2Z8CA

Phosphorylated insulin receptor tyrosine kinase in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin-2-yl]amino}phenyl)acetic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
300
structure length
297
Chain Sequence
FVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin receptor
publication title Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 297
sequence length 300
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z8cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z8cA01
4E6CA 3DDQA 2XB7A 5HD7A 4YMJA 1YXVA 3RWPA 4FOBA 4G3FA 2JIVA 2QI8A 1VR2A 2UUEA 4FKPA 1OPLA 3F3ZA 4NSTA 4WBOA 3MA6A 4I6BA 4LUEA 1BX6A 1XR1A 2GNFA 3H9OA 1P4OA 3EWHA 3FE3A 3HP2A 3MDYA 4LL5A 4RGJA 4A9SA 4FNZA 4EJNA 2PY3A 2XEYA 3CEKA 4CTCA 3VS1A 5AUUA 2GFCA 5CF4A 5IKWA 1NY3A 5ANEA 3I1AA 1ZRZA 4I1ZA 5FEQA 4UWYA 4FKJA 2G01A 1OZ1A 5DA3A 2XJ2A 3U6JA 3OF0A 3QD0A 3TI1A 3W2QA 4XLIA 4DG2E 4O7NA 4X2JA 3OZ6A 4U43A 2EXMA 3VS2A 3ZLXA 2ZB1A 3TNWA 3PYYA 3OD6X 4Z7HA 4ZTLA 3FC2A 2VRXA 4F7SA 4JG6A 5FP6A 4EOMA 1P14A 1GZOA 3Q60A 4UMUA 3KU2A 5HHWA 2UZEA 5HIDA 2WMUA 4ZY6A 4O1PA 5CF5A 5E8XA 5AV0A 4DT9A 4ACHA 5C27A 4HVGA 2B7AA 1M2PA 4W4YA 3R83A 3ZXZA 2PPQA 3OEZA 4J1RA 4UMTA 3DT1A 5CZIA 4Z7GA 2ZMDA 4RLLA 3BLHA 2OLCA 4YJVA 2C6MA 4QMSA 1AD5A 4X3FC 2YZLA 1LUFA 4YPDA 3ELJA 3EN6A 4F6WA 1BI7A 2HK5A 3BEGA 3NAXA 4FL1A 3NUXA 3JS2A 5KE0A 3N4UA 3GU7A 5FD2A 1JPAA 1YQJA 2IZUA 4EOOA 1SVHA 3BHUA 1UVRA 4C37A 3KMUA 4M7IA 4XYFA 4OTRA 3P9JA 4PTGA 2YJSA 1BYGA 4R3CA 3SGCA 3KXZA 4DFZE 2GTNA 2P3GX 5FTQA 4DGNA 3BHVA 3SV0A 3ORIA 4IAAA 5M53A 5AV1A 3TKHA 3O17A 4AW0A 3G51A 3DFCB 4MYGA 4KIOA 2BIKB 3NYVA 4LRMA 4FKTA 2E9UA 4TZRA 3FXXA 5EYCA 2QR7A 2NRUA 4E7WA 3TUCA 2JDOA 3EKNA 4FT5A 3OCGA 3OUNB 4M0ZA 2ETMA 3E5AA 2ZDUA 3L1SA 4MAOA 4EH2A 1ZLTA 2ITOA 4L6QA 5I9XA 2B9JA 5F9EA 4GKIA 2UW3A 2Y6OA 2VWZA 4NZWB 5CNNA 4CLIA 5HLNA 1ZMWA 4I6QA 5TKDA 4C7TA 2C5OA 4O7WA 1CKJA 2OXDA 4MF1A 4DEHA 3O7LD 4O0VA 2Y0AA 4PTCA 4Y72A 5EYDA 4IWDA 4AZEA 5CEPA 5H8GA 3H0ZA 5BVKA 4C4FA 4FNYA 2X81A 4LL0A 3VQHA 2WKMA 1F0QA 2JITA 4G5PA 2W4KA 3FJQE 5EOLA 4ACGA 5IEVA 1NT2A 2IVTA 1KOBA 2OIDA 3H10A 2P2HA 4F99A 5CVHA 4ANNA 3W2CA 5IMEA 4MWIA 3LFQA 4D5KA 1LPUA 3QQFA 4CV8A 2PZPA 4ZAUA 3VJOA 3S95A 4QYFA 5E1SA 4ZSAA 1VJYA 3CQWA 4AG8A 2BFYA 3DA6A 3WF8A 3Q3BA 1XH5A 4WSQA 4WUNA 4G1WA 3QFVA 2ZOQA 2BPMA 4GVJA 4I0TA 4MD8E 4MXCA 4YSMA 5D12A 3BQCA 3R2YA 4O2ZA 4J8MA 1GOLA 4IE9A 5F20A 3OTVA 1PKGA 2XK9A 3IOPA 4FODA 3VS4A 4W4XA 3RAHA 4EOSA 3ZUVA 2PVJA 2VTHA 2YFXA 4RPVA 2JKMA 3QUDA 4DEGA 3ACKA 3QKLA 1BL6A 5EQYA 2GFSA 1SZMA 4L42A 4EI4A 5AUZA 4U3ZA 2BFXA 3QWJA 4UX9A 5DVRA 3SLSA 4RBLA 2QU6A 3KREA 4GU9A 3ULZA 5KMMA 2ITTA 4YJUA 5JMSA 2EXEA 4HCVA 3S4QA 4QPSA 3UJGA 3W18A 4EYJA 1JAMA 4W4VA 2Q83A 4HOKA 4RJ7A 4PDOA 4DC2A 3O50A 1RW8A 1OKWA 5K5NA 3A2CA 2B9IA 3V3VA 1WBSA 3CKWA 3HA6A 3B2TA 3G5DA 3LZBA 5M51A 3UC4A 4NFMA 3OBGA 4YBJA 3PIYA 4MXYA 3N51A 5BUEA 1OBGA 3ANQA 5AMNA 3ZM4A 5CAPA 4ZTHA 2C3KA 4FTRA 5DOSA 2UVYA 2QOBA 2BHHA 2XJ1A 3BBWA 3Q9ZA 4NTTA 4PX6A 5CSPA 5FP5A 2PULA 1AQ1A 3ITZA 4YHFA 3V8TA 5KBRA 2CGXA 4TWOA 3ZTXA 1E1XA 4TXCA 2E2BA 2W99B 3GNIB 3BPRA 4I23A 4N6YA 3TV4A 5L6OA 3NDMA 4U7ZA 3U6IA 3Q9YA 3IOKA 4I21A 4C0TA 5JFVA 3PTGA 3PDTA 5GJFA 5IUHA 3FKOA 1OMWA 3CBLA 1FVVA 2VU3A 3FQSA 4AT3A 4L43A 4A06A 3V5QA 3KRJA 3ZFMA 2HW7A 5ANOA 3SXFA 2W1CA 1XH6A 4YURA 1UNLA 2B4SB 4DEIA 4XBUA 3I81A 2H8HA 2J4ZA 4XMOA 2WTWA 4FT9A 4FV6A 3TN8A 4BCOA 3F5XA 2HZ4A 2IWIA 1LR4A 4YJPA 5FXQA 4FT3A 3AD5A 4PMTA 2JAMA 4JQ7A 1Q24A 3QX4A 5HU9A 1ZOGA 2VGPA 1SNUA 3QZFA 4KIQA 2EB2A 3D9VA 4L7SA 4YZDA 5DWRA 3R7IA 2OU7A 3SHEA 3EQIA 4P5QA 2OWBA 3KRRA 5EH0A 3OOMA 4TWPA 3SAYA 2ITWA 5HTIA 4NK9A 1KWPA 2JIIA 5I9ZA 2HENA 4J52A 4W9XA 3TNIA 5K0KA 5IH4A 3PSBA 1Q8YA 4XH6A 2IZRA 4ZOGA 2HIWA 2PUUA 2WMTA 5J79A 3MGYA 3UP7A 3I5ZA 4O6EA 3UTOA 3W2PA 3S1HA 4CEGA 4FT7A 5EQEA 4Z9LA 5J7HA 3DLSA 4JR7A 4RLKA 2UW9A 5JQ5A 3AOXA 3Q4TA 3QC4A 4PQNA 4RFYA 1H1WA 3PG1A 4BDKA 4YJSA 5DHJA 3IKAA 4IM0A 5LJJA 2WQBA 3PXKA 2NRYA 3DZQA 5L6WL 3UVPA 4F9CA 4O7VA 3O8PA 3TXOA 4BTKA 4ERKA 2XNBA 2X9FA 2H34A 2R3PA 4EKKA 2P2IA 4R7BA 2UVXA 4TPTA 4KBAA 3LE6A 4ZZOA 1Q8WA 4W8DA 1VEBA 2OXYA 1NXKA 4DH1A 4KS8A 3HV6A 4OLIA 4U3YA 4AA0A 1YWVA 3OP5A 5M4UA 1H1PA 4UXLA 4O0XA 3NUNA 5IH6A 1OVEA 5AP3A 3NIEA 4MCVA 2XKEA 2YITA 3FI4A 3JYAA 3NUUA 5AIRA 2Y9QA 4DAWA 5ETCA 1XO2B 3LFDA 3LHJA 4FVRA 3CS9A 2XBAA 2IW8A 3GC8A 3CQEA 1XWSA 5KMIA 4PMSA 2QOIA 5DE2A 4O0UA 2B54A 3EQBA 2B55A 4ITIA 5AP4A 5L8JA 4D2SA 2I0EA 4ZMEA 4FGRA 5DR6A 5G1XA 3HMNA 2VNWA 3QTSA 2R3NA 4X21A 3GU8A 4JR3A 2QKWB 4GS6A 3GI3A 3RAKA 2FA2A 4TW9A 2H6DA 4AXAA 1E9HA 3AXWA 4DE4A 1J1CA 4J99A 4UWCA 4PP9A 2W5BA 4O21A 4O96A 2G9XA 4LYNA 5GJDA 3KMWA 2I1MA 5AAEA 3KA0A 4YZBA 3UIMA 5K0XA 2W5HA 2HZNA 4I5HA 3VWAA 4JRNA 4D4YA 3E87A 3O71A 3VBQA 2R0UA 4GK4A 3HA8A 3M2WA 2PSQA 4FKIA 3GOPA 2UVZA 4NM7A 5IUGA 4FEWA 1Q41A 4FKGA 3QQGA 4FV8A 4M84A 4MXZA 4U8ZA 2XYNA 3AMBA 5EM8A 2PMIA 3NAYA 3POOA 4O7ZA 4BICA 5H8BA 2HYYA 1H4LA 3TIYA 4HVDA 4NTSA 3AC8A 2XIRA 1I44A 1XHAA 3LJ2A 2OJIA 1OUYA 1T46A 3F3UA 4IANA 1OIUA 3E8NA 4ZTNA 4YO4A 3EN9A 2YM7A 