5HESA 2JDRA 2W1EA 4H05A 3HA8A 1BKXA 3EQPA 5CAOA 3MIYA 4KIKB 4PDPA 3BCEA 4S31A 4B4LA 1Y91A 4BR3A 5E91A 3DNDA 3ANRA 3DV3A 5AUWA 1MQ4A 2RFEA 3HDMA 3F3VA 4RWLA 4DAWA 2PVLA 3R8VA 5CSPA 2HY81 4J98A 4FEUA 4AZTA 4RRVA 3DXPA 3V5LA 4O0TA 4ZIMA 2OKRA 1Q99A 3QQLA 4XG7A 3I1AA 5J9LA 3E92A 2O64A 1TQMA 3FZOA 4LUEA 4QQ5A 2G2HA 2PYWA 3LQ8A 2C5VA 3IDBA 3PPKA 5CF6A 3LIJA 2C6LA 3QU0A 4X3JA 4HNFA 4MXYA 2PVFA 3KVWA 2C3JA 3FL5A 2BZJA 2PUUA 4S30A 1V1KA 3CEKA 3FC1X 1SZMA 2V7AA 2PUPA 4GU6A 3H9RA 3OWLA 4IZAA 3FLYA 3UPXA 5I4NA 2GHLA 4XCUA 3EOCA 4OTIA 4X3FA 4F7SA 2VWBA 2OK1A 2BAJA 4AW2A 4CG8A 4IWPA 2QOKA 2VTQA 2V7OA 4CRSA 2XRUA 4MD7E 4D0XA 3ORNA 1UV5A 3C1XA 2Z7QA 2YITA 3IGOA 2FA2A 3PY1A 3UE4A 4HVDA 2QC6A 4Z55A 4IHPA 4PRJA 2H96A 4D1ZA 4O7TA 5B0XA 3O7LB 4RT7A 2QR7A 4L45A 3HMIA 4FT0A 2Z7LA 1YI4A 2CKEA 5F1ZA 2X7FA 3R2BA 4BB4A 4FC0A 5J7BA 5HX8A 4BBFA 4L53A 5AM6A 5HKMA 3C4XA 4NU1A 3S3IA 5CT0A 4HCUA 4BZNA 4YJNA 4E26A 4Q2AA 4ZP5A 4F09A 5BVFA 2GFSA 5GZ8A 5H9BA 5A4EA 4PV0A 3BGPA 5KO1A 4O91A 2YJRA 4FTLA 4MK0A 4FKWA 4BHZA 1WVYA 1O9UA 4W4YA 2CGWA 5M44A 1ATPE 3HV7A 1WBPA 5IA1A 3N4VA 3HKOA 3LCOA 4O0YA 5CQWA 3LCKA 1Q8UA 1LEWA 3BYOA 1ZWSA 3DAJA 3QD4A 4CQGA 4IANA 4FYOA 4GV1A 3NAYA 4QYEA 5CU4A 1RW8A 3F2RA 2W1IA 3ODYX 4CCUA 5CSVA 2YN8A 3G6HA 4JDJA 3R1NA 2R7IA 3PJ8A 5E1EA 4E4XA 1ZXEA 2Q0NA 4ZZNA 4YZDA 4QMWA 1XWSA 3KRRA 3GEQA 4M69A 3IONA 3UODA 3SG9A 3TNIA 2B54A 5AR2A 2HWOA 2XCHA 3BGQA 3HVCA 3KL8A 1OI9A 2PZPA 4MKCA 4FE2A 2PMLX 4FKTA 1DAYA 5L2QA 5FXQA 4FG9A 4A7CA 4PL4A 3ZFXA 2QG7A 3HRBA 3UC4A 3Q4ZA 3P86A 5I9YA 5LWMA 3F5PA 4RJ3A 4JI9A 4UXQA 1JVPP 3F7WA 1WBOA 3O23A 4ZLYA 3RJCA 5I0BA 5CZHA 4ANQA 2QR8A 3Q32A 4NWMA 4EBVA 5IQAA 4K11A 4CFFA 4CG9A 2X1NA 3NYXA 3P78A 4MBIA 3ZC5A 2WTJA 4GFGA 3SA0A 4K33A 3NGAA 3GCPA 3PUPA 3PXRA 4BIDA 4FKJA 4GEOA 4HZRA 4ASDA 4ALWA 4DFYA 4BCNA 3PSCA 4F6UA 1Y6BA 4RZVA 4FEWA 2OBJA 2GQGA 3CSVA 1XR1A 3P7CA 4GT5A 4FKVA 4G3GA 2OJJA 2UVZA 3KRWA 4RVLA 4FZFB 4YHFA 3K2LA 4F6WA 2ZM4A 2NPQA 4QMPA 1FGKA 4FSYA 2CMWA 2UZOA 3R22A 2R2PA 3I79A 2WELA 1XH5A 5BUEA 4L44A 5FTGA 1IG1A 2YJSA 4MEDA 3U4UA 3JPVA 3VW6A 3L9PA 3VBYA 2GQSA 1NVQA 3HDNA 3JVSA 3Q04A 3R1SA 2VWUA 2VX1A 4MCVA 4AT4A 3IW5A 1YOLA 3D4QA 5J79A 4G3EA 3TJDA 3VUGA 3WF8A 1KOBA 4YJSA 3REPA 3RNYA 1M2QA 4BI1A 3MA6A 4A4LA 4NIFA 2OJ9A 4KWPA 5AUYA 4G3DA 2OFUA 3GOKA 4BYJA 3Q9WA 3RWQA 2C1AA 2A19B 4RFYA 5FDXA 4ZTNA 4ZY4A 4OR5A 2UZUE 4F1OA 4H1MA 3MJ2A 2WMBA 4BY9E 1PYEA 3PVUA 5FGKA 3BWFA 3LXLA 3WILA 4D2RA 4BL1A 1OMWA 3D5XA 3QC4A 3MDYA 5JSMA 2PVKA 3U55A 2BAKA 3DK6A 2WTIA 5JGDA 5JKGA 4NFMA 2JBOA 5C26A 5EQPA 4UMRA 5B2KA 5D10A 3BRBA 5AUVA 1OKWA 2C3KA 