4BL1A

Crystal structure of unphosphorylated maternal embryonic leucine zipper kinase (melk) in complex with amp-pnp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
332
structure length
312
Chain Sequence
KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKSLAYAAPELIQGKGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title Crystal Structure of Unphosphorylated Maternal Embryonic Leucine Zipper Kinase
rcsb
source organism Homo sapiens
total genus 102
structure length 312
sequence length 332
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bl1A00
4D2WA 3UNJA 4RIXA 5BVWA 2VTMA 4MBJA 3FYJX 3U6JA 3RP9A 3HA8A 3W1FA 3DBFA 4PMTA 4C34A 4DLIA 2DS1A 1CSNA 1IRKA 3D7TB 3PG3A 2EXEA 3D2KA 5FP5A 4BCJA 3W2QA 4P90A 2UW9A 4XV3A 4WNPA 3H4JA 1YHWA 2RFDA 3C4XA 3I5ZA 3RK5A 3V6RA 4DLJA 2WTWA 4V05A 3OCBA 5L2QA 5M55A 4AZVA 4CRLA 2YZAA 1Q8WA 3BGZA 3DV3A 4FZAB 4D0WA 2XNNA 2J90A 1CDKA 3PJCA 4FKTA 4O0WA 3VF9A 5CEOA 3A7FA 4QD6A 4AX8A 4Y5QA 2XM9A 3D5XA 4G17A 3FI4A 4QYEA 4A7CA 5I5ZA 3IONA 3COIA 5IDNA 5AUUA 5HIDA 4B8MA 4CMOA 4GU9A 3TI1A 4F7LA 4RBLA 4GK4A 2XNEA 3QCSA 4UB7A 4BCGA 5EYCA 5BVEA 4MQ2A 3U87A 3TXOA 2C5NA 2XNOA 1X8BA 2EXCX 5HG9A 4A9SA 4IAAA 1ZYCA 2UZNA 2XK3A 4JG8A 4G31A 4BCPA 3Q9ZA 1GZOA 2Z7QA 5CSWA 1XH8A 3NCGA 4ITJA 3WZJA 4GG7A 3LM0A 5J1WA 3BV2A 3DOGA 4JG6A 4C8BA 3IG7A 1RDQE 4BZOA 3QTSA 4YSJA 4FNXA 3QRKA 3GNIB 3BLQA 1YVJA 3EFJA 4NWMA 5CI6A 5L8LA 3P7BA 2XJ1A 2GNHA 2BAQA 5KNJA 3D14A 1JLUE 3GEQA 3PG1A 5HTCA 4FTKA 4W9XA 2J50A 3PVBA 3V5TA 4ZAUA 2JIVA 1ZLTA 2E9NA 3T3UA 3C4WA 3SD0A 4M97A 4AOTA 5JT2A 4UMTA 3QBNA 5BX0A 3PY0A 2BKZA 4YO4A 4O2ZA 1UNLA 1YXUA 3LFNA 1FINA 2X4ZA 3VHKA 4APCA 5LVNA 3FY0A 4Y46A 1ZMWA 2PZIA 3QHWA 4TYHB 1JKTA 2PVHA 3P78A 5HHWA 2WHBA 3ZRKA 4RWJA 4U79A 5KKRB 3FBVA 4FTMA 3R7YA 4HGTA 4LI5A 3ZMMA 3K5UA 2OF4A 4XG7A 2VTSA 2WELA 3FZOA 2QVSE 4DEIA 2CMWA 4GT3A 4IZYA 4ASDA 2WMXA 3QQFA 3M42A 5L6WL 3EZRA 2QHMA 2YHVA 3P7CA 2H8HA 4EOIA 5M56A 3RTPA 4FODA 1REJA 1WBPA 3ODZX 4JX3A 2O64A 2C6TA 2ZDTA 4RLLA 1R3CA 1UNGA 3HX4A 1OZ1A 2X6DA 3ZXZA 3LFAA 2PSQA 3LFSA 3NW5A 4HZRA 5K0KA 3JS2A 4BDFA 5KMMA 5M53A 2OI4X 2P3GX 2E2BA 4FZ6A 4U97A 1JSUA 3V5JA 3OZ6A 5A6OA 4E4MA 2ETKA 4TNDA 2B1PA 2YITA 2UZTA 3LLTA 4N6ZA 5E91A 2HYYA 1J1CA 4O6LA 4FIEA 2F9GA 3DNDA 3RZBA 3W8QA 1Y6BA 3BHHA 3QRUA 3FPQA 3ZFMA 5IISA 2UZBA 4FYOA 4D9UA 2PVJA 4CFUA 2ZB1A 2WQNA 4FG8A 3RWPA 4H36A 3DCVA 1JKKA 5AIRA 2VRXA 3FMNA 4D2PA 4F9YA 5ICPA 5CALA 4JDJA 3HDMA 3R71A 4FTUA 4HNIA 5CQUA 4YPDA 3C9WA 3W18A 4QTCA 2QC6A 5AP6A 5GJFA 5LARA 4GS6A 5HLPA 4IX3A 5CI7A 3W2CA 2ONLC 4IWDA 3FZPA 4TZRA 4IVBA 5AUWA 4WRSA 4FV3A 1SVGA 3C0IA 4JT3A 2VO6A 3AC4A 4FV4A 4ACDA 3EFWA 3GU4A 1M14A 3TNPC 3COHA 3P23A 3RPSA 2V22A 2J0IA 2W9ZB 3RGFA 3VS4A 4EOSA 4EHEA 3NNUA 5A6NA 3NNXA 2IZUA 3EYGA 3CTQA 3C4CA 4BYIA 3TL8A 3CR0A 3QUEA 4F7JA 2R3KA 4XRLA 3G51A 5J79A 4EQMA 3T3VA 3ACKA 3CPCA 2PUUA 4RFZA 4IX5A 4TYIA 4BWKA 3DLZA 3HEGA 5DR9A 4EOLA 3AMBA 5EM6A 5JFWA 1SNUA 3FLQA 3QXOA 3VW6A 4HYIA 5AAEA 4O0YA 4F9CA 3NYOA 3QWKA 2QOFA 4HOKA 1DM2A 2WMWA 3C7QA 3ORLA 3QUPA 2W1GA 3PZHA 4FEQA 4TT7A 1Y8GA 4D5KA 2OH4A 3BZ3A 5CENA 3RBWA 1YDTE 4GIIA 3KF7A 3CD8A 5JFVA 3PJ1A 3WIGA 3KL8A 2ZYBA 5L6OA 5AUYA 4PRJA 2YAKA 4I94A 5KX8A 4CFMA 2G2HA 1SM2A 1HCKA 2HW7A 4M68A 3IW7A 3TNIA 3KFAA 3OY1A 4EOPA 5M44A 1PMUA 1FGKA 3NUSA 5EYDA 5HO8A 5C27A 1NVSA 4XJ0A 4C7TA 2C68A 2WPAA 3FWQA 5AX3A 5JK3A 2JDVA 4YR8A 1YI4A 2YM3A 4FSWA 2C6IA 3LQ5A 2WTJA 2ZVAA 2PZYA 2ITYA 2W1ZA 3NCZA 4BWPA 2R3NA 5LXMA 4QMUA 4O91A 4MXZA 2AC3A 5EI2A 2VTNA 3VUGA 3BYMA 4UYNA 4UMRA 3PJ2A 3UQFA 2C5YA 3EQDA 3W8LA 2YIRA 4LGGA 2X6EA 4MXAA 1J3HA 4AT3A 3UIXA 3U6IA 1U4DA 5HBEA 3SX9A 2R64A 5KHXA 2YN8A 4Y95A 3A61A 3TWJA 3PPKA 1H08A 4G6NA 2QLQA 2FVDA 5ETAA 2R3FA 5IA1A 3CQEA 5CEQA 3UPZA 4F9AA 4FA2A 4KA3A 2VN9A 3GOPA 3RPRA 4HNFA 4WBOA 5F1ZA 3RWQA 4OBPA 1B39A 1P5EA 3FAAA 1YXTA 4OTQA 5HNIX 4IDVA 3MS9A 3IO7A 2GSFA 4A4OA 3QAME 3OXIA 4AW5A 3EQBA 4CKJA 3ZC6A 5HU9A 4H58A 5HQ0A 1K9AA 3HECA 2CPKE 4D5HA 4LGHA 2G15A 5JEBA 5L2SA 4OT6A 3WZDA 4BKYA 4JOAA 5FGKA 4JNWA 5AP5A 3CBLA 3FI2A 1RE8A 3HP2A 4I6HA 5EW3A 3VS0A 4FL3A 3MWUA 3MBLA 3NDMA 5HX8A 3QTXA 3PVUA 2W4KA 1FQ1B 4FIIA 5EI8A 4H1MA 3OVVA 1Y6AA 4MK0A 4CT2A 3HV5A 4BGHA 4PDSA 1W82A 1H4LA 4TRLA 4FTAA 3EQIA 4I0TA 2IVTA 5LWNA 4CKIA 4U7ZA 2IW8A 4UMPA 3KRLA 4GMYA 2R5TA 2WTIA 4RLKA 3O17A 4EH4A 