4ZP5A

Map4k4 in complex with inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
296
structure length
284
Chain Sequence
DLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structure of MAP4K4 complex
rcsb
source organism Homo sapiens
total genus 84
structure length 284
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zp5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zp5A01
3VN9A 4FKIA 4EOOA 2GNIA 3V3VA 3W2RA 2VTMA 3G9LX 4RIOA 4JBVA 3F3WA 5GIPE 4DN5A 2G2IA 4TW9A 4ZSLA 4IVDA 2ZV2A 2XKFA 3S0OA 2IG7A 3N9XA 4ZK5A 3UP7A 2Y6OA 3DOGA 2WQMA 3OMVA 4HYUA 2PZ5A 4QP4A 4YBJA 4BYJA 5KMKA 4QYEA 5HLWA 4MXYA 1UNLA 1S9JA 2ONLA 4XMOA 5DIAA 3UDBA 5ANKA 5L6WL 1GIHA 2QLUA 3UZTA 1J7UA 5EHOA 4D9TA 5FEEA 4TTHB 3HGKA 4QMWA 2YISA 4YGAA 4FSYA 3QUEA 3KGAA 4WRGA 4KSQA 5AP3A 3F88A 2ZM1A 2OSCA 4YMJA 1WMKA 3R2YA 5BYLA 5E8YA 1XBCA 2IZSA 2C69A 2XNNA 3FMJA 3KMWA 3POOA 2HW6A 4OAUC 4PX6A 2XM8A 1R0PA 3TJDA 2PVKA 3VRZA 3RM6A 3WYYA 4Y8DA 1J1CA 3V5PA 4TPTA 4DFZE 3L8XA 3QRIA 1YKRA 4FTOA 5ETFA 5I9ZA 4LGDA 5AV0A 4E7WA 5EQPA 3JPVA 3QAME 4HOKA 4II5A 3HRCA 2H96A 2F7XE 4CRLA 5HOAA 4TZRA 1P4OA 4F4PA 2OJGA 1PMEA 4IAKA 4AT4A 2GQRA 4YJUA 5G1XA 3TUDA 3PIZA 2ITZA 2WQOA 4FIEA 4C4EA 5IA3A 4USDA 4ZJIA 3HZTA 2VWBA 3EWHA 4MEDA 4XX9A 2XUUA 3IS5A 3LIJA 3QZHA 5J9LA 1CSNA 1DI8A 1WBNA 3CD8A 4FT3A 4HW7A 3T9TA 3R7OA 4FZ6A 3BGQA 4XV1A 4FYNA 2PYWA 5LVOA 2WMAA 2ERZE 2XJ0A 5F95A 5ANDA 4I1ZA 1OPJA 2QR8A 5AP7A 4TNDA 4RWJA 2C6DA 4AOTA 4MF1A 4E5BA 4K0YA 3C0IA 3F7WA 3OY3A 4NJ3A 3G15A 2QOBA 3FKOA 2GTNA 4PF4A 4JJRA 3VUKA 3NNUA 4ENXA 3P9JA 4U79A 5FXRA 1Y91A 3FE3A 3FI4A 4QP9A 5E8UA 3Q9YA 2WEVA 2B0QA 3Q2JA 4TYGA 4BIEA 4NL0A 2C3IB 5M4UA 2RG6A 4G6OA 1WBOA 4EOQA 3TL8A 3V8TA 3FWQA 3ORXA 3QTIA 4Y83A 5AX3A 3NW7A 2PVNA 1FGIA 5BYZA 5IUIA 2H6DA 4AA4A 4BRXA 5CQUA 3V8SA 2WZJA 4AGCA 3ZM9A 4HGTA 1FVVA 3RI1A 4JLCA 5HG8A 3S4QA 4ZSAA 4RC2A 2VAGA 1PW2A 3FQSA 3QALE 1QMZA 2RFSA 3E7OA 3R1SA 2WTKC 3ORKA 4MXCA 3CD3A 1U5RA 1OB3A 4DGNA 1Z5MA 3TNQB 5GINE 2BFYA 3FKNA 1KWPA 3PDTA 2JDVA 3W2CA 5DHJA 3MI9A 4Z7HA 4PY1A 4XV3A 2WO6A 3R1YA 2HZ0A 5T3QA 4B8MA 4C38A 4R1VA 1ZYDA 1LR4A 3R6XA 4ITHA 5BUIA 5AP5A 2WTWA 1KE5A 5CU0A 3MDYA 4Z55A 5FP5A 4IANA 4BDKA 4NYEA 4A9SA 5BNJA 4WBOA 5C03A 1OIUA 5KZ0A 2XA4A 3ETAA 1JVPP 3P4KA 4J53A 3BQRA 3FLSA 4XLVA 3MJ1A 5AV4A 1L3RE 3C50A 3D7TA 2PZRA 3GFWA 3RWQA 4GK4A 4P5ZA 2OFVA 3F7ZA 2OWBA 4YJRA 2BUJA 4DEDA 1XKKA 2QONA 4DGOA 2XK4A 4AN2A 4EBWA 5IMXA 2JFLA 4IM3A 3LXNA 3SD0A 3LOKA 4EZ5A 2YABA 3OS3A 3PVWA 4PTEA 4V04A 5E8SA 4F9WA 4I24A 5HBEA 3PRFA 2E9OA 3K2LA 1V0OA 3LFFA 4F9AA 3F5GA 3I0OA 4G16A 4EOLA 4CKRA 2OJFE 5C1QB 1FQ1B 3BYSA 4M67A 2ITWA 4LOOA 1XH9A 5I3OA 2OH0E 1ZZLA 4BTJA 4J98A 3QTUA 4DAWA 4DBNA 3KXMA 3F69A 5A14A 3M42A 4QTAA 3F2AA 5CSXA 3UO5A 4IM0A 3KEXA 4IWPA 3RZBA 3ZRLA 2V62A 1G8SA 1OIQA 2WEIA 3PLSA 4IM2A 4E5AX 5AP0A 4G3GA 3PY1A 2BZJA 1DAWA 4F1OA 5DR6A 4D58A 5HI2A 3A2CA 3ET7A 4IAAA 3UODA 1ZMWA 2VD5A 5HQ0A 3JXWA 2PUUA 5IA1A 3IO7A 3DKOA 4RSSA 4Z16A 4ALWA 4YBKA 2B4SB 3GBZA 3CSVA 1TQPA 1Q3WA 3MH2A 1UV5A 3Q6UA 2QO2A 3R9NA 4C62A 1Q24A 1V1KA 3CTJA 3MWUA 2XK8A 2R3GA 5M4IA 4O84A 3FLZA 3P7AA 3R71A 2HZIA 4MAOA 4NM7A 3MBLA 4BDFA 4DEBA 5F9EA 4M69B 4AQCA 1YXXA 3R1NA 2W0JA 3TJCA 3S00A 3GCPA 3ZZWA 4DGLC 2PMLX 4GIIA 1R1WA 4IAIA 5EOBA 3VNTA 4O0XA 3OW3A 3OWKA 4C61A 3R8LA 4DFUA 3D0EA 4DLJA 5EYDA 3UMXA 4I5CA 4H3PA 4IX3A 4MCVA 4FOCA 3PXYA 3NEWA 1Q8ZA 4KIKB 1DI9A 3HDMA 3ODZX 3ZHPC 4A4OA 4TN6A 4BTMA 1YQJA 3C4CA 4I5HA 1AQ1A 2BAJA 3SW4A 3T3VA 4CLJA 3VS2A 4AFEA 3ZH8A 3E64A 3VHEA 3F5UA 4FNWA 4WOVA 4OBPA 4C3PA 2C4GA 3V04A 3JR1A 3QQFA 1K9AA 3AC5A 4GT4A 4E73A 5CU4A 4KIPA 3S95A 2H8HA 3PUPA 4NUSA 2VRXA 3CPCA 4LGHA 5AR3A 4EQCA 4V01A 4I4EA 1GJOA 5KNJA 3HECA 3EZRA 4FZ7A 4DG3E 2C30A 1XH4A 2J50A 4J52A 4LUDA 3BU6A 3R21A 3POZA 4BDAA 3UNKA 3LQ3A 3AGLA 4GKHA 4DT8A 4AZEA 5D12A 1OUKA 3VUDA 3D2IA 3BCEA 3FPQA 4FGBA 3U8WA 3SLSA 4G17A 1PHKA 2BAKA 3OD6X 3QQHA 3ACJA 4KWPA 3DXNA 2R3FA 3A61A 3AC1A 5ITAA 2W5AA 5CX9A 3VO3A 4BTFA 4GFOA 3BEGA 3MTLA 4C4FA 2O2UA 2OXDA 4B0GA 4CXAA 1OGUA 2WD1A 3DKCA 3GUBA 4FEUA 1PMVA 4ANBA 4O2ZA 5C27A 5C9CA 2JKOA 4B4LA 4GIHA 4F0IA 2O5KA 3D5WA 4MVFA 3E87A 5J87A 2NO3A 3C4EA 4ASXA 2W1HA 2Y0AA 2XRWA 4KIOA 1JAMA 4M0ZA 3VBXA 4ACMA 4RVLA 4AGWA 4AX8A 1Q8UA 4FVQA 3MS9A 2LGCA 1BL7A 4CEGA 5CSPA 2OF4A 3BLHA 3UVQA 3C7QA 3U54A 2XBAA 3KY2A 4ZSEA 4L8MA 3QCSA 3BV3A 3FV8A 2QD9A 2PL0A 4R5SA 3F5XA 2BDWA 2FSLX 5J9YA 5IH4A 2R2PA 3UNZA 2OJJA 4QMQA 5AV3A 2P33A 4L52A 4X6QC 4FSRA 2YCRA 5AEPA 4PNKA 3BKBA 3JVSA 5AUWA 2BZIB 4HCVA 3NIEA 4GU9A 1WBVA 4ARKA 4GJ3A 1ZOHA 3Q4ZA 1Y8GA 5HKMA 4ZZOA 3KN5A 3QTXA 4HYHA 3S1HA 3HMNA 3WZJA 1OL5A 5HNGA 4V0GA 4RA4A 4X2FA 3COKA 4AZWA 1ATPE 4FTLA 4IC7A 1WVXA 2ZDUA 2W5BA 2UV2A 3RPYA 1E1XA 2Z2WA 3C0GA 3KMMA 5AUUA 5JH6A 3L1SA 1JOWB 1PXOA 3DT1A 3F61A 4NM0A 4EC8A 5A4LA 3LJ1A 5DVRA 4YTIA 5IKWA 2CJMA 2VTRA 5HHWA 4FKWA 5HTIA 3R30A 4JDHA 3GCUA 3KRXA 2QNJA 2X2LA 3HV4A 1YI4A 2CLQA 1YXSA 2I0VA 4EOPA 5KMJA 5E9EA 4QD6A 3BELA 4I22A 3UIBA 2UZWE 4FKOA 2UW5A 3VUIA 4YO6A 1ZOEA 1H1RA 2YLFA 4CNHA 2RFDA 3NUNA 2I0YA 4JDKA 