4ZP5A

Map4k4 in complex with inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
296
structure length
284
Chain Sequence
DLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of MAP4K4 complex
rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
total genus 84
structure length 284
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zp5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zp5A01
4QMQA 3HAVA 3OZ6A 3QQFA 3CD8A 4ZY6A 5AUVA 1STCE 2GDOA 4AACA 3OXIA 4D2VA 2QONA 4G17A 4KS7A 4EOLA 4D0WA 3RI1A 5EYMA 2HW7A 3QQLA 4GFOA 1YWRA 4G3EA 4IVAA 4TNDA 3NWWA 1JWHA 3FC2A 5DVRA 3WILA 4DG2E 3A7GA 5JFSA 4ZY4A 5AUUA 3IOPA 1J7LA 1K2PA 5LJJA 4FV2A 5D1JA 4I24A 3S4QA 4D9UA 5ANGA 1Q41A 4R5YA 3JVSA 3NNXA 3DKOA 2XIXA 4FSNA 4LOOA 3UZRA 4X0MA 4GT3A 4I6FA 3GI3A 3IW5A 4F9AA 4DFBA 4YHTA 3ET7A 4FSWA 4IAFA 4YLKA 4ZLOA 4X2GA 4FSQA 4DF3A 4IC7A 2GQRA 2EU9A 4LFIA 1WZYA 4IADA 4O7RA 4M97A 2I0VA 3F9NA 3VF9A 1PKGA 1NA7A 2XK3A 4N6ZA 4NT4A 3ZM4A 5HTIA 3DXPA 4D1ZA 3AMBA 4V01A 3LAUA 4NKSA 5EYKA 3NYOA 3ORZA 4ZJVA 4D9TA 1T45A 3LQ8A 5E8YA 5FEEA 3EQIA 2Z8CA 5AV0A 5EDPA 5DYJA 4K2RA 2JKOA 4OR5A 1KE7A 2LGCA 3KXXA 5BVWA 5HNGA 2BVAA 3R8UA 5J87A 4BDBA 2X2LA 1M7QA 5FXSA 4EYJA 4QRCA 1URCA 2JDSA 3WIGA 4AE9A 1GY3A 2QOLA 2RFEA 3R73A 5HBJA 1G8SA 3FZOA 3QCQA 3ZOSA 4BGGA 2RSVA 2IVUA 2XBJA 3NUAA 4D4VA 1H28A 4D28A 4RFZA 2IG7A 3RPYA 2G1TA 2C4GA 5ACBC 4BDKA 1WCCA 4JG7A 4RVMA 4K9YA 4U8ZA 4CVAA 3AC1A 1A48A 4YTCA 5FBNC 4E6AA 2C5XA 2W1ZA 3V5JA 5HIEA 4YC8A 5FXQA 2UZNA 3V5WA 1PXKA 3LCOA 4ANSA 2WTCA 3FMNA 4YJUA 5LXMA 3VIDA 4CKJA 4DFXE 2YZAA 4NM3A 4C4EA 3HV6A 4GL9A 2X4FA 4GUBA 3GCSA 2ZV8A 3R7YA 5EM5A 3RAHA 2I0HA 4CKRA 3AQVA 3MY1A 3LXNA 1W83A 2EWAA 4L53A 5GNKA 2QCSA 3KULB 5KMKA 3ORTA 3DDQA 4O7YA 4FMQA 3PVBA 4FSRA 1SYKA 4U43A 3AD6A 1QPEA 2VTNA 3CXWA 4NM5A 1OL6A 3F2NA 5FEDA 4EOIA 2I40A 3F7ZA 3DK7A 2CN8A 2QLUA 1CSNA 5GJGA 5HU3A 4S33A 5HD4A 4KBAA 4GRBA 3QF9A 3HV7A 2QO2A 3E8NA 5CVGA 5AR5A 4ZZOA 3VUTA 4WD5A 3ZDIA 5L6PA 1ATPE 1ERKA 1P5EA 3GCPA 4ACCA 3TUBA 1PXPA 4Y46A 5AUYA 5HORA 3EQFA 2R7IA 3DXNA 3K3JA 3QWKA 4IE9A 3W32A 2VN9A 2W7XA 1KV1A 3GVUA 3MIAA 5TE0A 3BYSA 2QG7A 4FTOA 3VS2A 2W1EA 3DAJA 5FP5A 3KRWA 3VS0A 5BVOA 5HLWA 3KMWA 4ZXTA 2ITZA 3LFBA 4LMNA 3MB7A 3FI3A 4KBKA 4UWBA 4FV7A 4XG2A 1Q62A 3RJCA 2IVSA 2OF4A 2PHKA 2YN8A 3G9LX 4QYFA 2BRHA 4S34A 1M7NA 2BAQA 2XNPA 1H1PA 5E8ZA 2B1PA 4EOPA 4F7JA 2VD5A 4MHAA 2Q0NA 4WT6A 4XV2A 3RWQA 4L42A 2VZ6A 3TTIA 2VWVA 1TVOA 2W4KA 1APME 1ZYCA 2W9ZB 3H0ZA 3BHUA 5J9YA 5LOHA 5DBXA 5CSVA 4EOQA 4EWHA 4AA0A 2WIHA 2X6DA 4OTPA 3ZRMA 4L6QA 5J7BA 3PLAE 1FMOE 4CCUA 5DIAA 1OBDA 3QRJA 3KEXA 5FDPA 2VTIA 4RLLA 3MFUA 3HRBA 2XKDA 2UW3A 3FLNC 2VV9A 5ETAA 5E8WA 2JKKA 3Q9WA 2R3PA 3M11A 3NIEA 5HU9A 5AP7A 3DPKA 3GQIA 3HMPA 4JQ7A 4ITJA 4F0GA 1KWPA 5IQCA 1O6YA 5AV4A 4Z9LA 1XBBA 5DT3A 3PXFA 4E8AA 2C68A 4L43A 4FT5A 1GZOA 3SA0A 3BWJA 5HE2A 5DNRA 2B9JA 4RX8A 1CKJA 1RW8A 2W4JA 4HGEA 4ZLZA 3FKLA 4O1OA 5HX6A 3ATTA 5GINE 4FL1A 2PE1A 4BZOA 5KO1A 5HG9A 1FMKA 4C0TA 2YIXA 3OC1A 4YC6A 3KXGA 3MI9A 3IPHA 5C8KA 3AC4A 5IDPA 2XNGA 3OWPA 5LARA 4CFXA 4FZDB 4AP7A 1UNLA 3KXHA 4S32A 4CFNA 4GUEA 4GK3A 4AW5A 2IWIA 5K4IA 5CU2A 2JEDA 4I94A 2WEVA 4ANOA 4CRLA 3HLLA 3C4XA 1WBSA 4BYJA 3FMLA 3FI2A 5D7VA 1Q8UA 2X9FA 3O96A 3OWJA 3GC0A 2YJRA 3E3BX 2VO7A 1OL1A 2C5OA 2PMNX 2Y6OA 2XP2A 2ZMDA 4FTJA 5I9YA 3RM6A 3HUCA 3LFDA 4U42A 4D2PA 3LJ1A 5HG5A 3FLYA 1ZMWA 3Q5IA 4WO5A 2R3OA 5HBHA 3CGOA 1EH4A 3WE4A 3SRVA 3ROCA 4CYIA 3HV5A 4C3FA 2BDWA 4TWPA 3A60A 4YLLA 1WMKA 5E90A 2OU7A 3DKCA 5T68A 3SC1A 2HZ0A 5KZIA 3FAAA 4F9BA 4RT7A 3ZS5A 3D0EA 3DQWA 3IK3A 3L9LA 1WVYA 4CKIA 1J7IA 2C5VA 3JXWA 3CTQA 4CNHA 4JJRA 1R0PA 2AYPA 4F08A 4XG8A 3O50A 4J99A 3TZMA 2I7QA 3KCKA 4AT3A 4LG4A 2PE0A 3EL7A 1FQ1B 4ALUA 1M52A 3UC4A 3WF8A 1YXUA 4HVGA 4U81A 1M17A 2P2HA 2BUJA 3V6RA 4FK3A 3BGPA 3MFTA 3QLFA 4I0RA 4CV9A 5E1EA 5D11A 3MFRA 4AZWA 2YACA 4R7HA 2SRCA 3NAXA 4I5MA 3H9OA 4BTKA 4IZYA 3FYKX 4YZCA 4ASXA 5M53A 2BTSA 3O2MA 4L7SA 5FTQA 1WBPA 3UTOA 3TZ7A 3E92A 4G9RA 1Q4LA 3NCGA 4CLIA 4FEVA 1FGKA 2NP8A 3ZZWA 2C6OA 2XMYA 2X7OA 4BBEA 5JRQA 5AP1A 4MX9A 3MB6A 3ZONA 3NUXA 4CFFA 3D94A 2G01A 3CCNA 1OITA 4LV8A 4WHZA 5AMNA 4I92A 3GFEA 4A06A 1J1CA 4W8DA 4FIEA 4L45A 4TN6A 4DCAA 5J9ZA 4G16A 3DFAA 3QAME 4EK6A 3P1AA 3NYVA 4CZUA 3ZLXA 3HV3A 5AR8A 4HZRA 5AP3A 5LWNA 4ZOGA 4JBVA 3SX9A 5HCYA 4OTQA 4ZMFA 1XO2B 2HZNA 5AX9A 2BHHA 3NUSA 4C4HA 3NUNA 4U40A 2B4SB 3GNIB 3H0YA 4O0RA 4PMSA 3FZSA 3UNJA 5M4UA 4FG8A 5CS6A 3VS4A 3ZH8A 3SLSA 4M66A 1M2QA 4FKLA 3MJ2A 4YC3A 3TNPC 5EM8A 4YLJA 4K6ZA 3MIYA 5I4NA 2I0EA 4QPAA 4FV3A 3SAYA 4DEGA 4DEHA 3L9PA 1YI4A 3CKWA 3NW6A 3PSBA 3PRIA 3QZGA 1H1SA 2WKMA 3R71A 2IVTA 2Y4PA 3QYWA 1E9HA 4XV9A 3SV0A 5B7VA 4DH1A 4WBBB 3SXRA 1RDQE 3M1SA 5ANOA 4NKAA 1XH8A 4ASZA 4EUTA 5I0BA 3U54A 3R8PA 4EHEA 5HZNA 4CFVA 3KU2A 4TYEA 5DA3A 2Y8OA 2QOIA 3VJOA 4CRSA 4Z7HA 1PYEA 3UOLA 4LM5A 2CJMA 4LRMA 4JRVA 5IH5A 5LMKC 5M07A 3OCBA 5F4NA 3BI6A 2OH0E 4O0YA 4RJ4A 1YHWA 2YM8A 5D41A 3D15A 4TYGA 4WKQA 4A7CA 1Z9XA 4DLIA 4RWKA 3UOKA 4E93A 4EJNA 4IDVA 5CU3A 3UVPA 4CG8A 3C5UA 3QGYA 