2J0MB 2Z7LA 4FV5A 1OM1A 2UW6A 4F1MA 2ONLA 2J4ZA 3HKOA 4BBFA 2BZJA 3UZPA 4EH6A 3GU6A 3G33A 4JL9A 3UODA 3HV4A 4XG8A 4WSYA 2QOQA 4GH2A 2HW6A 2GNLA 3IW4A 3VUKA 2GHGA 2PHKA 4RJ5A 1MRUA 4QOXA 5J95A 4E6AA 2ERKA 2XZSA 4TNBA 4MD7E 1YW2A 2C3LA 1A9UA 4O0TA 5JZJA 3EQGA 5JQ5A 3W2PA 3BU3A 4K11A 5AR5A 3R7IA 3GUBA 3JYAA 5DEYA 4ZTRA 4AWIA 2W1CA 5T3QA 4IWPA 2OJIA 2VGOA 1GZKA 1H01A 2OZAA 3FKOA 5AA9A 3RK7A 2IVUA 1PKGA 4GFOA 5ETFA 1ZYLA 3CJGA 5DEWA 3MIYA 3WF9A 3DFAA 2V0DA 3FC1X 4GV1A 2CHLA 5IF1A 3UDBA 2J0JA 2DQ7X 2VWBA 4EH7A 3F5GA 3RJCA 3VS5A 1ZY4A 5CAPA 3L8VA 1OGUA 3DY7A 3UNZA 3MPMA 3P1AA 3F3WA 3D5WA 4EHZA 1VJYA 2WIPA 2XKDA 3MFUA 3ZM4A 3UOLA 4XBUA 1PXOA 4ZTNA 2VTTA 4GT4A 5JRQA 1JQHA 5A14A 2X8IA 4C2VA 5HEZA 3DB6A 4FV2A 4QNAA 2BFYA 1JOWB 4RVLA 4AACA 5AP0A 4IB5A 4AFEA 2YIXA 5CWZA 4ZJIA 4GJ3A 2P33A 2OFVA 4YJSA 5IA4A 1GIJA 3LJ1A 4U40A 2V7OA 2QOHA 3G9NA 5KMKA 3PSBA 1FPUA 2PVKA 3BX5A 3QKMA 4AFJA 2C6DA 4OTRA 2X7OA 1PXKA 3DK3A 2LGCA 3O8TA 2XVDA 4B7TA 3Q53A 1H1PA 4K9YA 2C69A 3S95A 1A06A 4FIHA 3CKXA 3DK6A 4CV9A 3A2CA 4NM0A 1TQMA 4LOPA 1Q24A 5I9VA 1O6KA 3G2FA 3MVMA 4YBJA 4CFVA 1FGIA 1YKRA 3QZHA 3WIKA 3GCVA 2CJMA 4IMYA 1P2AA 4GW8A 5J8IA 1LUFA 4KKHA 5C01A 4RWIA 5EG3A 1XHAA 1GZNA 3F66A 2RGPA 5IUIA 4FV0A 2EU9A 3PSDA 4I3ZA 4C59A 4PMSA 5EDQA 3HMPA 5IEYA 1IEPA 2RKUA 5E8TA 3R7EA 4P5QA 3RI1A 3EFLA 4OW8A 3BWFA 2B9JA 2BMCA 3F3VA 5HD4A 2XRWA 4DFNA 3A7GA 3RM6A 4YMJA 2XK9A 1HOWA 4CQGA 5FM3A 1PYXA 1UNHA 4OTFA 5JGDA 5BVKA 5HLNA 5CF6A 3F88A 1K2PA 4C38A 1Z9XA 3FZTA 3EN6A 4BDGA 3QU0A 4CFWA 2QD9A 3JUHA 4YP8A 3UIBA 4QMTA 1VYWA 4CXAA 3TUCA 2QONA 3PWYA 3V5QA 4CTBA 4YUQA 4WG4A 4EYMA 2ITPA 1Q3WA 2WMAA 2VV9A 4HYHA 4UWYA 2CGXA 2JLDA 3ACJA 2WU6A 1XR1A 2HZNA 2PK9A 3BI6A 3O50A 5HE1A 2HZ0A 3A60A 4XLVA 4EZ5A 1MQ4A 2QCSA 4J7BA 4HYUA 2JAVA 3H30A 4YPSA 4X2FA 4WG3A 4O38A 2OZAB 2YACA 2F49A 4FZFB 4MX9A 1E9HA 3JPVA 3EN5A 3QA0A 5HCZA 4ZK5A 4JBVA 4IB0A 3F3UA 4KD1A 5AAGA 1YQJA 3TKIA 4CEGA 3RNYA 4NJ3A 5FEDA 4BYJA 1M7QA 4FT0A 3DDQA 4N70A 5C8MA 2AYPA 3RK9A 3FHIA 3JXWA 2OKRA 5CQWA 3ORTA 4CKRA 4PF4A 3OXZA 2OF2A 3VS7A 4JAIA 4B0GA 2WMVA 4I22A 5DGZA 4EH2A 4QMZA 4JIKA 4YURA 4TWNA 4ZTSA 1H1QA 1U46A 2WTCA 2ITOA 4ENYA 3H10A 2VX0A 1YWRA 2R7IA 3VNTA 4EK8A 4L7SA 3MA6A 3P9JA 4DH7A 4BC6A 1AGWA 4F7SA 5CXZA 1ZOEA 3D15A 4RSSA 4EH9A 2IO6A 3I0OA 2W1IA 4QP8A 4EORA 3UYTA 3VUTA 3OP5A 5BMMA 3WBLA 2YM7A 2O2UA 5A4TA 4TN6A 3EQCA 3S2PA 1OL6A 4RGJA 4FKLA 3PA4A 4A4XA 4ZZOA 3HUCA 4DN5A 4KIOA 4FNWA 5A4QA 4CV8A 4OTWA 3KXGA 4KABA 1MRVA 4PMMA 2VWZA 1UVRA 2OJJA 2XEYA 3IDPA 3JY0A 4BICA 4U9AA 2IZRA 2I40A 4AN2A 4C58A 4WSQA 2ITXA 4ASXA 4ITHA 5FBNC 5B0XA 3V5LA 3H9OA 3GU7A 5EYMA 1V0OA 3KXMA 4EUUA 1OL5A 1ZRZA 4S2ZA 4FKRA 4C02A 2B7AA 3R1NA 4DGNA 4C33A 2HK5A 3CCNA 5BVNA 1Q62A 3LCKA 4ZY4A 3BPRA 3CTHA 4R6VA 2VTPA 2W1HA 3LFEA 3OUKA 3UO4A 4A9YA 2BDFA 3ORXA 3BGPA 1TQIA 5G1XA 1H24A 4BI2A 3B8RA 4YJNA 1OKWA 3FXXA 2BUJA 2YCQA 3V8WA 5K5NA 4H3BA 4NZWB 3DJ5A 3E5AA 4RZWA 1ZXEA 1KWPA 4FK3A 2W5HA 3OEZA 4R5YA 2BAJA 2PY3A 1GJOA 3FMDA 4W4XA 4F6SA 5BVFA 4FT7A 4FT3A 2OO8X 4GSBA 4J97A 2IVSA 2X0GA 3R63A 2UV2A 5KO1A 5EKNA 3A7HA 5FLFA 4EBWA 3AC3A 5DLSA 4IM2A 3R8UA 4WUNA 3C4FA 3RPYA 3RAIA 3FQEA 3R8MA 4PL5A 2PL0A 2CGWA 4C4GA 2WEVA 5GJDA 2FUMA 3MY0A 3BV3A 3ULIA 4OT5A 1P4OA 4Q9ZA 1STCE 4M3QA 4RQVA 3BHYA 4JBQA 4QPSA 5K3YA 4BDBA 1PYEA 4RJ3A 3AGLA 4RJ4A 4CYJA 3DBDA 2XK8A 4QMVA 2XNPA 2ZM1A 5AUZA 3ANQA 3R7GA 3U6HA 1PY5A 1UU7A 3UQGA 1FOTA 3CP9A 4EOQA 4E26A 4U43A 4B4LA 3QWJA 2ZV8A 3AC5A 5M4UA 3LCOA 2QKWB 3EFKA 4HPUE 3T9TA 4YTFA 1BX6A 3NS9A 4KINA 1T45A 2B9FA 1ZOGA 4I24A 4BCFA 5BYZA 3OFMA 2F7ZE 4LYNA 4QRCA 1PMEA 4D9TA 3NRMA 2ITNA 4YJTA 3SQQA 3WILA 4QQ5A 4D4RA 1OKZA 1Y57A 1YOLA 4MNEA 4UXQA 2GTNA 2W99B 4RJ7A 3WE4A 4BCQA 4QTEA 5AR3A 4AZTA 3ULZA 2X81A 5CSVA 3VBQA 5KE0A 4AN9A 3BHTA 1XJDA 3EL7A 1JVPP 4JAJA 3DBCA 4FKGA 4ONAA 4YZDA 2C30A 3PPJA 1LR4A 3C50A 4BHZA 2WGJA 4I6BA 4NK9A 4LFIA 1M7NA 4IC7A 1EH4A 4YGAA 3IDCA 3RAWA 5KUPA 3KMWA 5AV0A 3HL7A 4IACA 3O8PA 4AS0A 2YERA 4XEYA 3EL8A 2RFNA 3LXKA 3QFVA 4G3DA 3MYGA 2PE1A 4FR4A 5FQDC 2XIKA 3EYHA 1JAMA 2EB3A 3DQXA 3Q4ZA 4TY1A 2DYLA 5H2UA 3VO3A 4WHZA 3Q4UA 3DKGA 2UZOA 5K5XA 4WD5A 3WE8A 5JMSA 3SOAA 2B9IA 2W0JA 4IB1A 3HV3A 5CS6A 3FXZA 4DGGA 2HZIA 3ZO3A 4ENXA 3QKKA 4XOYA 5E8VA 3O2MA 2XM8A 4U3ZA 5AIKA 4GYIA 3KULA 3A7IA 5EHLA 3KVXA 4MF0A 5HORA 2BAKA 4F1TA 4TKSA 4QMXA 