4IWOA 4J7BA 5GJFA 2OJFE 5E8ZA 2Z02A 3NVMB 4AN9A 4C36A 3RHKA 3VQHA 4F9WA 2O63A 2OSCA 3R7GA 4L7SA 4D4VA 3CTQA 5HIEA 2PY3A 2RG6A 3BIZA 3D2IA 5AIRA 3U9CA 5KMJA 1PMEA 3OS3A 1S9IA 3PIYA 2GS7A 5JFSA 4TN6A 2EXMA 3E8DA 3BE9A 3I81A 4HJOA 1PW2A 2E2BA 2YIXA 5AV1A 4AZVA 4QPAA 4IB3A 4RX9A 4GL9A 4W9WA 3MY0A 1JWHA 4WNMA 3R73A 5IA3A 4FIFA 4K1BA 3R8PA 3W2RA 1PRYA 4DT9A 1PMVA 2OZOA 3DB8A 4QD6A 3UBDA 5HU3A 2UZDA 3VF9A 2VTHA 1H28A 5D41A 4EH6A 1OKYA 4PPCA 3WZJA 3EJ1A 3UJGA 4MF0A 2J5EA 4EOOA 4BCPA 3VRYA 3COIA 1NVRA 2HZ4A 5IH5A 1H4LA 2WO6A 2F2CB 3GCVA 3GC9A 3GU6A 3QZHA 4CQEA 5A54A 3BQRA 4JG8A 3R8UA 2XRWA 2GDOA 3U54A 2R3LA 5LOHA 3FI2A 3A7IA 4V01A 4U79A 5BX0A 3JVRA 1HOWA 4IQ6A 4IM3A 3EN5A 4FR4A 3ZTXA 2BPMA 5BMMA 4L68A 2P0CA 3R8LA 3S0OA 2PE0A 3TT0A 5EQEA 3QWKA 3ORMA 2H9VA 1ZY4A 2VU3A 5AA8A 4M67A 4O96A 1R3CA 4ZOGA 2XM9A 4N4SA 3FXWA 3BBWA 4CMTA 4FGRA 1BUHA 2VO0A 1OKZA 2V5QA 3QQGA 4IZYA 2RKUA 2VTMA 4USDA 4X6QC 5IMXA 4ZTRA 5KE0A 5AP4A 4LQMA 4MXAA 4YNOA 3PVWA 3FQEA 2YCSA 2XNEA 3QTQA 3GVUA 4FX3A 3WIGA 4XBUA 5HBJA 4UX9A 2PUNA 1APME 1ZRZA 4LV8A 4CZTA 1XBCA 3M42A 5AA9A 4DTBA 4BBMA 4XRJA 5HOAA 1H00A 3GI3A 5A9UA 2BRNA 3AGMA 4QPSA 1XBBA 3DT1A 4DFXE 4DFBA 3CXWA 4NSTA 4ERWA 4FSZA 2XIYA 3QQJA 5C8KA 1J7UA 4OTDA 4EOIA 4RQVA 5C9CA 4CKIA 3HYHA 4RIXA 4BGHA 3IW7A 2YDKA 2C6DA 2CNUA 3D14A 3FLNC 3D7TA 3LFQA 4G6NA 5HZNA 2F57A 3WARA 1U54A 3ET7A 4FVPA 4RIXB 5AWMA 3CIKA 1F3MC 5AJQA 5BUJA 3WOWA 1NY3A 2VTIA 3A61A 1FINA 2ETMA 3F3WA 3I60A 4HYIA 3NYOA 3NUYA 5D7VA 4EYMA 3QZIA 3PY0A 4WG3A 2GU8A 4XLVA 4O83A 1YWVA 1J1CA 2VTOA 3VUTA 2R3FA 3EKKA 1JBPE 4IH8A 5EOLA 3ZLWA 1LEZA 2UW9A 3C4ZA 4FKSA 4CT1A 2OWBA 2JIVA 4E5AX 5CU2A 4XG4A 2VTJA 1WFCA 3MV5A 2GS6A 5IISA 1ZOHA 4RFMA 4U7ZA 2FH9A 4XLIA 4DBNA 3VJNA 2WOTA 3V5TA 4ANLA 5EI8A 3ZBFA 4NTTA 4OAVB 1NXKA 2VTNA 2X7GA 4WSYA 2XJ1A 5ANJA 2Y4PA 4L52A 5ANIA 3FMKA 4JLCA 4FTKA 3POOA 4I94A 5J87A 3VO3A 3W2QA 3GU5A 4FUXA 3P1AA 3MPMA 3OHTA 5DH3A 3CJFA 2GHMA 4FV8A 1ZZLA 1HCLA 4ANNA 5FP5A 3E62A 5JK3A 4IC7A 4OLIA 5FEDA 4B7TA 4P5ZA 2YAAA 3HLLA 4FNZA 4AA5A 3R9DA 2VNWA 4G31A 1MP8A 2YIQA 4JIKA 3A60A 3H10A 4O7VA 4APCA 4ALUA 4WKQA 3OY1A 3UOHA 3EYHA 4G6OA 3WI6A 3KKVA 3MFUA 1BL6A 4ZZMA 3E8NA 2IN6A 3WYYA 2YA9A 2YFXA 4IADA 5CEKA 3ZUUA 5AUZA 4JXFA 2FSOX 4G17A 5H8GA 3UG1A 3UOLA 4EORA 5JRQA 4EH5A 4FV0A 3POZA 4TYIA 4Q9SA 3R1YA 1BI7A 4ID7A 4B6LA 5E90A 4BTMA 5BVOA 1R78A 4M0ZA 3CD3A 3AD6A 5EQYA 4RWIA 4I92A 2HENA 1XH8A 2H34A 3KMMA 4QMSA 4WNPA 3GUBA 3SHEA 5AR3A 4E3CA 3IDCA 3PIZA 5M56A 4FNYA 2QONA 1ZYCA 4KABA 5AMNA 5HGIA 4DGLC 4XV9A 1TQIA 3ZSIA 4FTMA 4LG4A 5DLSA 2GTNA 2W9FB 4XH6A 3AT4A 3D94A 4ZTMA 