4JLCA 4QP9A 4FIGA 4A9SA 3B8RA 4G6LA 5F9EA 1NVRA 4R6VA 3ZHPC 4PUZA 3MDYA 3HZTA 3R7GA 3RAKA 3RMFA 1DI9A 2VTTA 2OZAB 3QFVA 4I6QA 4E5BA 4RRVA 2VWBA 4RWIA 5DT4A 3C0HA 4EK3A 3QTSA 4RZVA 1OZ1A 1ND4A 2C3JA 3RNIA 4ERWA 3G15A 4H1JA 2WMRA 5M09A 3CBLA 5IA1A 4FTLA 1MQBA 1GZNA 1WAKA 3NYXA 4JX3A 4WSYA 3S2PA 4E3CA 3PZEA 3QQHA 4EOSA 2B54A 4AS0A 2PZIA 4MWIA 2YAKA 3AC3A 3R8VA 4EWQA 4DEBA 3V5LA 3G9NA 5FQDC 4NIFA 4AE6A 2UW7A 4DLJA 4O7TA 4O2PA 4WG5A 3UIUA 3FL4A 2XZSA 2ZDUA 4W8EA 3QZFA 2RFDA 2W1IA 1PJKA 1W0XC 1P4FA 3NW7A 4FTKA 4H1MA 3BQCA 3NUYA 4RLKA 5FLFA 5EI2A 2PE2A 3LM0A 5IQBA 3COMA 4BIEA 3ORNA 3OS3A 2XVDA 3GCQA 3NNUA 5LMKA 1VJYA 2WQMA 2WTJA 3QCXA 3VVHA 1YQJA 3HAMA 2V7AA 5ANKA 1M14A 4J1RA 1YXVA 5AAGA 1U46A 4F9CA 2XF0A 5I9WA 1UU7A 2OFVA 4FVPA 3RGFA 3Q6WA 2ZJWA 2C6DA 3EFLA 2QLQA 4WNPA 4X3FA 3EWHA 4EKKA 3Q9XA 3A7FA 5K9IA 3NDMA 5E7RA 3D7ZA 4ZIMA 4UMPA 2XK7A 3EH9A 4YBJA 2XNNA 5F1ZA 4FKOA 5GHVA 2WTWA 2VGOA 3EQGA 5BVKA 3F5XA 5AR7A 5L2QA 4O84A 3F88A 4DGOA 4IMYA 2C5YA 2XIRA 3A8XA 1WBNA 4RX9A 3TV6A 4O22A 4ANLA 4MH7A 5IQGA 3PJ1A 3AOXA 3IDBA 3PPZA 4PPBA 2CMWA 2XJ1A 2J7TA 4XV3A 5KCVA 4LOPA 1UV5A 2JFMA 4MYGA 1FBNA 4BHNA 3GQLA 2VO3A 5BUIA 3FXZA 1WVWA 3UGCA 2WHBA 3E7OA 4RC4A 2O0UA 4EH7A 5IF1A 2OFUA 2VTHA 4TWCA 2ERZE 5IZFA 5KMIA 3LCKA 5HGIA 1QPCA 4GK2A 5LVNA 4MNFA 1BUHA 4GH2A 4QQTA 4PQNA 4ZSLA 5J8IA 3RINA 4CMOA 2Z2WA 3QTUA 5AM7A 2YISA 3DAKA 4IZAA 1Q5KA 3HMIA 4NFMA 4ZK5A 1RQQA 2QKWB 3SKCA 5HX8A 3R7UA 4GIHA 3F69A 4JT3A 3HMOA 4L3PA 3IONA 4Y95A 2DS1A 4F65A 2IN6A 1GNGA 3ZRLA 3BHHA 2H8HA 5M4IA 3FLQA 4RIXA 4EH5A 4F6WA 3R28A 1OPLA 2XM9A 4M8TA 4X3JA 2FA2A 1QCFA 3E8DA 4F4PA 4Q2AA 2WOTA 4FKUA 5HLPA 3PJCA 3PIXA 3PP0A 4CZYB 2IZTA 5BMSA 4HPTE 4CCBA 2F2CB 2J0IA 4XS2A 5JT2A 3PJ2A 4O0WA 3D5UA 4IB3A 5T3QA 3WYYA 4BTFA 5DMZA 1H8FA 3EFWA 4QYHA 3TUDA 4IWPA 4DG0E 2GMXA 4C59A 4DGMA 4AQCA 3LFSA 4YJVA 4G1WA 3TM0A 2X7FA 2WQEA 3H3CA 2XKFA 4U41A 4FF8A 2ITTA 5FDXA 4C37A 3ZRKA 3EN5A 4O7LA 2YIWA 3RAWA 5JRSA 3TL8A 2XKCA 4F1TA 4UX9A 2W05A 1IAJA 4U45A 4AG8A 3OUKA 5CF4A 3HP2A 4DAWA 4JBPA 4QMSA 4BF2A 3KMUA 4I5CA 5EI8A 2WU7A 1XBAA 3IS5A 5C8NA 4O82A 4FV9A 4NCTC 3LMIA 3PWYA 4S30A 5ACKA 3EKNA 3EQBA 3QXOA 5AIRA 4HW7A 3C9WA 4OTIA 4KWPA 1REKA 5CSWA 3ZXTA 4EQUA 4O7VA 5EQPA 4RIWA 5IQDA 3ORPA 2AUHA 4FV0A 4UZHA 3K5VA 4DH8A 4YSMA 3D14A 1TQPA 3FXXA 5CQUA 2YM6A 5TT7A 4LV5A 4FR4A 2I0YA 2WMTA 4RX7A 1NXKA 4L01A 4WBOA 3IOKA 3R1QA 5AP4A 5CANA 1ZARA 4DFUA 2BROA 3UNZA 2PZRA 2P55A 3DK6A 5L8JA 1Y6AA 3P4KA 4C33A 4IB1A 3ZFMA 2O64A 5M4CA 5AUWA 2RG6A 2W1DA 3KK8A 2HWPA 3AC5A 4X21A 3BU3A 4Y72A 5FD2A 3U8WA 3W16A 4AZFA 4EHZA 4M67A 4ASDA 1ZAOA 4LGDA 3OHTA 4AA4A 1I09A 4C3RA 4UMRA 4UWCA 3BE2A 3ZCLA 4QYEA 1DI8A 4W9WA 4IDTA 4MXOA 3ZFYA 1VZOA 4OBPA 4PDYA 1OI9A 4U7ZA 5E8SA 3C7QA 1OGUA 2QOOA 3B2TA 3VBXA 4BGQA 3OD6X 2P4IA 3UBDA 4IVDA 1OIUA 3Q04A 4FICA 2CGUA 3R01A 5GIPE 4FNYA 5E8UA 2O8YA 2C30A 3UIBA 3UQCA 4MBJA 2VRXA 4MCVA 4OT5A 4H36A 3BV3A 5LVMA 5TF9A 1IAHA 1U54B 1AD5A 2C6IA 4M3QA 2R5TA 5B2MA 2CN5A 3PXKA 3UMXA 3IW8A 3D2KA 4M69B 4WNOA 5HNBA 3QQKA 3AGLA 3KRRA 2JDRA 2YCSA 4YURA 4BWPA 3CPBA 1OL2A 5C26A 4FTMA 4O0TA 1Q8YA 5A46A 1H1RA 4UZDA 3RVGA 5BUEA 5AJQA 2R3IA 3TUCA 4PPCA 4FSZA 3C5IA 3RAIA 4I6BA 4R1VA 2YA9A 3UOHA 5C27A 1PXJA 3HKOA 3OCTA 4UXLA 2J0LA 3RP9A 5IUHA 4QP4A 4PDOA 3FLZA 2ONLC 1Y91A 3QA8A 4AN3A 3ROYA 3WF5A 1CMKE 5HTBA 3OVVA 1BL6A 5FTOA 3PXZA 4OBOA 4GEOA 5A4QA 3QX2A 4RA4A 5CAPA 2VAGA 1F5QA 3R7IA 4UMTA 4F64A 5M44A 1U59A 4DINA 1O9UA 2QVSE 3PE2A 4RWLA 5EM6A 3RM7A 2UW5A 4JBQA 4PMTA 5JKGA 1JPAA 4C61A 4I20A 3S0OA 2W1CA 4IBMA 5C1QB 4LGGA 4TKSA 5L6OA 3BLHA 3AGMA 4AGUA 2PVFA 3T9TA 4E26A 4JRNA 3Q2MA 4ARKA 3JVRA 1JSTA 3CY3A 4E4MA 2WELA 4BDFA 4FZ6A 4EK5A 5FRIA 3R63A 4HVHA 2XEYA 3BX5A 4CMTA 2QHNA 4IANA 3WIKA 1AGWA 5AADA 2C6LA 2EVAA 4KSQA 4ZY5A 1KOBA 4ZJJA 2E2BA 5IEVA 2YWVA 4PDSA 3KQ7A 2IO6A 2R3HA 3DT1A 4IH8A 4MEDA 2YM4A 3K2LA 4FV4A 2ITYA 2WPAA 4M84A 2HIWA 2O65A 3W8QA 2PYWA 3QZHA 4FUYA 4E4XA 3U6HA 4TYIA 1CKIA 5AR2A 3I5NA 4AOIA 1I44A 4L8MA 4D1SA 2XK9A 4NZWB 2CGWA 2EXEA 2UZVA 3ACKA 3I0OA 4RWJA 3UYTA 4AN2A 4BI1A 3EN6A 3QHWA 3QQGA 4O1PA 5CY3A 3RZFA 5IEYA 1BKXA 5G6VA 4KIKB 2P2IA 2R0IA 3A7HA 4XYFA 4IXPA 3OW4A 3SW4A 2X8IA 3S00A 3RPSA 3DJ5A 4R1YA 1JBPE 1Z5MA 2WTKC 3TJCA 3QRIA 3W2PA 4CFUA 3F5PA 3DBEA 3Q32A 4RFMA 5H8EA 3ZSHA 5IQEA 3D83A 4Y73A 2CHLA 3UC3A 2FYSA 2BAKA 3BGZA 3A99A 4NU1A 2WTVA 4EYMA 4Y8DA 4ZP5A 3DNDA 3R7VA 4ANQA 3LVPA 3COKA 3GGFA 4BCHA 3QKLA 5FP6A 3QD2B 4OTGA 2V7OA 4PV0A 1XBCA 4MNEA 3PYYA 4B0GA 5LVPA 3EN9A 1OIRA 4F9YA 5JQ5A 3RPOA 2CKPA 4M0YA 4AFJA 4IFCA 4QMZA 4BI0A 3F61A 4TRLA 3ZTXA 4DEEA 3TDVA 1PMNA 4R3RA 1K9AA 4O2ZA 4KUJA 3Q6UA 3NZ0A 5AUZA 4EQCA 4P7EA 4W4WA 4E6QA 2PUUA 4MXZA 4CFMA 4JL9A 4QP7A 1XJDA 4EH6A 1YXXA 2JD5A 3FMMA 3IECA 5A3XA 4ACDA 4DT8A 1JSUA 3R83A 4Y5HA 3AG9A 2F7XE 4LI5A 4NL0A 4EH8A 2FVDA 2W5AA 4HVSA 4BTMA 3PG3A 3OBGA 3V8WA 1HOWA 3H30A 3QKMA 3D2IA 2GHMA 4FSYA 4LOQA 3R8MA 2R9SA 2WXVA 2A1AB 4R3PA 4B4LA 4E6DA 3DTWA 3HECA 5C9CA 4QP3A 4Q9ZA 1S9JA 3ZFXA 2PVJA 2H9VA 4IX6A 4W9XA 3O17A 1REJA 3VBYA 3TN8A 4OGRA 2PMOX 2J9MA 1Y57A 