1JKLA 4TWOA 4GUEA 1ZOHA 1DI8A 2XYNA 4FICA 3QRIA 4I6FA 4V01A 2IJMA 2JKMA 1G5SA 3NW6A 1TVOA 3CLYA 3JVSA 5H3QA 4G5PA 3HA6A 4M15A 4W4VA 4YZMA 2BRMA 4YU2A 3OOMA 1Q8YA 2WNTA 4L7FA 2J0KA 3UO5A 4YJPA 4CCBA 2X2MA 2YDIA 3Q9XA 4FTTA 1SVEA 2G2FA 2YIYA 3V8SA 4EYJA 2CCHA 4BDHA 4XUFA 4AZFA 4AZSA 2O0UA 2GS7A 5L2IA 3RHKA 3P86A 2VZ6A 3MGYA 4NTTA 2BRHA 3C51A 3D5VA 3UOKA 2C0IA 4O1OA 2QOOA 3D83A 3IGGA 4FSNA 3AD6A 2UZVA 2WD1A 4I5CA 1UKHA 5FTOA 3VWAA 1GZ8A 3I6WA 4KBKA 4IVCA 3FLSA 4L52A 4PTCA 4PUZA 3M1SA 4OBQA 2A27A 1FMKA 3GBZA 3DJ6A 5EDPA 4HVIA 4LRJA 1WZYA 3PE2A 4RA5A 4GYGA 3TNHA 4RIWB 4MXOA 1FVTA 4HZSA 3ZONA 4XG4A 5EM8A 2YJRA 3M2WA 3DZOA 2R3RA 5DRBA 4C35A 4IZ7A 4KIQA 2WQEA 4C36A 3UVRA 3Q60A 4P7EA 3OTUA 3H0YA 4UEUA 4U42A 5T68A 4XP2A 4MNEB 4FX3A 4C57A 4AGWA 4JLCA 3ORPA 4EZ3A 4FKJA 4IVAA 2HXLA 4CZUA 1OITA 2C1AA 1OVEA 3ZYAA 1XBBA 4AQCA 5BPYA 2BCJA 3EWHA 5IPJA 4M66A 3R00A 3QQUA 4BDKA 2C3IB 3PXKA 3F7WA 1F0QA 1XBCA 2F7XE 5AADA 2RFEA 3NX8A 4IW0A 4C4JA 3H3CA 1YI3A 5KMLA 1KOAA 1BL7A 3G9LX 5A4CA 3EKKA 1H00A 4ALVA 3PRIA 4Q2AA 4QMOA 1UU8A 4TW9A 2CSNA 3NAXA 4M13A 2W5BA 4ZLYA 3Q3BA 4TYGA 3I4BA 4A4LA 4IWQA 4ZSJA 1XH5A 4BDJA 2WTDA 3KXZA 4L45A 5CF5A 3BWJA 5DWRA 2XK4A 4QMSA 5FG8A 2V5QA 2C1BA 3Q2MA 3U8WA 3ZRMA 2VWYA 3DFCB 3QQKA 4DGLC 2YM8A 4RC2A 3AD4A 3KU2A 4XBRA 3W10A 2B9HA 4DGOA 2YABA 4FT9A 4A07A 5E8ZA 4AW1A 1OPKA 5KBQA 2WIHA 4RX8A 4ANLA 4BGQA 2WQMA 3HVCA 4YHFA 4HCVA 1ZMUA 5L8JA 1YDSE 4ZOGA 5I9YA 3P4KA 2ITTA 5ETIA 4AZWA 1Q5KA 4E4XA 2W5AA 3R02A 3BHUA 5FEEA 3R83A 4I6QA 4QTDA 3QQJA 4DINA 3FPMA 3I5NA 2RL5A 1XH6A 2XK6A 4BGGA 2Q0BA 4ZTQA 2F57A 4LMNA 3ALOA 1PXMA 5HBJA 1PXIA 2H34A 2QOCA 2X2LA 1R39A 5LMBA 2C3KA 1H1SA 4X2GA 3FLYA 4E6DA 3ZC5A 1SMHA 5JH6A 2WZJA 4K2RA 3HDNA 3DLSA 4K77A 3L8PA 4FV1A 4FKUA 3MDYA 4KKEA 4O0RA 4FNZA 4I93A 3V5PA 5IG1A 2PVMA 4PDOA 3U4WA 1APME 3HV6A 2WB8A 3BYSA 5L2TA 3S3IA 4LRMA 1T46A 2YISA 5BUIA 3EQHA 3ELJA 3OS3A 3S0OA 4EK5A 2Y6MA 3MVJA 3BYOA 3PA5A 3R2YA 4ZJJA 4RIXB 2ERZE 1VYZA 4EI4A 1WBWA 5EH0A 1Q8TA 3DT1A 5L6PA 3C0GA 3UJGA 3R1QA 5LMAA 2C4GA 5F94A 3ODYX 5CU0A 3LCSA 2CN5A 3CE3A 4FOBA 2O63A 4C3FA 2QOKA 2VWUA 3FSKA 3R7UA 2WO6A 2J5EA 4RMZA 5EFQA 4DG2E 2XIZA 1ZMVA 5D11A 4D2RA 3MH2A 4PWNA 3O51A 4R1YA 4USFA 3MTLA 3Q32A 3VS2A 2BIYA 4K8AA 4KIKA 3TZ9A 4BCHA 3WARA 2VTJA 1VZOA 3QZFA 2J0LA 2HELA 2B55A 4L43A 3F82A 4JVGA 2GFSA 5K0XA 3BQCA 2WTKC 3QTQA 4O27B 5JGBA 4MWIA 4F08A 2Y0AA 4BKZA 4CD0A 3NW7A 1SYKA 2ITZA 2R0UA 4CYIA 2EVAA 4JJRA 4EJNA 4F4PA 3FLZA 3QRJA 1VR2A 4FVRA 4XNEA 1H1WA 2ZJWA 4KS7A 2QU5A 2WMTA 5GHVA 5HCXA 3E62A 4GCJA 5ETCA 4E4LA 3RALA 1P4FA 1ZYJA 4QMLA 5J9YA 5E8WA 4O0VA 3KVWA 4ARKA 3TV6A 4IEBA 5EHOA 3HMIA 2VTLA 3HRCA 2C0OA 3RCJA 4IM0A 3LAUA 2A4LA 3AT3A 3VBWA 2CGUA 2FH9A 3DAEA 4JRNA 2JDRA 5FTQA 4L44A 2Y4PA 1WBSA 4UN0C 3I7CA 2PMLX 5JZNA 4XCUA 3K5VA 4IAKA 4Q5HA 3OTVA 1NVRA 1M2RA 1ZY5A 4WBBB 1M17A 3DAJA 1G3NA 4U5JA 5CZIA 4YZNA 5B2LA 4S32A 3ZUTA 4FVPA 2XF0A 4IB3A 4NKSA 4F0GA 2G1TA 2BRNA 4M69A 3ORMA 4L42A 2R3IA 1PMNA 4NFMA 1O9UA 3T9IA 2OJFE 4EH5A 4XMOA 4N0SA 3ZSIA 3IW8A 3G6HA 3BYUA 5L2WA 4E93A 3FL4A 5CT7A 3PLSA 2QR8A 4OR5A 3AOXA 3TNQB 3ZLYA 2X8DA 4ACHA 4QYGA 3OEFX 3TUDA 3COKA 2GDOA 3HRFA 3THBA 4EWHA 1DAWA 4HVHA 3PA3A 3GCUA 3W32A 2XBJA 1KE7A 4II5A 4CSVA 4O0XA 3AXWA 2QU6A 4ANQA 5JFSA 1XH9A 2OK1A 2GPHA 5B7VA 3MB7A 2Z2WA 4QYYA 1PXLA 3D4QA 1PHKA 4MTAA 4XRJA 3T8OA 3WYXA 4BTMA 3R04A 3AG9A 2H96A 3E87A 3E92A 3FDNA 3PP0A 4X6QC 4APPA 3UP7A 4BTJA 3ORNA 4NKAA 2G9XA 4L8MA 4IANA 3ZOSA 2F4JA 2XCKA 2XIRA 3DBEA 2PMNX 3P79A 4FG7A 4A06A 3NUXA 4KIKB 3KXHA 5BVDA 3NZ0A 3V3VA 1PKDA 5CEMA 1OL1A 1WVWA 3ORZA 4FTJA 3HMNA 4KWPA 5EW9A 4OTPA 4NM3A 3V5WA 4EOKA 1CKPA 3MSSA 3QF9A 3OW3A 3FKNA 4MCVA 4UWCA 3QHRA 2FB8A 3GI3A 1XO2B 3IW6A 4I0SA 2JBOA 4L68A 2R3MA 5F20A 1XBAA 2VTRA 2J9MA 2RF9A 4UWBA 3E8DA 4YTCA 2EXMA 2QHNA 2OIBA 2ZDUA 2R9SA 2HWPA 4UZHA 1K3AA 2UVYA 2YDKA 3ZSHA 1R0EA 2XKEA 4IM3A 2W4OA 1BL6A 4H3PA 5B2MA 2XKCA 2BZHB 2W96B 4QMMA 1E1XA 1WMKA 4PPCA 3F5PA 3LMGA 3NUNA 4R7HA 5K4JA 4I5HA 3LM5A 3ZSGA 4ZY6A 1GNGA 5A46A 3FQSA 2DUVA 3AT4A 4Y72A 4EK4A 1Q8ZA 5F9EA 4EZ7A 3FY2A 3UGCA 5TOZA 2HY0A 4GL9A 2WKMA 5HBHA 4LMUA 2PVYA 1OIYA 3PVGA 2FSTX 3VUIA 2XYUA 4DBNA 1OKYA 2ITQA 5LWMA 3EN7A 4OAUC 3GGFA 2JC6A 3K2LA 4TPTA 5DBXA 1KE9A 1WAKA 2UW4A 3EZVA 3CKWA 3HV7A 3QKLA 4FSYA 2YM6A 3LHJA 3RPOA 3ZRLA 3F3TA 2BDWA 3MW1A 2JDSA 3VVHA 