3V8TA 2QU5A 4ZY5A 4KB8A 3K5VA 4RWJA 3VJOA 4C4JA 1CKPA 4AWIA 2XKEA 4NKSA 2BDJA 3VNTA 1SMHA 5CAVA 3QYZA 4JAIA 5AV4A 1NA7A 4X2JA 3NYVA 5CQUA 5EHOA 1MRYA 5DR6A 5KX8A 1OUKA 1GIHA 2OXXA 3C51A 5CF5A 2ITVA 4H3BA 4BDAA 4JNWA 4DG2E 3HMPA 4MXXA 4M3QA 5DIAA 4DHFA 3A62A 3KC3A 4FKLA 5HORA 5K4IA 3OEZA 4KSPA 1GNGA 4BRXA 3A8WA 2PPQA 2C0OA 4IM0A 3OVVA 4C4FA 2E9PA 3H30A 1JKLA 1URWA 4LMNA 3V51A 1PMNA 3G0FA 3NUPA 3NDMA 3TL8A 1DS5A 1OBGA 2HWPA 4TTHB 3RKBA 3ZLYA 4CVAA 4WUNA 5EM5A 3DFAA 3K3IA 3AC3A 5B2MA 4IDVA 3RK9A 2VTPA 1Q24A 1Q61A 4NCTA 3MESA 4O7WA 2W1FA 4BTJA 4LRJA 2XIKA 5HO7A 1V0PA 2PVHA 3TTJA 3VHKA 3LOKA 4P5QA 2BHEA 3ITZA 2WMRA 1QL6A 4IX6A 3UGCA 4PDOA 4PDSA 3LXPA 2PZ5A 3KRJA 3MI9A 4NKAA 4XV3A 2XJ0A 2IWIA 4XNEA 5ACBC 2PVNA 5I9VA 3D5VA 1M7QA 3BYSA 4MBJA 5DT0A 4D2PA 2CHLA 3DBDA 2GCDA 5IH6A 3FLSA 2OICA 4FSTA 2WMWA 4NT4A 5AM7A 4KIOA 5EYCA 4DBXA 3KCKA 3R7OA 4RZWA 3ZSGA 4NM0A 1IASA 4FVRA 4MNEB 4EK8A 4NZWB 4F70A 3BYMA 4QQJA 3PRFA 4USFA 2R3RA 2FSMX 3OUNB 3M1SA 4F0GA 4TWCA 5AX3A 3WIKA 4E20A 4YR8A 2XK9A 3QXOA 1JLUE 4CYJA 2BDFA 2CPKE 3Q6WA 4QMLA 4NEUA 2I1MA 3U87A 5LMKC 2QLQA 3VVHA 5BYZA 2HZIA 3L1SA 3OEFX 1YXSA 3ACKA 4EOMA 3LHJA 4JQ7A 4JBPA 2PTKA 3HUCA 3EMGA 2W99B 4Y5HA 3TCPA 5DVRA 4C3FA 4LOOA 4CLJA 3UPZA 1GIIA 4DTAA 4J53A 4DTKA 4JDIA 2I6LA 2OGVA 4DFNA 2CSNA 4BC6A 5CF8A 3DKOA 4I1ZA 5K9IA 4NJDA 5D7AA 4TYEA 5HE1A 3DNEA 3F88A 2VUWA 3ZBXA 3SQQA 5ETIA 4FL3A 4ANSA 2V62A 4Z9LA 1WBNA 4DEDA 4C8BA 2YM3A 4U8ZA 4XP2A 3FPMA 5HLNA 4PMMA 2CN8A 4FG7A 2PVYA 5AP1A 2VTTA 2ZAZA 4GW8A 4FKUA 5HBEA 4WBOA 3CS9A 4YTHA 4KKEA 4BIEA 4EOSA 3ZM9A 3VW8A 1YOJA 3PSBA 5D11A 1J1BA 3HMMA 3A4OX 1B39A 5T3QA 5JZJA 4IXPA 3UNZA 4FV7A 4AU8A 4M97A 1GOLA 3MFRA 3E63A 3QX4A 1FVVA 4AE6A 2ZV8A 4RX7A 3D7ZA 4FTTA 3QUEA 5HQ0A 3F6XA 3DXNA 4Q5EA 4QYGA 4WIHA 5H2UA 5HTCA 5M57A 4OT6A 4YHTA 2J0LA 5EK7A 5CI7A 4AGDA 3IW4A 5L2WA 2OXDA 4JX3A 4DFZE 4K2RA 1OUYA
chains in the Genus database with same CATH superfamily
4IJ9A 1YXTA 4U3YA 5KBQA 5FRIA 2EXEA 2Y4IB 5DGZA 4YSMA 2F7ZE 4F1MA 4YURA 4KD1A 3PY3A 5J1WA 1PXOA 4YUQA 4NK9A 2HXLA 3HV3A 2ITXA 4DA5A 3P4KA 2YCRA 1GY3A 2I0YA 3NW6A 4OTWA 5FTQA 4OTPA 3RMFA 4K18A 3PJ2A 4X3FC 3DBCA 3AMAA 4I5HA 3DLSA 3RPRA 4JT3A 1OPKA 2A1AB 2ETRA 2XK4A 3GP0A 3MWUA 4N6YA 5FQDC 2X0GA 4ASEA 3AG9A 4JG6A 1IRKA 5IQDA 1Y57A 2PE1A 2ZJWA 2ITOA 1FGIA 5CAPA 1YW2A 3DPKA 4YNEA 3V8WA 5DEWA 3HAMA 3AKKA 4NH1A 5AP3A 5IQGA 3FY0A 4QT1A 3EQHA 4LRMA 2P4IA 2JGZA 5TF9A 2GTMA 1ZY5A 3MH0A 5HG8A 4D58A 1XH4A 4TNDA 3PFQA 3BYVA 3PZEA 5IEYA 4F99A 4FSWA 4X2KA 4EOQA 4Z3VA 3FE3A 4UWBA 3K54A 2CGUA 2JAVA 5M08A 2V55A 2O2UA 1WAKA 2C5NA 1XKKA 