3EQPA 4KSQA 4FG8A 5BX0A 4GIHA 5IU2A 3JY0A 5JKGA 4FG7A 1KSWA 3FLZA 2VZ6A 2EXCX 3EQHA 4G6LA 5J95A 4CV9A 4CLJA 3U54A 4BBEA 2GHMA 2UZNA 2W9ZB 2WQNA 3LFEA 2OH0E 4LQMA 4QP7A 4R1YA 4XG3A 5LQFA 1PRYA 2XK7A 2RF9A 2C6EA 3BCEA 4LOPA 4BC6A 4AFEA 3ZS5A 2Z60A 5DFPA 1H27A 3GVUA 2QKRA 4R7HA 3RNYA 3RWQA 2IO6A 4CCUA 2BHEA 5FQDC 2CLQA 3OOGA 4C57A 4HCTA 1J7IA 2QOCA 1YHVA 3HV3A 1XJDA 1P2AA 5GZAA 3LLAA 4EK8A 5IA3A 5KKRB 4A9RA 4O0RA 4NH1A 4JI9A 4U79A 4DLIA 4OTPA 4R1VA 3R7VA 4RWJA 4DYMA 2W96B 3R6XA 3TDVA 2UZTA 4HZRA 5JGBA 2QQ7A 5T3QA 3R9NA 5EHOA 5BVEA 1H26A 5CEKA 2XH5A 3LFNA 3OT8A 5M55A 2X7OA 4B9DA 4Y85A 2X6DA 3FMHA 2XIXA 5E9EA 3TT0A 5IQAA 3GCSA 2ITVA 4G34A 5EW9A 4EJ7A 2LGCA 4J71A 4ITJA 3SXSA 1MRVA 2W06A 3COHA 3W33A 4FZDB 3R9OA 1QMZA 1PXMA 4FIJA 4E4MA 3FQHA 4FTTA 4FZ6A 3SXRA 4FG9A 4XRJA 4LGGA 3Q53A 5I9UA 2X0GA 3IW6A 4FUXA 2PVYA 2BVAA 3UMWA 5CYIA 3COKA 3CY2A 4KNBA 4O82A 2WAJA 3ZLYA 4DINA 4E93A 4LUDA 4A9UA 2Q0BA 4TYIA 2WMSA 3U51A 1L8TA 3RBWA 5ICPA 4FV1A 3MB7A 4B8MA 5BVWA 4S33A 3RINA 1YWNA 2VD5A 5IEXA 2C5NA 2R2PA 3F7ZA 4QNYA 5EI2A 3RP9A 2XK6A 3QHWA 2VX1A 4DEAA 1F5QA 5IQHA 3UVQA 4FTCA 3OROA 4L01A 3OFMA 5LVNA 1FVTA 4YTIA 4IEBA 4QMYA 3R7EA 1HCKA 3ZYAA 5IISA 3E3BX 3E8CA 4XV3A 5CSHA 2ITNA 3E88A 4J8NA 4O91A 3U55A 4FT0A 5HO8A 5CX9A 3NRMA 4O0YA 4JRVA 3MB6A 4JAIA 4IAKA 3PSDA 1ND4A 4QTCA 5C01A 2R7IA 2W4OA 4FVQA 4FA2A 4ORKA 4CG9A 5GINE 4FTMA 4RQVA 4F1OA 3GU4A 2JDTA 3GU6A 4GRBA 4IJ9A 4L3JA 5EQPA 3TZ7A 2YIQA 3OWPA 3UBDA 4FYOA 5LXMA 4O0WA 4BB4A 4RC3A 4NW6A 4C36A 4DT8A 4ENXA 4JLCA 2Z7QA 4LOOA 4JBVA 4HYHA 1I09A 4YPSA 2C0OA 2QOOA 1DI9A 1IRKA 4GL9A 4FSMA 3TDWA 4AGWA 3UPZA 1ZYLA 3WARA 3RTPA 4U9AA 2FYSA 4CQEA 3B8RA 2G15A 3IGOA 5L4QA 3BYSA 1WBPA 4IX4A 1QPDA 2WTJA 5HG8A 2C4GA 4RIOA 1OECA 4L8MA 1H25A 3BHHA 1PF8A 2GDOA 1V0PA 4YZNA 5GZ8A 5I4NA 1RDQE 4PMPA 4C02A 2HCKA 4KIKB 3G15A 3MY0A 2WU6A 3UNJA 4KIKA 4XP2A 2B52A 4FICA 1PMEA 4KRCA 4HVSA 4E3CA 5CAOA 3FY0A 3IW8A 1GY3A 4WSYA 2ERZE 4X6QC 3MH1A 1PYEA 3V8WA 3ZHPC 3ZZWA 3AMAA 4XV1A 5CXHA 1TVOA 5ANGA 3CJFA 2YDJA 4KKHA 3OS3A 1BUHA 1NVSA 4AA4A 5CAVA 3QQUA 3C13A 3L8SA 4R7IA 1X8BA 2PZRA 3ZM9A 3HMIA 1OITA 3V5TA 1M2QA 1JKSA 4J7BA 4H39A 2V5QA 1OUKA 3KKVA 3R0TA 4F0GA 4GFGA 5D9HA 2ZV9A 1H1QA 2AYPA 3DNEA 1UNHA 4H1JA 5T6KA 3W2SA 5DYJA 5IQDA 1LP4A 3O23A 3NNWA 4OBOA 3OMVA 5DRBA 3MH3A 3CQUA 3UOLA 5IQGA 2YIRA 2E9PA 3AD6A 5AX3A 4HGSA 4K9YA 2VTIA 2ZAZA 3I7BA 2OXXA 2HXQA 3NMUF 3NCZA 4QP2A 4FF8A 3A61A 3ZO1A 2J50A 2VV9A 4Y46A 1O6LA 3D14A 3KEXA 2YM3A 3F3TA 3FPMA 5BMMA 4KB8A 3FLWA 4QQJA 4RZVA 5EI6A 2I0HA 2ITZA 5F1ZA 2O2UA 5K4JA 5JZNA 4IX6A 4C59A 1DM2A 1Q3WA 4S32A 3BE2A 1YOMA 3CCNA 4UB7A 3ALNA 5C4KA 4M97A 4P4CA 3CP9A 1UA2A 3PJ2A 3ZO4A 2VTSA 5JSMA 4PL3A 3W55A 2BZHB 3DKOA 5TF9A 5JFXA 2PVRA 3MVLA 4L3PA 3ANRA 4RX9A 3C4ZA 4GU6A 4I0SA 4G2FA 5HOAA 4DEEA 4DLJA 3LCKA 2PVLA 4J53A 4ZTQA 5HCXA 1ZY5A 2GS7A 4FV9A 4ZZNA 5BUIA 3ZBFA 3FDNA 4IIRA 3VUIA 4BI2A 4FTLA 3OHTA 3V5PA 4EL9A 4F6UA 3C5IA 2VTNA 3WZKA 4CSVA 4AW1A 4GJ2A 5H3QA 4ACDA 3OUKA 3UP2A 3OY3A 3VUGA 1OKZA 4Q2AA 5FBOA 5DGZA 3E62A 3KXMA 2F2UA 3DK6A 4KBCA 4V05A 1YXTA 4FKRA 3ZBXA 5CLPA 2W1GA 4FVPA 4GFMA 3I6WA 3V6RA 1ZYDA 3ZFXA 1CMKE 5E4HA 3VUDA 3F69A 3WZUA 4F9AA 5M09A 2XVDA 1F3MC 3PE2A 2FGIA 3BGQA 3FSFA 5AAGA 4L00A 3P7AA 5AR7A 3VS0A 1KE7A 5HE3A 2PE1A 3MVMA 3RCDA 3JXWA 2C6OA 2R3LA 3PA3A 3OCBA 1KE8A 5JRSA 2XS0A 4EC9A 2J0LA 3TM0A 3IDBA 2A4LA 2CGVA 3ZRLA 3CIKA 3OWKA 3ZO2A 4EOIA 4V0GB 3R8LA 4JBPA 5HESA 3VUHA 3LM5A 5DLSA 1RE8A 5AP6A 4V0GA 3RALA 3PE1A 5DIAA 3NIZA 3PPZA 1GIIA 3HP5A 3V5LA 5HLWA 4Z3VA 3NNVA 3L9NA 1U54B 5KZ0A 1WBWA 2R3RA 1W83A 2SRCA 4U40A 5C1QB 3FHIA 4R3RA 1U54A 3M42A 3FSKA 4NIFB 1QPCA 2HZIA 4E6DA 4ZIMA 2JDSA 4NIFA 2AUHA 1JBPE 5LCKA 3ENHA 4JX7A 3TV7A 4DH3A 3PVWA 4FZAB 4QMUA 3TIZA 4I93A 5IA0A 5HO6A 5LVMA 2GU8A 2BRBA 4DFBA 4DFNA 3PPJA 2ZMCA 4XG6A 2XP2A 4DH8A 2XM8A 3HRBA 3P4KA 3QRTA 3L8VA 4EWHA 5HTCA 4G3DA 4GIIA 3UOKA 3DJ5A 2OK1A 5KBQA 1GIHA 3R8MA 3KXHA 3HKOA 4PF4A 5HTBA 4NL0A 4DCAA 4LRKA 2ITQA 5CEMA 4MQ2A 3WYYA 3NGAA 5CEQA 1ERKA 5AM7A 5DPVA 5BVFA 4D4VA 5J5TA 2QR8A 2Y7JA 3FLSA 4BIDA 4C34A 4FKUA 4X2GA 1OL5A 4DCEA 5HZNA 2V0DA 3DLZA 3AT3A 3C0GA 4AACA 4AGCA 2CNUA 3JVSA 3SD0A 3Q04A 2J5FA 2E9VA 3V01A 4BWPA 4AGDA 3D94A 4FKQA 2FH9A 4JVGA 1ZOHA 1FMOE 2Z7LA 2BRNA 2YDIA 2X8DA 4IAZA 2YIYA 4C3RA 4TNDA 2WGJA 3LIJA 3CSVA 4Y5QA 3TNHA 5CVFA 4YJTA 2JGZA 4JJRA 4MD9E 5EM5A 5B2MA 4XV9A 3TACA 3W8LA 3NUAA 4DTBA 4XP3A 4Y95A 4DEDA 4FTUA 4OTGA 4OT5A 1XH4A 3HLLA 4X2KA 4BCMA 4XG8A 3E7OA 2BMCA 4UV0A 4CTBA 5H2UA 1KE6A 3CTJA 5HE0A 2WELA 4HPTE 5FRIA 5HX8A 1WBTA 3MIYA 5HIBA 3V8SA 2BAKA 2QU5A 3EN4A 5A14A 5HU3A 4CFWA 3DXPA 1UU8A 1FVRA 3U9CA 4B8LA 3HDNA 1TQIA 4MEDA 3M1SA 1UNGA 5EK7A 3DBCA 2XNPA 4FSTA 3EQGA 3ZONA 4WOVA 5ANJA 4LOQA 5B7VA 2I7QA 1MRYA 3PY3A 3TTIA 3QGYA 4EZ5A 4EUUA 3EL7A 3DNDA 2ZJWA 4X2NA 3NYNA 5IUIA 3BX5A 1ZYSA 3IS5A 4EUTA 3QQKA 4EBWA 3DKFA 2JEDA 4IWOA 4XCUA 5K9IA 2PYWA 2WMVA 3DBDA 5AV2A 5HKMA 5EHLA 3UVRA 4QMVA 4J98A 4K8AA 1M2RA 3UOJA 3FMNA 3OW3A 2VTLA 3KL8A 3PP1A 4BY9E 5I9YA 3A7GA 2R64A 3PVGA 4BDEA 3THBA 2W9FB 4JNWA 4FX3A 3MYGA 3RNIA 1JSUA 