3WF8A 4LL0A 4C2WA 4BWXA 4BB4A 5H9BA 4EQUA 3ZLSA 3ZXTA 4IFCA 3TT0A 3L1SA 3BRBA 1YHVA 4M69B 2VWVA 3MH1A 5FM2A 3VQHA 2JFMA 5CU6A 2EB2A 3UTOA 4D55A 5LCJA 4DGMA 4DEGA 5CAOA 4K0YA 4LGDA 3PE1A 5AP3A 4G1WA 2HAKA 1Q97A 4IJPA 3V8TA 3R21A 4GVAA 2C6OA 1Q61A 4W4YA 4BDIA 3PUPA 3BU5A 3GQIA 3R8PA 3F69A 5HESA 1W0XC 1OIRA 3NGAA 1W83A 3UQCA 1PXPA 4PP7A 3ZUUA 5DE2A 3FLWA 5LMKC 2ITWA 4X6RA 4EOJA 2OSCA 2IN6A 2Q0NA 3QQLA 4WIHA 4AE9A 1F5QA 3R1SA 3MFRA 5HGIA 3I1AA 4FG9A 2UZEA 4KKGA 4GFGA 4G3EA 2W4JA 4EL9A 4M8TA 4D4VA 3PWDA 3KB7A 5DMZA 1LEWA 3KN6A 4JR7A 5M51A 3RM7A 4A9RA 2VWIA 1BYGA 3OC1A 2XEZA 3VRYA 3BU6A 5CLPA 1DAYA 4JDIA 4NJDA 4FGBA 2WXVA 3A4OX 3G0EA 3OCTA 3CY2A 2UW7A 3IK3A 4E6CA 2BZIB 5EM5A 5EYKA 1QPDA 1NVQA 4NH1A 4FSZA 2QLUA 5CNOA 5CXHA 3UG1A 3QTRA 3KMMA 4G34A 1WFCA 4X21A 2SRCA 5DA3A 2C3JA 4KS8A 3I60A 4EH8A 4PDPA 5DT0A 3OG7A 4EONA 5F4NA 4X7QA 3H9RA 3MFTA 4QMYA 3GU8A 4O96A 4I23A 5E92A 1IG1A 2R3LA 5CVFA 4UMQA 4Y85A 5AA8A 4W8EA 3OWKA 1CM8A 1M2PA 4FSTA 4BIEA 3GC9A 3QTUA 2OJ9A 3QRTA 3IECA 2WTKB 4ACGA 4BDEA 2FSLX 4LOQA 5HNGA 1CKJA 4RFYA 4J52A 4BL1A 3IGOA 3PXFA 5L3AA 4F0IA 3W2SA 4QT1A 2ZMCA 3ROCA 5JGAA 4W4WA 3ZO2A 3PIZA 4P4CA 2I0VA 4DCEA 3UVQA 4PP9A 3SXFA 3UOJA 2QNJA 3LFCA 2REIA 1E1VA 3LXPA 3NLBA 4JRVA 5CAVA 4F6UA 3AT2A 5EI6A 1IA8A 5A4LA 3OCGA 3KMUA 3O23A 4EK6A 3R28A 3Q5IA 3C1XA 4YNEA 5AR7A 3ZLWA 4D2VA 5JFXA 4U41A 4DFLA 1H0VA 1URCA 3DXNA 3V01A 4E5WA 3OD6X 3KA0A 2R7BA 4OTHA 4FKQA 2R3JA 3DAKA 1YRPA 2FSOX 3B8QA 2UZWE 1AD5A 1KE6A 5L4QA 3FZSA 1Q99A 3NNVA 5J1VA 5K9IA 4ALWA 3AC1A 2OG8A 3MH3A 1JBPE 2JBPA 2C6EA 2QG5A 2FO0A 3QTWA 4FC0A 4I4FA 4UXLA 5AP1A 3VBTA 3WZKA 4FTQA 4PY1A 4FIFA 5AV2A 1I44A 2GFCA 4YBKA 4HJOA 1YXXA 3FMMA 3CIKA 3LPBA 3PJ8A 5GNKA 4KSPA 5JQ8A 4ACMA 2YLEA 2C5OA 2H9VA 5HE0A 3PP1A 5DR2A 4RX9A 2YIWA 3Q9YA 3MJ1A 5E8YA 2HXQA 5CEPA 2QODA 4EH3A 3ZU7A 4HPTE 2QOIA 1BI8A 5CEIA 2VTHA 3DS6A 5LMKA 5CVHA 3ZUVA 1U59A 4FSMA 1ZYDA 5ANKA 2PMOX 2XBAA 2XP2A 1HCLA 4FKWA 4U80A 4EHGA 2J51A 4D1ZA 3D0EA 3FUPA 3QCXA 2WQBA 3A62A 1OIQA 4BI1A 5J5SA 1PXNA 4XOZA 1R0PA 2OJGA 3AGMA 2XH5A 5TO8A 5C8KA 4RWKA 4S34A 3ORKA 2J2IB 3KK9A 1BKXA 4F09A 2J6MA 4X3FC 4DEAA 2UW0A 4XG6A 3S00A 3AC2A 4KNBA 3ZBFA 4EKLA 2BDJA 5ACKA 3BKBA 3PRFA 3VC4A 5DHJA 5DT4A 4QQTA 2W05A 3F6XA 3FL5A 4QP7A 4AA4A 4L3LA 3QD0A 4UBAA 3ERKA 5LOHA 1OB3A 3E7VA 4B9DA 2KULA 2O5KA 3QX2A 4WOVA 4YC8A 4AE6A 2OXDA 3HRBA 3LE6A 3L8SA 4CNHA 3NUUA 2XA4A 4AW2A 4YJUA 3GU5A 2PE2A 2GNJA 3GXLA 5C8NA 2NRYA 3QXPA 3CTJA 5HE2A 5HICA 2RFSA 2VUWA 4C3PA 4QPMA 4FI1A 4IQ6A 3VJOA 3QZGA 3UZTA 3DB8A 5CASA 2F2CB 4I20A 3ZFYA 3FMJA 2XJ0A 5E8XA 5IU2A 4FKPA 4QMPA 5DIAA 2JIIA 1KV1A 5J5TA 4MD8E 4YO6A 4WRGA 2WMQA 4YJRA 4R3PA 1GIHA 4E3CA 4ASZA 3KXNA 2JKOA 3DGKA 4MWHA 5M57A 1OUKA 4WNKA 4QMWA 5IA5A 3REPA 4YLLA 4DFZE 5AUVA 3U4UA 5DPVA 4ZEGA 3U9NA 5CF8A 5IEVA 3F61A 2Y4IC 3SXSA 4BF2A 4I5MA 1KOBA 3RZFA 1WCCA 3CY3A 4RIYA 3ALNA 4LV5A 1H07A 2ZM4A 4RG0A 5CAQA 4ERKA 5IEXA 2YCSA 5I9XA 4FBXA 4X0MA 3IQ7A 3O96A 4ZXTA 3NIZA 4EC9A 3EN4A 5HI2A 4O2PA 3MB6A 4IDTA 5FDPA 4B6LA 4QO9A 1V0PA 5GJGA 4OUCA 3W2OA 4PV0A 1QL6A 5FD2A 3TZMA 3FYKX 4DYMA 5CSXA 3QA8A 5TR6A 2VTQA 4ANMA 3B2WA 3KC3A 4R1VA 3KEXA 1OPJA 3ZH8A 2UW5A 4LQMA 3BQRA 2IZTA 4YTIA 2PZPA 2QO7A 2R3QA 2W17A 4UV0A 3QQGA 4BCNA 3I6UA 3SKCA 3LFBA 3LQ8A 3RHXA 1GY3A 5L8KA 3ENHA 2XS0A 3MTFA 5E7RA 4XS2A 4ZIMA 3GC7A 4RVTA 2X2KA 3PIYA 3ZHPC 2I0HA 3EH9A 3KXXA 1URWA 2E9PA 2R3OA 1H27A 3LXLA 4FTOA 3B2TA 4J98A 3MVHA 3QX4A 5AV3A 1U5RA 4OTIA 3R22A 2VO3A 3ZZWA 2IW9A 3SLSA 1RJBA 3HGKA 3DZQA 4B8LA 5IUHA 3R1YA 5FXSA 2Z60A 2JKKA 3NR9A 5EW8A 4OGRA 4H1JA 4BCKA 2YAAA 3KRWA 4ANSA 4AG8A 4J95A 4BFMA 4G6LA 2B53A 4LOOA 4BBMA 1W98A 1WVYA 3UE4A 4PNIA 4NIFA 3UYSA 5IA2A 5HKMA 5M4FA 3GCQA 4X3FA 1R1WA 3UMXA 4EQCA 5FP6A 2YLFA 3QGWA 4EBVA 3R9OA 2UVZA 2G2IA 1M52A 5A9UA 4IZ5A 1R78A 2OZOA 3RVGA 4QTAA 5DH3A 2J7TA 2PVRA 3E93A 5KHWA 3WF7A 4GK2A 3GC8A 3LJ0A 4AGCA 4KSQA 4NW5A 2OW3A 5J9ZA 3QD2B 5E1SA 3PXQA 2FGIA 4Z7GA 4G9CA 1UU9A 3IPHA 4XG3A 4GG5A 2ZV2A 3SW7A 4J53A 3LOKA 1GIIA 4EKKA 5I3RA 3EJ1A 2JFLA 4Y73A 3OWPA 3EOCA 1JKSA 4NFNA 2VTOA 1PXJA 3E8NA 3TIYA 3ZLXA 3JY9A 3QQHA 2R2PA 4K6ZA 4USEA 4BKJA 5CYIA 4YZ9A 2VX1A 4QP6A 1WBTA 3N9XA 5TE0A 5EKOA 4HGSA 4DH3A 4Z16A 3P5KA 1U54A 5EHYA 4BCOA 2AC5A 4MXYA 3R01A 3BYVA 4IAYA 5FBOA 4JQEA 4XLIA 4MXCA 3NPCA 3SOCA 3DPKA 4J96A 5F95A 3PIXA 2VGPA 5IH6A 2C6MA 