4UEUA 3NUXA 4TKSA 4EZ7A 3O50A 3UC3A 4H39A 5DOSA 4ACCA 3UQFA 4LI5A 4D2WA 4FSRA 3PLSA 4L3JA 2JDOA 3R83A 1JKKA 3AC4A 5E8WA 2OF4A 4BDIA 4CKJA 5EYDA 2ZB0A 5K0KA 2JD5A 4B8LA 5CANA 4R7HA 4B0GA 3BWJA 4YLKA 3UZTA 3A7FA 4IACA 3DTWA 3BKBA 1H0WA 2QOQA 4IX4A 2QOFA 3R1QA 1SVEA 3HMOA 4RJ6A 3UNKA 3W0RA 2X2MA 2OLCA 2DQ7X 4AP7A 5HTIA 4RIWA 2BALA 4TNBA 3TXOA 2WD1A 1CM8A 4DINA 3H9FA 4BWKA 3DCVA 3QXPA 5FP6A 3ULZA 3BGZA 2PSQA 3L8VA 3Q53A 5IUHA 4O38A 3D9VA 3PTGA 4QTCA 5JT2A 1Q8ZA 5HX6A 4AE9A 4TWNA 4P90A 3QTUA 4JR7A 4YC8A 3E5AA 5HNIX 4RMZA 3KULA 3OFMA 4QTAA 2ERZE 4Y73A 5E8UA 4HVSA 2JFMA 3TIZA 4RWKA 2WQMA 4O0VA 5EDPA 4I0SA 4JIAA 3PUFC 4C34A 3KK8A 5DR2A 1OL6A 3VBQA 2QCSA 4DLIA 2XAOA 2CGVA 4L7FA 4AF3A 3OP5A 4AZWA 2XARA 3Q2MA 5FBNC 5JGAA 4V05A 2VGOA 3MN3A 4TYHB 1Q4LA 3FMJA 5G6VA 5BYLA 4F9AA 1YVJA 3S2PA 5KHXA 2JC6A 5IA4A 3OWKA 5HE3A 3DBEA 4LL5A 5C03A 4BWXA 4FIGA 4RX5A 2XYUA 4IBMA 1KSWA 3N51A 4KS8A 3TZ9A 5I9WA 2WIHA 4DITA 2YABA 1I44A 5D1JA 2SRCA 2W06A 2YM8A 3KF7A 3KRXA 3QA8A 4KIKA 3G6GA 4D4YA 4ACGA 4FTCA 2VX0A 4HYUA 1GZOA 3CBLA 3MVMA 2REIA 4XG3A 4CSVA 4YTFA 2YIRA 2J0MB 5CS6A 3BEAA 1UKHA 4I6QA 2OIDA 3TEIA 4FV3A 3R04A 3DXQA 2C5OA 2E9NA 3OCSA 4HPTE 4QNAA 3R7VA 3VUIA 3RK5A 4TT7A 4U5JA 4CYIA 4F9CA 5DPVA 3SGCA 3R7EA 4FTIA 3NIEA 2X9FA 4C33A 2XK3A 2Y6MA 4CFUA 1W8CA 3RAHA 4WNOA 5K5XA 3EL7A 4F4PA 4C4IA 4YU2A 5J9ZA 2UUEA 4YJVA 4YJRA 3ZZWA 4IIRA 4HZSA 3O8TA 3BQCA 3ORKA 3R7UA 4XHKB 4D4SA 4EI4A 4BDCA 4KIPA 2KTYA 1VR2A 4O2PA 5HLPA 1QPCA 3B8QA 4S34A 5LMAA 3W2OA 4A9TA 1KWPA 4QMNA 5CAUA 3DTCA 4JVGA 2QI8A 3BHHA 2BAQA 1L8TA 1FPUA 4D28A 3O0GA 4RX8A 1O6LA 2AC5A 4YJTA 1Y8GA 5H8EA 1CDKA 4EH3A 4ZJVA 1OB3A 4QMOA 4GSBA 4KSQA 5E7RA 2ONLA 4DH3A 4E6DA 3OBJA 2Z60A 3EH9A 4USEA 3G51A 3GT8A 1H8FA 2OH4A 4DEGA 3DKFA 3UQGA 4AXDA 3CQEA 3F5UA 3QRJA 1PXMA 3BELA 4FJVA 4IB0A 4F64A 4O7RA 2XBAA 5JEBA 3VC4A 1QPDA 1PXNA 5T6KA 3P08A 1LP4A 1FVTA 4LGDA 2BRGA 4Y95A 4DG3E 4EHVA 3FI4A 4I21A 3BHYA 4YJOA 3BHVA 5LVOA 2PUIA 3I5NA 3L9NA 4WSQA 4OTHA 3LCTA 5L2TA 2BTSA 3WBLA 1B38A 3A7JA 4FV9A 3SW7A 3KY2A 2J51A 3HMNA 4O86A 3GQLA 3E64A 4UZDA 4FSNA 4L6QA 2BMCA 1XH7A 4KIQA 3PYYA 4PMPA 4Q9ZA 2I7QA 5A4TA 5EH0A 5EOBA 4JMQA 5KMLA 5C4LA 5AP6A 3W0OA 1STCE 4GK3A 5DFPA 2IVTA 4BCOA 3ACJA 5A14A 3FMNA 3QTRA 4FYNA 4HOKA 4YZMA 1FMOE 2QOHA 5B2LA 2HXQA 3R00A 1U46A 4F9YA 3IS5A 3G9LX 2ZM3A 2FGIA 2X9EA 3OOGA 4M68A 4EK6A 1PKGA 3TUBA 3DAEA 4I6BA 1Q8TA 2IZRA 3NIZA 3QC9A 4HGSA 3SD0A 3ZMMA 4FNXA 3FZRA 3LFSA 4HYHA 3W32A 3L9MA 1JNKA 2LGCA 5DE2A 1XH9A 3S00A 3ZRLA 3DOGA 3UTOA 3BLHA 1W2FA 2VWVA 3UVQA 2ACXA 3QCSA 2YIWA 3C0IA 2W4KA 3FMLA 4L01A 3C4EA 3UIMA 4GH2A 