1U54A 2F57A 3TI1A 4AE9A 4E5WA 2VO0A 4DF3A 4LMNA 3BI6A 3HV5A 4WT6A 3ZTXA 2XIKA 5F94A 3L9LA 5EKNA 5LVNA 5GHVA 5HLPA 4I3ZA 2OGVA 3HMIA 3SXFA 3O71A 5CWZA 2XNMA 4C58A 3D4QA 4ERKA 2GHGA 3EYHA 2W1GA 3THBA 2R7IA 2VTQA 5K3YA 4JAJA 4E3CA 3FLQA 4LRMA 3LMIA 1IR3A 3LJ2A 3PJCA 4KA3A 2W17A 2ITUA 1JKTA 1M14A 1APME 2BIYA 3FMLA 3GFEA 3HP5A 4FUXA 3UP2A 1G8AA 3UG1A 3OWLA 5AUYA 3DBCA 3AXWA 5DEWA 1JSUA 4JX3A 5HG7A 2PZYA 3O7LD 3OFMA 4MH7A 4PMPA 3K3IA 4IACA 3E3PA 4YZDA 3FZRA 5H2UA 1SVEA 2Y9QA 2Q0BA 5DT0A 3D5VA 3QWKA 4Z7GA 1LUFA 5CT7A 3PXQA 3R63A 4W4WA 2HZNA 1OKYA 3U55A 3IGOA 4X7QA 5M4CA 4O21A 5DG5A 5I9XA 4BIBA 1PXNA 2RGPA 3OROA 5GZ9A 2HWOA 4CZYB 2YN8A 3GC0A 3QCQA 4WG4A 3TIYA 1TQIA 3GQLA 4RFYA 3SV0A 3PP1A 5M07A 4IWQA 1O9UA 3BYVA 1Q41A 3HAVA 3T8OA 3ZONA 5KMNA 4D2WA 2NRYA 4IEBA 3M1SA 3DLSA 4E4NA 3L9MA 1CKJA 2JDOA 1UU7A 3DB6A 3NSZA 5K9IA 4RJ3A 4ERWA 2O8YA 2EVAA 3R01A 3G51A 4CMTA 4MTAA 4AT5A 3PJ8A 5DT4A 5KBQA 5KE0A 4ZTMA 2QC6A 4R78A 2UZEA 3R28A 4O1PA 1S9IA 4YJSA 5EQYA 1SNXA 4GG7A 4DCAA 3MYGA 4J96A 2EUFB 3M2WA 4MBIA 2CN5A 4FV3A 3BPRA 4ZLYA 3PP0A 5JFWA 5F20A 1W0XC 4JG7A 3RHXA 3O7LB 3IQ7A 2V0DA 2JC6A 3GC9A 3FKLA 2FSTX 4IC8A 4IAZA 4JOAA 4L00A 4S30A 4UMUA 4Z9LA 2GNFA 2PMNX 3F3UA 4F6SA 5IUGA 3OT3A 3VS3A 1K2PA 3ORMA 3OZ6A 4AF3A 1PXLA 2PZIA 3CTQA 4IZYA 1HCLA 2Z7SA 5IUHA 5HIBA 2VO6A 3E8DA 4JT3A 4O7LA 3L9NA 1H1PA 5LARA 4NCTA 4B9DA 4QMZA 3HX4A 3CGFA 2FO0A 5J5SA 2YIWA 2VTNA 4KKEA 2VN9A 1IRKA 3DJ7A 4C57A 3AC8A 4FK3A 2VWXA 1PXKA 2YCFA 3R22A 5IEVA 3PVGA 2HK5A 4C2VA 4DFNA 3ZEWA 1AGWA 2C47A 3WZKA 3QD3A 3OTUA 2YM5A 2IPXA 5CXHA 4CTBA 5IQEA 3NRMA 2XKCA 1ZRZA 5JQ5A 3KCKA 4CFXA 3UMWA 4TWPA 3IDPA 3ZDIA 2X7OA 4HNIA 1WBSA 4QRCA 1ZYLA 4YTCA 4E20A 3O51A 4AFJA 1I09A 3BHHA 2QQ7A 2X1NA 3BHYA 4N4SA 4TYHB 5LJJA 1PYXA 3NNXA 4I94A 1R0EA 2V5QA 4ANSA 1O6LA 4K1BA 3D94A 3OXTA 2XIZA 3Q4UA 2W1ZA 2C6TA 3ZCLA 4BWXA 2XK9A 4I5PA 2HCKA 4EC9A 1UNHA 3Q3BA 4DEEA 2WIPA 1JSVA 4F08A 2JDRA 1W8CA 4FNZA 4LM5A 3BV2A 4ZJVA 4OTDA 2VTAA 2ZOQA 5GJDA 2HY81 4FKPA 3LZBA 4NTTA 4EH2A 3NYVA 3HMMA 4H1MA 4C35A 4FKTA 5M57A 4O91A 1BLXA 5IH5A 3MSSA 1BX6A 3FZSA 1Q4LA 4O7TA 3EMGA 3EQGA 4J97A 3CGOA 2PU8A 3FY2A 3F9NA 3V5LA 2XNOA 1E1VA 3QCYA 4BCOA 3HL7A 4FV4A 1Y57A 4FC0A 2WU7A 5FXSA 4UWCA 2B7AA 4ORKA 4MX9A 2B9IA 4BYIA 3COIA 4QYYA 4GL9A 2UW8A 4AZVA 4LQMA 3O96A 4U3YA 4OTWA 5IEXA 5CI6A 4BIDA 3U6HA 4FEXA 3PSCA 4PDPA 3IG7A 4RG0A 4OTGA 4RJ5A 3ZRMA 3FLWA 4CVAA 3JVRA 4QP8A 3QQKA 4X2JA 3MVMA 3SDJA 4F63A 1XQZA 4LFIA 3DXPA 3PWDA 1OM1A 4CYJA 4A4XA 2PSQA 2QHMA 1DS5A 2C6IA 5FQDC 4KSPA 3HDNA 4BI0A 1YXVA 3L8VA 4I93A 2F7ZE 4APPA 4DG2E 4TL0A 1Q5KA 2E2BA 3R00A 2ZB1A 4PL4A 1Y6BA 5TOZA 3OOMA 3QD2B 4BDDA 4O2PA 2EB2A 5ANEA 4D4SA 3QF9A 5BVOA 5DI1A 3K5UA 3PSDA 4HZSA 3LLTA 2VX0A 2HELA 3VUGA 4S34A 4RWLA 4UB7A 4XP3A 4HPTE 3QLGA 4TNBA 3LMHA 5M56A 2FH9A 1H25A 2PZPA 3O8TA 3R9HA 3CBLA 3T3UA 1GY3A 3EJ1A 5C26A 2RIOA 2F2UA 4DGMA 4G2FA 1GZOA 4PP9A 3RAIA 1OL7A 3NYNA 4FT0A 4L01A 5TT7A 4UZHA 2A0CX 3U51A 3KU2A 2GFSA 4JX7A 4GUEA 1NXKA 5J9ZA 4R77A 2BCJA 2IZRA 5HO7A 3QHRA 2ZAZA 2X7GA 1FBNA 4RVMA 4CT1A 5LMKA 5A6OA 4EH8A 2YDJA 2UVZA 2BTSA 2BTRA 2W4KA 4IFCA 4RGJA 3TDVA 3LFAA 4ZTRA 2AC5A 3WI6A 1UU3A 5IPJA 4BHNA 1GAGA 3Q2MA 4KD1A 3PVBA 4NW6A 3DK6A 4ZS0A 2UW6A 2YAKA 3ALNA 5CVGA 2WOUA 5LWMA 2XB7A 4QPAA 1KE8A 4TYIA 5JRQA 4H39A 4ZSGA 2OI4X 2X39A 2XCKA 4MD9E 5IQGA 2ACXA 4WUAA 2R3RA 4FIJA 4FTIA 4IZ5A 4ZY4A 5FWKK 3OXZA 2QO9A 3EN4A 4HCUA 2E9NA 2J7TA 3FI3A 3LM5A 4XG4A 3R7EA 2PE1A 5CTPA 3CP9A 1VR2A 4KRCA 1M7QA 2DYLA 3C4XA 4I6BA 5FGKA 1RJBA 3WBLA 4CQEA 4X21A 2DUVA 3DU8A 5AUVA 3RZFA 3UQCA 3V51A 3GGFA 5AX9A 4I5MA 4KS8A 1RW8A 3EYGA 4DEIA 1CDKA 3EKKA 4GT5A 1YDRE 1WVYA 2DS1A 3V5WA 3D9VA 4QMSA 5CY3A 2R5TA 2W1DA 3EOCA 4PDSA 5ICPA 3FSFA 4O96A 4FV0A 4Y72A 4WNPA 5KO1A 4BR3A 4RFZA 4CFWA 3FZ1A 3EN5A 2WOTA 2VO7A 4L53A 3AOXA 3RM7A 3TTJA 5CEKA 5C4LA 2BFXA 2BRNA 5LWNA 5FBOA 4TKSA 2UVYA 3G90X 4ASZA 2XNEA 4XP2A 2OZOA 3VW8A 2C5XA 1GIJA 4BCMA 4JAIA 3G2FA 4FEWA 4ZMEA 2R3OA 5IG1A 5D7VA 2ZMDA 3W2PA 4DYMA 5JGBA 4EL9A 5F4NA 3W2QA 4ANQA 4FSZA 2B9JA 2A27A 5EI2A 5L2WA 5CZHA 1JBPE 3TZ9A 3ANRA 1MQ4A 2YIQA 4FTQA 4DGGA 1XJDA 3B8RA 4X2KA 3ODYX 1SVGA 4UY9A 2OG8A 4U42A 1R78A 1G3NA 3CJFA 4IJ9A 5HU3A 2O63A 5CEPA 4KUJA 3E88A 3UIUA 4F7LA 2XZSA 5TKDA 1ZARA 2JBOA 4RWKA 5CF6A 1QPJA 4O81A 3AT3A 4XJ0A 4MD7E 4NJDA 3MFSA 2RSVA 3QHWA 3DAKA 2OJ9A 3COHA 3FDNA 3PE1A 4YP8A 4IDVA 3QTZA 1U59A 3LMGA 3BIZA 4YHTA 1OL6A 4GK2A 4Y46A 5JFXA 3A99A 4R5YA 2O65A 4CMUA 4WG5A 3FHRA 2VTSA 4P5QA 3KXZA 3OUKA 4MXZA 4IBMA 2X4FA 2W4JA 3ZLWA 5LXMA 2XIYA 2PWLA 4CD0A 4BDJA 2C1BA 4FTRA 3U6JA 4M3QA 3RWPA 2HAKA 4K18A 1FMOE 5IISA 4L67A 1YWVA 3ZO4A 1XWSA 1ZYJA 2IW9A 4CGAA 3MY5A 4UWBA 4KS7A 2BRGA 5AP6A 4BB4A 2J0MB 2GHLA 4QYGA 3R8ZA 2FSOX 5FTOA 4MYGA 5HLNA 4XUFA 4G1WA 3BU3A 5EW8A 5A4TA 1OITA 1T45A 2W06A 2X6EA 1UA2A 3R7IA 2EWAA 4H58A 3UO6A 3FY0A 3C4FA 3QQGA 2GDOA 4QT1A 3OTVA 4CZUA 5HCXA 4JDJA 4DH5A 5C8MA 4KINA 5JZNA 4HGSA 2C6OA 2R7BA 4FV1A 3VUMA 2YZLA 2CPKE 3G33A 2QKWB 2WMBA 3ZUUA 1PKGA 1UU9A 2VTPA 5EK7A 3ZLYA 1LPUA 2Y6MA 3PPJA 2OICA 3CLYA 3QX4A 