2YCRA 1CMKE 5I9ZA 4Z9LA 3U51A 4U81A 4HGLA 3SDJA 4I0RA 3TIZA 1F3MC 4PNKA 4ZLOA 5IZFA 5IA3A 4D1XA 2B4SB 3R2BA 3TACA 4KRDA 4LRKA 1Q3DA 5KBRA 3U9CA 4DEDA 5LVLA 4QMQA 3QYWA 3P08A 5AJQA 2X9EA 3CPBA 4MF1A 2DWBA 5AP4A 2WMSA 2YM4A 4RC3A 3ZCLA 5AUTA 5ANGA 1H0WA 3N51A 4A9UA 5HNBA 4PPAA 4C4EA 4FT5A 4BCMA 4WNMA 4H39A 5AWMA 5CEKA 4MHAA 4TYJA 2W1FA 4DC2A 4GVJA 3F5UA 3V51A 4YZBA 5LVPA 2Y7JA 3R30A 4KBCA 3A8WA 3MV5A 4IBMA 3DKFA 5BUJA 4FTIA 3CGFA 2ZM3A 3R9HA 2BRGA 4F9BA 4OAVB 3KCFA 4FK6A 1L3RE 3ORIA 1CKIA 4J99A 2OH0E 2BR1A 5KMOA 1LP4A 5AV4A 1W84A 4KRCA 2QR7A 4F0FA 3SVVA 4FTCA 3MY1A 4OTGA 3BLRA 2BRBA 4MBIA 3K3JA 4ALUA 4NIFB 3R0TA 3UNKA 4J8MA 3KULB 3DJ7A 4ZSEA 3PXZA 4X3FB 4PX6A 4XHKB 5EOBA 2C6LA 4YLJA 3IOKA 4FKIA 3Q6UA 3QLGA 3RPVA 4F65A 5IDPA 3VUDA 3ZEWA 4ANNA 3HP5A 4CT1A 1XQZA 3DTCA 4HGEA 4IWOA 4CFXA 3EQFA 2X9FA 2A1AB 5KMIA 2UZUE 4O22A 1JPAA 1WBOA 4S30A 3OT8A 3ENMA 4N6YA 4YJVA 5J7HA 4ZLZA 3COMA 1IR3A 4ZSLA 3O8UA 2A19B 4AW0A 1UV5A 2QOLA 5HG7A 4AF3A 5HTIA 3ZZEA 4FKSA 3W16A 3CJFA 4FTLA 2BZKB 2EWAA 2WOUA 1ZAOA 1V1KA 4YHJA 3ZO4A 4CFNA 4DG3E 4Z3VA 3R73A 4R8QA 4BRXA 3DK7A 4BIDA 2HWOA 3HYHA 4QPAA 2OU7A 2UW3A 2O8YA 4U44A 5TT7A 3NNWA 4PQNA 2I0EA 2UZLA 1U54B 3KK8A 3NUYA 4ZSGA 4BVUA 3IKAA 5D9HA 3OF0A 2UW8A 2EUFB 1H8FA 3R7OA 4CCUA 5I9WA 3MA3A 3BELA 4G2FA 3W55A 4ASEA 5HVJA 1JWHA 3FZ1A 5FDXA 4DAWA 1BLXA 4E7WA 3F5XA 4AT4A 4O0UA 2WOTA 2OXXA 3ETAA 4C0TA 3VS3A 4ERWA 2YCFA 2Y4IB 3CGOA 3QL8A 5AR4A 4F9WA 4DEBA 5J7BA 1UWJA 3AC8A 1FMOE 2ETMA 3H0ZA 3IS5A 3ROYA 4IFGA 4XG2A 1J91A 1WBVA 2V62A 4I4EA 4JBOA 4LUDA 4RPVA 4B99A 4F63A 5ITAA 2P4IA 4YZCA 2QO2A 2C5XA 5CNNA 3BLHA 3PJ3A 4QP1A 5E90A 3HNGA 2W7XA 3QD3A 3UBDA 3G0FA 4E73A 5CU4A 2GQGA 4N4SA 4FTNA 3BBTB 1OL2A 4OTDA 4P2KA 3TCPA 4ZZMA 1VEBA 5LCKA 3KRJA 3VBXA 2VU3A 4ITIA 5FEQA 3ZDUA 3DDPA 3GC0A 3KGAA 3SV0A 5D12A 4E4NA 1AQ1A 3OT3A 4R3RA 3ITZA 3PVWA 2V7AA 3TUBA 5CAUA 5D41A 3KRXA 4Y5HA 5A54A 3DNEA 4IADA 3BE2A 5AR2A 5JKGA 3GB2A 3KCKA 1OUYA 2ACXA 3LIJA 4RX7A 4PMPA 1YDRE 3WZUA 2NO3A 4RVMA 4G5JA 5BQ0A 2Z7SA 4NCTC 1XKKA 3KQ7A 4QP4A 5AEPA 1YWNA 3AD5A 4CMTA 3EKNA 1XWSA 2BILB 3DKCA 4IXPA 4QNYA 3FQHA 2FSMX 4YC6A 2ESMA 1PMVA 4FV9A 3SW4A 4TL0A 5HIEA 5DT3A 2A0CX 1B38A 3FHRA 5AV1A 4BTKA 4E20A 2PMIA 3GVUA 3SHEA 5HO7A 1MQBA 1W8CA 4FL1A 4XP0A 3VBYA 2JIUA 5M4CA 4FYNA 4U0IA 4JX7A 4YC3A 3QCQA 3TNWA 2J5FA 5LVOA 3HUBA 2VTAA 4RZVA 4W9WA 2BFXA 4ZP5A 4AOJA 4M14A 4EUTA 3FLNC 3MPAA 3NAYA 4HCUA 3II5A 4JS8A 4E1ZA 4BBEA 4F70A 5AP7A 3SC1A 4GK3A 5IA0A 3TEIA 4DFYA 3VUHA 4O21A 3OY3A 4AU8A 3I0QA 4QQJA 3RCDA 1CTPE 2LAVA 4L9IA 4G16A 3TV7A 4S33A 3BCEA 2WQOA 3C0HA 4K18A 4CZYB 3M11A 5ACBC 1ZWSA 2F7EE 4FKVA 4NEUA 5I0BA 2PWLA 5CANA 2CCIA 3OW4A 4AUAA 2Y9QA 1GOLA 4L46A 3VBVA 2YFXA 3PXYA 5HU3A 2XNMA 3QTZA 2HIWA 3NEWA 3L9PA 1UWHA 4CLIA 5IH4A 2WTVA 2YJSA 5ANDA 3FMHA 3LFQA 4FSQA 4FUXA 4O1PA 4F99A 2RIOA 4ZS0A 2GS6A 4L3JA 2OWBA 1XH7A 3ET7A 4KB8A 3PXRA 2IVVA 3Q6WA 1IASA 4ZJVA 4BI0A 3AQVA 4RA4A 3OXTA 5I9UA 3SAYA 5BYYA 4V04A 3I79A 4F7NA 3LFDA 3ZFXA 4F1OA 1YHSA 4Z55A 4FZDB 4JQ8A 1KE8A 2ZV7A 2GCDA 2KTYA 4U8ZA 1TKIA 5CSPA 4C4IA 1Z57A 4I92A 3MJ2A 4U45A 4FNYA 2CKEA 2QQ7A 4GRBA 3RKBA 2GHMA 3E64A 5HIBA 3CQUA 5E8UA 1Q8UA 2BHEA 4PTEA 5DG5A 2WAJA 2W06A 5JSMA 4WKQA 2HENA 3MFSA 3UMWA 3UVPA 1BI7A 4XV9A 5K4IA 3GT8A 4D0XA 4RQKA 3R9DA 5D7AA 4ZSAA 1M2QA 4GFMA 4EOOA 4O0SA 1REKA 3MN3A 2ZB0A 4UX9A 2X7FA 4HCTA 3VQUA 2XB7A 4QP2A 3F3ZA 4HVDA 2WMUA 2X8EA 1H1RA 2X7GA 2JITA 1O6LA 4DG0E 3FXWA 5HTBA 3CQWA 4IJ9A 2C47A 5HCYA 2YIQA 4G3FA 3BE9A 2C6KA 4L53A 3GP0A 3TKUA 3C13A 3R7VA 3DA6A 1LEZA 2IZSA 2QOBA 5E1EA 4EEVA 2FYSA 4KBAA 4YJOA 2X39A 2C5VA 4PPBA 3O0GA 4XH6A 4E5BA 4BDCA 3D7ZA 2IW6A 3WI6A 4C4HA 4BHNA 4I5PA 5KMJA 3KKVA 4NM5A 4FIGA 2XMYA 4CQEA 5DVRA 4G9RA 3R8ZA 4NCTA 3CEKA 4KIPA 3TZ8A 2BHHA 3C4ZA 2E9VA 1H26A 2XNBA 2PZRA 2Y8OA 3G6GA 4NT4A 4O6EA 3FMKA 2F2UA 3UO6A 5HX6A 4IAFA 4TYEA 5EK7A 3O7LB 4GUBA 3GQLA 4WUAA 3CS9A 5IKWA 1Q41A 4AN3A 4GJ2A 2GNIA 5IMEA 4JIAA 3QTIA 2BTRA 2VX3A 4I41A 3SRVA 3FC2A 1UU3A 2XK7A 3MH0A 3MY5A 4X2NA 2E9OA 3IW5A 2GHLA 3F9NA 3G90X 3P7AA 3D2IA 1Q4LA 4BIBA 3TG1A 2VTIA 3VAPA 4IVDA 3WYYA 3E3BX 2PE0A 1Z5MA 5KZ0A 5BMSA 3O7LD 4Q9SA 3W33A 4AA5A 3QD4A 5I4NA 3HZTA 4D4SA 3W2RA 1MUOA 2C0TA 1TQPA 5DR6A 2OXYA 3DTWA 3K3IA 4I1ZA 4JG7A 3F2NA 3F7ZA 2WFYA 4JQ7A 4LUEA 5LJJA 4WA9A 3V04A 5DI1A 2XIXA 3F2AA 5FXRA 5CTPA 3SXRA 2BTSA 