4GUEA 3R1SA 3W2RA 4G31A 4WHZA 3GGFA 2O64A 2R3IA 3QZGA 2BKKA 2PE0A 3I5NA 5KMOA 4BTFA 2R9SA 3T9TA 4W4WA 3QKMA 3EYHA 5LOHA 2OJFE 2V22A 2WTKC 3BI6A 4NJ3A 4EWQA 3O8UA 3I4BA 3BWFA 4KWPA 3GUBA 3KXXA 2A27A 1DAWA 2BTRA 3LXLA 2G2IA 3O51A 5T68A 2QHNA 3RPVA 2BDFA 4AAAA 1PXNA 4G3GA 4IDVA 4X0MA 5DI1A 4KA3A 4UXQA 3TEIA 1H24A 3D5UA 3WZDA 4AT5A 3Q4ZA 4C62A 2X7GA 2JKKA 4H3PA 4H05A 4OTFA 1G8SA 4BKJA 4KAOA 3RHKA 1ZYJA 3KFAA 2BAQA 3TJDA 5HNIX 5BPYA 2C5YA 3P86A 3RZFA 4MK0A 3W32A 3ORKA 2P33A 4AZVA 2CN8A 4FIEA 4BIEA 1XQZA 2Y4PA 3HMPA 3G33A 4YTHA 5H8EA 5HNBA 4ZY4A 5KMJA 1P5EA 1JQHA 2ZV2A 1HOWA 3Q5IA 4LV5A 5ACKA 4CMUA 2OFUA 3QAME 5HIEA 5LMBA 3R30A 3UG1A 3KY2A 3OY1A 3TKUA 3LCSA 4IHPA 1WCCA 5IQCA 3FMEA 4BTMA 2JBPA 3U9NA 4TYGA 2XZSA 5JGDA 4JIKA 3Q6WA 4MQ1A 3HV5A 2WPAA 3T3UA 1H8FA 3HL7A 1JVPP 4EYMA 1J1BA 1H1SA 4BFMA 4D0WA 1YDTE 4Y5HA 3EHAA 1NVRA 2A2AA 2F7XE 2W1IA 3VBVA 5E8YA 3BV2A 2CJMA 5E92A 3NSZA 3IDCA 4G3EA 1OL2A 4IVAA 1MRUA 1JNKA 2DWBA 2NO3A 4YZCA 3U4WA 3H4JA 4YC8A 2XNGA 4A4OA 4AX8A 3VS7A 3LXPA 4AZWA 5CI6A 1GZNA 1YOJA 2WIPA 2YAKA 3FAAA 3CE3A 5L3AA 1OL1A 4QYYA 2Z02A 3OEFX 4BI0A 4EC8A 1VZOA 3NLBA 4J96A 2WHBA 5HE2A 3WE8A 2R4BA 3KVXA 5E7RA 5D41A 4O27B 3F7WA 1P4FA 1CM8A 1A9UA 3QALE 3PWDA 5F95A 4YP8A 4QQTA 2C47A 4NCTA 4F0IA 2VTMA 5FUTA 3E63A 4XP0A 2HELA 3RI1A 5M57A 3UQFA 5KMNA 2HY0A 3PJ1A 4BKYA 3LKMA 4RA4A 4IVDA 4D5HA 3NNUA 5CWZA 3ATTA 4I94A 3MFUA 3HX4A 4IADA 5HVYA 4IW0A 3ORLA 2YIWA 3U4UA 1OBDA 2QOKA 5HVJA 5B0XA 2R3HA 3BE9A 3PSCA 4CCBA 3FBVA 3R1YA 2C6DA 3ORPA 1APME 2ETRA 3LPBA 4D55A 5A4LA 1M52A 3ZMMA 1Q8ZA 3DCVA 3NW7A 1YI3A 3NX8A 4QPMA 3FMDA 5JH6A 4ASXA 1M7NA 4C4EA 2OICA 3QCXA 4JQ8A 4EQUA 5L2TA 3ZXTA 4FEXA 4K2RA 2WTIA 4AZFA 4DGLC 1IAHA 4Z16A 2V55A 2OI4X 4MHAA 2BILB 2V62A 4BRXA 5JT2A 2BZKB 3UPXA 2RSVA 3ORMA 3UO4A 4CZUA 3MPTA 5LWNA 3NUSA 2PVNA 4UZDA 5IG1A 3JR1A 3UO6A 1QPEA 1YDSE 3D2KA 4UWBA 5FXRA 3VULA 5E1EA 5AFVA 2QODA 3Q4UA 5IQEA 3FI3A 3ORZA 3EFWA 1M7QA 3KXGA 4FSNA 4EK5A 1PMVA 4USEA 3C4CA 4NW5A 1BLXA 2B1PA 2B0QA 4M69A 3OBJA 4TKSA 3V51A 3EQFA 3Q4CA 3IK3A 2PUPA 2R3MA 1YDRE 1FINA 1PMUA 4RJ6A 3AC1A 4PL5A 2YAAA 4UBAA 1K2PA 5E8SA 4D4SA 5A9UA 4UMPA 4M15A 2XEZA 4H1MA 4CFUA 4ZLZA 4R5SA 5J8IA 1PKDA 2XA4A 4LV8A 4GJ3A 1Q3DA 2WZJA 1W82A 2UZWE 2YCQA 4QP1A 4ASEA 5CEIA 4B6LA 5L2IA 4MH7A 4E5BA 4IX5A 4ANBA 3DS6A 3RK9A 3RM7A 4YUQA 2QLUA 4EH9A 4FNXA 2PVFA 3Q52A 3QTRA 3C4WA 1BI8A 2A1AB 2BRHA 3DBEA 3LCDA 5I9WA 4A7CA 4N4SA 5HNGA 4GT4A 4MTAA 1MQBA 2C6LA 3LOKA 4OTWA 4CMOA 1YXUA 1ZZLA 3HV7A 4GV1A 4BZOA 4TNBA 4IWQA 5AA9A 5AAFA 3TZMA 2FSLX 2ONLC 3VW8A 4IMYA 4Q5HA 4ANMA 3CJGA 4AE9A 2PU8A 3K3IA 3FL5A 3FMMA 4I24A 4I20A 4O0SA 2QO2A 1Z57A 4RWIA 2CGUA 4BDBA 2Z2WA 3TV6A 5M06A 5KCVA 3CKXA 4ZTSA 3PFQA 5L2SA 4CYJA 4FOCA 2ZM1A 4FKVA 4CFVA 4EBVA 3TL8A 1KV1A 1H1RA 4AW5A 2R3GA 5D11A 2IJMA 3LFSA 3JVRA 1PW2A 4PL4A 2DS1A 4P90A 4EHVA 2R5TA 3PVBA 2YEXA 1KV2A 4GYIA 4CKJA 2KULA 3N4TA 4FKLA 3DOGA 1YOLA 3K3JA 4JL9A 2OZOA 5FEEA 4AOIA 4I4EA 4NKAA 2UW8A 5EI8A 4FIFA 4R77A 2RG5A 4AWIA 3HAVA 4GK3A 5DEYA 2IVUA 2OKRA 4WBBB 4C2VA 3MBLA 5FLFA 3RAIA 3RPRA 5A4EA 4TTHB 3FZ1A 3A7HA 4XHKB 2W1ZA 1U4DA 3K54A 5C8KA 4I92A 2IN6A 1KOAA 3R1NA 4DFLA 4OTIA 3MPMA 3QD3A 1FPUA 3R02A 3ODZX 4G5JA 2XBJA 4GG7A 2NP8A 3UZRA 2ZB0A 5ETFA 3MH2A 1JOWB 3EH9A 4BZNA 5LWMA 3KN5A 3AT4A 4RIWB 5JRQA 1J3HA 5LVPA 4LFIA 2HWOA 2RG6A 3GB2A 2FB8A 2X9EA 4HZSA 4RIWA 4XUFA 5I3OA 2ITUA 3D2IA 4BVUA 4KRDA 2X39A 4S2ZA 4JT3A 4RC4A 3UC3A 4AOJA 4CYIA 4E4XA 5HQ0A 2XRWA 5AJQA 3SW7A 2WMBA 3FKLA 2O5KA 4F9BA 4O7LA 2QVSE 3QRKA 3BU3A 3RAWA 3VN9A 1JWHA 1U5RA 3MIAA 2PZ5A 1CTPE 4MKCA 5AP1A 3QKKA 4ZLOA 2VTQA 3JUHA 3SOCA 2G1TA 2J0JA 2ZVAA 3FMLA 4IZAA 3U87A 4HGTA 3NEWA 2VWIA 2I40A 4FKWA 4QP4A 1O9UA 2DUVA 4I3ZA 5KHWA 4EOLA 4AZSA 3LCOA 5M08A 1PMNA 2HAKA 4GMYA 4LG4A 5HCZA 4BI1A 3QZIA 5FXSA 1J91A 3TZ8A 3KRXA 3R1QA 1OGUA 3PPKA 3GCUA 4JG8A 4MBIA 3ZSGA 3Q2JA 2X8EA 4UMQA 2W1HA 5J9YA 3QWKA 4I6HA 4U45A 3IPHA 3WZEA 4D2WA 4GFOA 5EG3A 3VJNA 4FTQA 3QZHA 4EKLA 4GYGA 4XNEA 2YIXA 3PLAE 5IDNA 3OCTA 4MBJA 3C51A 3KN6A 5ETIA 3K5VA 1ZY4A 3LQ3A 3OVVA 3QA8A 4CFMA 3QQJA 3ZC5A 4B99A 3Q2MA 5CU0A 3FLYA 4JS8A 3ATSA 3F61A 3WILA 2QLQA 2CNVA 4O7SA 5AR8A 3I79A 3VO3A 3VVHA 5F94A 3P78A 3L9MA 4L68A 4ALVA 3Q5ZA 4U41A 4NYEA 1Q5KA 4R78A 4NWMA 3DQXA 2O3PA 1K9AA 4BCHA 5HX6A 3A4PA 4DBNA 5HBEA 3EQCA 3C50A 1WBOA 3ETAA 2UZVA 4UY9A 3VBXA 5EDRA 1PXJA 4ANLA 4ZXTA 5AUVA 2G2HA 3QC9A 3CC6A 1WVXA 2WEIA 3RK7A 4AA5A 2RIOA 4ARKA 3E8EA 4F1TA 4TL0A 3GT8A 2WMQA 5FBNC 5M44A 1OKYA 4XOYA 2VWYA 4O83A 5CU2A 4YR8A 2YA9A 3ERKA 3H0YA 4NCTC 3NYXA 5AP5A 4BDCA 2F7ZE 3D7TB 4I5PA 3ENMA 3FZOA 3UG2A 2XKFA 5CT0A 1R3CA 4USDA 3D7TA 4S31A 5GIOE 4GSBA 4F65A 3R8VA 4WNOA 1YHSA 2X2LA 3NNXA 4EZ3A 4YLLA 5CALA 4O84A 3UIUA 3PY0A 1AGWA 2WTDA 4YSJA 2W7XA 5HGIA 4ZMFA 3DXNA 3TNPC 4PDPA 2HOGA 3H9FA 2BZIB 4M0YA 2C5VA 1M14A 2C3JA 5IPJA 3N4VA 4ITHA 4RWKA 5TR6A 4E73A 4M8TA 3DFAA 3GCQA 5HCYA 1U5QA 2XCHA 5HEZA 2QG5A 4QRCA 4XX9A 1U59A 4CKIA 4RJ5A 5AUXA 5KX8A 4BR3A 3GOKA 3SKCA 3PXFA 4F63A 5HVKA 3QQLA 4ASZA 4CFFA 1EH4A 2VWVA 4BDIA 3CGOA 4OBPA 2CSNA 4QMMA 3P23A 2OF4A 1OPJA 3QLGA 4NEUA 