4PMTA 4PTCA 4Q2AA 3CQWA 4YC8A 1MRUA 5CEOA 4FKRA 4MXOA 4QP6A 3OF0A 3HA8A 4FTMA 2C0OA 3EQBA 4MXXA 2XKDA 2C3LA 3FLNC 5L3AA 3CS9A 3FQEA 3P23A 4BC6A 4ZZNA 4CG8A 3GU8A 3FC1X 4BCJA 4EHVA 2J0JA 2H34A 3MV5A 5CS6A 3SOAA 4QMMA 4F0GA 3I1AA 3V5JA 3ORLA 3TUBA 4NZWB 2WELA 2PPQA 3VS4A 2J9MA 5CU2A 4D28A 4O7SA 3TUCA 3NPCA 4FV6A 4JIAA 4E4LA 4WNOA 2JD5A 4ZY6A 1IASA 2VWZA 1PRYA 4FBXA 5IQFA 4AZFA 4ZMFA 5DMZA 4DE4A 5DE2A 2QOHA 3VS7A 2R0IA 5L2TA 5EG3A 2B9HA 2C3KA 3QRUA 3MPMA 5FM3A 4FL2A 5AA9A 5CSHA 4ANLA 3SRVA 3IW8A 4RPVA 1XH5A 3R7VA 3CXWA 4D2TA 4ID7A 5EQEA 2YA9A 4U45A 5FM2A 1SZMA 1PKDA 2VV9A 4EH3A 5K5XA 4O0RA 4JS8A 1YOMA 3O23A 4AAAA 3OOGA 3KRLA 3P0MA 3VBTA 2E9VA 5JQ8A 4D4VA 3RPRA 4BGQA 3SW7A 4EOJA 3FEGA 5FP6A 4FL1A 2IJMA 1QL6A 5ANOA 4EHGA 2JKKA 1KOAA 3EL7A 5HIDA 4Q9SA 5JN2A 4JBPA 3TACA 4KBCA 4YJOA 4AN3A 2XNGA 1URWA 2P3GX 4I0TA 4JNWA 3GEQA 4AN9A 2CKPA 2JAMA 2XKEA 5AP1A 4RC4A 3GB2A 2YCSA 5LVLA 3VQUA 3B2WA 3UTOA 5CU3A 2WGJA 4YC6A 4DH3A 4DFBA 5IQIA 4F0FA 1STCE 3MY1A 4EZ7A 3KXXA 3VWAA 4ZSJA 4EH4A 5DH3A 4O0WA 3AMBA 2OKRA 1H1WA 4MBJA 2C6KA 4YURA 4EI4A 3LLAA 5FTGA 2JDSA 4XG8A 4O0YA 3ZFYA 3TM0A 2X8IA 2RFEA 3LCDA 4PPCA 3A7JA 4WSYA 2Y7JA 3LE6A 3KN6A 2OZAA 4FVPA 4Q5HA 4FOBA 4PP7A 5L6PA 4YO4A 4D2SA 3ZOSA 4AZSA 4XEYA 3D2KA 4F1MA 1Q3DA 3NYOA 4QMUA 5DR2A 4HYSA 3RMFA 5IDNA 1R39A 1RQQA 1OMWA 3H9OA 4EK6A 1YXUA 5E8XA 4S32A 3PWYA 3BHUA 4AT3A 4U7ZA 4U9AA 5DOSA 3NCZA 3ZC6A 3E93A 3F3VA 3SG9A 2A19B 2C5YA 4IVBA 4J8MA 2WTVA 5FEDA 2PVYA 5AIKA 1HCKA 4M15A 4BBEA 2J6MA 2WXVA 2QO7A 3NWWA 3QKMA 5JEBA 3OEFX 5CLPA 5LMBA 3F3ZA 2XK7A 5EH0A 4RQKA 4BKYA 3I79A 5LVMA 4MHAA 3DV3A 4BI1A 5HTCA 4IHPA 5HORA 1JNKA 1TQMA 3U4WA 4CKIA 3MVLA 4O7YA 2FSMX 5DPVA 3RTPA 4EYJA 5AWMA 3VBVA 2ITPA 5ANJA 4QTEA 2HOGA 4ZIMA 3BGPA 3Q5IA 3RNYA 3SKCA 4RX5A 5ACBC 5JK3A 4X3FC 4FKQA 4G5PA 3A4PA 2UZVA 3SXSA 2X9EA 4F65A 4AP7A 3QQUA 3REPA 3ZXTA 2VGPA 2JIIA 3BWJA 4RA5A 4GVJA 1OIYA 2XJ2A 4C2WA 4QMXA 1JKLA 4PMMA 3H0ZA 3HP2A 3IW6A 2YITA 4ZTSA 5BVFA 3UQGA 5D9HA 3FMKA 4BICA 3AGMA 2CNQA 2BHEA 3R8VA 3H9RA 3FMMA 2ZVAA 3RK9A 5DT3A 3KXNA 4IX5A 4F7SA 3TWJA 5BQ0A 5BUJA 4C36A 4HJOA 5DRBA 2I0HA 5JRSA 3RPOA 5DNRA 3NGAA 1U4DA 3KF4A 4EONA 3ZBFA 2W1EA 4QTCA 4R3PA 3SA0A 3DY7A 2FUMA 4EUUA 2OJIA 4NM5A 3GQIA 5L2IA 4TWNA 1SVHA 2QVSE 3OHTA 4FEVA 3TKUA 4U97A 2JKMA 4XP0A 1NA7A 2PUIA 4OGRA 3W8LA 4IB1A 3ERKA 3DFAA 3DTCA 4ANNA 2QODA 5AR5A 4CFFA 2PULA 3D5XA 5CI7A 1H24A 1P14A 4XBUA 4J1RA 5FDXA 2R3PA 2XIXA 1NVRA 3WARA 4DTKA 5BMMA 3QTQA 3UYTA 4O1OA 2H9VA 3KREA 2YIRA 5D7AA 4LMUA 4M68A 3RAKA 4I6FA 5BVKA 3CKWA 3FMDA 3KF7A 4ZEGA 3CR0A 3CCNA 2Y4IC 4RT7A 5KZIA 3RALA 5EDRA 4GUBA 3ZEPA 3UGCA 5E4HA 4YZBA 4I6QA 4RVKA 3W33A 2WQEA 4E1ZA 3UOJA 3TV7A 3B2TA 1PMNA 1WBPA 3V5QA 4L3PA 4UMQA 3EQPA 3BYMA 3VVHA 2WTIA 2WB8A 1GIIA 2RKUA 4ONAA 1WVWA 3BWFA 3AC3A 5FUTA 3CQUA 3JS2A 3W2OA 1XR1A 1YW2A 5CSVA 2WQBA 3Q6WA 1I44A 4EK5A 3PSBA 1REJA 2AYPA 3UBDA 2UZLA 3S2PA 4FT7A 4DEAA 2C5NA 4DA5A 3DLZA 2RL5A 3ALOA 1YDTE 4P2KA 3VRYA 5HIEA 3R8UA 3KK9A 3LVPA 4GFGA 4GFMA 4GYGA 2X8DA 4FNYA 2WTKB 5HVYA 5EM5A 5CAPA 3HYHA 3EIDA 3MH0A 4GRBA 4TWOA 4W4XA 5DLSA 5L2QA 4G3FA 5FEQA 3PJ1A 4YHJA 5DGZA 2IWIA 5L8LA 2F4JA 2R3MA 4O6LA 3JY0A 2WNTA 4NCTC 4LYNA 1KSWA 2QU6A 3L8PA 3F5PA 5EOLA 2GMXA 4UMTA 2W1FA 4GH2A 4QO9A 3ZYAA 5L2SA 2WMTA 5DWRA 4FA2A 1YOJA 3O8PA 2R9SA 3O50A 3D5UA 3DS6A 2Z60A 4XG7A 5H3QA 1NT2A 2I7QA 2VWUA 1BMKA 1H0VA 4QTDA 3N4TA 3RNIA 3KRRA 2YZAA 1REKA 3ZDUA 3MVHA 1OECA 4FX3A 4CV9A 2XH5A 5BVDA 2OH4A 2PE0A 3PA5A 5HBHA 1IA9A 2VWYA 3C13A 5D10A 3ID6C 2JDTA 3MGYA 4RIWA 4S33A 3TKIA 5AUZA 1JPAA 3QTRA 4UV0A 1UVRA 5HO6A 1A06A 4JIKA 3FXZA 1CKIA 2P4IA 1YI3A 3IW5A 2QKRA 1JKSA 3E7VA 2NNWB 4U44A 4TT7A 4TYJA 2W96B 3LJ0A 3RK7A 2ZV7A 3SAYA 4C33A 2YM8A 3TG1A 4YJNA 5EKOA 5HE3A 4CTCA 3RAHA 4YTFA 4X3FA 3SQQA 3D83A 3MFUA 4X3JA 5HG5A 5BMSA 2QG5A 2BALA 2ERKA 3EQIA 4AA5A 3UZRA 4V0GB 2Q0NA 3K5VA 3QYZA 3DBQA 3MESA 5BYYA 3CQEA 4GMYA 2ZMCA 2JEDA 3NW6A 4O83A 4PMSA 2V7OA 4BCQA 1J7IA 3OG7A 1DM2A 3HEGA 1CTPE 2P55A 3QWJA 3U6IA 4B99A 3V5TA 2ITXA 4L3JA 1WBWA 4KRDA 4KBKA 4K8AA 2C0IA 5EFQA 5IEYA 4R7BA 5KBRA 4IADA 1HOWA 3PZEA 1IA8A 3OWPA 2CMWA 3BE2A 1H1QA 1SYKA 2VO3A 3ENHA 3DJ6A 4RIXA 2UW9A 2O0UA 3RJCA 1W84A 3BGZA 3OCTA 2UW7A 1U54B 2YCQA 3ROYA 4MNEA 2IVVA 3ORPA 2R3QA 4FSTA 1GZKA 3C1XA 3G6HA 3ACKA 4KB8A 2BILB 5HD7A 4EWHA 4WD5A 4RC3A 4OT5A 3VS5A 4IMYA 4A7CA 2UZUE 3KVWA 4IVAA 1SNUA 3IDBA 3CY2A 4BDHA 1IAJA 3Q04A 2I40A 5I9UA 3EFJA 1YWRA 3FHIA 4IZAA 5G6VA 4LG4A 4YLKA 2Y4PA 3RGFA 1JKKA 4JDIA 3SXRA 5EHLA 3H30A 4BZNA 4O7ZA 1LEZA 4QQCA 5EW9A 3LM0A 4EEVA 5HD4A 5B0XA 4L9IA 1KE9A 4CCBA 4AGDA 2W05A 4YUQA 2VU3A 4R3RA 3R2BA 4PPBA 1UKIA 1P5EA 2RG5A 4O7NA 4RIYA 3C5IA 3W32A 4X0MA 2QI8A 2OO8X 4R6VA 3KXHA 3IKAA 5L6OA 1YI6A 1XH6A 4YHFA 3TTIA 1KE7A 3WZEA 1WCCA 4R3CA 4IWDA 3I6WA 3GU7A 3KULB 4XCUA 5LMKC 2O64A 5IA5A 4UZDA 3VS6A 3DQWA 3E8EA 4CZTA 4EJNA 4F09A 3PPZA 3NIZA 4OTIA 3FXWA 4LGGA 3R8PA 3UOHA 4G9CA 1WAKA 2CKEA 4CCUA 2PVLA 4XG6A 3W8QA 2WMWA 3F2NA 4WNMA 4C59A 2P2HA 5HCZA 4IFGA 2UZDA 4JG8A 5B2LA 2QOCA 5HE0A 4F9YA 2YM3A 1IAHA 3CPBA 2Z7RA 2WTCA 