3C5UA 1MP8A 4AGUA 1ZYSA 3OBJA 4DFXE 4J71A 5CU2A 3ANRA 3DQWA 4ZTMA 5BVOA 5TKDA 2R4BA 4L3PA 2Y6OA 5C26A 4ACCA 3GENA 4QP3A 4TWPA 4CRSA 5D7VA 1QPEA 1ZZLA 2XNGA 4R7IA 1QCFA 2XUUA 2GU8A 3OBGA 5HE3A 3TZ7A 4NSTA 4CZTA 3L9MA 3KF4A 5ANJA 2GTMA 5KCVA 3E8EA 4WT6A 4HW7A 5AX9A 1P14A 5DRDA 4UALA 4AT5A 4D2TA 3RAKA 1WBNA 3VRZA 1NY3A 2W1DA 4KAOA 5CSHA 2Z8CA 2H6DA 4D1SA 2P55A 4G3CA 3A7JA 1ZZ2A 2NRUA 5HG8A 5CVGA 3VN9A 1QMZA 3E7OA 4E6QA 2I6LA 4XYFA 3A99A 4K1BA 4PL4A 4UZDA 1H25A 5A3XA 3PZEA 2VD5A 2W1EA 2E9UA 5J9LA 3D9VA 3TJDA 2JDOA 4D58A 3H9FA 5ANEA 5GZAA 2OIQA 3G5DA 4FL2A 3RINA 4LM5A 4IE9A 1OECA 2YM5A 3GCPA 4YNOA 2PTKA 4M7IA 4A9TA 4BDAA 3Q04A 3SA0A 4DH1A 4H3QA 3FMEA 2NPQA 3QYZA 3FE3A 2BPMA 2JEDA 5ANOA 2XIYA 5BUEA 5DOSA 4AOIA 4X2KA 3GFEA 3QALE 3QCYA 4IH8A 4ANOA 4RX5A 4DTKA 4DEHA 3MVLA 4FUYA 3UG2A 4EK3A 1DI9A 4GT5A 5AR8A 2UVXA 3PFQA 5ANIA 2ITVA 3ZBXA 3BEGA 4FKOA 2P2HA 2R3HA 4CVAA 4U3YA 2ZV9A 3L8XA 5EDRA 5AUXA 3FV8A 1NA7A 4LG4A 3E63A 3QC9A 3SRVB 4AAAA 4CLJA 4MH7A 4MNFA 4DEEA 5LQFA 3PY1A 3UP2A 3HMMA 2QI8A 2OIDA 1FVVA 3NYNA 5TF9A 4QYFA 3IOPA 1PJKA 5A4EA 2B54A 3E88A 4FV8A 1YI6A 5BNJA 2ZAZA 3Q9WA 4M12A 2P2IA 3UC3A 3D94A 5C03A 5HO6A 3VS6A 3D5UA 2RSVA 2BROA 3NIEA 5EM7A 1Y8YA 4YTHA 3OMVA 5I3OA 4LL5A 5H8BA 2YEXA 5FRIA 4Q5EA 5HZNA 4EC8A 3EN9A 3LW0A 1KE5A 3ZO1A 2GMXA 1S9IA 3LJ2A 3QGYA 4IAZA 4G6OA 2YDJA 4F6WA 2ETRA 4JXFA 1RQQA 3VUMA 3KRRA 5AMNA 4DH5A 2G01A 2VO0A 4QP9A 4YSMA 1H28A 3NWWA 4CMUA 4UMUA 5M4IA 2CN8A 3O71A 3NYXA 2CGVA 2FA2A 3UC4A 4BDDA 1MRYA 5AAFA 2BIKB 3CD3A 3I81A 4NW6A 3GOKA 2RG6A 4HYSA 4AP7A 4CFFA 5T6KA 3UIUA 1WVXA 3FSFA 5H8EA 2R0IA 4RT7A 2ZMDA 4FV7A 4BZDA 3EQPA 4IX6A 1YXSA 1KSWA 3TKHA 4JI9A 3FMLA 2WEIA 5DNRA 5JRSA 5CU3A 3IDBA 5HG5A 1I09A 4JR3A 3FKLA 4K33A 3S1HA 3OROA 2VO7A 3ZS5A 1OL7A 3TJCA 5DFPA 5IUGA 3OWJA 5AP2A 2YWPA 3NUPA 2VNWA 3LCDA 3LVPA 1ATPE 2UZDA 1O6YA 1NXKA 4L00A 5FWKK 3TN8A 4AZEA 5HVYA 4AGDA 2VNYA 2HZ4A 3VJNA 2BVAA 2I0YA 4V0GA 4BZNA 4C61A 1GAGA 4D28A 3L9LA 1J1BA 4XG9A 4F64A 4ZZNA 2ITUA 1JSTA 3PTGA 4FF8A 4RJ8A 4XV1A 3EMGA 4MKCA 3TTIA 3TTJA 1OI9A 1YOJA 4L6QA 5EOLA 3A8XA 5KMNA 1PF8A 4RC4A 1RW8A 3NSZA 1OMWA 3WF6A 2B52A 4GEOA 4FVQA 4UY9A 2XRUA 3EIDA 4R3CA 4Y8DA 5FXQA 4ID7A 2CDZA 1BUHA 1SNXA 1XH4A 1B6CB 4WG5A 3VHEA 3BHVA 4MXXA 5C9CA 4D4YA 4I21A 2PZ5A 4CTCA 4DITA 4HVSA 3ZDIA 3AMYA 2CLQA 4MYGA 4FMQA 2WMBA 2AUHA 4R5SA 4C62A 4YLKA 3BIZA 4U6RA 5HLWA 5KKRC 3PYYA 4AXAA 2W9FB 3DBQA 3OCSA 5CF4A 3P0MA 1UKIA 4IHPA 4ANBA 3S4QA 4L01A 3ZEPA 3VS1A 2GNFA 3OWLA 2JKQA 2OGVA 4S31A 4L67A 5KZIA 2GNGA 2HCKA 2HY81 3MPTA 3QZIA 2R3GA 1BMKA 3OUNB 4FTRA 4ZY5A 3HMOA 4JDHA 5E8SA 4MD9E 2VWWA 2R3PA 1JSVA 3VW8A 3WZEA 3Q5ZA 5JN2A 2OICA 3Q4CA 2WMRA 2PVFA 1W7HA 4IAIA 3LZBA 4MBLA 3Q96A 1YXVA 5DN3A 3UIMA 4EOMA 2UUEA 3LCTA 4IC8A 1ERKA 3HLLA 4TXCA 4WO5A 5G6VA 2O3PA 3K54A 3EQRA 3Q52A 4C4FA 4M0YA 4NUSA 4RIOA 4XP3A 3ZTXA 5LVMA 3WF5A 4RIWA 2NP8A 4OBOA 2V55A 2PVLA 3R9NA 4C37A 5IH5A 4YHTA 4C3RA 2QURA 5D10A 1Y91A 3VIDA 3LFFA 4X2JA 2PVNA 4FSUA 2QO9A 3BGQA 4FIJA 3E3PA 4G3GA 3BBWA 2OBJA 4XV2A 1PW2A 2I1MA 3PPZA 1FVRA 3E8CA 1DS5A 3D7TA 4EHVA 2A2AA 1SZMA 4FSRA 2P0CA 3CXWA 4J1RA 4UYAA 4GU6A 3R8VA 2WU7A 4DHFA 4QMNA 3FZRA 4MVFA 3EB0A 3QLFA 5B2KA 2BALA 4E5AX 1ZARA 5CY3A 4IZAA 4M67A 3GFWA 4V0GB 4USDA 4AA0A 5HVKA 5HOAA 3WOWA 3POZA 3R6XA 3DU8A 2CLXA 3AMAA 2XJ2A 5GZ9A 1OIUA 2JAMA 3VF8A 5GZ8A 4GIHA 4JBPA 1YWVA 4QYHA 4FV6A 4RVKA 1QPJA 4LV8A 1JNKA 3KY2A 1V0BA 4Y83A 1S9JA 3I7BA 3MIAA 3FI3A 4M0ZA 5CX9A 3Q4TA 3QUDA 4J8NA 3V6SA 3KN5A 3UPXA 2XKFA 3C4EA 3LXNA 5D1JA 1YOMA 2IWIA 4YJQA 3A4PA 1OKVA 3UOHA 1OPLA 3GCSA 2Z7RA 3PSCA 2JD5A 4ZTHA 4XX9A 4M84A 4DH8A 3EHAA 3JVRA 4ZTLA 4WNOA 1KV2A 2XCHA 4RFMA 4W8DA 5C1QB 4RIYB 5HD7A 4RJ6A 3PY3A 3OHTA 3TV4A 2O65A 3QC4A 3NYVA 3L9NA 2OFUA 4RRVA 3RNIA 3DKOA 2VWXA 3RMFA 4MQ1A 3BEAA 2X4FA 5IMXA 4PTGA 4NM7A 2JGZA 4NU1A 4TTHB 2YA9A 4Z7HA 5AM7A 4MAOA 4BTFA 4FOCA 5H8GA 3VULA 4OLIA 4HVGA 4IX4A 1SVHA 1UA2A 4D2SA 4TWCA 4TYHA 2JDTA 2QKRA 3MI9A 4JDKA 2ZOQA 4PL3A 1QPCA 4E8AA 4IIRA 4EWQA 4MEDA 4FZ7A 2X1NA 4P5ZA 4NTSA 4QQCA 3FJQE 3POOA 5CT0A 1U5QA 5CZHA 5J87A 1LPUA 2VAGA 3OOGA 2HOGA 3R8LA 2RG5A 4BCIA 4X3JA 4BN1A 5AM6A 2GS2A 3RAHA 4RWLA 3CC6A 4QTBA
chains in the Genus database with same CATH superfamily