5DG5A 4ZZMA 1SNXA 3D5VA 2IPXA 3DU8A 4PMMA 1DI8A 1H08A 4IH8A 2WMRA 2WMXA 3LFFA 2BCJA 1ZWSA 2CCHA 4I5CA 4K33A 2WOTA 4EK6A 2CKQA 3QBNA 1J7LA 4KSPA 5JFWA 3POZA 3RGFA 4K11A 5FTOA 2IVSA 5GHVA 3V04A 3ET7A 3QCSA 4DFUA 3T3VA 3LCTA 2YABA 4LRJA 4IAIA 3EZVA 2WB8A 2WTKB 3ORNA 1FQ1B 3OXZA 3COIA 4U81A 4IWPA 4DH7A 3EL8A 4XV2A 4LM5A 2E9NA 2J0IA 3UQGA 3ZH8A 4FV0A 2ESMA 4NFNA 4JDIA 4XG2A 5CVGA 3T9IA 4D1XA 1B39A 4XJ0A 3ZO3A 4L46A 1Y8YA 3R01A 3BU5A 3UO5A 2YDKA 5EKOA 4CZYB 5HG7A 4IB1A 5B2LA 5C8NA 4OAUC 5KUPA 3OWLA 4XEYA 4Q9ZA 2CCIA 4OR5A 5J7BA 2PZYA 2FSOX 5CS6A 4E1ZA 3S00A 3UIXA 2QURA 4ZSLA 1YW2A 1J7UA 1IR3A 2GNGA 2GSFA 4FKOA 3C1XA 3I0QA 3Q96A 2OIBA 4GVAA 1PXIA 1GZ8A 2VX3A 1QL6A 5DN3A 1WMKA 2B9FA 5CT7A 2YCFA 2XNEA 3TTJA 4ALUA 1S9IA 3AMYA 2PVKA 2R7BA 4FTOA 3BEAA 3GXLA 3QUEA 2BKZA 4PY1A 5GZ9A 2V7AA 1SVEA 4ZJIA 4DGOA 3QUPA 5EM7A 1K3AA 4G6NA 3HV4A 1R0EA 3OW4A 4FI1A 4WRSA 1RJBA 4JBQA 3UOHA 3FV8A 4LI5A 1OB3A 4DF3A 3L8XA 4RVTA 3CPCA 1R78A 2OF2A 5EW3A 3KK9A 4BCPA 1HCLA 1OIYA 4F6SA 1G5SA 1XBAA 2XM9A 3RM6A 3KXNA 1Y8GA 3LXNA 2WIHA 3MY5A 3MH0A 5AWMA 4IFCA 5EDPA 4EOQA 5DRDA 3G6GA 3WF5A 4O7RA 2UZOA 4G16A 5EYMA 1FGIA 4QO9A 5E8TA 4ASDA 4FV7A 1ZMVA 1SVGA 3BRBA 2WEVA 4IB5A 4MVFA 4R6VA 3PUPA 4TWNA 5L8LA 5LCJA 3VS6A 4RWLA 5HD4A 3QXOA 5FM3A 4APPA 4BN1A 2XCKA 4EHGA 4EOJA 5AA8A 1YHWA 5EOBA 5E8VA 3OCSA 3QTUA 3O96A 5HO7A 5CQUA 2JFLA 4C8BA 2ZV7A 4LMUA 2PMLX 5EYKA 2VAGA 1YI6A 3SW4A 2IW9A 4IFGA 3ZSIA 4B0GA 3D15A 4D2RA 4EK4A 4O6LA 3HGKA 3LLTA 4BBMA 5CU3A 4BGGA 3QCYA 4H36A 2RGPA 3QRUA 2WD1A 2X6EA 5F4NA 3RMFA 2QO9A 3NWWA 3ZUTA 1XH9A 2J0MB 4G17A 4JBOA 4X2FA 5DBXA 4AN2A 4JDJA 3A62A 3A7JA 4E20A 3F2RA 5EW8A 5GNKA 4QTEA 2QD9A 4MF0A 3WOWA 3TKIA 3DB8A 3ZDIA 4II5A 1JKKA 2R3FA 3A8XA 4S30A 5E91A 3C4XA 4UN0C 2J90A 2XIKA 4AE6A 4BDDA 3LMHA 3QRIA 2NNWB 3BIZA 4L52A 4W8EA 4IB0A 3V6SA 2Y8OA 4G9RA 3ULIA 5JEBA 4YC3A 4FV5A 4EOPA 5IA5A 2HW6A 1MP8A 3CPBA 3ZEPA 3MSSA 2UZLA 3AGMA 3R9RA 2PE2A 3D83A 3PVUA 4CVAA 4USFA 2VTRA 4JDHA 4KD1A 4R8QA 2XMYA 4YJRA 3VBWA 3SC1A 3ZC6A 3KB7A 4FV3A 2HXLA 3FYKX 3LAUA 3C4EA 4QYEA 4RVLA 3ZLSA 4CD0A 5CI7A 2V7OA 4YTFA 5HI2A 4I22A 3G0FA 4QQ5A 4BKZA 3SG9A 4FK3A 4FSWA 5J9LA 3MS9A 4C35A 3GCVA 4RFZA 5A6OA 3PRFA 1O6YA 3EN5A 3FQEA 2GNLA 1CSNA 2PUIA 5BNJA 1Q61A 2X8IA 3UE4A 4FTKA 1WAKA 4I6FA 2BRGA 1XH8A 2VTJA 3NS9A 3QTWA 4L44A 4OAVB 2Y6MA 4C38A 1G8AA 4F7JA 3RCJA 4JQEA 4TN6A 5DT4A 3A7IA 4CRLA 3BGZA 3C0HA 3VNTA 2JDVA 3NPCA 3PA5A 3VUMA 3IECA 2RFDA 2VTOA 4IZYA 4AF3A 5A3XA 1OIQA 1Q8UA 3GU5A 5C4LA 2PZIA 3PLSA 5J5SA 1GAGA 4J97A 4BZDA 2RFEA 3WIGA 4B7TA 4BYIA 3A60A 3G6HA 5JQ8A 3ROCA 5EKNA 5AR3A 5IQFA 4PV0A 3R7YA 2J9MA 3CY3A 4HNIA 4NU1A 5EDQA 2YM5A 3FI8A 3WE4A 3PJCA 2W0JA 4BDGA 4HYUA 3VRYA 4U97A 4FK6A 2J7TA 5K3YA 2C3IB 5L8KA 3UNKA 3DBQA 1H07A 4ALWA 2CKPA 1M17A 2YLFA 2JDRA 4ZTRA 4D2TA 3HAMA 2CDZA 3N9XA 4MNFA 4D4RA 5LARA 3DAKA 4A9TA 4UYAA 5AP7A 4HNFA 5FDXA 3E3PA 4FL3A 2ONLA 5D7AA 4WT6A 1H0VA 2YM4A 5M4FA 4KBKA 3V5WA 3C7QA 4GKHA 1JKLA 5D10A 4N0SA 2BDJA 2PK9A 2XKDA 4PRJA 3ORXA 4XG9A 4EH3A 2W1FA 4GEOA 4WO5A 4GUBA 5CENA 4CQGA 5M4IA 2QG7A 2F57A 2PVHA 5CZHA 4KKEA 2YCSA 1H28A 2IVVA 2OJGA 3QYWA 2ZV8A 4EH7A 1XH7A 3BYVA 4HW7A 3MESA 3QTZA 2XUUA 3P0MA 3EJ1A 4FEVA 4AQCA 1KE5A 3KMMA 5E8WA 5HORA 3WYXA 1Y6BA 4O0TA 4F08A 4UMRA 4CT1A 5H9BA 5ANKA 1ATPE 4F7LA 3Q9WA 4FZ7A 5DMZA 4A9YA 3DTWA 2VNYA 2OO8X 3F2AA 5AX9A 3B8QA 1NW1A 4YJNA 4QMOA 4AUAA 4JIAA 4BWKA 3WF7A 3GFWA 5IA4A 3IG7A 3KCFA 4QTAA 2XKCA 3VQUA 5CANA 2P4IA 3IQ7A 3MJ2A 4L53A 4MNEB 3VRZA 1UU9A 4NM5A 3UNZA 4YGAA 2PVMA 4F64A 3PP0A 2GS6A 4MNEA 4WIHA 4FEQA 4RG0A 4XBRA 5A46A 3QTIA 4OW8A 3F9NA 2X4FA 3QX2A 4JXFA 2WTCA 2YZAA 4RZWA 4CMTA 1YVJA 2OW3A 4FTIA 4D9UA 4M67A 2PHKA 1H01A 3KRLA 2X2MA 3D0EA 3MFTA 1RQQA 3OG7A 1FOTA 1SYKA 4OTHA 4RSSA 3UDBA 3WF9A 4AOTA 3F3VA 3FXZA 4QMQA 4PDYA 3IO7A 4TY1A 3MVHA 3RKBA 3ZDUA 4L45A 3RZBA 4OTDA 3I7CA 4XOZA 2F4JA 5FDPA 1SMHA 3EFLA 3MPAA 4F70A 2JAVA 2A0CX 2BR1A 4QPAA 4IDTA 3BYMA 1S9JA 5TT7A 4C61A 4C2WA 3DV3A 1R0PA 4ZP5A 2FO0A 4M66A 2XNOA 3GCPA 4QMXA 3R7UA 2WQEA 3QF9A 4BCIA 5J1WA 4F4PA 3DB6A 3EFKA 4U42A 4HVHA 5IMXA 2PMNX 3O2MA 5GIPE 4EHEA 4WKQA 4Y83A 1V1KA 4GH2A 1LEZA 1Q99A 5HG9A 3BLQA 2PUNA 4ZSGA 1JSTA 1UWHA 3C9WA 4L67A 3DAEA 4FV4A 4KINA 4Q5EA 4HVIA 2J0KA 4FNWA 4NUSA 2BUJA 3AC2A 3AQVA 5DT0A 2ZM3A 4C3PA 1MQ4A 1Z5MA 3EQDA 5CU4A 2J6MA 4RVMA 4D1SA 2PTKA 1W84A 4ZJVA 2YISA 2YN8A 3QTQA 4TWCA 4U5JA 3LQ5A 2JFMA 2YWVA 1YI4A 1PXLA 4BCNA 5JK3A 3LXKA 5IDPA 3UZPA 1ZXEA 2REIA 2VWUA 2Y4IC 3MA3A 3FC1X 3SOAA 3EQRA 4O7YA 2GNJA 3CGFA 4FMQA 4DHFA 3VS5A 3K2LA 5HBJA 1XBBA 4G3CA 4OUCA 4WUAA 3BV3A 3GQIA 3LM0A 2YERA 2ZYBA 3R9HA 3FZSA 4OGRA 4TT7A 4WD5A 4N57A 3VUKA 4E6QA 4F1MA 4MD7E 4CFNA 4AS0A 4CXAA 4QTBA 2I0VA 4Q9SA 1YXXA 5C8MA 4IQ6A 3F82A 4WA9A 3LVPA 2I0YA 3PIZA 2VO0A 4O22A 3ZSHA 4BTJA 4PPAA 4IBMA 4HYIA 2ITYA 1PXKA 3HRFA 3SRVB 4FC0A 4YZMA 3QRJA 4FTAA 4QYGA 3FI2A 5ANDA 3SRVA 1WBVA 3QLFA 5FWKK 4DN5A 4MX9A 4JX3A 2YM8A 3PWYA 3ACJA 3D5XA 4O38A 5CAQA 1OKVA 1URWA 3CXWA 1VYWA 2BZJA 2PMOX 3COMA 3EIDA 3ODYX 3O8TA 3OXTA 3PXYA 5CEOA 4P2KA 5AR4A 2C6IA 4R5YA 4DTKA 1Y6AA 3P79A 2UZBA 