1SMHA 1TKIA 4F6UA 2X2MA 4EYMA 4K33A 5DRDA 5CEMA 3NZ0A 3QBNA 3UG2A 3BLQA 3E8NA 4WBBB 4ACGA 4FODA 3F82A 1U46A 3FAAA 4IDTA 4NWMA 4B8LA 1VYWA 5HG9A 3WE8A 3FBVA 1O6YA 3QQJA 4M66A 5CNOA 3BEAA 4HVSA 4USFA 5J5TA 4RJ8A 4IX6A 3PLAE 4PUZA 4XOZA 3VS0A 2GSFA 3OP5A 4QYFA 4QNAA 3TDWA 2IVTA 3QXOA 4FZAB 2VX1A 4MWIA 4OUCA 4XV9A 3WYXA 3ZLXA 1M52A 5CF4A 3RHKA 3G0EA 3WILA 3LPBA 1KUTA 3F6XA 4G3DA 3QQLA 4OT6A 3CY3A 2DQ7X 3NW5A 4CLIA 2YJSA 3HV7A 2C1AA 3QUDA 4KABA 3UPXA 4BWKA 2CN8A 3R9RA 2FGIA 4DH8A 2WPAA 5B7VA 2YWPA 4E6DA 3HKOA 4PV0A 4NH1A 5EW3A 5K0KA 1KV1A 3ZMMA 1OKZA 4QMNA 2JKQA 5LVPA 4NIFA 4MD8E 3TZ7A 1J7LA 3GI3A 2FVDA 1AD5A 4L45A 3GCQA 5ETCA 4DEHA 3UYSA 2RFNA 4M0YA 4D1SA 2BKZA 3D14A 1FINA 3R73A 2HWPA 2ZYBA 4R1YA 4FIGA 3P79A 1MP8A 4P90A 3VHKA 1A48A 3OW4A 4L7SA 1YRPA 4Y85A 4ZAUA 4YU2A 2YEXA 4FKVA 5HX6A 2YAAA 2G2HA 2UZTA 4ZTHA 2R3HA 2VNWA 2GNHA 3QZIA 5ETAA 5BVNA 4W9WA 5M51A 3BZ3A 3QZFA 3TN8A 5M53A 4ALUA 4G9RA 4C02A 4FTJA 2OXYA 3PXKA 3QA0A 3DK7A 2VTIA 3MN3A 4PRJA 5HNBA 4AOJA 3MPTA 1BI7A 2BRMA 2QLQA 1BKXA 2FB8A 4U43A 3GP0A 4BF2A 3IDCA 3C5UA 4MBLA 1M7NA 3DZOA 3GC7A 5D1JA 4QP3A 4EHZA 5BPYA 3DBEA 3HUBA 3R7YA 4CFUA 4WIHA 3DJ5A 4DT9A 4WHZA 2YDKA 4KBAA 4XG3A 3SC1A 3LFEA 3MY0A 2BAQA 3KKVA 4LRJA 4TRLA 3V8WA 4TYEA 3O8UA 4MQ2A 3RKBA 3W16A 2ZM4A 3DDQA 5L8KA 5M44A 4UX9A 5DBXA 4G34A 4IE9A 5JGAA 4PTGA 4AZTA 4C4GA 3HMPA 4DEGA 5J7HA 4AACA 3QL8A 4F7NA 3WZDA 2BDJA 3I7CA 3HA6A 4YSJA 3T9IA 2CKQA 4ACCA 3E92A 3MB7A 3PVUA 3W18A 3DPKA 5AM7A 4AE6A 4UMRA 3PFQA 3OT8A 5EI8A 2A1AB 4QQ5A 4MWHA 4NFMA 2B1PA 2QOFA 3LHJA 3NMUF 3I7BA 1Q61A 3OWJA 4J99A 3FLYA 3ZSGA 3VF9A 3JUHA 5HTBA 5JSMA 4D0WA 5M4FA 4DTAA 3ZSHA 4FVRA 4M97A 4AOIA 2VWVA 2ITNA 2ZV8A 3R0TA 4EOSA 2X0GA 2A4LA 3EB0A 3Q96A 1UNGA 2QOLA 4U5JA 4QOXA 3R04A 4DFYA 4KNBA 4RX7A 3LCKA 3H0YA 1XBBA 4OBQA 2WAJA 4IW0A 2W1CA 4JRNA 5A6NA 4UBAA 1Q97A 4FZDB 4FG8A 4YPSA 3KRWA 3QKKA 4HVGA 1UWHA 3PTGA 5JFVA 3P78A 3KFAA 4OLIA 4U81A 4FI1A 2I6LA 4XOYA 1WZYA 2PUPA 5HGIA 2XEYA 4KKHA 2GHMA 1OKVA 2JFMA 4PL3A 4BTKA 3G5DA 4AW1A 2C5OA 2GS7A 2OIBA 5TE0A 4X6RA 2OU7A 5LCKA 4GYIA 4KKGA 4ZTNA 2ITQA 2O3PA 2YDIA 3FUPA 5I9VA 4FTAA 3P5KA 4WO5A 1XO2B 3EHAA 2ETKA 4FICA 4FUYA 3RCJA 1GZNA 3JYAA 4U41A 3WF8A 4EORA 5A3XA 4L46A 1YDSE 1ZYSA 4O82A 3DNDA 4E8AA 2EXEA 4HPUE 2G1TA 4BCIA 3ZO2A 4FEQA 5E7RA 5HU9A 1YVJA 1IEPA 3UVRA 5M09A 1B39A 3NVKI 1SM2A 4FIFA 4PQNA 1H4LA 3OCGA 4HNFA 4YPDA 4EOMA 2WIHA 3NCGA 4FV8A 3NUSA 4KIQA 3O0GA 3P7CA 2WMQA 4EK3A 4NKAA 5EM6A 4ASDA 4ZTLA 5B2KA 1M17A 2B53A 4FTUA 5A9UA 4C4JA 5I0BA 2W99B 2F49A 4N0SA 3LCTA 4OBOA 5CNNA 4RJ4A 3WF9A 5HCYA 3ZC5A 4E6CA 4QMPA 5EYCA 3QKLA 3V01A 3VBQA 3U9NA 1CM8A 5DA3A 3AMYA 2B52A 3W55A 3A8XA 3FJQE 3NLBA 3QD4A 3ORZA 4OTHA 1ZMUA 3QRTA 4BBFA 5I9WA 5IA2A 5DN3A 3PG3A 5LCJA 1ZZ2A 3PE2A 3NUXA 3A60A 4H3QA 3TZ8A 3AD5A 4PDOA 3VUTA 4RLKA 3UIXA 3PJ2A 2CHLA 4CV8A 2BVAA 1M2QA 2ITYA 4YZ9A 3TCPA 3ZU7A 1ND4A 4K6ZA 1X8BA 3MB6A 4FF8A 4OW8A 5JFSA 1NVSA 2XF0A 2CKOA 2PVMA 2XCHA 1BI8A 3W1FA 1PF8A 4EOIA 4UALA 5K5NA 2KULA 1XHAA 3Q4CA 4FG7A 4NKSA 5HICA 4ZJJA 1PXPA 2V22A 4P7EA 3WF6A 3HV3A 3NNVA 3Q9WA 2EU9A 4MXAA 4AA0A 5A54A 5KUPA 4IH8A 4YLJA 4QMTA 1MUOA 4L43A 5A4QA 3LFNA 2BR1A 3DBFA 1Q8YA 5C8KA 1PYEA 3R1QA 3H3CA 2GU8A 3HUCA 3LCSA 4FG9A 4TWCA 3OVVA 4ZP5A 4NU1A 1VYZA 3OBGA 2EXMA 4XRLA 4A9UA 4C4HA 4FGRA 3U9CA 4NTSA 4U40A 3VJNA 4DH7A 3P1AA 3F66A 2PVRA 4RBLA 2XM9A 1ZY5A 2JLDA 2WTDA 4AW0A 5BVWA 4FKSA 2XP2A 4IZ7A 4QMYA 4LOQA 5H8GA 2C6EA 4BDCA 4G3EA 4DH1A 5FBNC 4DFLA 2CNUA 3KK8A 5GZAA 5C8NA 2CLXA 3QTSA 4HVDA 5GJFA 1K3AA 4J8NA 1KE6A 4DLIA 3KB7A 3KC3A 1OIRA 3MJ2A 3P86A 4QMVA 4L44A 3TIZA 2ITOA 4U6RA 4GV1A 2XBJA 5IA0A 2WFYA 1M2PA 2QHNA 4U0IA 4FZFB 5E90A 4D2PA 3LAUA 4F9BA 4DINA 1WFCA 4JR7A 4HVHA 5IQBA 5I4NA 2JIUA 3BE9A 2HXLA 4YLLA 4FSNA 4ACDA 1A9UA 2W7XA 3C0HA 4YZMA 4XG9A 4CG9A 3EH9A 2IZTA 3HRBA 2XS0A 3S3IA 2OIQA 3EL8A 1MRVA 1YHVA 3HLLA 5J1WA 2X4ZA 4MNFA 3RCDA 5JMSA 3SGCA 2V55A 4FE2A 3TEIA 4DG0E 4I4FA 5A46A 4V05A 2BRHA 4YJPA 5FTQA 3H4JA 5CAQA 4ENYA 2X2KA 4WA9A 5AADA 5AP4A 3ROCA 4RQVA 3OEZA 5H8EA 2ETRA 4O86A 3FL4A 1L8TA 2UUEA 2PVJA 3LW0A 3MVJA 3QUPA 4UYAA 3ZS5A 4EK8A 3FI2A 2BMCA 2ZDTA 2Z02A 3G0FA 4ACHA 4HCTA 3GCVA 4W9XA 3RP9A 3BYOA 3QGWA 3OC1A 4FKJA 3FMEA 3I5NA 4D1XA 4FNXA 4LL5A 1OL1A 4RJ6A 3B8QA 1P2AA 3MPAA 4D2RA 4JBQA 3DGKA 2XYNA 5AP2A 1RE8A 1LEWA 3CTHA 4GW8A 1OPLA 2GS6A 3AC4A 4OTFA 3BHTA 5EI6A 2X9FA 4M8TA 3ZO1A 2R3NA 2F7EE 2VZ6A 1ZLTA 3DAEA 4G5JA 3I60A 5HO8A 3A7IA 3MTFA 5M55A 1ZAOA 2XK3A 3GU4A 2VWWA 3G6GA 4ZZMA 2V7AA 2R3KA 4LI5A 5J95A 4QPMA 2C3JA 2OIDA 4IX4A 4RX9A 1CMKE 4JRVA 4O6EA 3VIDA 3LFCA 3SRVB 4BI2A 3UNJA 4BCFA 2YIYA 4UYNA 3AMAA 3CKXA 2PMOX 2YIXA 4M14A 3IOKA 1JSTA 5M06A 3PYYA 3Q52A 3P08A 1U5QA 3PPKA 2WMXA 4OR5A 2WKMA 4IXPA 5HESA 2OF2A 4HZRA 4I20A 5JGDA 2AUHA 3WOWA 1OPKA 3DKGA 3DQXA 3QC9A 4JL9A 2IW6A 4EH6A 3KA0A 4W8EA 5AR8A 2XIRA 3UZPA 4M69A 3WF7A 5AA8A 1M2RA 3N4VA 4PDYA 3BLRA 2PUNA 4ZS4A 3D7TB 5HE1A 5HE2A 3PXFA 2VWIA 5IQAA 4J71A 3EQCA 3PIYA 5FRIA 5AV2A 5CALA 3NVMB 3BU5A 4I0SA 2PVFA 4Y5HA 5IQHA 3OCBA 3AG9A 4DBXA 1OI9A 2B9FA 3UQFA 4KIKA 