4B9DA 4GJ3A 3PPJA 1O6YA 2WB8A 3COKA 5EYMA 3VRZA 3N4UA 1PHKA 2VWXA 4F7JA 4GUEA 3NMUF 3UMWA 3Q4TA 4UWYA 5AP7A 1J7IA 4X2NA 4UMUA 3FQSA 4J97A 2YCQA 4I93A 3UOJA 4K6ZA 4RGJA 5JN2A 4AXFA 3RNIA 4FTOA 4A9SA 4U44A 1U4DA 4O7LA 5J9YA 4BFMA 2UW8A 2XKDA 4QP8A 1F5QA 3OY3A 2PVJA 3C5UA 4O4EA 2UZWE 2WQOA 3HV5A 3RZBA 3Q60A 3OZ6A 4OTFA 4QO9A 3QTZA 2WPAA 3NFFB 1SNUA 4XS2A 4J96A 5DEYA 5BNJA 4EKLA 4YLLA 3Q9ZA 4ENYA 4C02A 4UMTA 5BMSA 2P33A 3RCDA 3BE2A 3IKAA 4I6LA 5EHLA 4F78A 3PG1A 4FZAB 5IU2A 2PWLA 3E93A 4FL1A 1LPUA 5HHWA 3O71A 2C68A 4LV5A 5IDPA 5HG7A 3L8PA 4R5YA 4U40A 3R7IA 3HRFA 4MXZA 4APPA 3GU7A 2VTSA 3RAWA 1CKIA 3SXFA 1JKSA 2C6TA 5E1SA 3E7OA 1Q41A 3QBNA 3FI3A 3VF8A 5K0XA 3DDQA 5DRDA 4YZCA 3EZVA 4KINA 4XG9A 1MRUA 4CKRA 4EOPA 4IZ5A 2F9GA 2R3OA 3GCQA 4XMOA 4JRNA 2ZVAA 3O8PA 3NW7A 1A06A 3TNWA 4FKIA 4GJ2A 3UZPA 3TN8A 4RLKA 1NT2A 3RM6A 3W1FA 4E7WA 2JKQA 2BKKA 4EH9A 3I5ZA 2WZJA 4DGNA 2QOBA 5DNRA 4HGLA 1G3NA 2HOGA 4L46A 5CEPA 3FKOA 5HD7A 5EM8A 5EW8A 5M4FA 4OBOA 2GNJA 4ITJA 4RC4A 3JYAA 5E8TA 2QG5A 4FV6A 1ZMUA 1UA2A 4I4FA 4X2FA 2WQBA 4KRDA 3SLSA 4ACDA 3ZSHA 2ZM1A 3MIAA 1ZMWA 4FZ7A 5ETFA 5DYJA 1VLRA 4FODA 5DBXA 4OUCA 4O22A 2OIQA 3ANQA 5A4LA 3VONA 3MS9A 3FMHA 3SDJA 4O0SA 3LFCA 4DT8A 4J8NA 4ZTLA 3O8UA 3NAXA 4GKHA 3GGFA 4IVCA 5EKOA 5IQHA 5JFVA 4C38A 2I40A 3TUCA 5HVYA 4WO5A 3FXXA 2IG7A 4QMXA 3RCJA 4V04A 1M52A 2JIUA 3QQHA 3R63A 4YZ9A 5GIPE 5EI2A 4QP2A 2BRBA 4GIHA 3VUMA 4QYFA 4X7QA 3F5GA 1E1XA 3KA0A 4O4CA 4J95A 3NSZA 2O65A 2YM5A 3ZLSA 4A06A 3VBTA 5IZFA 5AIKA 4WA9A 2XH5A 4XV2A 3QZFA 3TKUA 3AD5A 4E6AA 4RJ4A 1H01A 2X0OA 3N9XA 4DCEA 5CALA 4EL9A 2DS1A 2ETKA 3GC0A 1Y8YA 1UNHA 4FRFA 5IUIA 3CCNA 5DHJA 3OXIA 1GIJA 3F3UA 3VS3A 4LOPA 2WEIA 4TRLA 2A4LA 1X8BA 4ZLZA 2VX3A 5BVKA 4ZAUA 2IZSA 1UWHA 3FHRA 5IKWA 3T9IA 5JMSA 2UZLA 4YC6A 5CNOA 3HP2A 4MUQA 4BCHA 1WCCA 2VNYA 4TW9A 3R30A 4UZHA 2J90A 2BCJA 4HVGA 3SKCA 4BCKA 3W0QA 3OWPA 2PMIA 2OW3A 3VUKA 4AZSA 3QHRA 4RQKA 5CVGA 4ZTHA 4QPMA 3MTFA 4GMYA 1O6KA 3MH1A 4G1WA 4DGGA 4F7LA 4C37A 3AT3A 3TIYA 3QALE 4RC3A 5IMEA 4R78A 5T68A 4QP7A 5CI6A 2QNJA 4AFEA 3DJ5A 4PP9A 3U6HA 1OGUA 3F3TA 2UW0A 3DZOA 1GZ8A 4ARKA 4E1ZA 4YZBA 5IQEA 4FIIA 1WBTA 3F69A 4U41A 4QTEA 2UW6A 2CKQA 3PP1A 5AR4A 3MY5A 4BDBA 2WAJA 3KVXA 4M8TA 5ICPA 4GVJA 5M55A 3C9WA 4II5A 3KMUA 4XRLA 1G8SA 3JUHA 5M06A 3R01A 4QRCA 4EOKA 1PF8A 4D2VA 5I5ZA 3KXGA 3AXWA 2BRHA 2B9FA 3AD4A 3QCYA 4QMTA 3ZO3A 2XNNA 2OFVA 4KKHA 4L9IA 3FLQA 1ZARA 5J95A 1YRPA 4F6SA 2ZDTA 2R7BA 4YTIA 3T8OA 3EFJA 3RPYA 5KMKA 3NR9A 1IAHA 3T3VA 3FSFA 1YOMA 1IA8A 5BVDA 2Q0BA 4JOAA 3VHEA 4GUBA 4GS6A 5BUIA 3E3BX 4IFCA 3BPRA 4L43A 2G1TA 5ETAA 