4ANSA 3SA0A 4ZSEA 2QOQA 1QCFA 4QP8A 3RHXA 4QTDA 3SVVA 3P7BA 3DKCA 4JAJA 2GQSA 4IC8A 5TOZA 4QMWA 5DH3A 2P0CA 2W4JA 4IB3A 3WZJA 1GZKA 4A4XA 1PYXA 2XJ0A 3MFRA 4GK2A 2G2FA 1Z9XA 5K4IA 5I9VA 2C30A 4KKGA 1OIRA 2BAJA 3F6XA 3R7GA 2F9GA 3PXQA 3QU0A 4IAYA 5BVNA 3MI9A 3ZFYA 3QTXA 5IZFA 2WMAA 4K18A 5EHYA 2RKUA 4U80A 5KNJA 4XLVA 3DK7A 3NW5A 2C0IA 4IX3A 4FZFB 1FMKA 1TQMA 2WQMA 2WQOA 4K1BA 4LMNA 4NT4A 4CZTA 2NPQA 4ZS0A 2GCDA 3AC3A 3IGGA 5TE0A 3H30A 4J95A 4OT6A 3ZZEA 4RC2A 2CPKE 3GFEA 2DYLA 4O2PA 4P5ZA 4M69B 3HYHA 3PZEA 1Y57A 2J51A 4ANOA 5I5ZA 4FYNA 2QCSA 5L2WA 1FBNA 1CDKA 4EH8A 4DG3E 4E26A 1R1WA 2YHVA 2C68A 3R73A 2EUFB 4TRLA 3EFJA 3P5KA 2IZSA 2Z8CA 1PJKA 1Q62A 3BYOA 3R00A 4TYJA 5AIKA 1NA7A 3TWJA 5BYYA 2FSMX 5CQWA 3NR9A 1OL6A 4F09A 2CKOA 4C4HA 2C3LA 4K77A 4WNKA 4YLJA 3BWJA 3AC5A 3G9NA 4K6ZA 4DGMA 5BQ0A 2ERKA 3WI6A 3Q9XA 4AGUA 5A6NA 4C33A 4DH5A 3SQQA 4QMNA 4FR4A 3HNGA 4X7QA 3PRIA 4L3LA 1ZOEA 3A7FA 2Z7SA 3II5A 4B4LA 1UU3A 4BDHA 1U46A 3DGKA 4FGBA 3R7OA 3DQWA 3IDPA 2WFYA 3PY1A 4PWNA 4M14A 3KRWA 4RRVA 5CAUA 2YCRA 2OFVA 2E9OA 1PY5A 2ACXA 3NZ0A 4HGLA 4XG4A 3UODA 5CASA 5D7VA 5K5XA 1OPKA 2EWAA 4ONAA 3BU6A 2IW6A 3MWUA 5AADA 2P55A 1E1VA 4EH5A 5KMLA 4O86A 2UW7A 4D1ZA 3OWJA 4UZHA 5LVLA 3R9DA 3RVGA 4BDAA 5A4CA 3TUDA 4BDJA 3NUYA 3BELA 4QYHA 1UKIA 1CKPA 3FWQA 4EORA 2CGWA 2X7FA 3OXIA 4L9IA 4IJPA 4D0XA 3F88A 3OT3A 5IEYA 4BCFA 3D7ZA 2VO3A 2I6LA 2UW4A 2VO6A 3F3WA 4I5MA 2CMWA 5KZIA 4WNMA 1PXPA 1OI9A 1WVWA 4QMTA 2GNHA 5DR9A 3BHTA 3QHRA 3R8UA 3PXRA 2IZTA 2YLEA 4IM2A 3AD4A 1A06A 4XG7A 3DJ7A 2JBOA 2GQGA 3HVCA 1GJOA 3AT2A 3KC3A 3L8PA 3NUPA 4IXPA 5AV3A 4QNAA 4U6RA 4BHNA 2DQ7X 3LMIA 1REKA 3F66A 2XNNA 3H3CA 3KQ7A 3BYUA 4ACMA 4BWXA 3DBFA 3V5JA 3FEGA 4CGAA 4XS2A 5FG8A 4D28A 4FV2A 4GCJA 4GW8A 5M4CA 4IZ7A 5G6VA 3FYJX 2AC3A 5E8ZA 1PHKA 4FSUA 1Y91A 4FSZA 2X2KA 4RJ4A 4RQKA 1JKTA 3BHYA 4Y73A 5CF8A 5JFSA 1YRPA 3KGAA 1FGKA 3VUTA 5LMAA 4RIYB 3HMOA 4QP3A 1W98A 4YZ9A 3R04A 3UYTA 3C5UA 2J5EA 2EVAA 3TCPA 4RIYA 5C26A 4FIGA 5CXZA 5IA2A 5L6PA 2WOUA 4LGHA 4EZ7A 2XIZA 3DKGA 3ALOA 3NVMB 4HCUA 3E8DA 2RL5A 2WMWA 4UYNA 5ETAA 4FTNA 4IZ5A 3ZUUA 2QOHA 4BYJA 4S34A 5AP2A 3R8PA 2VGOA 5IH5A 1LEWA 2VWXA 3PA4A 3EZRA 3U6HA 5HG5A 4TYHB 3WBLA 4BCQA 4WG4A 4GG5A 4TYHA 3VC4A 3MTLA 5EFQA 3UQCA 4ZY5A 4F9YA 5B2KA 4C4IA 4IAFA 4QOXA 5AR5A 4CT2A 1B6CB 5AEPA 4IACA 4PNKA 4Z55A 2R0IA 2JLDA 2UZDA 4QMPA 4Y8DA 2OBJA 5IF1A 4YO6A 1WZYA 2KTYA 3L9LA 3R71A 3UIBA 4RA5A 4WNPA 3MV5A 3GC0A 3LJ1A 4WG3A 3Q32A 2WXVA 4A4LA 4FSYA 3REPA 4YLKA 3F2NA 4IVBA 3MTFA 5KMKA 4LGDA 1WVYA 4RMZA 4QP6A 3SG8A 2F2CB 4DITA 2C69A 1REJA 1WFCA 1BL7A 2GMXA 3LJ0A 5LMKA 1YXSA 2H96A 4C3FA 2Z7RA 1Q97A 1V0BA 2GQRA 3FKNA 3P08A 1KUTA 4FL2A 3VIDA 4PUZA 3KVWA 5E8UA 3S0OA 4AT4A 5M07A 2EB3A 2VWWA 3MFSA 3VBYA 4AU8A 5J1VA 2VTAA 3W16A 1XBCA 4BIBA 2HY81 2HZ0A 4EONA 4BGHA 4YJQA 2GHLA 3VAPA 3GC9A 4ACCA 4X6RA 4YHTA 2H9VA 2WO6A 4O81A 5AP0A 3NCGA 4WRGA 5FEDA 4F7NA 3CD8A 4RX8A 5BYLA 1Q8TA 5EM6A 4NJDA 3WF6A 1UKHA 3DAJA 2C1AA 2R3QA 3O0GA 1STCE 4NM0A 3RK5A 4E5AX 5JZJA 1JLUE 2C6TA 2B53A 3VW6A 5JGAA 1ZARA 3JPVA 4RJ3A 3A99A 4CRSA 4X3JA 4M3QA 3M11A 3KULB 2O63A 2QC6A 2X1NA 5CNOA 1UV5A 2O0UA 4YNOA 2GHGA 3DPKA 3QD2B 3ZRMA 3KULA 4M12A 3GC7A 4C4GA 2VTTA 1UU7A 3FZTA 4AFJA 4RX5A 4DBXA 3FL4A 3IW7A 5ANIA 3UGCA 4KUJA 2CKEA 2QOLA 4KIPA 4CNHA 4YC6A 2XF0A 4F0FA 5C9CA 4UALA 4OTQA 4DG0E 2UV2A 2QONA 4H3BA 3PZHA 1IA9A 3DDPA 3DK3A 3I6UA 5BYZA 3S3IA 5A4QA 2XRUA 4WG5A 3FZPA 1Q4LA 4R3PA 4FE2A 3IW4A 4KABA 3BKBA 4KS7A 2W5AA 4U0IA 5J87A 4O1OA 4BL1A 4G6OA 4EQCA 3HZTA 3W8QA 2XK4A 4L7FA 3P1AA 4DA5A 2WTVA 2BTSA 1OM1A 4BCGA 1XKKA 3HDMA 5BVDA 5I0BA 1W7HA 2CLXA 4GT5A 4ZK5A 3FZRA 3CR0A 4FBXA 3RJCA 4DFXE 4BF2A 2W17A 3P7CA 3SDJA 4DTAA 1BMKA 2YM6A 3OC1A 4YNEA 3K5UA 3L9PA 3I0OA 3ROYA 4APCA 4D2PA 2QO7A 3B2WA 4AN9A 2GS2A 3RPYA 2ETKA 4YBKA 2VN9A 2UZUE 4X3FB 5BMSA 2XNMA 3EYGA 3DJ6A 4D58A 4OBQA 1WBNA 3UMXA 4X3FA 4PNIA 3KF4A 5CSVA 5FTGA 4H3QA 4ZLYA 4O7TA 3U8WA 5I3RA 5DNRA 1O6KA 2OJ9A 5J9ZA 2YJRA 4E4LA 4RIXB 4CFXA 4C4JA 2ITPA 2O65A 1ZAOA 4RIXA 4FSRA 2A19B 4CKRA 2CN5A 3BQRA 5AUWA 3LFAA 4IC7A 4N70A 3A4OX 3FMJA 3PG3A 2OGVA 3DY7A 1CKIA 5C03A 5AUTA 3HEGA 2RFSA 3E64A 3QCQA 5HE1A 1A48A 1DS5A 2YWPA 4RFMA 4FTJA 4ZS4A 4RT7A 2C5XA 3WIKA 5HBHA 3QA0A 1TKIA 2W1EA 5CSWA 3W10A 5CU6A 2RFNA 5IQIA 5ACBC 3R8ZA 1GNGA 1W8CA 2BIYA 2J2IB 2JIUA 3G9LX 4HJOA 4QT1A 5GJGA 2X4ZA 4IVCA 3FUPA 2BDWA 2GNIA 2XIYA 2ZM4A 3EN7A 3LMGA 5CSXA 3FPQA 1UWJA 3FLQA 5BUJA 3BGPA 4JOAA 3W1FA 1T45A 1IASA 2LAVA 3RPSA 3HMMA 3W2OA 4EH6A 1IAJA 3FXWA 3O7LB 4FUYA 3KK8A 2UW5A 2OZAB 4I41A 5LVOA 4EOKA 2Y4IB 3EB0A 5AM6A 4E4NA 3ZCLA 2OZAA 3R28A 4H58A 4EHZA 2VO7A 4UEUA 2C0TA 2UW6A 5CF6A 4I4FA 3UZTA 3ID6C 3OTUA 2B9HA 1IG1A 2BALA 2BRMA 1GIJA 3NW6A 2JC6A 4N6ZA 5E90A 5KO1A 4ZTMA 5KHXA 2XYUA 3QD4A 2VTPA 4AN3A 2CHLA 3FMKA 3QXPA 2R3OA 3KCKA 2OJJA 4ENYA 2YACA 3EMGA 3QYZA 3GQLA 2AC5A 4E5WA 5D1JA 1SM2A 3NVKI 4EQMA 3VF8A 3G90X 4BGQA 4M68A 4ZSJA 1TQPA 4YJOA 5FM2A 4NKSA 2FUMA 4HGEA 3AC4A 3F5GA 2FSTX 3LFCA 4U44A 4YTCA 4E6AA 3SX9A 2PL0A 2UW0A 3QGWA 5AV4A 4ZEGA 3MN3A 2JD5A 3G2FA 3ZU7A 1ZMUA 3MY1A 3E93A 5IA1A 