2PTKA 4IIRA 1H00A 4CEGA 4FT3A 1PXLA 3JY9A 2WEIA 3EZVA 2C0TA 5CVFA 3R21A 4OUCA 4FGRA 4E6CA 3MH0A 2HOGA 4JG8A 4RC2A 4IWDA 1ZZ2A 4FK6A 1GIHA 4JDHA 3R8LA 3SG9A 3V04A 2VGPA 4J71A 5DI1A 5EKNA 3S3IA 4BCPA 1W8CA 3PY0A 4L00A 2X0GA 3CE3A 3FSKA 3E8CA 3TXOA 4ANBA 5JQ8A 5KMLA 3PJ8A 2CNQA 5JSMA 4JDKA 5AP0A 4U44A 3ORIA 5L2SA 2ZM4A 1MRYA 3IGGA 2Z7SA 2X1NA 2P33A 4MVFA 4GG5A 3FQSA 3QTRA 4I21A 3HX4A 4G9CA 3F5GA 2GFSA 3BRBA 1OBGA 3TACA 4RMZA 4XRLA 5HCXA 3VQUA 5CT7A 2WMUA 2P0CA 3G90X 3I81A 3ZLYA 2WNTA 3FKNA 2IPXA 4NEUA 3WZKA 3DLZA 3K5UA 2ONLA 2XJ0A 5JZNA 2VTPA 1H4LA 3LQ3A 2WQNA 2RGPA 1ZXEA 3CJGA 4FKWA 4YSJA 4XBUA 1SVHA 3O71A 2WO6A 3EFJA 4FT0A 3BBWA 3O8PA 2XM8A 3WE8A 3V5PA 5A4LA 5CLPA 3FZ1A 2GNJA 3G0FA 4C35A 3ATSA 2ITUA 3RBWA 3OEZA 3E5AA 3EN4A 1H07A 5CI7A 3VC4A 4F6UA 3EB0A 1YHVA 1YOJA 3K3IA 3UP2A 4IZ7A 5BNJA 2ERKA 4D1XA 1KV2A 2R3RA 5CNNA 4DYMA 3TNHA 5IQFA 4YHJA 1ZRZA 3G2FA 2R64A 3NNWA 4O0UA 2Z7QA 3S1HA 1DAWA 5LVLA 4MBLA 4NFNA 3LW0A 2XH5A 1G3NA 5DGZA 3R2YA 5CEQA 3KA0A 4BIBA 2Y6MA 4CT1A 5IH4A 4A9UA 3L8PA 4FIIA 4PNKA 1GIIA 2C6MA 4CTCA 4NW5A 4XHKB 4XNEA 3SHEA 4D2RA 3WARA 1Q3DA 2EXMA 2FUMA 4M14A 4EI4A 4U0IA 4YMJA 5GZ8A 3SG8A 3HYHA 3ZO3A 5EM7A 3FPQA 4NCTA 3PSCA 3VJNA 2PUPA 2QR8A 4GU9A 4TWOA 4LGHA 3OMVA 3ULZA 2RL5A 5DRDA 2J4ZA 5IA2A 3PG1A 4ZZNA 2YJSA 3ZDUA 4BDGA 3QUDA 4QMUA 1HCLA 4Y85A 3LE6A 3CP9A 5ETFA 3HA6A 4HYHA 4RIOA 4EC9A 4BKZA 4QMWA 2VX1A 3ZLSA 1Y6BA 2YCQA 3ENMA 3FY2A 2XJ2A 3O23A 2OO8X 4MD7E 4W4VA 5I3OA 3T3UA 5D9HA 2WQOA 2Y0AA 2A27A 1UWJA 4YNOA 4JBOA 5L6WL 4QTDA 5CU4A 2R3KA 3CS9A 4BZDA 3A62A 3KFAA 3OY3A 4YJOA 2OW3A 3H10A 5HTCA 5E1SA 4H05A 4AGWA 5EH0A 2W1HA 4GYGA 3D5XA 4EUUA 4ANMA 4I41A 2BZIB 2ITWA 2XK4A 3VRZA 4B7TA 4DHFA 3M2WA 2BTRA 3I5ZA 4PPAA 3RTPA 2YDIA 1XH9A 4FKPA 4MXCA 4XLVA 4OTFA 3QCYA 2PVHA 4ZS0A 1KE9A 2XRUA 2X39A 4FTQA 4JI9A 3E64A 2Q0BA 4QT1A 5CWZA 3V5TA 4RGJA 4TYHB 3D5VA 3V3VA 4A4XA 3OW3A 5GJFA 4KKHA 2I1MA 4PF4A 1KE6A 2X2MA 3QD3A 3F7WA 4LL5A 1YDSE 4WG3A 1SNUA 4KB8A 4DTAA 2C1BA 4OT6A 2XBAA 3BHYA 3JYAA 4QQ5A 1P4OA 2HENA 4IWOA 5DR9A 1GJOA 2OBJA 5EKOA 5EOLA 4KKGA 3SD0A 2R3JA 4BWXA 4C57A 4APCA 3LFQA 3BQRA 1YOLA 2UW6A 3FZTA 4FKJA 4YJRA 5A14A 3MS9A 3FMHA 1W84A 3AT3A 1YDTE 4MQ1A 3I0QA 4QO9A 3MJ1A 3AD4A 3ZYAA 4EL9A 5IQHA 2UVXA 5JN2A 2BIKB 3SXSA 1BI8A 3DA6A 3E62A 4AT5A 2PZPA 3P79A 4KAOA 3C13A 3OCGA 5KKRC 4U79A 3PE1A 4AA5A 2VU3A 3LJ2A 3VO3A 1H1QA 4ALWA 2CKEA 3GXLA 4YJPA 3VF8A 3DBQA 4GJ2A 4WA9A 1TQIA 4N70A 4XEYA 4O91A 3ZC5A 3W2OA 3F3TA 5E9EA 3BIZA 3DU8A 4EZ7A 4EK8A 4USFA 3NW5A 5CAVA 1AQ1A 2XUUA 4BRXA 2ZVAA 2W9FB 4APPA 3A7IA 4FTNA 4GJ3A 4QNAA 5L2WA 3RK5A 5CU0A 2VTSA 3PWDA 2BHEA 1IRKA 2QKRA 3MY0A 3TV7A 2B9HA 3FMEA 3VW8A 4F99A 5BPYA 4H58A 4B9DA 3CKXA 4KSPA 2XA4A 4XH6A 3TDWA 4GW8A 5M08A 3NMUF 5BQ0A 4L44A 5HVYA 4CG9A 4ZTQA 3JPVA 4BDHA 3Q5ZA 1H08A 1H25A 2YM5A 1J91A 2PY3A 4R3CA 4RIYA 5HESA 1CKPA 2JDVA 1A06A 4G34A 4V0GA 5EDQA 1W98A 4PP7A 4ZTMA 2DQ7X 4QMLA 2H6DA 3UDBA 3EJ1A 4U3YA 4C58A 4G5PA 4UV0A 4BCIA 3HDNA 1YI3A 2OJFE 4UMQA 1LEWA 2BIYA 4XP3A 3ZEWA 2RF9A 1XKKA 4RFYA 1YXTA 1OL5A 2W4OA 1W7HA 4ENXA 2BMCA 3E93A 2CCHA 3HL7A 1H0WA 3VWAA 3UPZA 2WB8A 3G5DA 2GQSA 4TPTA 5JFVA 5CVHA 3FSFA 3BWFA 4BDAA 2VTMA 5E8VA 3A4PA 2FSMX 5L2IA 3WF7A 3DBCA 2PSQA 3GP0A 2QHMA 3QTQA 4WG4A 3SDJA 3KVXA 3CQWA 4EEVA 4IHPA 3FMJA 4N6YA 2LAVA 4X3FB 4IVBA 5DPVA 5C03A 3FUPA 4K77A 4X2KA 5B2KA 1VR2A 4BDDA 4GFMA 4ZTSA 3QC4A 3AMAA 3R7EA 4BHZA 2BRNA 3B2WA 3DJ6A 2HK5A 4H3QA 2FO0A 2WQBA 3QTXA 3KK9A 5EYCA 2C5NA 1Q3WA 4OTHA 5DG5A 3PP1A 2Z7RA 3A7JA 3GOKA 2YDKA 4J8MA 4DTBA 1WBOA 3LXKA 4GU6A 4QP1A 2OICA 3FLWA 4FODA 3U4UA 3VS1A 5K5XA 2ACXA 2VWIA 4GYIA 5CEMA 2UV2A 4NJ3A 5DT0A 5AR4A 5CEPA 1PMUA 4FC0A 1GAGA 5M55A 1UA2A 4BDIA 4DTKA 4QYGA 4QMNA 4UWYA 4FEXA 3UQFA 2GNGA 4AZTA 2WZJA 3MYGA 3NIZA 5EW3A 3G6GA 3SOAA 4U3ZA 3WZDA 1OMWA 3W55A 3BGQA 3GU7A 2ETRA 3LHJA 4R5SA 4ZSEA 5AFVA 4ZMEA 4OLIA 4EORA 4OTDA 5F20A 3ZZEA 3DV3A 1BLXA 2QD9A 5J7HA 4HVIA 3H4JA 4ZZMA 3HRFA 2O63A 3LIJA 4UY9A 2XYNA 4XX9A 2OJGA 1R3CA 4BYIA 2YHVA 3TZ9A 5JGAA 3IKAA 3DK3A 2PVNA 3IG7A 5HBEA 2ZOQA 2C6KA 4RIXB 4IFGA 4IX4A 2GU8A 2QC6A 3QRTA 3PXQA 4BCFA 4CZTA 1H1WA 2P3GX 3DJ7A 3DKGA 3G6HA 3ODYX 3VBTA 4GMYA 2YCFA 5M4FA 4FTRA 4F7SA 2RIOA 3DNEA 4DCEA 2VWZA 3KXNA 2XNMA 3PVWA 3ZLWA 5KHWA 3UJGA 4ITHA 4FTIA 2NRYA 2W1FA 4PNIA 4U97A 5A4CA 4O0SA 5M06A 2XIZA 2NRUA 5IPJA 5HKMA 5DHJA 3BHVA 1OKYA 4XV1A 4QP8A 3KMMA 3KCFA 1F3MC 1VYWA 4FKIA 2YERA 4I22A 4KABA 4PRJA 3QZIA 3BELA 4YTIA 3U87A 1PMVA 3HP5A 4YJNA 4L52A 2CLXA 5HHWA 3VHEA 4J97A 2O3PA 2OKRA 4LMUA 3TI1A 3V8TA 2YEXA 1PW2A 1V0PA 3T9IA 4K8AA 4AW0A 2UZWE 5EDRA 2CKOA 2J0KA 2FSTX 2VTAA 1KE5A 1SVGA 3VUKA 4U5JA 4O6EA 4D55A 3R22A 3LOKA 3VHKA 3W2SA 4C4FA 4KD1A 1CTPE 1DAYA 1R1WA 1OUYA 2AC5A 4QD6A 3TV4A 3O7LD 3P7BA 4H3PA 3D7TA 3F3WA 4O21A 3IGOA 3U6IA 4EHVA 5L8LA 3C4WA 2WMWA 2OXXA 1JNKA 2HY0A 3DBDA 5M51A 3EQPA 4F1OA 3Q4CA 1NVQA 4QPMA 5ANDA 4DEDA 4EH9A 3OUNB 3EOCA 4QNYA 2EXCX 2HWOA 4G6OA 5CTPA 4D4SA 3PUPA 5AV2A 3FZRA 4EBVA 2ZV9A 2NO3A 2VO6A 2J51A 2QOCA 1J1BA 4ERKA 1B38A 3W33A 5A4EA 4ORKA 3LXPA 4AUAA 3MW1A 1PKDA 2ITPA 