5LMBA 4EQUA 3BU5A 4ZJIA 3UYTA 2XK6A 4S33A 1H25A 3M11A 3NCGA 3P79A 2XMYA 4WUAA 3MVHA 3QD3A 3COHA 4CV8A 4JQ8A 2WFYA 4G3CA 2R4BA 1GJOA 4EHEA 4O7SA 5IH4A 1CTPE 4PY1A 2NNWB 5A6OA 1G8KA 4H58A 4FICA 4RC2A 3L8SA 4Z7GA 4FKGA 4DDIA 4ZS4A 5A4CA 5CENA 2YEXA 3E7VA 3GQIA 1M2PA 4IX5A 2YACA 3U6IA 1XMMA 2QD9A 4TYGA 4RBLA 3L8XA 4G9CA 5AV0A 4FGBA 2W9ZB 2UZVA 3T9TA 4W9XA 3VBWA 1GAGA 2WMAA 1URCA 4FUYA 1YHVA 4L3LA 5AP2A 3P9JA 3R9HA 2WGJA 3ZS5A 4DN5A 1PXPA 2FO0A 4FOBA 4GG5A 4O7YA 5BVWA 4JJRA 3LXKA 4KS7A 5KUPA 1XH6A 3QRTA 4FKQA 2ITUA 3LVPA 2ITPA 4QTDA 1YDRE 3NZ0A 3QLGA 4FKOA 4XP0A 5EM6A 4QP6A 3TKIA 4BDHA 1PXIA 3ZFMA 3V5QA 5ANGA 3TKHA 4I5CA 1Q62A 2EB2A 4MQ2A 4OGRA 4BICA 2R5TA 4J52A 4B99A 2IW9A 3ZO4A 1OIUA 4E6QA 3FZSA 4GK4A 2HIWA 1GZNA 3BHTA 2CJMA 4JDHA 2C5YA 3OBGA 5J8IA 4BCJA 3Q4CA 3R02A 4IWQA 5GZ9A 3KCFA 4EUUA 1T46A 5AADA 5L3AA 4KNBA 4U42A 4Y46A 1OL5A 3FZ1A 3NX8A 2E9OA 3VS2A 4F9BA 1JSUA 2I0VA 3MFTA 4PPBA 4XYFA 3OT3A 3S1HA 5EYKA 2VWYA 1Y6AA 1UU3A 1W2CA 3ZYAA 3RPVA 3V5JA 4AN2A 4LM5A 4OBQA 4YPSA 4A9UA 5HD4A 5ACKA 2IF8A 4R7IA 2ZFYA 4JX7A 2UV2A 3PE1A 2Z7RA 4QMUA 5E8SA 1YI3A 4IAZA 4RVKA 5AX9A 3OUKA 5GINE 4D2TA 4AOJA 4R5SA 2ZDUA 2VO6A 4BBEA 2YCFA 4NUSA 2OXYA 3I6UA 5HICA 4D9TA 5L2SA 5LVMA 3LLAA 4JL9A 2F2UA 2J2IB 2B53A 2R3NA 2XNMA 3QA0A 3ZONA 3BX5A 2Z2WA 4E5WA 1YKRA 5E4HA 3C50A 3QKLA 2RIOA 3CQWA 5A3XA 3V6RA 2XNPA 4G3FA 4ITIA 4Y83A 5KZIA 1H27A 4ZSAA 4FNWA 3NLBA 2VD5A 5E9EA 2CLQA 2R3IA 2J5FA 1TKIA 2RGPA 2X6DA 2AC3A 4ASZA 2C1BA 4BTKA 1P4FA 3RGFA 2WNTA 4EJNA 2WQNA 2X0QA 4QMYA 1ND4A 3ZO1A 2GNFA 1UU7A 3P23A 4EJ7A 2QKRA 4LDTA 3ZFYA 5F9EA 2O5KA 3KXMA 5CYIA 1ST4A 2QOIA 2CKPA 4LMUA 4FF8A 4AS0A 4EWHA 1Z57A 2XNGA 4N0SA 2JDVA 4AUAA 3QX2A 3SC1A 3DKGA 3V6SA 5KKRC 3PPZA 2YM7A 5CASA 3E8EA 5L8KA 5IQFA 1J7LA 1AGWA 3MA3A 1PXKA 4PNIA 3EL8A 4EOJA 5DI1A 5BVNA 3ZRMA 1P14A 3ORXA 4Y5QA 2YLEA 3EQDA 3R21A 3FYJX 4Y85A 5CEIA 4IB5A 3U6JA 3DY7A 5GJGA 2WTKC 4AA0A 2X7OA 3EQIA 4IC8A 5TR6A 2XBJA 4BWPA 5LJJA 3W10A 3LFBA 3QQFA 4HCTA 1H1RA 4Z16A 3QZGA 4C2WA 4X21A 3UDSA 4BN1A 5LVNA 4PX6A 2CCIA 2G9XA 5EI6A 5L6WL 4R3RA 4OTRA 4Q5HA 1NVSA 3TNHA 3VAPA 1R39A 3EHAA 4A9RA 4D4RA 3TZMA 2I0HA 3QQUA 4MNEA 3KK9A 3F82A 4I41A 3U9NA 3NNVA 4DH7A 3H4JA 4EH7A 3IW8A 3P0MA 4G2FA 4MXOA 4ZEGA 2OJIA 1W82A 5GNKA 2PVMA 2QOLA 3EFLA 4TXCA 5L2IA 4UN0C 3EFKA 3MTLA 3D0EA 4IFGA 3CQUA 3JS2A 4S32A 5CEMA 3NNWA 2W5BA 2W17A 2W1ZA 3PXZA 4M12A 4BGQA 3OOMA 3QYWA 2HELA 4YC3A 4BJJA 1W98A 2IPXA 4ZXTA 1HCKA 1Q3DA 4XOZA 5LARA 3VQUA 3OTUA 4M84A 4RJ5A 5K4JA 2YERA 3SX9A 1WBSA 2F7EE 4YSJA 1YXVA 3VS6A 4BKJA 3P5KA 5H3QA 3ZXZA 3IDPA 1YWRA 4MX9A 4XG8A 5HVJA 