4D9TA 3VHEA 3A8WA 1PXOA 3D5WA 3R21A 4HYSA 3LFBA 1KE9A 3BLRA 1BKXA 3TG1A 3LW0A 4QMLA 3PJ8A 3IW5A 3MVJA 2F49A 1MUOA 4BHZA 3FY2A 3H9RA 3LQ8A 4GT3A 4NM3A 4K0YA 4PPCA 2OG8A 3TZ9A 3I60A 4I0RA 4RVKA 1YWRA 4ID7A 4AP7A 4JDKA 4F9WA 4DGGA 3UYSA 4RJ8A 3ZOSA 2W05A 3R2BA 3HRCA 2ITXA 1V0OA 4IM3A 4M13A 4EK3A 5JN2A 2WNTA 3DTCA 2VWBA 4PP7A 4YHJA 4QP9A 4D2VA 1DAYA 3G0EA 4EEVA 1NVQA 4PTEA 3PJ3A 5TO8A 1L3RE 3AG9A 4MWHA 3JY9A 2XK8A 3CTQA 5A54A 3FHRA 2C1BA 2PWLA 4PDSA 1B38A 2F7EE 1G3NA 2VX0A 3BBTB 3E92A 3IONA 3MW1A 3T8OA 3VBTA 2R3JA 5L2QA 1R39A 3GP0A 2JKOA 2GPHA 5AR2A 2VUWA 5DEWA 5HLPA 4AZTA 4MXOA 4BCKA 4EH4A 2OIQA 4FKSA 4DEBA 4QQCA 5M56A 4W9WA 5IQBA 3KF7A 3R63A 3HUCA 1W0XC 1H0WA 5DR2A 1IA8A 1OL7A 3VF9A 2GTMA 2QHMA 4FEUA 2W1DA 3CLYA 1IEPA 4P7EA 1ZYCA 3TJCA 4BBFA 2OSCA 4ZJJA 4ANQA 3NYOA 5BVOA 5HICA 4BCJA 3PIXA 2ZDTA 3RPOA 2HWPA 2XK3A 4JG7A 2QOFA 3D4QA 4FIHA 4MBLA 4DFYA 4RX7A 3BZ3A 3ORTA 5LMKC 3ZRKA 3PXZA 3QQHA 3C4FA 3AGLA 1ZZ2A 3CD3A 4FSQA 4HPUE 2QNJA 4CG8A 4V04A 3R22A 4PPBA 4A07A 5KKRC 4QMZA 4E8AA 3EKKA 4ERWA 3TUBA 5CY3A 3GENA 1VYZA 4MXXA 4V01A 4XRLA 2BROA 5ITAA 3DZOA 1URCA 3HECA 5DT3A 1QPJA 3GEQA 5AUYA 4BDFA 3EOCA 4G9CA 3S2PA 5A4TA 2OH4A 1JSVA 3GBZA 2Q0NA 2JKQA 2CNQA 3ZEWA 2O8YA 3Q6UA 1H00A 2R3KA 3DXQA 2IG7A 3VHKA 3TNQB 3C0IA 4YU2A 2FVDA 4QD6A 5CTPA 2WU7A 2C6KA 5FGKA 3VS3A 3ZLWA 3MJ1A 2EU9A 3F5PA 3CTHA 3FLNC 4MXAA 3HUBA 4C58A 3QL8A 3E7VA 4FIIA 4AW2A 4TYEA 3F5UA 1YKRA
chains in the Genus database with same CATH superfamily
4E6CA 3DDQA 2XB7A 5HD7A 4YMJA 1YXVA 3RWPA 4FOBA 4G3FA 2JIVA 2QI8A 1VR2A 2UUEA 4FKPA 1OPLA 3F3ZA 4NSTA 4WBOA 3MA6A 4I6BA 4LUEA 1BX6A 1XR1A 2GNFA 3H9OA 1P4OA 3EWHA 3FE3A 3HP2A 3MDYA 4LL5A 4RGJA 4A9SA 4FNZA 4EJNA 2PY3A 2XEYA 3CEKA 4CTCA 3VS1A 5AUUA 2GFCA 5CF4A 5IKWA 1NY3A 5ANEA 3I1AA 1ZRZA 4I1ZA 5FEQA 1G8JA 4UWYA 4FKJA 2G01A 1OZ1A 5DA3A 2XJ2A 3U6JA 3OF0A 3QD0A 3TI1A 3W2QA 4XLIA 4DG2E 4O7NA 4X2JA 1W2FA 3OZ6A 2EXMA 4U43A 3VS2A 3ZLXA 2ZB1A 3TNWA 3PYYA 3OD6X 4Z7HA 4ZTLA 3FC2A 2VRXA 4F7SA 4JG6A 5FP6A 4EOMA 1P14A 1GZOA 3Q60A 4UMUA 3KU2A 5HHWA 2UZEA 5HIDA 2WMUA 4ZY6A 4O1PA 5CF5A 5E8XA 5AV0A 4DT9A 4ACHA 5C27A 4HVGA 2B7AA 1M2PA 4W4YA 3R83A 3ZXZA 2PPQA 3OEZA 4J1RA 4UMTA 3DT1A 5CZIA 4Z7GA 2ZMDA 4RLLA 3BLHA 2OLCA 4YJVA 2C6MA 4QMSA 1AD5A 4X3FC 2YZLA 1LUFA 4YPDA 3ELJA 3EN6A 4F6WA 1BI7A 2HK5A 3BEGA 3NAXA 4FL1A 3NUXA 3JS2A 5KE0A 3N4UA 3GU7A 5FD2A 1JPAA 1YQJA 2IZUA 4EOOA 1SVHA 3BHUA 1UVRA 4C37A 3KMUA 4M7IA 4XYFA 4OTRA 3P9JA 4PTGA 2YJSA 1BYGA 4R3CA 3SGCA 3KXZA 4DFZE 2GTNA 2P3GX 5FTQA 4DGNA 4DDIA 3BHVA 3SV0A 3PFYA 3ORIA 4IAAA 5M53A 5AV1A 3TKHA 3O17A 4AW0A 3G51A 3DFCB 4MYGA 4KIOA 2BIKB 3NYVA 4LRMA 4FKTA 2E9UA 4TZRA 3FXXA 5EYCA 2QR7A 1PRYA 2NRUA 4E7WA 3TUCA 2JDOA 3EKNA 4FT5A 3OCGA 3OUNB 4M0ZA 2ETMA 3E5AA 2ZDUA 3L1SA 4MAOA 4EH2A 1ZLTA 2ITOA 4L6QA 5I9XA 2B9JA 5F9EA 4GKIA 2UW3A 2Y6OA 2VWZA 4NZWB 5CNNA 4CLIA 5HLNA 1ZMWA 4I6QA 5TKDA 4C7TA 2C5OA 4O7WA 1CKJA 2OXDA 4MF1A 4DEHA 3O7LD 4O0VA 2Y0AA 4PTCA 4Y72A 5EYDA 4IWDA 4AZEA 5CEPA 5H8GA 3H0ZA 5BVKA 4C4FA 4FNYA 2X81A 4LL0A 3VQHA 2WKMA 1F0QA 2JITA 4G5PA 2W4KA 3FJQE 5EOLA 4ACGA 5IEVA 1NT2A 2IVTA 1KOBA 2OIDA 3H10A 2P2HA 4F99A 5CVHA 4ANNA 3W2CA 5IMEA 4MWIA 3LFQA 4D5KA 1LPUA 3QQFA 4CV8A 2PZPA 4ZAUA 3VJOA 3S95A 4QYFA 5E1SA 4ZSAA 1VJYA 3CQWA 4AG8A 2BFYA 3DA6A 3AKJA 3WF8A 3Q3BA 1XH5A 4WSQA 4WUNA 4G1WA 3QFVA 2ZOQA 2BPMA 4GVJA 4I0TA 4MD8E 4MXCA 4YSMA 5D12A 3BQCA 1TZDA 3R2YA 4J8MA 1GOLA 4IE9A 4O2ZA 5F20A 3OTVA 1PKGA 2XK9A 3IOPA 4FODA 3VS4A 4W4XA 3RAHA 4EOSA 3ZUVA 2PVJA 2VTHA 2YFXA 4RPVA 2JKMA 3QUDA 4DEGA 3ACKA 3QKLA 1BL6A 5EQYA 2GFSA 1SZMA 4L42A 4EI4A 5AUZA 4U3ZA 2BFXA 3QWJA 4UX9A 5DVRA 3SLSA 4RBLA 2QU6A 3KREA 4GU9A 3ULZA 5KMMA 2ITTA 4YJUA 5JMSA 2EXEA 4HCVA 3S4QA 4QPSA 3UJGA 3W18A 4EYJA 1JAMA 4W4VA 2Q83A 4HOKA 4RJ7A 4PDOA 1TFFA 4DC2A 3O50A 1RW8A 1OKWA 5K5NA 3A2CA 2B9IA 3V3VA 1WBSA 3CKWA 3HA6A 3B2TA 3G5DA 3LZBA 5M51A 3UC4A 4NFMA 3OBGA 4YBJA 3PIYA 4MXYA 3N51A 5BUEA 1OBGA 3ANQA 5AMNA 3ZM4A 5CAPA 4ZTHA 2C3KA 4FTRA 5DOSA 2UVYA 2QOBA 2BHHA 2XJ1A 2X0PA 3BBWA 3Q9ZA 4NTTA 4PX6A 5CSPA 5FP5A 2PULA 1AQ1A 3ITZA 4YHFA 3V8TA 5KBRA 2CGXA 4TWOA 3ZTXA 3BL7A 1E1XA 4TXCA 2E2BA 2W99B 3GNIB 3BPRA 4I23A 4N6YA 3TV4A 5L6OA 3NDMA 4U7ZA 3U6IA 3Q9YA 3IOKA 4I21A 4C0TA 5JFVA 3PTGA 3PDTA 5GJFA 5IUHA 3FKOA 1OMWA 3CBLA 1FVVA 2VU3A 3FQSA 4AT3A 4L43A 4A06A 3V5QA 3KRJA 3ZFMA 2HW7A 5ANOA 3SXFA 2W1CA 1XH6A 4YURA 1UNLA 2B4SB 4DEIA 4XBUA 3I81A 2H8HA 4DHJA 2J4ZA 4XMOA 2WTWA 4FT9A 4FV6A 3TN8A 4BCOA 3F5XA 2HZ4A 2IWIA 1LR4A 4YJPA 5FXQA 4FT3A 3AD5A 4PMTA 2JAMA 4JQ7A 1Q24A 3QX4A 5HU9A 1ZOGA 2VGPA 1SNUA 3QZFA 4KIQA 2EB2A 3D9VA 4L7SA 4YZDA 5DWRA 3R7IA 2OU7A 3SHEA 3EQIA 4P5QA 2OWBA 3KRRA 5EH0A 3OOMA 4TWPA 3SAYA 2ITWA 5HTIA 4NK9A 1KWPA 2JIIA 5I9ZA 2HENA 4J52A 4W9XA 3TNIA 5K0KA 5IH4A 3PSBA 1Q8YA 4XH6A 1G8KA 2IZRA 4ZOGA 2HIWA 2PUUA 2WMTA 5J79A 3MGYA 3UP7A 3I5ZA 4O6EA 3UTOA 3W2PA 3S1HA 4CEGA 4FT7A 5EQEA 4Z9LA 5J7HA 3DLSA 4JR7A 4RLKA 2UW9A 5JQ5A 3AOXA 3Q4TA 3QC4A 4PQNA 4RFYA 1H1WA 3PG1A 4BDKA 4YJSA 5DHJA 3IKAA 4IM0A 3BL9A 5LJJA 2WQBA 3PXKA 2NRYA 3DZQA 5L6WL 3UVPA 4F9CA 4O7VA 3O8PA 