3KVXA 3C4ZA 3QU0A 2C5VA 1H00A 3R7GA 3QC4A 4C0TA 4ZY5A 4C8BA 1Z57A 3DA6A 3DFCB 4PPAA 5TF9A 2ITTA 3PG1A 4MKCA 3WIGA 4BZOA 4O7VA 3R02A 4Q9ZA 1Q8TA 5IH6A 5D11A 2WMRA 3I4BA 2OZAB 1OBDA 2IN6A 5E1EA 4BL1A 3MH3A 5KHWA 3W2SA 4MQ1A 3KCFA 4U80A 4YNOA 3DAJA 1H1SA 2GNGA 4HGLA 2W4OA 5GJGA 4F9CA 3EN6A 3VC4A 3NS9A 3QRKA 4I6HA 2CCIA 4LOPA 1UU8A 4E4XA 5A4CA 1LP4A 1TVOA 4RZWA 4DCEA 3CC6A 1FPUA 1ZOGA 3HAMA 4N6YA 4AW2A 5FDPA 4OAVB 2QOOA 1E9HA 5GZ8A 3RK5A 5IU2A 4O7WA 4D4YA 4DITA 4FKUA 4QP2A 5EHYA 2FA2A 4EKKA 4BGHA 5E91A 3K3JA 5KMMA 1BYGA 3NDMA 2G2FA 4DTBA 4U3ZA 1PJKA 5M08A 4JQ7A 2YM7A 3FSKA 4XS2A 4NK9A 5DFPA 5JT2A 3ZO3A 5KKRC 5AUXA 3BHVA 2YFXA 2IW8A 3UE4A 2GS2A 4IVCA 2PTKA 4IB3A 3NNWA 4YTHA 4BCKA 3FZOA 3PY3A 5CF8A 3LFSA 5IF1A 3CE3A 2LAVA 4D0XA 1H26A 1MQBA 2BZKB 3NAYA 4ANOA 3U87A 4FKGA 3Q32A 5KMIA 5E1SA 1Q8WA 5CQWA 3SX9A 4AWIA 3IK3A 4UMPA 3FYJX 3UOLA 4X2NA 4XHKB 2YJRA 4NSTA 2DWBA 4TXCA 3PXZA 1F5QA 3DDPA 3D7ZA 4FSWA 5CSWA 3O17A 5CAVA 4EH9A 4EH5A 3EQRA 3Q5ZA 3FZPA 3ORIA 3QRJA 4I23A 5E92A 1P4FA 5EM7A 4RZVA 1ZMVA 3UC4A 4EWQA 2PY3A 4H1JA 4W8DA 5H8BA 4RJ7A 4D2VA 4F64A 4FSMA 1URCA 5AJQA 1BL6A 3ENMA 5CEQA 3UIMA 2XVDA 4JBOA 3Q53A 4GJ2A 2IZUA 3AD6A 5FG8A 2OK1A 3FMNA 3I5ZA 4FIHA 2VUWA 4ASEA 5J79A 4XNEA 5IDPA 3CEKA 1OVEA 3A7HA 3E62A 3UVPA 2NRUA 2XNPA 4CT2A 4NT4A 2OXXA 4IQ6A 3TNPC 4RWIA 5IQDA 2BZHB 4UN0C 1QPCA 3A62A 4FIIA 4JQ8A 4WG3A 3SOCA 4BN1A 1KV2A 4D9UA 5AAGA 2C68A 3C4WA 2SRCA 5IMEA 4EK4A 3C51A 4A4LA 2HY0A 4NW5A 2YLEA 4LL0A 4CKJA 4GU6A 5B2MA 2J0IA 2XMYA 3LFDA 5KCVA 2BDFA 4WUNA 1DAYA 2W9FB 4CRSA 3GCSA 4FL3A 1Y6AA 4A07A 5FXQA 5BUEA 3L8SA 2OBJA 4E6QA 4O27B 4C37A 4D4RA 4O0SA 1YOLA 2PVHA 1W7HA 2C0TA 3QX2A 1JQHA 4BDGA 3IGGA 4PWNA 4QPSA 4BKZA 4W4YA 1Z9XA 1ZXEA 2G9XA 4MF0A 5ACKA 4UEUA 4N57A 2YM6A 4FSQA 1T46A 4JR3A 5HX8A 4F7JA 3QA8A 3VQHA 2CGWA 5T68A 3TZMA 2BIKB 3BX5A 3CJGA 3ZFMA 5I9YA 5IZFA 2GFCA 4B6LA 1G5SA 2J5FA 3FZTA 3OBJA 4CSVA 3QXPA 4BVUA 3VBWA 1XBAA 3Q4TA 5K4JA 4E93A 2YHVA 4NM3A 3GOKA 5TR6A 4D1ZA 3WIKA 1FGKA 2JIVA 3WF5A 2CNVA 2YERA 3K54A 3W10A 1B38A 2CGVA 4QNYA 4L7FA 2R4BA 3KQ7A 5ANGA 4AGUA 4BWPA 5AFVA 3E63A 2VX3A 4BZDA 4UWYA 3NAXA 3D15A 3EFWA 3TXOA 3IW4A 4GKIA 5DYJA 4H3BA 4IAYA 4OTRA 2WMVA 2ZJWA 2I0EA 4QYHA 3MFTA 2QG7A 2ZM3A 3VF8A 3LFBA 3QZGA 1XH7A 4IB5A 5BVEA 2R64A 2JBPA 1ERKA 3DCVA 3EZVA 1JWHA 3ZUTA 2OLCA 4TY1A 4QQTA 3ANQA 4FTNA 4AW5A 2RF9A 3Q60A 3NUPA 4YR8A 3I81A 4EQUA 1YXTA 3UOKA 3N51A 2J4ZA 2J0KA 5DR9A 3MA6A 4RRVA 2XYUA 5AAFA 2XRUA 3I0QA 5LMAA 2KTYA 2GNLA 4CYIA 1J1BA 1PXMA 3VBYA 2UZNA 4RIWB 3SVVA 4IAFA 1W83A 1WBTA 2ETMA 3PA3A 5EDQA 4P4CA 1J3HA 2W9ZB 1OUYA 1BUHA 2GQGA 3LQ8A 3QTWA 3COMA 4W4VA 4L68A 1UKHA 2VTTA 2GPHA 3F2RA 2HZ4A 4BHZA 3HNGA 4A06A 4EKLA 4BY9E 4O0TA 3DKFA 1R3CA 2R0UA 5CAOA 2Z7QA 1GOLA 4M13A 4C3FA 2QOIA 5BX0A 4FSUA 1H8FA 3PRIA 3GT8A 4X3FB 4BDBA 3SHEA 3A4OX 4BDIA 4WKQA 3IONA 2W1IA 5C01A 2XK6A 3WE4A 5CASA 2HYYA 4ZOGA 2AC3A 1H27A 4C3RA 4O38A 2QR7A 4HYIA 4FV9A 4LUEA 1FMKA 1YHSA 3AD4A 4I21A 5LOHA 1NW1A 4E4MA 5AMNA 4Y95A 3GVUA 4XRJA 2GTMA 4O7RA 3GOPA 1FOTA 3KULA 5AV1A 3TNWA 3RVGA 1EH4A 3Q9XA 4M84A 2IVUA 2YACA 3NYXA 4CQGA 2BPMA 2E9PA 2UW4A 2ZV9A 3MA3A 1OL2A 3MIYA 1B6CB 4N6ZA 2UW0A 5EYMA 3GNIB 3V6SA 4ZLZA 3ZSIA 4AUAA 5HVKA 2CDZA 3AC2A 3G9NA 2HXQA 3NX8A 4LV5A 4RIXB 5H9BA 4L3LA 3ULZA 5LQFA 1NY3A 4I41A 4QP7A 3LKMA 2J90A 4X2GA 5AM6A 4A9RA 5CZIA 1GNGA 5IQCA 4C34A 5KKRB 2XNBA 4MNEB 4O22A 3PJ3A 5CAUA 3RPVA 1OKWA 2QOQA 2X7FA 3GENA 2ITVA 4ITJA 1UWJA 4Q5EA 5CU6A 2YM4A 3ZXZA 4O0UA 1CKPA 1Q62A 2F2CB 3E3BX 4CMOA 2IO6A 4QMOA 2EB3A 2PE2A 3FL5A 5E8TA 3V6RA 2Z7LA 3II5A 3DBDA 2J0LA 5HVJA 4FMQA 4K2RA 1IG1A 2Y4IB 4YJTA 5EYKA 4D5HA 5CENA 3VUHA 2Y8OA 3HV6A 1YHWA 2FYSA 4Z3VA 4FTTA 4UXQA 4HGEA 3QCXA 4TYHA 4JQEA 3FI8A 5AR2A 1Q99A 2UZOA 4DC2A 5T6KA 4GT3A 3FQHA 4RIYB 4D5KA 3IOPA 3LQ5A 1O6KA 3QGYA 4AG8A 3E5AA 2QCSA 2J51A 1QPDA 3TNIA 3BYUA 5AUTA 3UPZA 2E9UA 3UO4A 2P2IA 2BKKA 5FD2A 3IPHA 3LXLA 4G31A 4F1TA 5F1ZA 2PMIA 2WQNA 2WMSA 3BQCA 2UW3A 4FV5A 4F70A 4RVTA 3KMUA 2UVXA 5CVHA 4CFVA 3ZUVA 4OTPA 4USEA 2J2IB 2R3LA 3R9DA 5GIOE 1FVRA 3MW1A 3LFQA 4E26A 2Q83A 3FXXA 3OUNB 5HNIX 3C9WA 3M11A 2JGZA 4BDEA 4BKJA 3RBWA 4BGGA 2REIA 5HBJA 3PZHA 2GQSA 3ZRKA 3RAWA 2WU6A 3ZM4A 4DFXE 4J7BA 3RPSA 2OFUA 4IWOA 3UC3A 4AXAA 5E8VA 3GC8A 3KL8A 4APCA 3R83A 3BBWA 4M7IA 4S31A 1RDQE 3R7UA 4RFMA 2ESMA 3EFKA 3EQFA 4O0VA 3AT2A 3LXPA 5K0XA 3ATSA 3O2MA 4YZNA 3TNHA 5I5ZA 5JKGA 5EM8A 4GVAA 1KOBA 5I3RA 5JZJA 2WMUA 4XYFA 5EDPA 3DNEA 3R8MA 4AU8A 2VNYA 2WTJA 3EN7A 5TO8A 5KMLA 4FT9A 4IIRA 4C4IA 5CXZA 1J91A 3DZQA 4YNEA 3R9OA 1PY5A 5CT0A 4FV2A 3A7GA 2CSNA 4HVIA 5HZNA 3PIXA 1YWNA 2EXCX 3I6UA 3BBTB 4CFNA 2WHBA 4BCNA 2QU5A 3NUYA 2JAVA 3ULIA 3PXRA 3Q9ZA 2R3IA 2HENA 4NEUA 4XLIA 3A8WA 4B7TA 3EQHA 4EBVA 5IA4A 3ORNA 3AT4A 2QURA 5CANA 3DK3A 1VZOA 4ITIA 3GXLA 4NIFB 2VTJA 4FKLA 4XV2A 2HW7A 1ZY4A 3FYKX 2B55A 4GEOA 2ONLC 4JG6A 4NFNA 2F9GA 2XEZA 3QD0A 1PMUA 4WRSA 4R7IA 4Y5QA 3TT0A 2VGOA 4OTQA 4YZCA 3BRBA 1PXJA 4YC3A 4BCPA 2C6LA 3PY0A 4ZTQA 2NP8A 4GK3A 5AR7A 4ZXTA 4EHEA 3ZZEA 3DB8A 3L9PA 1H28A 4QTBA 5E8ZA 4RMZA 3SG8A 3U4UA 