5K3YA 4R78A 3U4WA 3CGFA 3OTUA 3KULA 2CKQA 2XEZA 3QYZA 2ZB1A 5CYIA 3UZTA 5FBOA 3VBVA 3KRJA 4R7IA 4IM3A 2W5HA 3DTCA 5CNOA 1UNGA 2CCIA 4XJ0A 4AGCA 4E5AX 3N4TA 3NUPA 3PTGA 4YO6A 2WGJA 3TJDA 3TTJA 2PUIA 4FIHA 5L2TA 5BYLA 3HA8A 3C0GA 3DOGA 5A54A 5JK3A 3Q9YA 3ZO4A 3CLYA 4HCTA 4CLJA 4IAIA 4NW6A 4G3GA 2G2HA 5IMXA 3ERKA 1U54A 4RC3A 1Y8YA 4YU2A 2QO7A 2BCJA 2OLCA 5AP6A 3OEFX 4KBCA 2QU6A 2C3KA 3QUPA 4TL0A 4RJ5A 5JEBA 1OPJA 5CQWA 4KIOA 3PRFA 5JZJA 3FDNA 3QTWA 2WU6A 3A61A 3RHKA 4EZ5A 1KE8A 3TIZA 4O83A 4GT4A 2WAJA 1UU3A 3IW6A 3NNVA 3NGAA 4BKYA 4CQGA 1BI7A 5EOBA 3VUDA 4I93A 2R3GA 4FKSA 2PULA 4OTWA 1GZKA 4I6HA 2B55A 4GIIA 4NM0A 2QG5A 4KRCA 3VUHA 3GUBA 2EUFB 3GB2A 4ASEA 2XCKA 1Y8GA 2A19B 3P23A 4G31A 3UYSA 2VTQA 3DB6A 5CXZA 2JLDA 2R3QA 4P2KA 1HCKA 2GNHA 4S2ZA 3GBZA 3PPJA 3TKHA 5DE2A 2WTKB 4FVQA 3ZO1A 4D0XA 3E7VA 5JFXA 3MA6A 2PL0A 2X7GA 1R0EA 3FWQA 4XP2A 2XKEA 4W4YA 2WTIA 3W10A 5KHXA 1L8TA 4IC8A 2BKKA 3VUGA 1GOLA 4TNBA 3F3VA 3NS9A 5H3QA 5DR6A 5AAEA 1LR4A 1ZYSA 4FOCA 1FVRA 3QALE 4X2FA 5EW9A 3CSVA 3UIXA 3UNKA 3SRVB 2Q83A 4E1ZA 3QXPA 4M68A 3C4FA 4EOOA 1OKZA 3EIDA 5K0XA 1IA8A 3WOWA 4WOVA 2OI4X 3OCSA 3GT8A 5CENA 3AC8A 4JG6A 5AUTA 3ORXA 5JH6A 4A9RA 1OKVA 1UU8A 4O7WA 5IQIA 4DA5A 2ITOA 3DKFA 2IW9A 3W2QA 3RCJA 5FXRA 1SNXA 3QQUA 2X9EA 4QOXA 4W4XA 4KA3A 5BVFA 1IA9A 3CEKA 1B6CB 3COHA 3H9FA 5DFPA 4MD8E 4BTJA 4WRSA 2YLFA 3VS7A 1FINA 1XH5A 5D7AA 3TZ8A 4R8QA 2CGXA 4DFZE 3CIKA 5FEQA 3PXYA 5H9BA 3OY1A 3RCDA 4FX3A 2C0IA 5IA5A 1UKHA 5HO8A 3QBNA 5CZHA 1OUKA 4MXAA 1PHKA 3F82A 3DCVA 3BBTB 2RFSA 2X2KA 4BVUA 5CAQA 4XLIA 3C0IA 1FGIA 2XRWA 4BDCA 5HE1A 4D2TA 3KKVA 5E4HA 3MTLA 5HNIX 3O51A 2W5BA 4PL3A 1MUOA 3ETAA 3OP5A 4LUEA 2J6MA 3P7AA 3SW7A 3PSDA 4FV5A 4IB5A 3HUBA 1OVEA 1ZMVA 4HYUA 5HICA 3IDCA 4PWNA 2CDZA 2Y7JA 4XUFA 1MP8A 5IUIA 4ACGA 3ZEPA 3N9XA 1A9UA 4FSTA 4ZEGA 3QKKA 4G2FA 3VBWA 2ZV2A 4GV1A 3R2BA 2JIIA 2IZUA 3PA5A 3I4BA 1YKRA 3QD0A 3Q60A 1IEPA 4CTBA 4EKLA 2VO0A 4BCJA 2HAKA 2X4ZA 4FBXA 4IEBA 4O38A 5F95A 4C4IA 4TXCA 1Q61A 3HGKA 4FKGA 3R8ZA 3IQ7A 4UALA 1H27A 2VNYA 2J0JA 2OIQA 4I0SA 5J5SA 1G8AA 1YI6A 3MSSA 2Y4IC 4QMOA 4ENYA 2R0UA 4C3PA 4Z7GA 3I6UA 3FHRA 3V51A 4RSSA 3D7TB 3RZBA 4BBFA 3DS6A 5J9LA 3BE9A 5B0XA 4R77A 4ZSJA 2JBPA 3QL8A 4QMVA 3NVMB 4GKHA 5EFQA 1YHSA 2PVRA 4OAVB 5E8TA 5AV1A 4ACHA 5AV3A 2IW8A 4X6RA 1LPUA 3REPA 3Q4ZA 1JSVA 3HMNA 2C3LA 5IG1A 2BZHB 2V0DA 2OIBA 3MVLA 4KIKA 4CD0A 2OJIA 4I4EA 3WYXA 1OPKA 2QURA 3QRUA 4JX7A 4L9IA 1JAMA 2GSFA 3TKUA 3RHXA 4CQEA 3MGYA 2GNIA 4OBQA 4PP9A 3GCVA 3S95A 2UZTA 5DR2A 4C2VA 4QMMA 1PXIA 3GCUA 4OW8A 4EH2A 3C50A 4FG9A 2VTRA 4V05A 5IA3A 2YLEA 3KB7A 2WMAA 4UXQA 3QU0A 4II5A 4DITA 3R04A 5C4KA 3CJFA 4PY1A 1V1KA 2OZAA 2XNOA 3I1AA 4H3BA 4MXYA 2ZYBA 3OTVA 4IAKA 4D4YA 4X2JA 4HYIA 4Q5HA 3V6SA 3EN7A 4PL5A 2PVKA 5HI2A 2GTNA 3FQEA 4M7IA 1OL7A 2R3FA 4ZLYA 4UBAA 4UN0C 1LUFA 2YAAA 2RFNA 4YTHA 3LKMA 3WZEA 2OK1A 2VWXA 5EHOA 3GEQA 3VBQA 1E1XA 2C6TA 4FKTA 3A8WA 2VX0A 3QGWA 5CZIA 4PMMA 3CPCA 1TKIA 2YIYA 1XWSA 3KXZA 4GFGA 3OF0A 3CY2A 3LFNA 2AC3A 4L3LA 4XOZA 3NAYA 3SXFA 4Z55A 1YOMA 5CU6A 4XRJA 3N51A 4TY1A 3IDPA 4FNZA 5I9XA 3AD5A 1H0VA 3F66A 1KOAA 5DOSA 3HEGA 3E8EA 3LCTA 4L46A 5AM6A 3W1FA 2WMSA 2FSOX 4NSTA 4ZJIA 2C69A 3RK9A 5CF8A 2W1GA 2YIQA 1SZMA 4TW9A 3ZUTA 4DGLC 5FWKK 4JR7A 1T46A 4AFEA 2ETKA 3LJ0A 4CV8A 2CSNA 4RZWA 2QR7A 4O86A 3T3VA 4EC8A 4FVRA 1PYXA 3ORMA 2A0CX 3F5UA 4C8BA 1J3HA 4FT7A 2XK8A 4XG4A 4R7BA 1Z57A 3FHIA 2ZB0A 3MVJA 4HGSA 1PF8A 3IW4A 3PVUA 4I0TA 4I3ZA 4C02A 3KGAA 3ANQA 2ESMA 3F2AA 2HXQA 3BU5A 1PXMA 3GC7A 3FKOA 3KRLA 2WOUA 3QC9A 4ZTHA 4JAIA 5HOAA 4BL1A 5LVOA 4EJ7A 5A4TA 4HVDA 4BCQA 3M42A 4YZ9A 3LMHA 3PXRA 2J5EA 3I60A 4NIFB 4AX8A 3MH2A 4IX5A 5HIBA 3C51A 5E8XA 2CPKE 2VWYA 3NPCA 4F7NA 3SGCA 5KE0A 4PX6A 4DBNA 5M57A 5EQEA 2JAMA 4K1BA 4UYNA 2FB8A 4FTAA 2BR1A 3TEIA 2VX3A 5IA0A 4F70A 5JGBA 4EK4A 2E9UA 2UZLA 2B7AA 3I6WA 4FEQA 3WF6A 2NNWB 1BX6A 5DRBA 4QTEA 3HMMA 3RWPA 1P2AA 4XP0A 4YGAA 5DWRA 4AZSA 3VULA 2E9OA 1SVEA 3MBLA 1O6KA 3OBJA 3FMDA 4QMXA 3RPVA 2GS2A 3NX8A 3R1YA 4P5ZA 3QTIA 5KKRB 2VWWA 1VYZA 4D5KA 5FTGA 5GZAA 4ID7A 4UEUA 2H34A 2WD1A 4ZTLA 4CMUA 2G2IA 3UODA 1ZOHA 2F4JA 5T6KA 4BZNA 1RE8A 4UB7A 5KMMA 3KREA 3TKIA 4XG6A 3BU6A 5IEXA 1JVPP 4BICA 3L8VA 5IUGA 4HJOA 2V55A 4O6LA 4HOKA 3EMGA 2YCRA 5CEOA 4AF3A 3TNQB 3G33A 5L3AA 4RJ8A 4JAJA 3BYMA 4I23A 2CNUA 1Q8WA 3DBFA 4K0YA 3O0GA 1YXSA 3ZUVA 4FTUA 5GZ9A 2I6LA 3RALA 4XG3A 5CSHA 3BYUA 3GOPA 4LUDA 3P78A 1Q8ZA 4QMPA 2UW4A 4FKRA 2HYYA 1WVXA 2QOKA 3QHRA 3VAPA 5KBRA 3MA3A 2C0OA 2DWBA 4BWKA 5KMJA 3DLSA 4IAAA 1KUTA 1WBWA 4JQ8A 2B0QA 4Y83A 1NW1A 4MBIA 2W0JA 3AT2A 1U5RA 3POOA 4E5WA 3KVWA 3NRMA 3OROA 3R02A 5JMSA 3EFKA 2ZV7A 3PPKA 2R2PA 4FIFA 4NM7A 4PTEA 1O6LA 2PVMA 4RG0A 1ZYJA 4FYNA 4RQKA 2C6EA 3UZPA 4D2WA 3EQRA 1FVVA 1V0BA 1ZMUA 3UE4A 3OWLA 4HGTA 4RIWB 4C2WA 4AW1A 5J5TA 3NUUA 2PK9A 4GCJA 2ZAZA 3FI8A 3MPAA 4F0IA 3C1XA 4BDJA 2GNFA 4DE4A 3I79A 3BEGA 3SOCA 5KUPA 5E92A 4FL2A 1DS5A 2UVYA 4C4JA 4HCVA 2ITNA 2R3MA 4P5QA 2JKMA 3WZUA 3DB8A 1JKTA 3ZU7A 1Q8TA 5AA8A 4GKIA 3R9DA 2GS7A 4DGGA 3KF7A 3KRXA 3UG1A 1W82A 2YIRA 