4EQCA 3LFDA 4JBVA 1SM2A 2R64A 4I22A 1WZYA 4RA4A 4U9AA 2RG5A 1YHSA 4ZSEA 3WF5A 3CPCA 3ZZEA 3EB0A 3QRIA 5CX9A 3KGAA 2W0JA 3OF0A 4C62A 1H0VA 4DGMA 2VRXA 3LM0A 2OIBA 5A4QA 5C4KA 1KV1A 3RM7A 4B8MA 3OTVA 3GENA 2JITA 4BYIA 2XVDA 4TWOA 4L00A 4PPAA 4P4CA 2X4ZA 2C47A 4AACA 3CY2A 3HAVA 1W7HA 4PNKA 4MD8E 2QO7A 3PVBA 1H1SA 3H9OA 4WNKA 2BTRA 3RI1A 1YHWA 3OT8A 4U81A 2JAMA 4FT3A 3UO4A 1U5QA 1RJBA 3NRMA 2AYPA 2Y6OA 1OIYA 4YBJA 5CY3A 3WZKA 4OAUC 3E88A 3BHUA 2ITTA 3ODZX 5L4QA 3SW4A 3U4WA 2VTLA 3KFAA 3SXSA 3D15A 5C8NA 4F63A 3MYGA 3R8ZA 3AC1A 2B55A 2JKOA 5EG3A 1ERKA 5KNJA 2OZAA 3AMBA 4JAJA 4GKIA 4AW0A 3CD8A 4FT5A 1XBAA 2X81A 4IAFA 2IVVA 3F3ZA 5HE2A 4ALVA 3G33A 4EWQA 5LWNA 2OZAB 1WVWA 3GCSA 4D1SA 1KE7A 2UW7A 5AP0A 4RFZA 3RVGA 4CCBA 2P55A 3VULA 3HEGA 5ANOA 4QMVA 1YI6A 4NJ3A 3ZRKA 4A9YA 4M13A 5BYYA 1M17A 1UWJA 3QCQA 1AD5A 2FSTX 2P3GX 2VO7A 1L3RE 2XCKA 3V3VA 4OTGA 3NVKI 3HUBA 5JFWA 5ANDA 4CLIA 1ZOGA 5HG9A 3ZC6A 2J9MA 3KN5A 3QTWA 3BEGA 3RTPA 2J6MA 3R6XA 4RLLA 4EK3A 4UBAA 3MPTA 4GCJA 1ZYJA 3R9OA 2GFCA 3DFCB 4WG4A 1FMKA 3ENHA 5AUTA 5HCXA 4EHGA 3UP2A 5LVLA 1W83A 2H8HA 3LFEA 3SRVB 4QDVA 3KMWA 5CTPA 4ZMFA 3PDTA 2XNBA 2CNQA 4IDTA 1K9AA 3F7ZA 2IZTA 4EUTA 3D2KA 1FOTA 3TG1A 2J0IA 3FYKX 3LAUA 4ZTSA 5DMZA 3WF9A 3ELJA 2UZEA 3EFWA 3DA6A 2WXVA 3DS6A 4GFOA 2XJ2A 5IF1A 1XHAA 3HZTA 2GS2A 4G5JA 5I9ZA 1OL1A 3HV6A 4I4EA 5FXSA 3V5WA 3EN6A 3QUDA 3LFFA 4DEAA 3O5AA 4AZFA 3A99A 4BKYA 4MF1A 1PXJA 4IZ7A 2QU6A 4MHAA 5EM7A 3CKXA 4OT5A 4GYIA 5GJDA 2QVSE 3VS0A 2YZLA 1M14A 3OCBA 3QTSA 3KF4A 1R0EA 2R3KA 2LAVA 4O27B 2YWPA 4O0XA 4D5HA 5KKRB 4R7BA 2YAKA 1WMKA 3QLFA 4HCVA 2EWAA 2NRUA 3RP9A 3BU3A 2QQ7A 3COMA 4FBXA 3VWAA 3UO5A 2FSLX 2WMXA 1YWNA 3LQ5A 4FKRA 4DG0E 3IO7A 2HW7A 2X8DA 3RINA 3FI8A 1UU9A 4YMJA 3LXNA 4FK3A 5ANKA 4GU9A 3TV4A 5M07A 3CPBA 1OL2A 4BCIA 2AEGA 4TYHA 4CXAA 3KEXA 3MGYA 2W5AA 2DWBA 1DI8A 5CSXA 5GHVA 4CFWA 4U45A 4KAOA 1KE6A 3UDTA 4FMQA 2QODA 4FT7A 1SNXA 3BI6A 1Z9XA 5M4IA 3NWWA 4TY1A 2I0EA 2B9HA 3W2SA 5K3YA 2JLDA 3Q6UA 3RK7A 5LMKA 3KRLA 4U97A 5M4UA 1H24A 1H1WA 2XEYA 4HGEA 4FOCA 2VO3A 4U0IA 4IMYA 4MVFA 1H1QA 5HI2A 1TZDA 1BYGA 4AGWA 4YPDA 1B6CB 2YDJA 2RFNA 3MBLA 4O21A 1OPJA 4V0GB 3OMVA 4JR3A 4AT3A 5TE0A 2YDIA 2C4GA 1PKDA 3LM5A 5FEEA 3JY9A 2F7XE 3CP9A 4JBQA 4O6LA 5TOZA 3ZM4A 5AFVA 5E8YA 4ZTQA 2WKMA 5AV2A 2Y0AA 4YO6A 3FKNA 4CFMA 5EHYA 4BCFA 1P4OA 3UIXA 5KMMA 3QCXA 2RSVA 4GK2A 4IM2A 3GBZA 4BCMA 1REJA 3Q4UA 1M7NA 5L6PA 3NYNA 2X8EA 4Y8DA 2EUFB 2J4ZA 2OG8A 2R3PA 4DE4A 4O4FA 4D5KA 3HX4A 4F65A 1ZAOA 2NO3A 2XIZA 3I4BA 3C13A 3PXYA 3MFSA 4GRBA 4HNIA 4LGGA 2RFSA 2YLFA 4GFMA 5FM2A 5KZ0A 4D2SA 3BBTB 4QNYA 