2R3JA 4PL5A 1W82A 5AAEA 5KX8A 2QOKA 3QYWA 3GU6A 2JITA 3KRJA 4N70A 1OBGA 1Y8YA 2I1MA 5L8JA 1FVTA 1VEBA 3GU5A 4YJVA 3TV6A 4QQJA 3DTWA 3NUUA 1W98A 1V0PA 2BRBA 4RX8A 3VJOA 3VAPA 2C6MA 1NVQA 4K11A 4RLLA 1V0BA 5K4IA 3ZLSA 4R8QA 4EJ7A 4IJPA 2VTOA 3VULA 1JLUE 2X8EA 4F6WA 4I0RA 2X81A 4QMLA 1ZWSA 3EN9A 4JVGA 4U8ZA 4K77A 2XJ1A 5J8IA 4AS0A 5J1VA 3F3TA 3HRFA 3PA4A 4R7HA 4ALVA 3EKNA 4EZ3A 3E8CA 5ETIA 3WZUA 4G6LA 4EUTA 4LRKA 2VTHA 4BBMA 3OCSA 5CF5A 2UZBA 5ANIA 4BCGA 2G01A 4GCJA 1QPEA 3NUAA 4KAOA 5AR4A 4MK0A 4WSQA 4E6AA 2W5HA 1F0QA 3ELJA 4WNKA 4FK6A 5A4EA 3LXKA 3ATTA 2BROA 3AQVA 2NPQA 3MFRA 3MIAA 4EH7A 2B54A 2J5EA 4CFMA 2ZB0A 4LV8A 1PXIA 1VJYA 3HVCA 4BFMA 3IW7A 2CGXA 3JY9A 3P7BA 3TKHA 4GG5A 3IECA 1MRYA 4K9YA 2GCDA 4UXLA 5CVFA 4D55A 4EOKA 4H05A 5C4KA 3UJGA 4FR4A 4JXFA 1H08A 3FC2A 3A7FA 4ZLOA 5KMOA 3DXQA 3HMOA 4I92A 1H01A 4S2ZA 5FLFA 1H07A 2IVSA 3ITZA 5DEYA 4XG2A 4YSMA 2OW3A 2A2AA 2PK9A 3EQDA 3H9FA 4C7TA 3N4UA 3QFVA 5AIRA 3VW6A 4ANMA 2Z8CA 1GZ8A 3KXGA 4G6NA 5E8WA 1F3MC 4L6QA 4IB0A 2G15A 3ORTA 1QCFA 3QLFA 4H36A 3OY1A 1OZ1A 2P0CA 1H0WA 3H10A 4FTCA 4J95A 3EFLA 2PHKA 3OXIA 4FTKA 4PNIA 4Y73A 3VS1A 3ZBXA 4QP1A 4EQMA 4A9TA 2YWVA 4L42A 3RINA 1ZYCA 5CYIA 3MH1A 4A9YA 5CEIA 4FV7A 5J7BA 5KHXA 3TV4A 4G3CA 3LCOA 2HIWA 4GSBA 2GNJA 5HEZA 5GNKA 2CCHA 2VTLA 3FPMA 4BCHA 4DHFA 4FT5A 4YJQA 4F99A 5D41A 2BHHA 4GS6A 3CIKA 3ZFXA 2CGUA 4FYOA 2X6DA 4XH6A 3NR9A 3FMHA 1XH8A 4M12A 5L4QA 4XBRA 4JI9A
chains in the Genus database with same CATH superfamily
3VN9A 4FKIA 4EOOA 2GNIA 3V3VA 3W2RA 2VTMA 3G9LX 4RIOA 4JBVA 3F3WA 5GIPE 4DN5A 2G2IA 4TW9A 4ZSLA 4IVDA 2ZV2A 2XKFA 3S0OA 2IG7A 3N9XA 4ZK5A 3UP7A 2Y6OA 3DOGA 2WQMA 3OMVA 4HYUA 2PZ5A 4QP4A 4YBJA 4BYJA 5KMKA 4QYEA 5HLWA 4MXYA 1UNLA 1S9JA 2ONLA 4XMOA 5DIAA 3UDBA 5ANKA 5L6WL 1GIHA 2QLUA 3UZTA 1J7UA 5EHOA 4D9TA 5FEEA 4TTHB 3HGKA 4QMWA 2YISA 4YGAA 4FSYA 3QUEA 3KGAA 4WRGA 4KSQA 5AP3A 3F88A 2ZM1A 2OSCA 4YMJA 1WMKA 3R2YA 5BYLA 5E8YA 1XBCA 2IZSA 2C69A 2XNNA 3FMJA 3KMWA 3POOA 2HW6A 4OAUC 4PX6A 2XM8A 1R0PA 3TJDA 2PVKA 3VRZA 3RM6A 3WYYA 4Y8DA 1J1CA 3V5PA 4TPTA 4DFZE 3L8XA 3QRIA 1YKRA 4FTOA 5ETFA 5I9ZA 4LGDA 5AV0A 4E7WA 5EQPA 3JPVA 3QAME 4HOKA 4II5A 3HRCA 2H96A 2F7XE 4CRLA 5HOAA 4TZRA 1P4OA 4F4PA 2OJGA 1PMEA 4IAKA 4AT4A 2GQRA 4YJUA 5G1XA 3TUDA 3PIZA 2ITZA 2WQOA 4FIEA 4C4EA 5IA3A 4USDA 4ZJIA 4DHZA 3HZTA 2VWBA 3EWHA 4MEDA 4XX9A 2XUUA 3IS5A 3LIJA 3QZHA 5J9LA 1CSNA 1DI8A 1WBNA 3CD8A 4FT3A 4HW7A 3T9TA 3R7OA 4FZ6A 3BGQA 4XV1A 4FYNA 2PYWA 5LVOA 2WMAA 2ERZE 2XJ0A 5F95A 5ANDA 4I1ZA 1OPJA 2QR8A 5AP7A 4TNDA 4RWJA 2XALA 2C6DA 4AOTA 4MF1A 4E5BA 4K0YA 3C0IA 3F7WA 3OY3A 4NJ3A 3G15A 2QOBA 3FKOA 2GTNA 4PF4A 4JJRA 3VUKA 3NNUA 4ENXA 3P9JA 4U79A 5FXRA 1Y91A 3FE3A 3FI4A 4QP9A 5E8UA 3Q9YA 2WEVA 2B0QA 3Q2JA 4TYGA 4BIEA 4NL0A 2C3IB 5M4UA 3BLAA 2RG6A 4G6OA 1WBOA 4EOQA 3TL8A 3V8TA 3FWQA 3ORXA 3QTIA 4Y83A 5AX3A 3NW7A 2PVNA 1FGIA 5BYZA 5IUIA 3ML1A 2H6DA 4AA4A 4BRXA 5CQUA 3V8SA 2WZJA 4AGCA 3ZM9A 4HGTA 1FVVA 3RI1A 4JLCA 5HG8A 3S4QA 4ZSAA 4RC2A 2VAGA 1PW2A 3FQSA 3QALE 1QMZA 2RFSA 3E7OA 3R1SA 2WTKC 3ORKA 4MXCA 3CD3A 1U5RA 1OB3A 4DGNA 1Z5MA 3TNQB 5GINE 2BFYA 3FKNA 1KWPA 3PDTA 2JDVA 3W2CA 5DHJA 3MI9A 4Z7HA 4PY1A 4XV3A 2WO6A 3R1YA 2HZ0A 5T3QA 4B8MA 4C38A 4R1VA 1ZYDA 1LR4A 3R6XA 4ITHA 5BUIA 5AP5A 2WTWA 1KE5A 4O4FA 5CU0A 3MDYA 4Z55A 3PFYA 5FP5A 4IANA 4BDKA 4NYEA 4A9SA 5BNJA 4WBOA 5C03A 1OIUA 5KZ0A 2XA4A 3ETAA 1JVPP 3P4KA 4J53A 3BQRA 3FLSA 4XLVA 3MJ1A 5AV4A 1L3RE 3C50A 3D7TA 2PZRA 3GFWA 3RWQA 4GK4A 4P5ZA 2OFVA 3F7ZA 2OWBA 4YJRA 2BUJA 4DEDA 1XKKA 2QONA 4DGOA 2XK4A 4AN2A 4EBWA 5IMXA 2JFLA 4IM3A 3LXNA 3SD0A 3LOKA 4EZ5A 2YABA 3OS3A 3PVWA 4PTEA 4V04A 5E8SA 4F9WA 4I24A 5HBEA 3PRFA 2E9OA 3K2LA 1V0OA 3LFFA 4F9AA 3F5GA 3I0OA 4G16A 4EOLA 4CKRA 2OJFE 5C1QB 1FQ1B 3BYSA 4M67A 2ITWA 4LOOA 1XH9A 5I3OA 2OH0E 1ZZLA 4BTJA 4J98A 3QTUA 4DAWA 4DBNA 3KXMA 3F69A 5A14A 3M42A 4QTAA 3F2AA 5CSXA 3UO5A 4IM0A 3KEXA 4IWPA 3RZBA 3ZRLA 2V62A 1G8SA 1OIQA 2WEIA 3PLSA 4IM2A 4E5AX 5AP0A 4G3GA 3PY1A 2BZJA 1DAWA 4F1OA 5DR6A 4D58A 5HI2A 3A2CA 3ET7A 4IAAA 3UODA 1ZMWA 2VD5A 5HQ0A 3JXWA 2PUUA 5IA1A 3IO7A 3DKOA 4RSSA 4Z16A 4ALWA 4YBKA 2B4SB 3GBZA 3CSVA 1TQPA 1Q3WA 3MH2A 1UV5A 3Q6UA 2QO2A 3R9NA 4C62A 1Q24A 1V1KA 3CTJA 3MWUA 2XK8A 2R3GA 5M4IA 4O84A 3FLZA 3P7AA 3R71A 2HZIA 4MAOA 4NM7A 3MBLA 4BDFA 4DEBA 5F9EA 4M69B 4AQCA 1YXXA 3R1NA 2W0JA 3TJCA 3S00A 3GCPA 3ZZWA 4DGLC 2PMLX 4GIIA 1R1WA 4IAIA 5EOBA 3VNTA 4O0XA 3OW3A 3OWKA 4C61A 3R8LA 4DFUA 3D0EA 4DLJA 5EYDA 3UMXA 4I5CA 4H3PA 4IX3A 4MCVA 4FOCA 3PXYA 3NEWA 1Q8ZA 4KIKB 1DI9A 3HDMA 3ODZX 3ZHPC 4A4OA 4TN6A 4BTMA 1YQJA 3C4CA 4I5HA 1AQ1A 2BAJA 3SW4A 3T3VA 4CLJA 3VS2A 4AFEA 3ZH8A 3E64A 3VHEA 3F5UA 4FNWA 4WOVA 4OBPA 4C3PA 2C4GA 3V04A 3JR1A 3QQFA 1K9AA 3AC5A 4GT4A 4E73A 5CU4A 4KIPA 3S95A 2H8HA 3PUPA 4NUSA 2VRXA 3CPCA 4LGHA 5AR3A 4EQCA 4V01A 4I4EA 1GJOA 5KNJA 3HECA 3EZRA 4FZ7A 4DG3E 2C30A 1XH4A 2J50A 4J52A 4LUDA 3BU6A 3R21A 3POZA 4BDAA 3UNKA 3LQ3A 3AGLA 4GKHA 4AQKA 4DT8A 4AZEA 5D12A 1OUKA 3VUDA 3D2IA 3BCEA 3FPQA 4FGBA 3U8WA 3SLSA 4G17A 1PHKA 2BAKA 3OD6X 3QQHA 3ACJA 