4N4SA 1Q24A 4P4CA 4X6QC 4AN9A 3IO7A 5DLSA 4KKEA 4FZ7A 4KNBA 5L4QA 5CAUA 5IKWA 3BPRA 3FE3A 1DM2A 2VTOA 3UVQA 3ZSIA 2FH9A 4EH4A 2GHLA 3R9NA 4FZAB 4QPSA 1JOWB 4YR8A 2J5FA 3GFWA 3PDTA 2OZOA 5CSPA 5GJDA 4TYHA 2A2AA 2BALA 4YP8A 3DDPA 4JVGA 4J96A 3VS3A 3LPBA 3D4QA 2UZOA 3DZQA 5FM2A 2OXYA 4EHGA 4BIDA 2YZLA 4JIKA 3LM5A 5M56A 1WBVA 4O7ZA 2C3IB 1LP4A 2VTLA 4BGHA 3ID6C 2W99B 3TIYA 4MF1A 3ITZA 4WUAA 3VRYA 3TG1A 2IVVA 4A4OA 2YABA 2JC6A 3FBVA 3KC3A 3MH3A 4IM2A 4M0ZA 5KBQA 3DGKA 2WFYA 2J0MB 3G51A 4O7NA 4KIPA 4HGLA 2BDFA 4RBLA 5FUTA 4MTAA 4AOJA 1R39A 2UUEA 1E1VA 2QO9A 1MRUA 2R3LA 2GFCA 5A6NA 3R9OA 1X8BA 4BDEA 4HYSA 2YFXA 4EOJA 1PXNA 3GC8A 2GQGA 3PFQA 2QI8A 1XH4A 3OFMA 2R3NA 3KN5A 3GU4A 4FGBA 4AT4A 1OM1A 3UO4A 5KX8A 3KF4A 2VUWA 4BBMA 4USEA 4DT9A 2YWPA 1XR1A 3VS5A 4EOMA 4XMOA 5CEKA 2OIDA 2X81A 1H01A 4NJDA 2BILB 3POZA 4RJ7A 2WMVA 1LEZA 4TWNA 1MQ4A 4TYJA 4XG9A 3FEGA 4O0XA 3VN9A 4DH5A 4B8LA 3UG2A 4C7TA 3D9VA 3Q96A 1ZYDA 4F7LA 2JKQA 2ZMCA 3E3PA 4AU8A 3P9JA 4IB0A 2YITA 4QTBA 4FTTA 3BYVA 4I5HA 5I9ZA 2F7ZE 3JS2A 4BFMA 3F2RA 3LCSA 3NVKI 2H96A 4XOYA 5EHLA 3ULIA 3JY0A 4B99A 3QWJA 3GU5A 5IQAA 4IX3A 3KN6A 2OJJA 4PTCA 3CD3A 5EI6A 4XBRA 2V22A 4FNWA 4A4LA 2FSLX 4NK9A 3CR0A 3AT4A 3GU8A 5JFWA 2Y9QA 3A2CA 3TCPA 4FV6A 4C62A 4NH1A 4EONA 3G0EA 4QQJA 3V5QA 4M69A 2F7EE 3DQXA 4DC2A 4FYOA 5TO8A 3UIMA 4FG7A 4FV1A 3FZPA 3F6XA 4C4GA 4YUQA 1G5SA 3QD4A 3R9HA 3L8XA 4D4RA 3RK7A 2XS0A 3FMKA 2XNBA 3PY3A 3ANRA 4K33A 4KRDA 4QTCA 4RJ3A 3ZC6A 3ZUUA 2QU5A 4FSMA 3ODZX 2XCHA 4G6NA 3W2RA 4EOKA 5CALA 2GCDA 2DUVA 3P5KA 3P08A 2E9VA 4ACMA 5IH6A 3PVGA 5A6OA 5EG3A 5HLNA 3BCEA 1NY3A 4X2NA 4BCOA 2JIUA 3FJQE 4HPUE 1CM8A 4QQCA 2BRBA 3PA3A 4DGNA 2PU8A 3E63A 4J8NA 5LWMA 5EYDA 5LMBA 2YDJA 5BUJA 2PZ5A 2PVYA 4AXAA 1K3AA 5CXHA 5K4JA 1RJBA 5DN3A 1XQZA 5HE3A 2HZIA 4ONAA 2HW6A 5TR6A 5J1WA 5AAFA 1U4DA 3UQGA 2C47A 3QRKA 4ZAUA 1ZY4A 4JNWA 4AZVA 3Q2JA 2IJMA 3NSZA 4FL3A 4FKVA 4JDJA 4Q5EA 1J7UA 1ZY5A 4B6LA 3R30A 4WUNA 4HZSA 4WIHA 1PY5A 3CQUA 4DFNA 4ALVA 4BB4A 4MNEB 3V01A 5K5NA 5CEIA 1P14A 2IZSA 4OAUC 4FZFB 2ETMA 4O27B 2OJ9A 3KY2A 5CAOA 1PMEA 3PY1A 4RVKA 3L1SA 2O2UA 2VTJA 3U55A 3VUMA 3CTHA 2BFYA 4ZTRA 5HD7A 5A9UA 4FIJA 3JR1A 4NTSA 4FNXA 4LQMA 1XH7A 3AXWA 3F3ZA 3PIYA 2J90A 3UVRA 5HO7A 5LCJA 5ANJA 4RX5A 5HCZA 3MWUA 4FA2A 4CT2A 4RVTA 4F0FA 2JAVA 2QOBA 4FUXA 1M2PA 3FYJX 4PDPA 4QP6A 4RQVA 3OOGA 1R78A 1QMZA 4C36A 3OOMA 4YTFA 2W06A 3ENHA 5LCKA 2HY81 2QOQA 1TQMA 4DFYA 3BLQA 1S9IA 3PZHA 2B53A 3QTZA 3DFCB 4BKJA 3UO5A 4H39A 3SVVA 5I5ZA 4D58A 2ZM1A 3E88A 4M13A 4MD9E 3ALNA 4K18A 4RPVA 4F09A 5CF6A 4ZS4A 1M2RA 4EH3A 1OKWA 2QNJA 2WIPA 3MN3A 4MQ2A 4FEWA 4BCNA 5AUXA 3C4EA 4IM0A 5ICPA 3TWJA 2Z02A 1UU9A 3FV8A 4EBWA 2VNWA 3EQDA 4LRJA 3WBLA 3NLBA 3NEWA 3PIZA 2UZBA 4GT5A 4IW0A 3QUEA 4J52A 5DEYA 5BVDA 2W96B 2JDTA 4BCMA 5H8GA 3MPMA 5CF5A 4NYEA 3FI4A 2XIKA 2XNEA 1YWVA 4A9TA 1VEBA 3P7CA 2JITA 3BYOA 5HO6A 2B9IA 4IJ9A 4UMUA 1L3RE 1JLUE 2B9FA 4PL4A 4BCGA 4MKCA 1SMHA 5CI6A 2EB2A 2WMXA 4HCUA 2V5QA 2PUNA 4F6SA 3LLTA 2PZYA 3ALOA 3ORKA 5HG8A 4E7WA 2ZDTA 4Y5QA 1PRYA 4B8MA 3LFFA 4BC6A 1MRVA 4GSBA 4JOAA 3HDMA 4GVJA 4DH7A 4EZ3A 2B52A 3OXTA 4JS8A 2JIVA 3MVHA 3JUHA 4E20A 5IDNA 3OWKA 5ETCA 2ITVA 5AIKA 3DAEA 2EB3A 2PMIA 5G1XA 4U6RA 5CX9A 4WSQA 4QMYA 4YNEA 4YZNA 3UOJA 1YRPA 2ITXA 2GNLA 1XH6A 3EHAA 3EQCA 4L68A 3MESA 3ACJA 4PTGA 3R7OA 1UKIA 3OXZA 2CNVA 4JQEA 5I9VA 1Q97A 4M15A 4YJQA 5BX0A 5H8BA 5CT0A 3BHTA 4FT9A 3MFSA 4FI1A 4ZTNA 3LZBA 4MAOA 2BZKB 3GENA 3MVMA 3QLGA 4U9AA 4GK4A 2F2UA 3NCZA 5EHYA 1H24A 4AZEA 4J95A 4U80A 2OGVA 4KS8A 4CXAA 4C38A 4L67A 2OWBA 5BYYA 4FTCA 4KIQA 3UMWA 2UW8A 4I1ZA 5EK7A 2RG5A 3C4CA 3VW6A 4MWHA 3KXMA 4JR3A 4RJ6A 3MTFA 3ELJA 1OIYA 4IWQA 2QQ7A 2ZM3A 2HXLA 3R6XA 5FG8A 2ITQA 3ORLA 3EKKA 5KZ0A 2BPMA 3VNTA 3L8SA 1ZOGA 3LQ5A 1SM2A 4Z3VA 5AX3A 4I4FA 4IACA 5TKDA 3R1SA 2PWLA 4IVCA 4NTTA 1IASA 3L9NA 4ZSAA 4CYJA 3N4VA 1CDKA 2HCKA 1XHAA 3OT8A 2BKZA 5CSXA 2Y4IB 4I5PA 4UYAA 4F9WA 2F9GA 3LFAA 1BYGA 2BFXA 3COIA 2BRMA 1WBTA 4BR3A 2QOFA 3UP7A 3ZXZA 3E87A 5EW8A 5HEZA 3ZM9A 1B39A 3R0TA 4CFWA 3WZJA 4C34A 3FY0A 2IW6A 3I7BA 1NT2A 3II5A 1ZWSA 1FVTA 2E9NA 5TOZA 1UVRA 3Q9ZA 3H9RA 3MH1A 4IJPA 3L9MA 1U5QA 5E91A 1PXOA 2F49A 4E4LA 3GC9A 3MY5A 3Q3BA 5HVJA 4BI2A 5J95A 5AEPA 4QP2A 5ETIA 4YO4A 2JGZA 3RPRA 5F94A 2GS6A 5KMOA 4AWIA 5C4LA 2WMBA 3O7LB 2UZEA 2GPHA 2HZ4A 4ANNA 4L3JA 4XCUA 1BL7A 3EQHA 4LYNA 2CLQA 3D5WA 3CQEA 4USDA 4JXFA 3UO6A 2JDOA 3U9NA 3BKBA 4G3DA 4WNKA 4YZDA 3KL8A 2BAJA 4A9YA 2X8DA 4E73A 1YVJA 3NR9A 1IR3A 4JDIA 1GIJA 4QYYA 3EYHA 2XK6A 1YWNA 5D10A 4YJSA 4XG7A 2Z7LA 5HVKA 3U6JA 2YM7A 5ITAA 4GVAA 3U9CA 3VUIA 3R00A 3FQHA 3PLSA 4QMTA 4AOTA 5K0KA 2W17A 3Q52A 5FGKA 3LCDA 4GG7A 4FE2A 1YDRE 4MF0A 2V62A 4S31A 3LFEA 3RNYA 2XIYA 3ZSGA 4BN1A 2J2IB 4DG3E 2E9PA 4MK0A 3MV5A 4YBKA 4Q9SA 1WFCA 4TTHB 4G3FA 5IA4A 4YPDA 1QL6A 2NPQA 4D5HA 2BRGA 4D2SA 4WRGA 1FOTA 3TT0A 4N57A 4Z16A 4LL0A 2O5KA 2PMLX 3MPTA 4CGAA 2WTDA 3BV2A 4KINA 5HQ0A 4WNMA 1URWA 1ZOEA 4E4NA 2GHGA 1ZLTA 2C1AA 2UW0A 3P86A 4L7FA 2REIA 5IMEA 4BY9E 1V0OA 2UZDA 4JIAA 4NUSA 2JFLA 2GTMA 2Z60A 5BMMA 2IZRA 