3OCGA 3FLZA 3UYSA 5DWRA 3ID6C 3OXZA 4U3ZA 1EH4A 4RG0A 4EK4A 3FSKA 4CV9A 2HAKA 4D1XA 3HECA 5GZAA 3FAAA 4NL0A 4C35A 3E3PA 3FZPA 3M2WA 4C3RA 1ZOEA 2W96B 4FV1A 4L42A 3TJCA 3AGLA 3Q5IA 4AW1A 3N4TA 3HA6A 5AR8A 3HP5A 4IEBA 2W1DA 5H8BA 3W0SA 4E4LA 5BQ0A 1J3HA 2ESMA 2J7TA 2PMOX 3LQ3A 2BILB 2BR1A 5FXRA 2RFDA 5DN3A 2V22A 1A48A 3LMHA 4WRSA 3NUNA 2CN5A 3PRIA 2XB7A 3C7QA 4DFLA 4KUJA 2A27A 4ZSGA 3O51A 1F0QA 3GB2A 4EC9A 3UDZA 2R0IA 2PVRA 3C4WA 4TZRA 3RZFA 4KRCA 3SOAA 4CFXA 4DH1A 4X3FB 3FUPA 2Y8OA 4W8DA 3IOPA 3CGOA 3O17A 3FV8A 2C5XA 2EXCX 2HK5A 1DM2A 3LJ2A 5C8MA 3OXTA 2G2FA 3PXFA 4CZYB 3VN9A 4C0TA 4TWPA 1XQZA 1W0XC 3DAKA 2B9IA 4FK6A 3UMXA 3R0TA 2RL5A 3NW5A 3G90X 3W18A 3FPQA 3JR1A 5IDNA 1REKA 5LVPA 2C6OA 4IVDA 2DYLA 3UZRA 3FQHA 3V8SA 3W16A 3E8CA 4AFJA 4AOTA 3G5DA 4LYNA 5IQIA 3H0YA 2XKFA 1JSTA 5HU9A 2H6DA 3OW3A 4XV1A 3DU8A 3LCDA 4IB1A 2CKOA 4DHJA 3TI1A 5AAGA 4HVIA 3BLAA 5AEPA 5DT3A 4LUDA 4AN3A 4DHIB 5KCVA 3RALA 5AUUA 3HNGA 5DR9A 5EDQA 3BLRA 4BZOA 4LGHA 3PFYA 4M0YA 3LW0A 2IZUA 3PA5A 4EONA 1JPAA 3IW6A 4K77A 5HNGA 2W05A 5CXZA 2ITYA 3QD0A 5EFQA 2OJGA 4ACMA 5M51A 5BV3A 3ULIA 4EH2A 2O3PA 2CNVA 4C4GA 2QLUA 3QRKA 4M69B 4BZDA 1SVGA 2EVAA 4J8MA 4NW5A 4ITHA 5G1XA 4CFNA 2G15A 5IQBA 1UU8A 1H08A 3EQBA 2XK8A 2R3GA 1A9UA 2PK9A 4QOXA 4BDGA 3SOCA 2OH0E 2UW5A 1WBWA 3DZQA 2X2LA 4M7IA 4MNFA 5KMNA 2BROA 5F94A 3PWDA 3R71A 3UNJA 2P2IA 4ZSJA 4ZJJA 4X0MA 2CLXA 2WHBA 2WU7A 5CT7A 3RWPA 3SAYA 3V04A 5M4CA 5JRSA 5HCZA 4CFVA 4EK5A 2QO2A 1YDSE 2CGXA 1CMKE 5J1VA 2J0KA 4Y72A 1R1WA 3QRUA 3TV7A 2XUUA 2ZV2A 3KXZA 1ZYLA 5M53A 1JSVA 4AGUA 4DGOA 4EH4A 1IAJA 3CGFA 3SVVA 3DJ6A 3GNIB 2Z7SA 2BFXA 1KE9A 2WEVA 2WTVA 3RHXA 4H3PA 4ZLOA 1WVXA 2UVXA 3MY1A 2DUVA 2PMNX 4ANMA 2B4SB 4EH8A 1FVRA 5ANEA 3ORZA 1K2PA 5TT7A 5FBOA 1TQPA 2YIYA 2GPHA 2C0IA 1Q3WA 2WTWA 2G01A 4CRLA 3MVJA 2JDSA 4PL5A 5IA2A 4DEEA 2PHKA 2XM8A 4KKGA 3RPSA 4CZUA 3AOXA 1KOAA 1OVEA 4WBBB 2PL0A 3D5UA 2PZIA 3EN9A 3TDVA 3QQKA 5E8VA 4DCAA 1V0BA 2Z8CA 5HCYA 4YO4A 1G5SA 3C4CA 1KE8A 5DA3A 4BDKA 3IGGA 3OG7A 4AG8A 4NIFB 3PXQA 4N70A 5CSHA 4DEHA 1G8AA 3K5UA 3Q9YA 2V0DA 5IUGA 3NFGB 4CMUA 4I0TA 3PIXA 1PYXA 3VBXA 5EKNA 1MQBA 4HW7A 4PQNA 2XS0A 5IA5A 5ETCA 3NS9A 4JRVA 3Q5ZA 4XOYA 4O7NA 2VGPA 2NRYA 4IAIA 3I0OA 2R3HA 1E1VA 5D12A 1W84A 4KA3A 1Z5MA 3UOKA 4AQKA 4MBLA 4UMQA 2WMUA 1H26A 5AV3A 3UVPA 3RBWA 2HZNA 3D5WA 2XK7A 4KBAA 2ZB1A 3WE8A 4CGAA 4WT6A 4XEYA 4DF3A 3CKWA 1QPEA 2UVYA 1JAMA 4I24A 2VV9A 4C3PA 3KXXA 4JQEA 4JBOA 2XKCA 2PU8A 4O0UA 2C3IB 3HGKA 3NNUA 3QWJA 4C57A 4WHZA 4FTJA 3V01A 3LKMA 2BZIB 3FHIA 3HV4A 1RE8A 4BGGA 2VWZA 3IK3A 1S9JA 4MH7A 4UALA 4X2GA 3LZBA 2UZTA