4KWPA 3DXNA 2R3FA 3A61A 3AC1A 5ITAA 2W5AA 5CX9A 3VO3A 4BTFA 4GFOA 3BEGA 3MTLA 4C4FA 2O2UA 2OXDA 4B0GA 4CXAA 1OGUA 2WD1A 3DKCA 3GUBA 4FEUA 1PMVA 4ANBA 4O2ZA 5C27A 5C9CA 2JKOA 4B4LA 4GIHA 4F0IA 2O5KA 3D5WA 4MVFA 3E87A 5J87A 2NO3A 3C4EA 4ASXA 2W1HA 2Y0AA 2XRWA 4KIOA 1JAMA 4M0ZA 3VBXA 4O4BB 4RVLA 4ACMA 4AGWA 4AX8A 1Q8UA 4FVQA 3MS9A 2LGCA 1BL7A 4CEGA 5CSPA 2OF4A 3BLHA 3UVQA 3C7QA 3U54A 2XBAA 3KY2A 4ZSEA 4L8MA 3QCSA 3BV3A 3FV8A 2QD9A 2PL0A 4R5SA 3F5XA 2BDWA 2FSLX 5J9YA 5IH4A 2R2PA 3UNZA 2OJJA 4QMQA 5AV3A 2P33A 4L52A 4X6QC 4FSRA 2YCRA 5AEPA 4PNKA 3BKBA 3JVSA 5AUWA 2BZIB 4HCVA 3NIEA 4GU9A 1WBVA 4ARKA 4GJ3A 1ZOHA 3Q4ZA 1Y8GA 5HKMA 4ZZOA 3KN5A 3QTXA 4HYHA 3S1HA 3HMNA 3WZJA 1OL5A 5HNGA 4V0GA 4RA4A 4X2FA 3COKA 4AZWA 1ATPE 4FTLA 4MUQA 4IC7A 1WVXA 2ZDUA 2W5BA 2UV2A 3RPYA 1E1XA 2Z2WA 3C0GA 3KMMA 5AUUA 5JH6A 3L1SA 1JOWB 1PXOA 3DT1A 3F61A 4NM0A 4O4DA 4EC8A 5A4LA 3LJ1A 5DVRA 4YTIA 5IKWA 2CJMA 2VTRA 5HHWA 4FKWA 5HTIA 3R30A 4JDHA 3GCUA 3KRXA 2QNJA 2X2LA 3HV4A 1YI4A 2CLQA 1YXSA 2I0VA 4EOPA 5KMJA 5E9EA 4QD6A 3BELA 4I22A 3UIBA 2UZWE 4FKOA 2UW5A 3VUIA 4YO6A 1ZOEA 1H1RA 2YLFA 4CNHA 2RFDA 3NUNA 2I0YA 4JDKA 1U54A 2F57A 3TI1A 4AE9A 4E5WA 2VO0A 4DF3A 4LMNA 3BI6A 3HV5A 4WT6A 3ZTXA 2XIKA 5F94A 3L9LA 5EKNA 5LVNA 5GHVA 5HLPA 4I3ZA 2OGVA 3HMIA 3SXFA 3O71A 5CWZA 2XNMA 4C58A 3D4QA 4ERKA 2GHGA 3EYHA 2W1GA 3THBA 2R7IA 2VTQA 5K3YA 4JAJA 4E3CA 3FLQA 4LRMA 3LMIA 1IR3A 3LJ2A 3PJCA 4KA3A 2W17A 2ITUA 1JKTA 1M14A 1APME 2BIYA 3FMLA 3GFEA 3HP5A 4FUXA 3UP2A 1G8AA 2XARA 3UG1A 3OWLA 5AUYA 3DBCA 3AXWA 5DEWA 1JSUA 4JX3A 5HG7A 2PZYA 3O7LD 3OFMA 4MH7A 4PMPA 3K3IA 4IACA 3E3PA 4YZDA 3FZRA 5H2UA 1SVEA 2Y9QA 2Q0BA 5DT0A 3D5VA 3QWKA 4Z7GA 1LUFA 5CT7A 3PXQA 3R63A 4W4WA 2HZNA 1OKYA 3U55A 3IGOA 1XMLA 3AKLA 4X7QA 5M4CA 4O21A 5DG5A 5I9XA 4BIBA 1PXNA 2RGPA 3OROA 5GZ9A 2HWOA 4CZYB 2YN8A 3GC0A 3QCQA 4WG4A 3TIYA 1TQIA 3GQLA 4RFYA 3SV0A 3PP1A 5M07A 4IWQA 3AKKA 1O9UA 3BYVA 1Q41A 3HAVA 3T8OA 3ZONA 5KMNA 4D2WA 2NRYA 4IEBA 3M1SA 3DLSA 4E4NA 3L9MA 1CKJA 2JDOA 1UU7A 3DB6A 3NSZA 5K9IA 4RJ3A 4ERWA 2O8YA 2EVAA 3R01A 3G51A 4CMTA 4MTAA 4AT5A 3PJ8A 5DT4A 5KBQA 5KE0A 4ZTMA 2QC6A 4R78A 2UZEA 3R28A 4O1PA 1S9IA 4FRFA 4YJSA 5EQYA 1SNXA 4GG7A 4DCAA 3MYGA 4J96A 2EUFB 3M2WA 4MBIA 2CN5A 4FV3A 3BPRA 4ZLYA 3PP0A 5JFWA 3PUFC 5F20A 1W0XC 4JG7A 3RHXA 3O7LB 3IQ7A 2V0DA 2JC6A 3GC9A 3FKLA 2FSTX 4IC8A 4IAZA 4JOAA 4L00A 4S30A 4UMUA 4Z9LA 2GNFA 2PMNX 3F3UA 4F6SA 5IUGA 3OT3A 3VS3A 1K2PA 3ORMA 3OZ6A 4AF3A 1PXLA 2PZIA 3CTQA 4IZYA 1HCLA 2Z7SA 5IUHA 5HIBA 2VO6A 3E8DA 4JT3A 4O7LA 3L9NA 1H1PA 5LARA 4NCTA 4B9DA 4QMZA 4DHJA 3HX4A 3CGFA 2FO0A 5J5SA 2YIWA 2VTNA 4KKEA 2VN9A 1IRKA 3DJ7A 4C57A 3TMOA 3AC8A 4FK3A 2VWXA 1PXKA 2YCFA 3R22A 5IEVA 3PVGA 2HK5A 4C2VA 4DFNA 3ZEWA 1AGWA 2C47A 3WZKA 3QD3A 3OTUA 2YM5A 2IPXA 5CXHA 4CTBA 5IQEA 3NRMA 2XKCA 1ZRZA 5JQ5A 3KCKA 4CFXA 3UMWA 4TWPA 3IDPA 3ZDIA 2X7OA 4HNIA 1WBSA 4QRCA 1ZYLA 4YTCA 4E20A 3O51A 4AFJA 1I09A 3BHHA 2QQ7A 2X1NA 3BHYA 4N4SA 4TYHB 5LJJA 1PYXA 3NNXA 4I94A 1R0EA 2V5QA 4ANSA 1O6LA 4K1BA 3D94A 3OXTA 2XIZA 3Q4UA 2W1ZA 2C6TA 3ZCLA 4BWXA 2XK9A 4I5PA 2HCKA 4EC9A 1UNHA 3Q3BA 4DEEA 2WIPA 1JSVA 4F08A 2JDRA 1W8CA 4FNZA 4LM5A 3BV2A 4ZJVA 4OTDA 2VTAA 2ZOQA 5GJDA 2HY81 4FKPA 3LZBA 4NTTA 4EH2A 3NYVA 3HMMA 4H1MA 4C35A 4FKTA 5M57A 4O91A 1BLXA 5IH5A 3MSSA 1BX6A 3FZSA 1Q4LA 4O7TA 3EMGA 3EQGA 4J97A 3CGOA 2PU8A 3FY2A 3F9NA 3V5LA 2XNOA 1E1VA 3QCYA 4BCOA 3HL7A 4FV4A 1Y57A 4FC0A 2WU7A 5FXSA 4UWCA 2B7AA 4ORKA 4MX9A 2B9IA 4BYIA 3COIA 4QYYA 4GL9A 2UW8A 4AZVA 4LQMA 3O96A 4U3YA 4OTWA 5IEXA 5CI6A 4BIDA 3U6HA 4FEXA 3PSCA 4PDPA 3IG7A 4RG0A 4OTGA 4RJ5A 3ZRMA 3FLWA 4CVAA 3JVRA 4QP8A 3QQKA 4X2JA 3MVMA 3SDJA 4F63A 1XQZA 4LFIA 3DXPA 3PWDA 1OM1A 4CYJA 4A4XA 2PSQA 2QHMA 1DS5A 2C6IA 5FQDC 4KSPA 3HDNA 4BI0A 1YXVA 3L8VA 4I93A 2F7ZE 4APPA 4DG2E 4TL0A 1OGYA 4AAYA 1Q5KA 2E2BA 3R00A 1TFFA 2ZB1A 4AXDA 3TYKA 4PL4A 1Y6BA 5TOZA 3OOMA 3QD2B 4BDDA 4O2PA 2EB2A 5ANEA 4D4SA 3QF9A 5BVOA 5DI1A 3K5UA 3PSDA 4HZSA 3LLTA 2VX0A 2HELA 3VUGA 4S34A 4RWLA 4UB7A 4XP3A 4HPTE 3QLGA 4TNBA 3LMHA 5M56A 2FH9A 1H25A 2PZPA 3O8TA 3R9HA 3CBLA 3T3UA 1GY3A 3EJ1A 5C26A 2RIOA 2F2UA 4DGMA 4G2FA 1GZOA 4PP9A 3RAIA 1OL7A 3NYNA 4FT0A 4L01A 5TT7A 4UZHA 2A0CX 3U51A 3KU2A 2GFSA 4JX7A 4GUEA 1NXKA 5J9ZA 4R77A 2BCJA 2IZRA 5HO7A 3QHRA 2ZAZA 2AEGA 2X7GA 1FBNA 4RVMA 4CT1A 5LMKA 5A6OA 4EH8A 2YDJA 2UVZA 2BTSA 2BTRA 2W4KA 4IFCA 4RGJA 2ZFYA 3TDVA 3LFAA 4ZTRA 2AC5A 3WI6A 1UU3A 5IPJA 4BHNA 1GAGA 3Q2MA 4KD1A 3PVBA 4NW6A 3DK6A 4ZS0A 2UW6A 2YAKA 3ALNA 5CVGA 2WOUA 5LWMA 2XB7A 4QPAA 1KE8A 4TYIA 5JRQA 4H39A 4ZSGA 2OI4X 2X39A 2XCKA 4MD9E 5IQGA 2ACXA 4WUAA 2R3RA 4FIJA 4FTIA 4IZ5A 4ZY4A 1W2CA 5FWKK 3OXZA 2QO9A 3EN4A 4HCUA 2E9NA 2J7TA 3FI3A 3LM5A 4XG4A 3R7EA 2PE1A 5CTPA 3CP9A 1VR2A 4KRCA 1M7QA 2DYLA 3C4XA 4I6BA 5FGKA 1RJBA 3WBLA 4CQEA 4X21A 2DUVA 3DU8A 5AUVA 3RZFA 3UQCA 3V51A 3GGFA 5AX9A 4I5MA 4KS8A 1RW8A 3EYGA 4DEIA 1CDKA 3EKKA 4GT5A 1YDRE 1WVYA 2DS1A 3V5WA 3D9VA 4QMSA 5CY3A 2R5TA 2W1DA 3EOCA 4PDSA 5ICPA 3FSFA 4O96A 4FV0A 4Y72A 4WNPA 5KO1A 4BR3A 4RFZA 3BL7A 4CFWA 3FZ1A 3EN5A 