4D2WA 3UNJA 4RIXA 5BVWA 2VTMA 4MBJA 3FYJX 3U6JA 3RP9A 3HA8A 3W1FA 3DBFA 4PMTA 4C34A 4DLIA 2DS1A 1CSNA 1IRKA 3D7TB 3PG3A 2EXEA 3D2KA 5FP5A 4BCJA 3W2QA 4P90A 2UW9A 4XV3A 4WNPA 3H4JA 1YHWA 2RFDA 3C4XA 3I5ZA 3RK5A 3V6RA 4DLJA 2WTWA 4V05A 3OCBA 5L2QA 5M55A 4AZVA 4CRLA 2YZAA 1Q8WA 3BGZA 3DV3A 4FZAB 4D0WA 2XNNA 2J90A 1CDKA 3PJCA 4FKTA 4O0WA 3VF9A 5CEOA 3A7FA 4QD6A 4AX8A 4Y5QA 2XM9A 3D5XA 4G17A 3FI4A 4QYEA 4A7CA 5I5ZA 3IONA 3COIA 5IDNA 5AUUA 5HIDA 4B8MA 4CMOA 4GU9A 3TI1A 4F7LA 4RBLA 4GK4A 2XNEA 3QCSA 4UB7A 4BCGA 5EYCA 5BVEA 4MQ2A 3U87A 3TXOA 2C5NA 2XNOA 1X8BA 2EXCX 5HG9A 4A9SA 4IAAA 1ZYCA 2UZNA 2XK3A 4JG8A 4G31A 4BCPA 3Q9ZA 1GZOA 2Z7QA 5CSWA 1XH8A 3NCGA 4ITJA 3WZJA 4GG7A 3LM0A 5J1WA 3BV2A 3DOGA 4JG6A 4C8BA 3IG7A 1RDQE 4BZOA 3QTSA 4YSJA 4FNXA 3QRKA 3GNIB 3BLQA 1YVJA 3EFJA 4NWMA 5CI6A 5L8LA 3P7BA 2XJ1A 2GNHA 2BAQA 5KNJA 3D14A 1JLUE 3GEQA 3PG1A 5HTCA 4FTKA 4W9XA 2J50A 3PVBA 3V5TA 4ZAUA 2JIVA 1ZLTA 2E9NA 3T3UA 3C4WA 3SD0A 4M97A 4AOTA 5JT2A 4UMTA 3QBNA 5BX0A 3PY0A 2BKZA 4YO4A 4O2ZA 1UNLA 1YXUA 3LFNA 1FINA 2X4ZA 3VHKA 4APCA 5LVNA 3FY0A 4Y46A 1ZMWA 2PZIA 3QHWA 4TYHB 1JKTA 2PVHA 3P78A 5HHWA 2WHBA 3ZRKA 4RWJA 4U79A 5KKRB 3FBVA 4FTMA 3R7YA 4HGTA 4LI5A 3ZMMA 3K5UA 2OF4A 4XG7A 2VTSA 2WELA 3FZOA 2QVSE 4DEIA 2CMWA 4GT3A 4IZYA 4ASDA 2WMXA 3QQFA 3M42A 5L6WL 3EZRA 2QHMA 2YHVA 3P7CA 2H8HA 4EOIA 5M56A 3RTPA 4FODA 1REJA 1WBPA 3ODZX 4JX3A 2O64A 2C6TA 2ZDTA 4RLLA 1R3CA 1UNGA 3HX4A 1OZ1A 2X6DA 3ZXZA 3LFAA 2PSQA 3LFSA 3NW5A 4HZRA 5K0KA 3JS2A 4BDFA 5KMMA 5M53A 2OI4X 2P3GX 2E2BA 4FZ6A 4U97A 1JSUA 3V5JA 3OZ6A 5A6OA 4E4MA 2ETKA 4TNDA 2B1PA 2YITA 2UZTA 3LLTA 4N6ZA 5E91A 2HYYA 1J1CA 4O6LA 4FIEA 2F9GA 3DNDA 3RZBA 3W8QA 1Y6BA 3BHHA 3QRUA 3FPQA 3ZFMA 5IISA 2UZBA 4FYOA 4D9UA 2PVJA 4CFUA 2ZB1A 2WQNA 4FG8A 3RWPA 4H36A 3DCVA 1JKKA 5AIRA 2VRXA 3FMNA 4D2PA 4F9YA 5ICPA 5CALA 4JDJA 3HDMA 3R71A 4FTUA 4HNIA 5CQUA 4YPDA 3C9WA 3W18A 4QTCA 2QC6A 5AP6A 5GJFA 5LARA 4GS6A 5HLPA 4IX3A 5CI7A 3W2CA 2ONLC 4IWDA 3FZPA 4TZRA 4IVBA 5AUWA 4WRSA 4FV3A 1SVGA 3C0IA 4JT3A 2VO6A 3AC4A 4FV4A 4ACDA 3EFWA 3GU4A 1M14A 3TNPC 3COHA 1W2DA 3P23A 3RPSA 2V22A 2J0IA 2W9ZB 3RGFA 3VS4A 4EOSA 4EHEA 3NNUA 5A6NA 3NNXA 2IZUA 3EYGA 3CTQA 3C4CA 4BYIA 3TL8A 3CR0A 3QUEA 4F7JA 2R3KA 4XRLA 3G51A 5J79A 4EQMA 3T3VA 3ACKA 3CPCA 2PUUA 4RFZA 4IX5A 4TYIA 4BWKA 3DLZA 3HEGA 5DR9A 4EOLA 3AMBA 5EM6A 5JFWA 1SNUA 3FLQA 3QXOA 3VW6A 4HYIA 5AAEA 4O0YA 4F9CA 3NYOA 3QWKA 2QOFA 4HOKA 1DM2A 2WMWA 3C7QA 3ORLA 3QUPA 2W1GA 3PZHA 4FEQA 4TT7A 1Y8GA 4D5KA 2OH4A 3BZ3A 5CENA 3RBWA 1YDTE 4GIIA 3KF7A 3CD8A 5JFVA 3PJ1A 3WIGA 3KL8A 2ZYBA 5L6OA 5AUYA 4PRJA 2YAKA 4I94A 5KX8A 4CFMA 2G2HA 1SM2A 1HCKA 2HW7A 4M68A 3IW7A 3TNIA 3KFAA 3OY1A 4EOPA 5M44A 1PMUA 1FGKA 3NUSA 5EYDA 5HO8A 5C27A 1NVSA 4XJ0A 4C7TA 2C68A 2WPAA 3FWQA 5AX3A 5JK3A 2JDVA 4YR8A 1YI4A 2YM3A 4FSWA 2C6IA 3LQ5A 2WTJA 2X0QA 2ZVAA 2PZYA 2ITYA 2W1ZA 3NCZA 4BWPA 2R3NA 5LXMA 4QMUA 4O91A 4MXZA 2AC3A 5EI2A 2VTNA 3VUGA 3BYMA 4UYNA 4UMRA 3PJ2A 3UQFA 2C5YA 3EQDA 3W8LA 2YIRA 4LGGA 2X6EA 4MXAA 1J3HA 4AT3A 3UIXA 3U6IA 1U4DA 5HBEA 3SX9A 2R64A 5KHXA 2YN8A 4Y95A 3A61A 3TWJA 3PPKA 1H08A 4G6NA 2QLQA 2FVDA 5ETAA 2R3FA 5IA1A 3CQEA 5CEQA 3UPZA 4F9AA 4FA2A 4KA3A 2VN9A 3GOPA 3RPRA 4HNFA 4WBOA 5F1ZA 3RWQA 4OBPA 1B39A 1P5EA 3FAAA 1YXTA 4OTQA 5HNIX 4IDVA 3MS9A 3IO7A 2GSFA 4A4OA 3QAME 3OXIA 4AW5A 3EQBA 4CKJA 3ZC6A 5HU9A 4H58A 5HQ0A 1K9AA 3HECA 2CPKE 4D5HA 4LGHA 2G15A 5JEBA 5L2SA 4OT6A 3WZDA 4BKYA 4JOAA 5FGKA 4JNWA 5AP5A 3CBLA 3FI2A 1RE8A 3HP2A 4I6HA 5EW3A 3VS0A 4FL3A 3MWUA 3MBLA 3NDMA 5HX8A 3QTXA 3PVUA 2W4KA 1FQ1B 4FIIA 5EI8A 4H1MA 3OVVA 1Y6AA 4MK0A 4CT2A 3HV5A 4BGHA 4PDSA 1W82A 1H4LA 4TRLA 4FTAA 3EQIA 4I0TA 2IVTA 5LWNA 4CKIA 4U7ZA 2IW8A 4UMPA 3KRLA 4GMYA 2R5TA 2WTIA 4RLKA 3O17A 4EH4A 2J0MB 2Z7LA 4FV5A 1OM1A 2UW6A 4F1MA 2ONLA 2J4ZA 3HKOA 4BBFA 2BZJA 3UZPA 4EH6A 3GU6A 3G33A 4JL9A 3UODA 3HV4A 4XG8A 4WSYA 2QOQA 4GH2A 2HW6A 2GNLA 3IW4A 3VUKA 2GHGA 2PHKA 4RJ5A 1MRUA 4QOXA 5J95A 4E6AA 2ERKA 2XZSA 4TNBA 4MD7E 1YW2A 2C3LA 1A9UA 4O0TA 5JZJA 3EQGA 5JQ5A 3W2PA 3BU3A 4K11A 5AR5A 3R7IA 3GUBA 3JYAA 5DEYA 4ZTRA 4AWIA 2W1CA 5T3QA 4IWPA 2OJIA 2VGOA 1GZKA 1H01A 2OZAA 3FKOA 5AA9A 3RK7A 2IVUA 1PKGA 4GFOA 5ETFA 1ZYLA 3CJGA 5DEWA 3MIYA 3WF9A 3DFAA 2V0DA 3FC1X 4GV1A 2CHLA 5IF1A 3UDBA 2J0JA 2DQ7X 2VWBA 4EH7A 3F5GA 3RJCA 3VS5A 1ZY4A 5CAPA 3L8VA 1OGUA 3DY7A 3UNZA 3MPMA 3P1AA 3F3WA 3D5WA 4EHZA 1VJYA 2WIPA 2XKDA 3MFUA 3ZM4A 3UOLA 4XBUA 1PXOA 4ZTNA 2VTTA 4GT4A 