1QPDA 2OXDA 4HNIA 5C01A 5L8KA 5B2LA 3OT3A 3BLRA 4O81A 5HE0A 4P90A 3VQHA 4BCKA 1F0QA 5H2UA 2X8EA 4RVLA 1ZYLA 2A4LA 3QX4A 2UVZA 3NYNA 3LMGA 4IAZA 4DFLA 3FC1X 4YZMA 4G5JA 4FKQA 1OECA 3FXWA 1H26A 3EYGA 4O0VA 3TNWA 2G2FA 2F57A 3ZMMA 5EQYA 4CSVA 3R1NA 5AWMA 3FPMA 3FLSA 1OB3A 2R4BA 3OG7A 4V04A 4J53A 2WMQA 4O96A 3ZBXA 4PMPA 2G9XA 2PPQA 3N4UA 5I3RA 5IISA 3PA4A 5AR3A 2JBOA 4RIYB 2YM3A 1UNHA 4LRKA 1JQHA 4G3CA 4TT7A 4YPSA 3RKBA 3IW7A 3UPXA 2VWUA 5C8MA 3WF9A 5KNJA 5IU2A 5J79A 4J7BA 4YZBA 2UW9A 5HG7A 2DYLA 4MXXA 3T8OA 2G15A 4AW2A 3B8QA 3BZ3A 2UZUE 3HNGA 3LFCA 3AC2A 1IG1A 4EQMA 3HVCA 5AP2A 1FPUA 3QA0A 3ZBFA 5JGDA 4IQ6A 3C4ZA 1JKKA 5BYZA 3WI6A 3PJ3A 3O8TA 5BVNA 3VS6A 4RA5A 3QCSA 4J98A 3BEAA 4A07A 2R7BA 2KTYA 5AP5A 3W18A 4F63A 5LMAA 4AAAA 1Q99A 3HRCA 3K54A 3ZO2A 3LLAA 3DY7A 4X7QA 3CC6A 2XYUA 2OG8A 5ANIA 5HIDA 1YW2A 5BVEA 5D12A 5J1VA 4IAYA 3Q53A 3AMYA 3CTJA 3FL5A 1ZZLA 4YHFA 2XB7A 1JKLA 1BMKA 1GZ8A 3QQJA 1UWHA 4QTAA 4N0SA 3P0MA 2X6EA 4DEAA 2BDJA 3HV4A 4FSUA 3W2CA 2FGIA 2QOHA 3Q4UA 1KSWA 3U51A 2BZJA 5GIOE 1OIQA 2J50A 5FM3A 2CGVA 4DH3A 3W8LA 2QODA 4AGDA 5KMNA 3THBA 3Q4TA 4V0GB 2OSCA 4M12A 3EZRA 4TZRA 4F1MA 3SQQA 3DZOA 3EL8A 3TNIA 4OTRA 2KULA 5DH3A 1NVSA 4NWMA 1QPJA 4DN5A 4FOBA 2OH4A 3O8UA 3GU6A 5DEWA 4ZSGA 3I7CA 3F3UA 4FEUA 4FV8A 4K11A 4O7SA 5CASA 2PVLA 3V8SA 5LQFA 5AA9A 4GS6A 4YJTA 4ITIA 3R9RA 2RKUA 2OF2A 4IZ5A 4X3FC 3A4OX 4DEIA 4DBXA 1JKSA 3LXLA 5ANEA 3DXQA 4HNFA 2HELA 5I9UA
chains in the Genus database with same CATH superfamily
4QMQA 3HAVA 3OZ6A 3QQFA 3CD8A 4ZY6A 5AUVA 1STCE 2GDOA 4AACA 3OXIA 4D2VA 2QONA 4G17A 4KS7A 4EOLA 4D0WA 3RI1A 5EYMA 2HW7A 3QQLA 4GFOA 1YWRA 4G3EA 4IVAA 4TNDA 3NWWA 1JWHA 3FC2A 5DVRA 3WILA 4DG2E 3A7GA 5JFSA 4ZY4A 5AUUA 3IOPA 1J7LA 1K2PA 5LJJA 4FV2A 5D1JA 4I24A 3S4QA 4D9UA 3W0MA 5ANGA 1Q41A 4R5YA 3JVSA 3NNXA 3DKOA 2XIXA 4FSNA 4LOOA 3UZRA 4X0MA 4GT3A 5BV3A 4I6FA 3GI3A 3IW5A 4F9AA 4DFBA 4YHTA 3ET7A 4FSWA 4IAFA 4YLKA 4ZLOA 4X2GA 4FSQA 4DF3A 4IC7A 2GQRA 2EU9A 4LFIA 1WZYA 4IADA 4O7RA 4M97A 2I0VA 3F9NA 3VF9A 1PKGA 1NA7A 2XK3A 4N6ZA 4NT4A 3ZM4A 5HTIA 3DXPA 4D1ZA 3P5JC 3AMBA 4V01A 3LAUA 4NKSA 5EYKA 3NYOA 3ORZA 4ZJVA 4D9TA 1T45A 3LQ8A 5E8YA 5FEEA 3EQIA 2Z8CA 5AV0A 5EDPA 5DYJA 4K2RA 2JKOA 4OR5A 1KE7A 2LGCA 3KXXA 5BVWA 5HNGA 2BVAA 3R8UA 5J87A 4BDBA 2X2LA 1M7QA 5FXSA 4EYJA 4QRCA 1URCA 2JDSA 3WIGA 4AE9A 1GY3A 2QOLA 2RFEA 3R73A 5HBJA 1G8SA 3FZOA 3QCQA 3ZOSA 4BGGA 2RSVA 2IVUA 2XBJA 3NUAA 4D4VA 1H28A 4D28A 4RFZA 2IG7A 3RPYA 2G1TA 2C4GA 5ACBC 4BDKA 1WCCA 4JG7A 4RVMA 4K9YA 4U8ZA 4CVAA 3AC1A 1A48A 4YTCA 5FBNC 4E6AA 2C5XA 2W1ZA 3V5JA 5HIEA 4YC8A 5FXQA 2UZNA 3V5WA 1PXKA 3LCOA 4ANSA 2WTCA 3FMNA 4YJUA 5LXMA 3VIDA 4CKJA 4DFXE 2YZAA 4NM3A 4C4EA 3HV6A 4GL9A 2X4FA 4GUBA 3GCSA 2ZV8A 3R7YA 5EM5A 3RAHA 2I0HA 4CKRA 3AQVA 3MY1A 3LXNA 1W83A 2EWAA 4L53A 5GNKA 2QCSA 3KULB 5KMKA 3ORTA 3DDQA 4O7YA 4FMQA 3PVBA 4FSRA 1SYKA 4U43A 3AD6A 1QPEA 2VTNA 3CXWA 4NM5A 1OL6A 3F2NA 5FEDA 4EOIA 2I40A 3F7ZA 3DK7A 2CN8A 2QLUA 1CSNA 5GJGA 5HU3A 4S33A 5HD4A 4KBAA 4GRBA 3QF9A 3HV7A 2QO2A 3E8NA 5CVGA 5AR5A 4ZZOA 3VUTA 4WD5A 3ZDIA 5L6PA 1ATPE 1ERKA 1P5EA 3GCPA 4ACCA 3TUBA 1PXPA 4Y46A 5AUYA 5HORA 3EQFA 2R7IA 3DXNA 3K3JA 3QWKA 4IE9A 3W32A 2VN9A 2W7XA 1KV1A 3GVUA 3MIAA 5TE0A 3BYSA 2QG7A 4FTOA 3VS2A 2W1EA 3DAJA 5FP5A 3KRWA 3VS0A 5BVOA 5HLWA 3KMWA 4ZXTA 2ITZA 3LFBA 4LMNA 3MB7A 3FI3A 4KBKA 4UWBA 4FV7A 4XG2A 1Q62A 3RJCA 2IVSA 2OF4A 2PHKA 2YN8A 3G9LX 4QYFA 2BRHA 4S34A 1M7NA 2BAQA 2XNPA 1H1PA 5E8ZA 2B1PA 4EOPA 4F7JA 2VD5A 4MHAA 2Q0NA 4WT6A 4XV2A 3RWQA 4L42A 2VZ6A 3TTIA 2VWVA 1TVOA 2W4KA 1APME 1ZYCA 2W9ZB 3H0ZA 3BHUA 5J9YA 5LOHA 5DBXA 5CSVA 4EOQA 4EWHA 4AXFA 4AA0A 2WIHA 2X6DA 4OTPA 3ZRMA 4L6QA 5J7BA 3PLAE 1FMOE 4CCUA 5DIAA 1OBDA 3QRJA 3KEXA 5FDPA 2VTIA 4RLLA 3MFUA 3HRBA 2XKDA 2UW3A 3FLNC 2VV9A 5ETAA 5E8WA 2JKKA 3Q9WA 2R3PA 3M11A 3NIEA 5HU9A 5AP7A 3DPKA 3GQIA 3HMPA 4JQ7A 4ITJA 4F0GA 1KWPA 5IQCA 1O6YA 5AV4A 4Z9LA 1XBBA 5DT3A 3PXFA 4E8AA 2C68A 4L43A 4FT5A 1GZOA 3SA0A 3BWJA 5HE2A 5DNRA 2B9JA 4RX8A 1CKJA 1RW8A 2W4JA 4HGEA 4ZLZA 3FKLA 4O1OA 5HX6A 3ATTA 5GINE 4FL1A 2PE1A 4BZOA 5KO1A 5HG9A 1FMKA 4C0TA 2YIXA 3OC1A 1W2CA 4YC6A 3KXGA 3MI9A 3IPHA 5C8KA 3AC4A 5IDPA 2XNGA 3OWPA 5LARA 4CFXA 4FZDB 4AP7A 1UNLA 3KXHA 4S32A 4CFNA 4GUEA 4GK3A 4AW5A 2IWIA 5K4IA 5CU2A 2JEDA 4I94A 2WEVA 4ANOA 4CRLA 3HLLA 3C4XA 1WBSA 4BYJA 3FMLA 3FI2A 5D7VA 1Q8UA 2X9FA 3O96A 3OWJA 3GC0A 2YJRA 3E3BX 2VO7A 1OL1A 2C5OA 2PMNX 2Y6OA 2XP2A 2ZMDA 4FTJA 5I9YA 3RM6A 3HUCA 3LFDA 4U42A 4D2PA 3LJ1A 5HG5A 3FLYA 1ZMWA 3Q5IA 4WO5A 2R3OA 5HBHA 3CGOA 1EH4A 3WE4A 3SRVA 3ROCA 4CYIA 3HV5A 4C3FA 2BDWA 4TWPA 3A60A 4YLLA 1WMKA 5E90A 2OU7A 3DKCA 5T68A 3SC1A 2HZ0A 5KZIA 3FAAA 4F9BA 4RT7A 3ZS5A 3D0EA 3DQWA 3IK3A 3L9LA 1WVYA 4CKIA 1J7IA 2C5VA 3JXWA 3CTQA 4CNHA 4JJRA 1R0PA 2AYPA 4F08A 4XG8A 3O50A 4J99A 3TZMA 2I7QA 3KCKA 4AT3A 4LG4A 2PE0A 3EL7A 1FQ1B 4ALUA 1M52A 3UC4A 3WF8A 1YXUA 4HVGA 4U81A 1M17A 2P2HA 2BUJA 3V6RA 4FK3A 3BGPA 3MFTA 3QLFA 4I0RA 4CV9A 5E1EA 5D11A 3MFRA 4AZWA 2YACA 4R7HA 2SRCA 3NAXA 4I5MA 3H9OA 4BTKA 4IZYA 3AKLA 3FYKX 4YZCA 