3TXOA 4BTKA 4ERKA 2XNBA 2X9FA 2H34A 2R3PA 4EKKA 2P2IA 4R7BA 2UVXA 4TPTA 4KBAA 3LE6A 4ZZOA 1Q8WA 4W8DA 1VEBA 2OXYA 1NXKA 4DH1A 4KS8A 3HV6A 4OLIA 4U3YA 4AA0A 3U54A 1YWVA 3OP5A 5M4UA 1H1PA 4UXLA 4O0XA 3NUNA 5IH6A 1OVEA 5AP3A 3NIEA 4MCVA 2XKEA 2YITA 3FI4A 3JYAA 3NUUA 5AIRA 2Y9QA 4DAWA 5ETCA 1XO2B 3LFDA 3LHJA 4FVRA 4QDEA 3CS9A 2XBAA 2IW8A 3GC8A 3CQEA 1XWSA 5KMIA 4PMSA 2QOIA 5DE2A 4O0UA 2B54A 3EQBA 2B55A 4ITIA 5AP4A 5L8JA 4D2SA 2I0EA 4ZMEA 4FGRA 5DR6A 5G1XA 3HMNA 2VNWA 3QTSA 2R3NA 4X21A 3GU8A 4JR3A 2QKWB 4GS6A 3GI3A 3RAKA 2FA2A 4TW9A 2H6DA 4AXAA 1E9HA 3AXWA 4DE4A 1J1CA 4J99A 4UWCA 4PP9A 2W5BA 4O21A 4O96A 2G9XA 4LYNA 5GJDA 3KMWA 2I1MA 5AAEA 3KA0A 4YZBA 3UIMA 5K0XA 2W5HA 2HZNA 4I5HA 3VWAA 4JRNA 4D4YA 3E87A 3O71A 3VBQA 2R0UA 4GK4A 3HA8A 3M2WA 2PSQA 4FKIA 3GOPA 2UVZA 4NM7A 5IUGA 4FEWA 1Q41A 4FKGA 3QQGA 4FV8A 4M84A 4MXZA 4U8ZA 2XYNA 3AMBA 5EM8A 2PMIA 3NAYA 3POOA 4O7ZA 4BICA 5H8BA 2HYYA 1H4LA 3TIYA 4HVDA 4NTSA 3AC8A 2XIRA 1I44A 1XHAA 3LJ2A 2OJIA 1OUYA 1T46A 3F3UA 4IANA 1OIUA 3E8NA 4ZTNA 4YO4A 3EN9A 2YM7A 3EQPA 4KSQA 4FG8A 5BX0A 4GIHA 5IU2A 3JY0A 5JKGA 4FG7A 1KSWA 3FLZA 2VZ6A 2EXCX 3EQHA 4G6LA 5J95A 4CV9A 4CLJA 4JMQA 4BBEA 2GHMA 2UZNA 2W9ZB 2WQNA 3LFEA 2OH0E 4LQMA 4QP7A 4FRFA 4R1YA 4XG3A 5LQFA 2XK7A 2RF9A 2C6EA 3BCEA 4LOPA 4BC6A 4AFEA 3ZS5A 2Z60A 5DFPA 1H27A 3GVUA 2QKRA 4R7HA 3RNYA 3RWQA 2IO6A 4CCUA 2BHEA 5FQDC 2CLQA 3OOGA 4C57A 4HCTA 1J7IA 2QOCA 1YHVA 3HV3A 1XJDA 1P2AA 5GZAA 3LLAA 4EK8A 5IA3A 5KKRB 4A9RA 4O0RA 4NH1A 4JI9A 4U79A 4DLIA 4OTPA 4R1VA 3R7VA 4RWJA 4DYMA 2W96B 3R6XA 3TDVA 2UZTA 4HZRA 5JGBA 2QQ7A 5T3QA 3R9NA 5EHOA 5BVEA 1H26A 5CEKA 2XH5A 3LFNA 3OT8A 5M55A 2X7OA 4B9DA 4Y85A 2X6DA 3FMHA 2XIXA 5E9EA 3TT0A 5IQAA 3GCSA 2ITVA 4G34A 5EW9A 4EJ7A 2LGCA 4J71A 4ITJA 3SXSA 1MRVA 2W06A 3COHA 3W33A 4FZDB 3R9OA 1QMZA 1PXMA 4FIJA 4E4MA 3FQHA 4FTTA 4FZ6A 3SXRA 4FG9A 4XRJA 4LGGA 3Q53A 5I9UA 2X0GA 3IW6A 4FUXA 2PVYA 2BVAA 3UMWA 5CYIA 3COKA 3CY2A 4KNBA 4O82A 2WAJA 3ZLYA 4DINA 4E93A 4LUDA 4A9UA 2Q0BA 4TYIA 2WMSA 3U51A 1L8TA 3RBWA 5ICPA 4FV1A 3MB7A 4B8MA 5BVWA 4S33A 3RINA 1YWNA 2VD5A 5IEXA 2C5NA 2R2PA 3F7ZA 4QNYA 5EI2A 3RP9A 2XK6A 3QHWA 2VX1A 4DEAA 1F5QA 5IQHA 3UVQA 4FTCA 3OROA 4L01A 3OFMA 5LVNA 1FVTA 4YTIA 4IEBA 4QMYA 3R7EA 1HCKA 3ZYAA 5IISA 3E3BX 3E8CA 4XV3A 5CSHA 2ITNA 3E88A 4J8NA 4O91A 3U55A 4FT0A 5HO8A 5CX9A 3NRMA 4O0YA 4JRVA 3MB6A 4JAIA 4IAKA 3PSDA 1ND4A 4QTCA 5C01A 2R7IA 2W4OA 4FVQA 4FA2A 4ORKA 4CG9A 5GINE 4FTMA 4RQVA 4F1OA 3GU4A 2JDTA 3GU6A 4GRBA 4IJ9A 4L3JA 5EQPA 3TZ7A 2YIQA 3OWPA 3UBDA 4FYOA 5LXMA 4O0WA 4BB4A 4RC3A 4NW6A 4C36A 4DT8A 4ENXA 4JLCA 2Z7QA 4LOOA 4JBVA 4HYHA 1I09A 4YPSA 2C0OA 2QOOA 1DI9A 1IRKA 4GL9A 4FSMA 3TDWA 4AGWA 3UPZA 1ZYLA 3WARA 3RTPA 4U9AA 2FYSA 4CQEA 3B8RA 4BJJB 2G15A 3IGOA 5L4QA 3BYSA 4BJJA 1WBPA 4IX4A 1QPDA 3W0PA 2WTJA 5HG8A 2C4GA 4RIOA 1OECA 4L8MA 1H25A 3BHHA 1PF8A 2GDOA 1V0PA 4YZNA 5GZ8A 5I4NA 1RDQE 4PMPA 4C02A 2XARA 2HCKA 4KIKB 3G15A 3MY0A 2WU6A 3UNJA 4KIKA 4XP2A 2B52A 4FICA 1PMEA 4KRCA 4HVSA 4E3CA 5CAOA 3FY0A 3IW8A 1GY3A 4WSYA 2ERZE 4X6QC 3MH1A 1PYEA 3V8WA 3ZHPC 3ZZWA 3AMAA 4XV1A 5CXHA 1TVOA 5ANGA 3CJFA 2YDJA 4KKHA 3OS3A 1BUHA 1NVSA 4AA4A 5CAVA 3QQUA 3C13A 3L8SA 4R7IA 1X8BA 2PZRA 3ZM9A 3HMIA 2XAMA 1OITA 3V5TA 1M2QA 1JKSA 4J7BA 4H39A 2V5QA 1OUKA 3KKVA 3R0TA 4F0GA 2X0OA 4GFGA 5D9HA 2ZV9A 1H1QA 2AYPA 3DNEA 1UNHA 4H1JA 5T6KA 3W2SA 5DYJA 5IQDA 1LP4A 3O23A 3NNWA 4OBOA 3OMVA 5DRBA 3MH3A 3CQUA 3UOLA 5IQGA 2YIRA 2E9PA 3AD6A 5AX3A 4HGSA 4K9YA 2VTIA 2ZAZA 3I7BA 2OXXA 2HXQA 3NMUF 3NCZA 4QP2A 4FF8A 3A61A 3ZO1A 2J50A 2VV9A 4Y46A 1O6LA 3D14A 3KEXA 2YM3A 3F3TA 3FPMA 5BMMA 4KB8A 3FLWA 4QQJA 4RZVA 5EI6A 2I0HA 2ITZA 5F1ZA 2O2UA 5K4JA 5JZNA 4IX6A 4C59A 1DM2A 1Q3WA 4O4CA 3BE2A 4S32A 1YOMA 3CCNA 4UB7A 3ALNA 5C4KA 4M97A 4P4CA 3CP9A 1UA2A 3PJ2A 3ZO4A 2VTSA 5JSMA 4PL3A 3W55A 2BZHB 3DKOA 5TF9A 5JFXA 2PVRA 3MVLA 4L3PA 3ANRA 4RX9A 3C4ZA 4GU6A 4I0SA 4G2FA 5HOAA 4DEEA 4DLJA 3LCKA 2PVLA 4J53A 4ZTQA 5HCXA 1ZY5A 2GS7A 4FV9A 4ZZNA 5BUIA 3ZBFA 3FDNA 4IIRA 3VUIA 4BI2A 4FTLA 3OHTA 3V5PA 4EL9A 4F6UA 3C5IA 2VTNA 3WZKA 4CSVA 4AW1A 4GJ2A 5H3QA 4ACDA 3OUKA 3UP2A 3OY3A 3VUGA 1OKZA 4Q2AA 5FBOA 5DGZA 3E62A 3KXMA 2F2UA 3DK6A 4KBCA 4V05A 1YXTA 4FKRA 3ZBXA 5CLPA 2W1GA 4FVPA 4GFMA 3I6WA 3V6RA 1ZYDA 3ZFXA 1CMKE 5E4HA 3VUDA 3F69A 3WZUA 4F9AA 5M09A 2XVDA 1F3MC 3PE2A 2FGIA 3BGQA 3FSFA 5AAGA 3TMOA 4L00A 3P7AA 5AR7A 3VS0A 1KE7A 5HE3A 2PE1A 3MVMA 3RCDA 3JXWA 2C6OA 2R3LA 3PA3A 3OCBA 1KE8A 5JRSA 2XS0A 4EC9A 2J0LA 4AXEA 3TM0A 3IDBA 2A4LA 2CGVA 3ZRLA 3CIKA 3OWKA 3ZO2A 4EOIA 4V0GB 3R8LA 4JBPA 5HESA 3VUHA 3LM5A 5DLSA 1RE8A 5AP6A 4V0GA 3RALA 3PE1A 5DIAA 3NIZA 3PPZA 1GIIA 3HP5A 3V5LA 5HLWA 4Z3VA 3NNVA 3L9NA 1U54B 5KZ0A 1WBWA 2R3RA 1W83A 2SRCA 4U40A 5C1QB 3FHIA 4R3RA 1U54A 3M42A 3FSKA 4NIFB 1QPCA 2HZIA 4AAYA 4E6DA 4ZIMA 2JDSA 4NIFA 2AUHA 1JBPE 5LCKA 3ENHA 4JX7A 3TV7A 4DH3A 3PVWA 4FZAB 4QMUA 3TIZA 4I93A 5IA0A 5HO6A 5LVMA 2GU8A 2BRBA 3UDTA 4DFBA 4DFNA 3PPJA 2ZMCA 4XG6A 2XP2A 4DH8A 3AKKA 2XM8A 3HRBA 3P4KA 3QRTA 3L8VA 4EWHA 5HTCA 4G3DA 4GIIA 3UOKA 3DJ5A 2OK1A 5KBQA 1GIHA 3R8MA 3KXHA 3HKOA 