2WOTA 2VO7A 4L53A 3AOXA 3RM7A 3TTJA 5CEKA 5C4LA 2BFXA 2BRNA 5LWNA 2X0QA 5FBOA 4TKSA 2UVYA 3G90X 4ASZA 2XNEA 4XP2A 2OZOA 3VW8A 2C5XA 1GIJA 4BCMA 4JAIA 3G2FA 4FEWA 4ZMEA 2R3OA 5IG1A 5D7VA 2ZMDA 3W2PA 4DYMA 5JGBA 4EL9A 5F4NA 3W2QA 4ANQA 4FSZA 2B9JA 2A27A 5EI2A 5L2WA 5CZHA 1JBPE 3TZ9A 3ANRA 1MQ4A 2YIQA 4FTQA 4DGGA 1XJDA 3B8RA 4X2KA 3ODYX 1SVGA 4UY9A 2OG8A 3W0OA 4U42A 1R78A 1G3NA 3CJFA 4IJ9A 5HU3A 2O63A 5CEPA 4KUJA 3E88A 3UIUA 4F7LA 2XZSA 5TKDA 1ZARA 2JBOA 4RWKA 5CF6A 1QPJA 4O81A 3AT3A 4XJ0A 4MD7E 4NJDA 3MFSA 2RSVA 3QHWA 3DAKA 2OJ9A 3COHA 3FDNA 3PE1A 4YP8A 4IDVA 3QTZA 1U59A 3LMGA 2X0PA 3BIZA 4YHTA 1OL6A 4GK2A 4Y46A 5JFXA 3A99A 4R5YA 2O65A 4CMUA 4WG5A 3FHRA 2VTSA 4P5QA 3KXZA 3OUKA 4MXZA 4IBMA 2X4FA 2W4JA 3ZLWA 5LXMA 2XIYA 2PWLA 4CD0A 4BDJA 2C1BA 4FTRA 3U6JA 4M3QA 3RWPA 2HAKA 4K18A 1FMOE 5IISA 4L67A 1YWVA 3ZO4A 1XWSA 1ZYJA 2IW9A 4CGAA 3MY5A 4UWBA 4KS7A 2BRGA 5AP6A 4BB4A 2J0MB 2GHLA 4QYGA 3R8ZA 2FSOX 5FTOA 4MYGA 5HLNA 4XUFA 4G1WA 3BU3A 5EW8A 5A4TA 1OITA 1T45A 2W06A 2X6EA 1UA2A 3R7IA 2EWAA 4H58A 3UO6A 3FY0A 3C4FA 3QQGA 2GDOA 4QT1A 3OTVA 4CZUA 5HCXA 4JDJA 4DH5A 5C8MA 4KINA 5JZNA 4HGSA 2C6OA 2R7BA 4FV1A 3VUMA 2YZLA 3W0PA 2CPKE 3G33A 2QKWB 2WMBA 3ZUUA 1PKGA 1UU9A 2VTPA 5EK7A 3ZLYA 1LPUA 2Y6MA 3PPJA 2OICA 3CLYA 3QX4A 4PMTA 4PTCA 4Q2AA 3CQWA 4YC8A 1MRUA 5CEOA 4JMQA 4FKRA 4MXOA 4QP6A 3OF0A 3HA8A 4FTMA 2C0OA 3EQBA 4MXXA 2XKDA 2C3LA 3FLNC 5L3AA 3CS9A 3FQEA 3P23A 4BC6A 4ZZNA 4CG8A 3GU8A 3FC1X 4BCJA 4EHVA 2J0JA 2H34A 3MV5A 5CS6A 3SOAA 4QMMA 4F0GA 3I1AA 3V5JA 3ORLA 3TUBA 4NZWB 2WELA 2PPQA 3VS4A 2J9MA 5CU2A 4D28A 4O7SA 3TUCA 3NPCA 4FV6A 4JIAA 4E4LA 4WNOA 2JD5A 4ZY6A 1IASA 2VWZA 1PRYA 4FBXA 5IQFA 4AZFA 4ZMFA 5DMZA 4BJJB 4DE4A 5DE2A 2QOHA 3VS7A 2R0IA 5L2TA 5EG3A 2B9HA 2C3KA 3QRUA 3MPMA 5FM3A 4FL2A 5AA9A 5CSHA 4ANLA 3SRVA 3IW8A 4RPVA 1XH5A 3R7VA 3CXWA 4D2TA 4ID7A 5EQEA 2YA9A 4U45A 5FM2A 1SZMA 1PKDA 2VV9A 4EH3A 5K5XA 4O0RA 4JS8A 1YOMA 3O23A 4AAAA 3OOGA 3KRLA 3P0MA 3VBTA 2E9VA 5JQ8A 4D4VA 3RPRA 4BGQA 3SW7A 4EOJA 3FEGA 5FP6A 4FL1A 2IJMA 1QL6A 5ANOA 4EHGA 2JKKA 1KOAA 3EL7A 5HIDA 4Q9SA 5JN2A 4JBPA 3TACA 4KBCA 4YJOA 4AN3A 2XNGA 1URWA 2P3GX 4I0TA 4JNWA 3GEQA 4AN9A 2CKPA 2JAMA 2XKEA 5AP1A 4RC4A 3GB2A 2YCSA 5LVLA 3VQUA 3B2WA 3UTOA 5CU3A 2WGJA 4YC6A 4DH3A 4DFBA 5IQIA 4F0FA 1STCE 3MY1A 4EZ7A 3KXXA 3VWAA 4ZSJA 4EH4A 5DH3A 4O0WA 3AMBA 2OKRA 1H1WA 4MBJA 2C6KA 4YURA 4EI4A 3LLAA 5FTGA 2JDSA 4XG8A 4O0YA 3ZFYA 3TM0A 2X8IA 2RFEA 3LCDA 4PPCA 3A7JA 4WSYA 2Y7JA 3LE6A 3KN6A 2OZAA 4FVPA 4Q5HA 4FOBA 4PP7A 5L6PA 4YO4A 4D2SA 3ZOSA 4AZSA 4XEYA 3D2KA 4F1MA 1Q3DA 3NYOA 4QMUA 5DR2A 4HYSA 3RMFA 5IDNA 1R39A 1RQQA 1OMWA 3H9OA 4EK6A 1YXUA 5E8XA 4S32A 3PWYA 3BHUA 4AT3A 4U7ZA 4U9AA 5DOSA 3NCZA 3ZC6A 3E93A 3F3VA 3SG9A 2A19B 2C5YA 4IVBA 4J8MA 2WTVA 5FEDA 2PVYA 5AIKA 1HCKA 4M15A 4BBEA 2J6MA 2WXVA 2QO7A 3NWWA 3QKMA 5JEBA 3OEFX 5CLPA 5LMBA 3F3ZA 2XK7A 5EH0A 4RQKA 4BKYA 3I79A 5LVMA 4MHAA 3DV3A 4BI1A 5HTCA 4IHPA 5HORA 1JNKA 1TQMA 3U4WA 4CKIA 3MVLA 4O7YA 2FSMX 5DPVA 3RTPA 4EYJA 5AWMA 3VBVA 2ITPA 5ANJA 4QTEA 3UDTA 2HOGA 4ZIMA 3BGPA 3Q5IA 3RNYA 3SKCA 4RX5A 5ACBC 5JK3A 4X3FC 4FKQA 4G5PA 3A4PA 2UZVA 3SXSA 2X9EA 4F65A 4AP7A 3QQUA 3REPA 3ZXTA 2VGPA 2JIIA 3BWJA 4RA5A 4GVJA 1OIYA 2XJ2A 4C2WA 4QMXA 1JKLA 4PMMA 3H0ZA 3HP2A 3IW6A 2YITA 4ZTSA 5BVFA 3UQGA 5D9HA 3FMKA 4BICA 3AGMA 2CNQA 3W0QA 2BHEA 4O4CA 3R8VA 1ST4A 3H9RA 3FMMA 2ZVAA 3RK9A 5DT3A 3KXNA 4IX5A 4F7SA 3TWJA 5BQ0A 5BUJA 4C36A 4HJOA 5DRBA 2I0HA 5JRSA 3RPOA 5DNRA 3NGAA 1U4DA 3KF4A 4EONA 3ZBFA 2W1EA 4QTCA 4R3PA 3SA0A 3DY7A 3VONA 2FUMA 4EUUA 2OJIA 4NM5A 3GQIA 5L2IA 4TWNA 1SVHA 2QVSE 3OHTA 4FEVA 3TKUA 4U97A 2JKMA 4XP0A 1NA7A 2PUIA 4OGRA 3W8LA 4IB1A 3ERKA 3DFAA 3DTCA 4ANNA 2QODA 1VLRA 5AR5A 4CFFA 2PULA 3D5XA 5CI7A 1H24A 1P14A 4XBUA 4J1RA 5FDXA 2R3PA 2XIXA 1NVRA 3WARA 4DTKA 5BMMA 3QTQA 3UYTA 4O1OA 2H9VA 3KREA 2YIRA 5D7AA 4LMUA 4M68A 3RAKA 4I6FA 5BVKA 3CKWA 3FMDA 3KF7A 4ZEGA 3CR0A 3CCNA 2Y4IC 4RT7A 5KZIA 3RALA 5EDRA 4GUBA 3ZEPA 3UGCA 5E4HA 4YZBA 4I6QA 4RVKA 3W33A 2WQEA 4E1ZA 3UOJA 3TV7A 3B2TA 1PMNA 1WBPA 3V5QA 4L3PA 4UMQA 3EQPA 3BYMA 3VVHA 2WTIA 2WB8A 1GIIA 2RKUA 4ONAA 1WVWA 3BWFA 3AC3A 5FUTA 3CQUA 3JS2A 3W2OA 1XR1A 1YW2A 5CSVA 2WQBA 3Q6WA 1I44A 4EK5A 3PSBA 1REJA 2AYPA 3UBDA 2UZLA 3S2PA 4FT7A 4DEAA 2C5NA 4DA5A 3DLZA 2RL5A 3ALOA 1YDTE 4P2KA 3VRYA 5HIEA 3R8UA 3KK9A 3LVPA 4GFGA 4GFMA 4GYGA 2X8DA 4FNYA 2WTKB 5HVYA 5EM5A 5CAPA 3HYHA 3EIDA 3MH0A 4GRBA 4TWOA 4W4XA 5DLSA 5L2QA 4G3FA 5FEQA 3PJ1A 4YHJA 5DGZA 2IWIA 5L8LA 2F4JA 2R3MA 4O6LA 3JY0A 2WNTA 4NCTC 4LYNA 1KSWA 2QU6A 3L8PA 3F5PA 5EOLA 2GMXA 4UMTA 2W1FA 4GH2A 4QO9A 3ZYAA 5L2SA 2WMTA 5DWRA 4FA2A 1YOJA 3O8PA 2R9SA 3O50A 3D5UA 3DS6A 2Z60A 4XG7A 5H3QA 1NT2A 2I7QA 2VWUA 1BMKA 1H0VA 4QTDA 3N4TA 3RNIA 3KRRA 2YZAA 1REKA 3ZDUA 3MVHA 1OECA 4FX3A 4CV9A 2XH5A 5BVDA 2OH4A 2PE0A 3PA5A 5HBHA 1IA9A 3O5AA 2VWYA 3C13A 5D10A 3ID6C 2JDTA 3MGYA 4RIWA 4S33A 3TKIA 5AUZA 1JPAA 3QTRA 3W0SA 4UV0A 1UVRA 5HO6A 1A06A 4JIKA 3FXZA 1CKIA 2P4IA 1YI3A 3IW5A 2QKRA 1JKSA 3E7VA 2NNWB 4U44A 4TT7A 4TYJA 2W96B 3LJ0A 3RK7A 2ZV7A 3SAYA