4ASXA 5M53A 2BTSA 3O2MA 4L7SA 5FTQA 1WBPA 3UTOA 3TZ7A 3E92A 4G9RA 1Q4LA 3NCGA 4CLIA 4FEVA 1FGKA 2NP8A 3ZZWA 2C6OA 2XMYA 2X7OA 4BBEA 5JRQA 5AP1A 4MX9A 3MB6A 3ZONA 3NUXA 4CFFA 3D94A 2G01A 3CCNA 1OITA 4LV8A 4WHZA 5AMNA 4I92A 3GFEA 4A06A 1J1CA 4W8DA 4FIEA 4L45A 4TN6A 4DCAA 5J9ZA 4G16A 3DFAA 3QAME 4EK6A 3P1AA 3NYVA 4CZUA 3ZLXA 3HV3A 5AR8A 4HZRA 5AP3A 5LWNA 4ZOGA 4JBVA 3SX9A 5HCYA 4OTQA 4ZMFA 1XO2B 2HZNA 5AX9A 2BHHA 3NUSA 4C4HA 3NUNA 4U40A 2B4SB 3GNIB 3H0YA 4O0RA 4PMSA 3FZSA 3UNJA 5M4UA 4FG8A 5CS6A 3VS4A 3ZH8A 3SLSA 4M66A 1M2QA 4FKLA 3MJ2A 4YC3A 3TNPC 5EM8A 4YLJA 4K6ZA 3MIYA 5I4NA 2I0EA 4QPAA 4FV3A 3SAYA 4DEGA 4DEHA 3L9PA 1YI4A 3CKWA 3NW6A 3PSBA 3PRIA 3QZGA 1H1SA 2WKMA 3R71A 2IVTA 2Y4PA 3QYWA 1E9HA 4XV9A 3SV0A 5B7VA 4DH1A 4WBBB 3SXRA 1RDQE 3M1SA 5ANOA 4NKAA 1XH8A 4ASZA 4EUTA 5I0BA 3U54A 3W0RA 3R8PA 4EHEA 5HZNA 4CFVA 3KU2A 4TYEA 5DA3A 2Y8OA 2QOIA 3VJOA 4CRSA 4Z7HA 1PYEA 3UOLA 4LM5A 2CJMA 4LRMA 4JRVA 5IH5A 5LMKC 5M07A 3OCBA 5F4NA 3BI6A 4AXDA 2OH0E 4O0YA 4RJ4A 1YHWA 2YM8A 5D41A 3D15A 4TYGA 4WKQA 4A7CA 1Z9XA 4DLIA 4RWKA 3UOKA 4E93A 4EJNA 4IDVA 5CU3A 3UVPA 4CG8A 3C5UA 3QGYA 4JLCA 4QP9A 4FIGA 4A9SA 3B8RA 4G6LA 5F9EA 1NVRA 4R6VA 3ZHPC 4PUZA 3MDYA 3HZTA 3R7GA 3RAKA 3RMFA 1DI9A 2VTTA 2OZAB 3QFVA 4I6QA 4E5BA 4RRVA 2VWBA 4RWIA 5DT4A 3C0HA 4EK3A 3QTSA 4RZVA 1OZ1A 1ND4A 2C3JA 3RNIA 4ERWA 1XMMA 4H1JA 2WMRA 3G15A 5M09A 3CBLA 5IA1A 4FTLA 1MQBA 1GZNA 1WAKA 3NYXA 4JX3A 4WSYA 3S2PA 4E3CA 3PZEA 3QQHA 4EOSA 2B54A 4AS0A 2PZIA 4MWIA 2YAKA 3AC3A 3R8VA 4EWQA 4DEBA 3V5LA 3G9NA 5FQDC 4NIFA 4AE6A 2UW7A 4DLJA 4O7TA 4O2PA 4WG5A 3UIUA 3FL4A 2XZSA 2ZDUA 4W8EA 3QZFA 2RFDA 2W1IA 1PJKA 1W0XC 1P4FA 3NW7A 4FTKA 4H1MA 3BQCA 3NUYA 4RLKA 5FLFA 5EI2A 2PE2A 3LM0A 5IQBA 3COMA 4BIEA 3ORNA 3OS3A 2XVDA 3GCQA 3NNUA 5LMKA 1VJYA 2WQMA 2WTJA 3QCXA 3VVHA 1YQJA 3HAMA 2V7AA 1W2DA 5ANKA 1M14A 4J1RA 1YXVA 5AAGA 1U46A 4F9CA 2XF0A 5I9WA 1UU7A 2OFVA 4FVPA 3RGFA 3Q6WA 2ZJWA 2C6DA 3EFLA 2QLQA 4WNPA 4X3FA 3EWHA 4EKKA 3Q9XA 3A7FA 5K9IA 3NDMA 5E7RA 3D7ZA 4ZIMA 4UMPA 2XK7A 3EH9A 4YBJA 2XNNA 5F1ZA 4FKOA 5GHVA 2WTWA 2VGOA 3EQGA 5BVKA 3F5XA 5AR7A 5L2QA 4O84A 3F88A 4DGOA 3NFGB 4IMYA 2C5YA 2XIRA 3A8XA 1WBNA 4RX9A 3TV6A 4O22A 4ANLA 4MH7A 3AKKA 3PJ1A 5IQGA 3AOXA 3IDBA 3PPZA 4PPBA 2CMWA 2XJ1A 2J7TA 4XV3A 3TYKA 5KCVA 4LOPA 1UV5A 2JFMA 4MYGA 1FBNA 4BHNA 3GQLA 2VO3A 5BUIA 3FXZA 1WVWA 3UGCA 2WHBA 3E7OA 4RC4A 2O0UA 4EH7A 5IF1A 2OFUA 2VTHA 4TWCA 2ERZE 5IZFA 5KMIA 3LCKA 5HGIA 1QPCA 4GK2A 5LVNA 4MNFA 1BUHA 4GH2A 4QQTA 4PQNA 4ZSLA 5J8IA 3RINA 4CMOA 2Z2WA 3QTUA 5AM7A 2YISA 3DAKA 4IZAA 1Q5KA 3HMIA 4NFMA 4ZK5A 1RQQA 2QKWB 3SKCA 5HX8A 3R7UA 4GIHA 3F69A 4JT3A 3HMOA 4L3PA 3IONA 4Y95A 2DS1A 4F65A 2IN6A 1GNGA 3ZRLA 3BHHA 2H8HA 5M4IA 3FLQA 4RIXA 4EH5A 4F6WA 3R28A 1OPLA 2XM9A 4M8TA 4X3JA 2FA2A 1QCFA 3E8DA 4F4PA 4Q2AA 2WOTA 4FKUA 5HLPA 3PJCA 3PIXA 3PP0A 4CZYB 2IZTA 5BMSA 4HPTE 4CCBA 2F2CB 2J0IA 4XS2A 5JT2A 3PJ2A 4O0WA 3D5UA 4IB3A 5T3QA 3WYYA 4BTFA 5DMZA 1H8FA 3EFWA 4QYHA 3TUDA 4IWPA 4DG0E 2GMXA 4C59A 4DGMA 4AQCA 3LFSA 4YJVA 4G1WA 3TM0A 2X7FA 4LV7A 2WQEA 3H3CA 2XKFA 4U41A 4FF8A 2ITTA 5FDXA 4C37A 3ZRKA 3EN5A 4O7LA 2YIWA 3RAWA 5JRSA 3TL8A 2XKCA 4F1TA 4UX9A 2W05A 1IAJA 4U45A 4AG8A 3OUKA 5CF4A 3HP2A 4DAWA 4JBPA 4QMSA 4BF2A 3KMUA 4I5CA 5EI8A 2WU7A 1XBAA 3IS5A 5C8NA 4O82A 4FV9A 4NCTC 3LMIA 3PWYA 4S30A 5ACKA 3EKNA 3EQBA 3QXOA 5AIRA 4HW7A 3C9WA 4OTIA 4KWPA 1REKA 5CSWA 3ZXTA 4EQUA 4O7VA 5EQPA 4RIWA 5IQDA 3ORPA 2AUHA 4FV0A 4UZHA 3K5VA 4DH8A 4YSMA 3D14A 1TQPA 3FXXA 5CQUA 2YM6A 5TT7A 4LV5A 1TFFA 4FR4A 2I0YA 2WMTA 4RX7A 1NXKA 2XAOA 4L01A 4WBOA 3IOKA 3R1QA 5AP4A 5CANA 1ZARA 4DFUA 2BROA 3UNZA 2PZRA 2P55A 3DK6A 5L8JA 1Y6AA 3P4KA 4C33A 4IB1A 3ZFMA 2O64A 5M4CA 5AUWA 2RG6A 2W1DA 3KK8A 2HWPA 3AC5A 4X21A 3BU3A 4Y72A 5FD2A 3U8WA 3W16A 4AZFA 4EHZA 4M67A 4ASDA 1ZAOA 4LGDA 3OHTA 4AA4A 1I09A 4C3RA 4UMRA 4UWCA 3BE2A 3ZCLA 4QYEA 1DI8A 4W9WA 4IDTA 4MXOA 3ZFYA 1VZOA 4OBPA 4PDYA 1OI9A 4U7ZA 5E8SA 3C7QA 1OGUA 2QOOA 3B2TA 3VBXA 4BGQA 3OD6X 2P4IA 3UBDA 4IVDA 1OIUA 3Q04A 4FICA 2CGUA 3R01A 5GIPE 4FNYA 5E8UA 2O8YA 2C30A 3UIBA 3UQCA 4MBJA 2VRXA 4MCVA 4OT5A 4H36A 3BV3A 5LVMA 5TF9A 1IAHA 1U54B 1AD5A 2C6IA 4M3QA 2R5TA 3BL9A 5B2MA 2CN5A 3PXKA 3UMXA 3IW8A 3BL7A 3D2KA 4M69B 4WNOA 5HNBA 3QQKA 3AGLA 3KRRA 2JDRA 2YCSA 3O5AA 4YURA 4BWPA 3CPBA 1OL2A 5C26A 4FTMA 4O0TA 1Q8YA 5A46A 1H1RA 4UZDA 3RVGA 5BUEA 5AJQA 2R3IA 3TUCA 4PPCA 4FSZA 3C5IA 3RAIA 4I6BA 4R1VA 2YA9A 3UOHA 5C27A 1PXJA 3HKOA 3OCTA 4UXLA 2J0LA 3RP9A 5IUHA 4QP4A 4PDOA 3FLZA 2ZFYA 2ONLC 1Y91A 3QA8A 4AN3A 3ROYA 3WF5A 1CMKE 2IEWA 3OVVA 1BL6A 5FTOA 5HTBA 3PXZA 4OBOA 4GEOA 5A4QA 3QX2A 4RA4A 5CAPA 2VAGA 1F5QA 3R7IA 4UMTA 4F64A 5M44A 1U59A 4DINA 1O9UA 2QVSE 3PE2A 4RWLA 5EM6A 3RM7A 2UW5A 4JBQA 4PMTA 5JKGA 1JPAA 4C61A 4I20A 3S0OA 2W1CA 4IBMA 5C1QB 4LGGA 4TKSA 5L6OA 4FRFA 3BLHA 3AGMA 4AGUA 2PVFA 3T9TA 4E26A 4JRNA 3Q2MA 4ARKA 3JVRA 1JSTA 3CY3A 4E4MA 2WELA 4BDFA 4FZ6A 4EK5A 1W2FA 5FRIA 3R63A 4HVHA 2XEYA 3BX5A 4CMTA 2QHNA 4IANA 3WIKA 1AGWA 5AADA 2C6LA 2EVAA 4KSQA 4ZY5A 1KOBA 4ZJJA 2E2BA 5IEVA 2YWVA 4PDSA 3KQ7A 