4PF4A 5HTBA 4NL0A 4DCAA 4LRKA 2ITQA 5CEMA 4MQ2A 3WYYA 3NGAA 5CEQA 1ERKA 5AM7A 5DPVA 5BVFA 4D4VA 5J5TA 2QR8A 2Y7JA 3FLSA 4BIDA 4C34A 4FKUA 4X2GA 1OL5A 4DCEA 5HZNA 2V0DA 3DLZA 3AT3A 3C0GA 4AACA 4AGCA 2CNUA 3JVSA 3SD0A 3Q04A 2J5FA 2E9VA 3V01A 4BWPA 4AGDA 3D94A 4FKQA 2FH9A 4JVGA 1ZOHA 1FMOE 2Z7LA 2BRNA 2YDIA 3P5JC 2X8DA 4IAZA 2YIYA 2ZFYA 4C3RA 4TNDA 2WGJA 3LIJA 3CSVA 4Y5QA 3TNHA 5CVFA 4YJTA 2JGZA 4JJRA 4MD9E 5EM5A 5B2MA 4XV9A 3TACA 3W8LA 3NUAA 4DTBA 4XP3A 4Y95A 4DEDA 4FTUA 4OTGA 4OT5A 1XH4A 3HLLA 4X2KA 1W2DA 4BCMA 4XG8A 3E7OA 2BMCA 4UV0A 4CTBA 5H2UA 1KE6A 3CTJA 5HE0A 2WELA 4HPTE 5FRIA 5HX8A 1WBTA 3MIYA 5HIBA 3V8SA 2BAKA 2QU5A 3EN4A 5A14A 5HU3A 4CFWA 3DXPA 1UU8A 1FVRA 3U9CA 4B8LA 3HDNA 1TQIA 4MEDA 3M1SA 1UNGA 5EK7A 3DBCA 2XNPA 4FSTA 3EQGA 3ZONA 4WOVA 5ANJA 4LOQA 5B7VA 2I7QA 1MRYA 3PY3A 3TTIA 3QGYA 4EZ5A 4EUUA 3EL7A 3DNDA 2ZJWA 4X2NA 3NYNA 5IUIA 3BX5A 1ZYSA 3IS5A 4EUTA 3QQKA 4EBWA 3DKFA 2JEDA 4IWOA 4XCUA 5K9IA 2PYWA 2WMVA 3DBDA 5AV2A 3W0RA 5HKMA 5EHLA 3UVRA 4QMVA 4J98A 4K8AA 1M2RA 3UOJA 3FMNA 3OW3A 2VTLA 3KL8A 3PP1A 4BY9E 5I9YA 3A7GA 2R64A 3PVGA 4BDEA 3THBA 2W9FB 4JNWA 4FX3A 3MYGA 3RNIA 1JSUA 4GUEA 3R1SA 3W2RA 4G31A 1XMMA 4WHZA 3GGFA 2O64A 2R3IA 3QZGA 2BKKA 2PE0A 3I5NA 5KMOA 4BTFA 2R9SA 3T9TA 4W4WA 3QKMA 3EYHA 5LOHA 2OJFE 2V22A 2WTKC 3BI6A 4NJ3A 4EWQA 3O8UA 3I4BA 3BWFA 4KWPA 4DHZA 3GUBA 3KXXA 2A27A 1DAWA 2BTRA 3LXLA 2G2IA 3O51A 5T68A 2QHNA 3RPVA 2BDFA 4AAAA 1PXNA 4G3GA 4IDVA 4X0MA 5DI1A 4KA3A 4UXQA 3TEIA 1H24A 3D5UA 3WZDA 4AT5A 3Q4ZA 4C62A 2X7GA 2JKKA 4H3PA 4H05A 4OTFA 1G8SA 4BKJA 4KAOA 3RHKA 1ZYJA 3KFAA 2BAQA 3TJDA 5HNIX 5BPYA 2C5YA 3P86A 3RZFA 4MK0A 3W32A 3ORKA 2P33A 4AZVA 2CN8A 4FIEA 4BIEA 1XQZA 2Y4PA 3HMPA 3G33A 4YTHA 5H8EA 5HNBA 4ZY4A 5KMJA 1P5EA 1JQHA 2ZV2A 1HOWA 3Q5IA 4LV5A 5ACKA 4CMUA 2OFUA 3QAME 5HIEA 5LMBA 2NYAA 3R30A 3UG1A 3KY2A 3OY1A 3TKUA 3LCSA 4IHPA 1WCCA 5IQCA 3FMEA 4BTMA 2JBPA 3U9NA 4TYGA 2XZSA 5JGDA 4JIKA 3Q6WA 4MQ1A 3HV5A 2WPAA 3T3UA 1H8FA 3HL7A 1JVPP 4EYMA 1J1BA 1H1SA 4BFMA 4D0WA 1YDTE 4Y5HA 3EHAA 1NVRA 2A2AA 2F7XE 2W1IA 3VBVA 5E8YA 3BV2A 2CJMA 5E92A 3NSZA 3IDCA 4G3EA 1OL2A 4IVAA 1MRUA 1JNKA 2DWBA 2NO3A 4YZCA 3U4WA 3H4JA 4YC8A 2XNGA 4A4OA 4AX8A 3VS7A 3LXPA 4AZWA 5CI6A 1GZNA 1YOJA 2WIPA 2YAKA 3FAAA 3CE3A 5L3AA 1OL1A 4QYYA 2Z02A 3OEFX 4BI0A 4EC8A 1VZOA 3NLBA 4J96A 2WHBA 5HE2A 3WE8A 2R4BA 3KVXA 5E7RA 5D41A 4O27B 3F7WA 1P4FA 1CM8A 1A9UA 3QALE 3PWDA 5F95A 4YP8A 4QQTA 2C47A 4NCTA 4F0IA 2VTMA 5FUTA 3E63A 4XP0A 2HELA 3RI1A 5M57A 3UQFA 5KMNA 2HY0A 3PJ1A 4BKYA 3LKMA 4RA4A 4IVDA 4D5HA 3NNUA 5CWZA 3ATTA 4I94A 3MFUA 3HX4A 4IADA 5HVYA 4IW0A 3ORLA 2YIWA 3U4UA 1OBDA 2QOKA 5HVJA 5B0XA 2R3HA 3BE9A 3PSCA 4CCBA 3FBVA 3R1YA 2C6DA 3ORPA 1APME 2ETRA 3LPBA 4D55A 5A4LA 1M52A 3ZMMA 1Q8ZA 3DCVA 3NW7A 1YI3A 3NX8A 4QPMA 3FMDA 5JH6A 4ASXA 1M7NA 4C4EA 2OICA 3QCXA 4JQ8A 4EQUA 5L2TA 3ZXTA 4FEXA 3W0NA 4K2RA 2WTIA 4AZFA 4DGLC 1IAHA 4Z16A 2V55A 2OI4X 4MHAA 2BILB 2V62A 4BRXA 5JT2A 2BZKB 3UPXA 2RSVA 3ORMA 3UO4A 4CZUA 3MPTA 5LWNA 3NUSA 2PVNA 4UZDA 5IG1A 3JR1A 3UO6A 1QPEA 1YDSE 3D2KA 4UWBA 5FXRA 3VULA 5E1EA 5AFVA 2QODA 3Q4UA 5IQEA 3FI3A 3ORZA 3EFWA 1M7QA 3KXGA 4FSNA 4EK5A 1PMVA 4USEA 3C4CA 4NW5A 1BLXA 2B1PA 2B0QA 4M69A 3OBJA 4TKSA 3V51A 3EQFA 3Q4CA 3IK3A 2PUPA 2R3MA 1YDRE 1FINA 1PMUA 4RJ6A 3AC1A 4PL5A 2YAAA 4UBAA 1K2PA 5E8SA 4D4SA 5A9UA 4UMPA 4M15A 2XEZA 4H1MA 4CFUA 4ZLZA 4R5SA 5J8IA 1PKDA 2XA4A 4LV8A 4GJ3A 1Q3DA 2WZJA 1W82A 2UZWE 2YCQA 4QP1A 4ASEA 5CEIA 4B6LA 5L2IA 4MH7A 4E5BA 4IX5A 4ANBA 3DS6A 3RK9A 3RM7A 4YUQA 2QLUA 4EH9A 4FNXA 2PVFA 3Q52A 3QTRA 3C4WA 1BI8A 2A1AB 2BRHA 3DBEA 3LCDA 5I9WA 4A7CA 4N4SA 5HNGA 4GT4A 4MTAA 1MQBA 2C6LA 3LOKA 4OTWA 4CMOA 1YXUA 1ZZLA 3HV7A 4GV1A 4BZOA 4TNBA 4IWQA 5AA9A 5AAFA 3TZMA 2FSLX 2ONLC 3VW8A 4IMYA 4Q5HA 4ANMA 3CJGA 4AE9A 2PU8A 3K3IA 3FL5A 3FMMA 4I24A 4I20A 2IEWA 4O0SA 2QO2A 1Z57A 4RWIA 2CGUA 4BDBA 2Z2WA 3KIOC 3TV6A 5M06A 5KCVA 3CKXA 4ZTSA 3PFQA 5L2SA 4CYJA 4FOCA 2ZM1A 4FKVA 4CFVA 4EBVA 3TL8A 1KV1A 1H1RA 4AW5A 2R3GA 5D11A 2IJMA 3LFSA 3JVRA 1PW2A 4PL4A 2DS1A 4P90A 4EHVA 2R5TA 3PVBA 2YEXA 1KV2A 4GYIA 4CKJA 2KULA 3N4TA 4FKLA 4O4EA 3DOGA 1YOLA 3K3JA 4JL9A 2OZOA 5FEEA 4AOIA 4I4EA 4NKAA 2UW8A 5EI8A 4FIFA 4R77A 2RG5A 4AWIA 3HAVA 4GK3A 5DEYA 2IVUA 2OKRA 4WBBB 4C2VA 3MBLA 5FLFA 3RAIA 3RPRA 5A4EA 4TTHB 3FZ1A 3A7HA 4XHKB 2W1ZA 1XMLA 1U4DA 3K54A 5C8KA 4I92A 2IN6A 1KOAA 3R1NA 4DFLA 4OTIA 3MPMA 3QD3A 1FPUA 3R02A 3ODZX 4G5JA 3W0SA 2XBJA 4GG7A 2NP8A 3UZRA 2ZB0A 5ETFA 3MH2A 1JOWB 3EH9A 4BZNA 5LWMA 3KN5A 3AT4A 4RIWB 5JRQA 1J3HA 5LVPA 4LFIA 2HWOA 2RG6A 3GB2A 2FB8A 2X9EA 4HZSA 4RIWA 4XUFA 5I3OA 2ITUA 3D2IA 4BVUA 4KRDA 2X39A 4S2ZA 4JT3A 4RC4A 3UC3A 4AOJA 4CYIA 4E4XA 5HQ0A 4LV7A 2XRWA 5AJQA 3SW7A 2WMBA 3FKLA 2O5KA 4F9BA 4O7LA 2QVSE 3QRKA 1OGYA 3BU3A 3RAWA 3VN9A 1JWHA 1U5RA 3MIAA 2PZ5A 1CTPE 4MKCA 5AP1A 3QKKA 4ZLOA 2VTQA 3JUHA 3SOCA 2G1TA 2J0JA 2ZVAA 3FMLA 4IZAA 3U87A 4HGTA 3NEWA 2VWIA 2I40A 4FKWA 4QP4A 1O9UA 2DUVA 4I3ZA 5KHWA 4EOLA 4AZSA 3LCOA 5M08A 1PMNA 2HAKA 4GMYA 4LG4A 5HCZA 4BI1A 3QZIA 5FXSA 1J91A 3TZ8A 3KRXA 3R1QA 1OGUA 3PPKA 3GCUA 4JG8A 4MBI