2IO6A 2R3HA 3DT1A 4IH8A 4MEDA 2YM4A 3K2LA 4FV4A 2ITYA 2WPAA 4M84A 2HIWA 2O65A 3W8QA 2PYWA 3QZHA 4FUYA 4E4XA 3U6HA 4TYIA 1CKIA 5AR2A 3I5NA 4AOIA 1I44A 4L8MA 4D1SA 2XK9A 4NZWB 2CGWA 2EXEA 2UZVA 3ACKA 3I0OA 4RWJA 3UYTA 4AN2A 4BI1A 3EN6A 3QHWA 3QQGA 4O1PA 5CY3A 3RZFA 5IEYA 1BKXA 5G6VA 4KIKB 2P2IA 2R0IA 3A7HA 4XYFA 4IXPA 3OW4A 3SW4A 2X8IA 3S00A 3RPSA 3DJ5A 4R1YA 1JBPE 1Z5MA 2WTKC 3TJCA 3QRIA 3W2PA 4CFUA 3F5PA 3DBEA 3Q32A 4RFMA 5H8EA 3ZSHA 5IQEA 3D83A 4Y73A 2CHLA 3UC3A 2FYSA 2BAKA 3BGZA 3A99A 4NU1A 2WTVA 4EYMA 4Y8DA 4ZP5A 3DNDA 3R7VA 4ANQA 3LVPA 4DDIA 3COKA 3GGFA 4BCHA 3QKLA 5FP6A 3QD2B 4OTGA 2V7OA 4PV0A 1XBCA 4MNEA 3PYYA 4B0GA 5LVPA 3EN9A 1OIRA 4F9YA 5JQ5A 3RPOA 2CKPA 4JMQA 4M0YA 4AFJA 4IFCA 4QMZA 4BI0A 3F61A 4TRLA 3ZTXA 4DEEA 3TDVA 1PMNA 4R3RA 1K9AA 4O2ZA 4KUJA 3Q6UA 3NZ0A 5AUZA 4EQCA 4P7EA 4W4WA 4E6QA 2PUUA 4MXZA 4CFMA 4QEBA 4JL9A 4QP7A 1XJDA 4EH6A 1YXXA 2JD5A 3FMMA 3IECA 5A3XA 4ACDA 4DT8A 1JSUA 3R83A 4Y5HA 3AG9A 2F7XE 4LI5A 4NL0A 4EH8A 2FVDA 2W5AA 4HVSA 4BTMA 3PG3A 3OBGA 3V8WA 1HOWA 3H30A 3QKMA 3D2IA 2GHMA 4FSYA 4LOQA 3R8MA 2R9SA 2WXVA 2A1AB 1TZDA 4R3PA 4B4LA 4E6DA 3DTWA 3HECA 5C9CA 4QP3A 4Q9ZA 1S9JA 3ZFXA 2PVJA 2H9VA 4IX6A 4W9XA 3O17A 1REJA 3VBYA 3TN8A 2NYAA 4OGRA 2PMOX 2J9MA 1Y57A 2PTKA 4IIRA 1H00A 4CEGA 4FT3A 1PXLA 3JY9A 2WEIA 3EZVA 2C0TA 5CVFA 3R21A 4OUCA 4FGRA 4E6CA 3MH0A 2HOGA 4JG8A 4RC2A 4IWDA 1ZZ2A 4FK6A 1GIHA 4JDHA 3R8LA 3SG9A 3V04A 2VGPA 4J71A 5DI1A 5EKNA 3S3IA 4BCPA 1W8CA 3PY0A 4L00A 2X0GA 3CE3A 3FSKA 3E8CA 3TXOA 4ANBA 5JQ8A 5KMLA 3PJ8A 2CNQA 5JSMA 4JDKA 5AP0A 4U44A 3ORIA 5L2SA 2ZM4A 1MRYA 3IGGA 2Z7SA 2X1NA 2P33A 4MVFA 4GG5A 3FQSA 3QTRA 4I21A 3HX4A 4G9CA 3F5GA 2GFSA 3BRBA 1OBGA 3TACA 4RMZA 4XRLA 5HCXA 3VQUA 5CT7A 2WMUA 2P0CA 3G90X 3I81A 3ZLYA 2WNTA 3FKNA 2IPXA 4NEUA 3WZKA 3DLZA 3K5UA 2ONLA 2XJ0A 5JZNA 2VTPA 1H4LA 3LQ3A 2WQNA 2RGPA 1ZXEA 3CJGA 4FKWA 4YSJA 4XBUA 1SVHA 3O71A 2WO6A 3EFJA 4FT0A 3BBWA 3O8PA 2XM8A 3WE8A 3V5PA 5A4LA 5CLPA 3FZ1A 2GNJA 3G0FA 4C35A 3ATSA 2ITUA 3RBWA 3OEZA 3E5AA 3EN4A 1H07A 5CI7A 3VC4A 4F6UA 3EB0A 1YHVA 1YOJA 3K3IA 1G8JA 3UP2A 4IZ7A 5BNJA 2ERKA 4D1XA 1KV2A 2R3RA 5CNNA 4DYMA 3TNHA 5IQFA 4YHJA 1ZRZA 3G2FA 2R64A 3NNWA 4O0UA 2Z7QA 3S1HA 1DAWA 5LVLA 4MBLA 4NFNA 3LW0A 2XH5A 1G3NA 5DGZA 3R2YA 5CEQA 3KA0A 4BIBA 2Y6MA 4CT1A 5IH4A 4A9UA 3L8PA 4FIIA 4PNKA 1GIIA 2C6MA 4CTCA 4NW5A 4XHKB 4XNEA 3SHEA 4D2RA 3WARA 1Q3DA 2EXMA 2FUMA 4M14A 4EI4A 4U0IA 4YMJA 5GZ8A 3SG8A 3HYHA 3ZO3A 5EM7A 3FPQA 4NCTA 3PSCA 3VJNA 2PUPA 2QR8A 4GU9A 4TWOA 4LGHA 3OMVA 3ULZA 2RL5A 2X0OA 5DRDA 2J4ZA 5IA2A 3PG1A 4ZZNA 2YJSA 3ZDUA 4BDGA 3QUDA 4QMUA 1HCLA 4Y85A 3LE6A 3CP9A 5ETFA 3HA6A 4HYHA 4RIOA 4EC9A 4BKZA 4QMWA 2VX1A 3ZLSA 1Y6BA 2YCQA 3ENMA 3FY2A 2XJ2A 3O23A 2OO8X 4MD7E 4W4VA 5I3OA 3T3UA 5D9HA 2WQOA 2Y0AA 2A27A 1UWJA 4YNOA 4JBOA 5L6WL 4QTDA 4BJJB 5CU4A 2R3KA 3CS9A 4BZDA 3A62A 3KFAA 3OY3A 4YJOA 2OW3A 3H10A 3VONA 5HTCA 5E1SA 4H05A 4AGWA 5EH0A 2W1HA 4GYGA 3D5XA 4EUUA 4ANMA 4I41A 2BZIB 2ITWA 2XK4A 3VRZA 4B7TA 4DHFA 3M2WA 2BTRA 3I5ZA 4PPAA 3RTPA 2YDIA 1XH9A 4FKPA 4MXCA 4XLVA 4OTFA 3QCYA 2PVHA 4ZS0A 1KE9A 2XRUA 2X39A 4FTQA 4JI9A 3E64A 2Q0BA 4QT1A 5CWZA 3V5TA 4RGJA 4TYHB 3D5VA 3V3VA 4A4XA 3OW3A 5GJFA 4KKHA 2I1MA 4PF4A 1KE6A 2X2MA 3QD3A 3F7WA 4LL5A 1YDSE 4WG3A 1SNUA 4KB8A 4DTAA 2C1BA 4OT6A 2XBAA 3BHYA 3JYAA 4QQ5A 1P4OA 2HENA 4IWOA 5DR9A 1GJOA 2OBJA 5EKOA 5EOLA 4KKGA 3SD0A 2R3JA 4BWXA 4C57A 4APCA 3LFQA 3BQRA 1YOLA 2UW6A 3FZTA 4FKJA 4YJRA 5A14A 1ST4A 3MS9A 3FMHA 1W84A 3AT3A 1YDTE 4MQ1A 3I0QA 4QO9A 3MJ1A 3AD4A 3ZYAA 4EL9A 5IQHA 2UVXA 5JN2A 2BIKB 3SXSA 3W0QA 1BI8A 3DA6A 3E62A 4AT5A 2PZPA 3P79A 4KAOA 3C13A 3OCGA 5KKRC 4U79A 3PE1A 4AA5A 2VU3A 3LJ2A 3VO3A 1H1QA 4ALWA 2CKEA 3GXLA 4YJPA 3VF8A 3DBQA 4GJ2A 4WA9A 1TQIA 4N70A 4XEYA 4O91A 3ZC5A 3W2OA 3F3TA 5E9EA 3BIZA 3DU8A 4EZ7A 4QDEA 4EK8A 4USFA 3NW5A 5CAVA 1AQ1A 2XUUA 4BRXA 2ZVAA 2W9FB 4APPA 3A7IA 4FTNA 4GJ3A 4QNAA 5L2WA 3RK5A 5CU0A 2VTSA 3PWDA 2BHEA 1IRKA 2QKRA 3MY0A 3TV7A 2B9HA 3FMEA 3VW8A 4F99A 5BPYA 4H58A 4B9DA 3CKXA 4KSPA 2XA4A 4XH6A 3TDWA 4GW8A 5M08A 3NMUF 5BQ0A 4L44A 5HVYA 4CG9A 4ZTQA 3JPVA 4BDHA 3Q5ZA 1H08A 1H25A 2YM5A 1J91A 2PY3A 4R3CA 4RIYA 5HESA 1CKPA 2JDVA 1A06A 4G34A 4V0GA 5EDQA 1W98A 4PP7A 4ZTMA 2DQ7X 4QMLA 2H6DA 3UDBA 3EJ1A 4U3YA 4C58A 4G5PA 4UV0A 4BCIA 3HDNA 1YI3A 2OJFE 4UMQA 1LEWA 2BIYA 4XP3A 3ZEWA 2RF9A 1XKKA 4RFYA 1YXTA 1OL5A 2W4OA 1W7HA 4ENXA 2BMCA 3E93A 2CCHA 3HL7A 1H0WA 3VWAA 3UPZA 2WB8A 3G5DA 2GQSA 4TPTA 5JFVA 5CVHA 3FSFA 3BWFA 4BDAA 2VTMA 5E8VA 3A4PA 2FSMX 5L2IA 3WF7A 3DBCA 2PSQA 3GP0A 2QHMA 3QTQA 4WG4A 3SDJA 3KVXA 3CQWA 4EEVA 4IHPA 3FMJA 4N6YA 2LAVA 4X3FB 4IVBA 5DPVA 5C03A 3FUPA 4K77A 4X2KA 5B2KA 1VR2A 4BDDA 4GFMA 4ZTSA 3QC4A 3AMAA 3R7EA 4BHZA 2BRNA 3B2WA 3DJ6A 2HK5A 4H3QA 2FO0A 2WQBA 3QTXA 3KK9A 5EYCA 2C5NA 1Q3WA 4OTHA 5DG5A 3PP1A 2Z7RA 3A7JA 3GOKA 2YDKA 4J8MA 4DTBA 1WBOA 3LXKA 4GU6A 4QP1A 2OICA 3FLWA 4FODA 3U4UA 3VS1A 5K5XA 2ACXA 2VWIA 4GYIA 2XAMA 5CEMA 2UV2A 4NJ3A 5DT0A 5AR4A 5CEPA 1PMUA 4FC0A 1GAGA 5M55A 1UA2A 4BDIA 4DTKA 4QYGA 4QMNA 4UWYA 4FEXA 3UQFA 2GNGA 4AZTA