5JRQA 1JQHA 5A14A 2X8IA 4C2VA 5HEZA 3DB6A 4FV2A 4QNAA 2BFYA 1JOWB 4RVLA 4AACA 5AP0A 4IB5A 4AFEA 2YIXA 5CWZA 4ZJIA 4GJ3A 2P33A 2OFVA 4YJSA 5IA4A 1GIJA 3LJ1A 4U40A 2V7OA 2QOHA 3G9NA 5KMKA 3PSBA 1FPUA 2PVKA 3BX5A 3QKMA 4AFJA 2C6DA 4OTRA 2X7OA 1PXKA 3DK3A 2LGCA 3O8TA 2XVDA 4B7TA 3Q53A 1H1PA 4K9YA 2C69A 3S95A 1A06A 4FIHA 3CKXA 3DK6A 4CV9A 3A2CA 4NM0A 1TQMA 4LOPA 1Q24A 5I9VA 1O6KA 3G2FA 3MVMA 4YBJA 4CFVA 1FGIA 1YKRA 3QZHA 3WIKA 3GCVA 2CJMA 4IMYA 1P2AA 4GW8A 5J8IA 1LUFA 4KKHA 5C01A 4RWIA 5EG3A 1XHAA 1GZNA 3F66A 2RGPA 5IUIA 4FV0A 2EU9A 3PSDA 4I3ZA 4C59A 4PMSA 5EDQA 3HMPA 5IEYA 1IEPA 2RKUA 5E8TA 3R7EA 4P5QA 3RI1A 3EFLA 4OW8A 3BWFA 2B9JA 2BMCA 3F3VA 5HD4A 2XRWA 4DFNA 3A7GA 3RM6A 4YMJA 2XK9A 1HOWA 4CQGA 5FM3A 1PYXA 1UNHA 4OTFA 5JGDA 5BVKA 5HLNA 5CF6A 3F88A 1K2PA 4C38A 1Z9XA 3FZTA 3EN6A 4BDGA 3QU0A 4CFWA 2QD9A 3JUHA 4YP8A 3UIBA 4QMTA 1VYWA 4CXAA 3TUCA 2QONA 3PWYA 3V5QA 4CTBA 4YUQA 4WG4A 4EYMA 2ITPA 1Q3WA 2WMAA 2VV9A 4HYHA 4UWYA 2CGXA 2JLDA 3ACJA 4O4DA 2WU6A 1XR1A 2HZNA 2PK9A 3BI6A 3O50A 5HE1A 2HZ0A 3A60A 4XLVA 4EZ5A 1MQ4A 2QCSA 4J7BA 4HYUA 2JAVA 3H30A 4YPSA 4X2FA 4WG3A 4O38A 2OZAB 2YACA 2F49A 4FZFB 4MX9A 1E9HA 3JPVA 3EN5A 3QA0A 5HCZA 4ZK5A 4JBVA 4IB0A 3F3UA 4KD1A 5AAGA 1YQJA 3TKIA 4CEGA 3RNYA 4NJ3A 5FEDA 4BYJA 1M7QA 4FT0A 3DDQA 4N70A 5C8MA 2AYPA 3RK9A 3FHIA 3JXWA 2OKRA 5CQWA 3ORTA 4CKRA 4PF4A 3OXZA 2OF2A 4O4BB 3VS7A 4JAIA 4B0GA 2WMVA 4I22A 5DGZA 4EH2A 4QMZA 4JIKA 4YURA 4TWNA 4ZTSA 1H1QA 1U46A 2WTCA 2ITOA 4ENYA 3H10A 2VX0A 1YWRA 2R7IA 3VNTA 4EK8A 4L7SA 3MA6A 3P9JA 4DH7A 4BC6A 1AGWA 4F7SA 5CXZA 1ZOEA 3D15A 4RSSA 4EH9A 2IO6A 3I0OA 2W1IA 4QP8A 4EORA 3UYTA 3VUTA 3OP5A 5BMMA 3WBLA 2YM7A 2O2UA 5A4TA 4TN6A 3EQCA 3S2PA 1OL6A 4RGJA 4FKLA 3PA4A 4A4XA 4ZZOA 3HUCA 4DN5A 4KIOA 4FNWA 5A4QA 4CV8A 4OTWA 3KXGA 4KABA 1MRVA 4PMMA 2VWZA 1UVRA 2OJJA 2XEYA 3IDPA 3JY0A 4BICA 4U9AA 2IZRA 2I40A 4AN2A 4C58A 4WSQA 2ITXA 4ASXA 4ITHA 5FBNC 5B0XA 3V5LA 3H9OA 3GU7A 5EYMA 1V0OA 3KXMA 4EUUA 1OL5A 1ZRZA 4S2ZA 4FKRA 4C02A 2B7AA 3R1NA 4DGNA 4C33A 2HK5A 3CCNA 5BVNA 1Q62A 3LCKA 4ZY4A 3BPRA 3CTHA 4R6VA 2VTPA 2W1HA 3LFEA 3OUKA 3UO4A 4A9YA 2BDFA 3ORXA 3BGPA 1TQIA 5G1XA 1H24A 4BI2A 3B8RA 4YJNA 1OKWA 3FXXA 2BUJA 2YCQA 3V8WA 5K5NA 4H3BA 4NZWB 3DJ5A 3E5AA 4RZWA 1ZXEA 1KWPA 4FK3A 2W5HA 3OEZA 4R5YA 2BAJA 2PY3A 1GJOA 3FMDA 4W4XA 4F6SA 5BVFA 4FT7A 4FT3A 2OO8X 4GSBA 4J97A 2IVSA 2X0GA 3R63A 2UV2A 5KO1A 5EKNA 3A7HA 5FLFA 4EBWA 3AC3A 5DLSA 4IM2A 3R8UA 4WUNA 3C4FA 3RPYA 3RAIA 3FQEA 3R8MA 4PL5A 2PL0A 2CGWA 4C4GA 2WEVA 5GJDA 2FUMA 3MY0A 3BV3A 3ULIA 4OT5A 1P4OA 4Q9ZA 1STCE 4M3QA 4RQVA 3BHYA 4JBQA 4QPSA 5K3YA 4BDBA 1PYEA 4RJ3A 3AGLA 4RJ4A 4CYJA 3DBDA 2XK8A 4QMVA 2XNPA 2ZM1A 5AUZA 3ANQA 3R7GA 3U6HA 1PY5A 1UU7A 3UQGA 1FOTA 3CP9A 4EOQA 4E26A 4U43A 4B4LA 3QWJA 2ZV8A 3AC5A 5M4UA 3LCOA 2QKWB 3EFKA 4HPUE 3T9TA 4YTFA 1BX6A 3NS9A 4KINA 1T45A 2B9FA 1ZOGA 4I24A 4BCFA 5BYZA 3OFMA 2F7ZE 4LYNA 4QRCA 1PMEA 4D9TA 3NRMA 2ITNA 4YJTA 3SQQA 3WILA 4QQ5A 4D4RA 1OKZA 1Y57A 1YOLA 4MNEA 4UXQA 2GTNA 2W99B 4RJ7A 3WE4A 4BCQA 4QTEA 5AR3A 4AZTA 3ULZA 2X81A 5CSVA 3VBQA 5KE0A 4AN9A 3BHTA 1XJDA 3EL7A 1JVPP 4JAJA 3DBCA 4FKGA 4ONAA 4YZDA 2C30A 3PPJA 1LR4A 3C50A 4BHZA 2WGJA 4I6BA 4NK9A 4LFIA 1M7NA 4IC7A 1EH4A 4YGAA 3IDCA 3RAWA 5KUPA 3KMWA 5AV0A 3HL7A 4IACA 3O8PA 4AS0A 2YERA 4XEYA 3EL8A 2RFNA 3LXKA 3QFVA 4G3DA 3MYGA 2PE1A 4FR4A 5FQDC 2XIKA 3EYHA 1JAMA 2EB3A 3DQXA 3Q4ZA 4TY1A 2DYLA 5H2UA 3VO3A 4WHZA 3Q4UA 3DKGA 2UZOA 5K5XA 4WD5A 3WE8A 5JMSA 3SOAA 2B9IA 2W0JA 4IB1A 3HV3A 5CS6A 3FXZA 4DGGA 2HZIA 3ZO3A 4ENXA 3QKKA 4XOYA 5E8VA 3O2MA 2XM8A 4U3ZA 5AIKA 4GYIA 3KULA 3A7IA 5EHLA 3KVXA 4MF0A 5HORA 2BAKA 4F1TA 4TKSA 4QMXA 1JKLA 4TWOA 4GUEA 1ZOHA 1DI8A 2XYNA 4FICA 3QRIA 4I6FA 4V01A 2IJMA 2JKMA 1G5SA 3NW6A 1TVOA 3CLYA 3JVSA 5H3QA 4G5PA 3HA6A 4M15A 4W4VA 4YZMA 2BRMA 4YU2A 3OOMA 1Q8YA 2WNTA 4L7FA 2J0KA 3UO5A 4YJPA 4CCBA 2X2MA 2YDIA 3Q9XA 4FTTA 1SVEA 2G2FA 2YIYA 3V8SA 4EYJA 2CCHA 4BDHA 4XUFA 4AZFA 4AZSA 2O0UA 2GS7A 5L2IA 3RHKA 3P86A 2VZ6A 3MGYA 4NTTA 2BRHA 3C51A 3D5VA 3UOKA 2C0IA 4O1OA 2QOOA 3D83A 3IGGA 4FSNA 3AD6A 2UZVA 2WD1A 4I5CA 1UKHA 5FTOA 3VWAA 1GZ8A 3I6WA 4KBKA 4IVCA 3FLSA 4L52A 4PTCA 1W2CA 4PUZA 3M1SA 4OBQA 2A27A 1FMKA 3GBZA 3DJ6A 5EDPA 4HVIA 4LRJA 1WZYA 3PE2A 4RA5A 4GYGA 3TNHA 4RIWB 4MXOA 1FVTA 4HZSA 3ZONA 4XG4A 5EM8A 2YJRA 3M2WA 3DZOA 2R3RA 5DRBA 4C35A 4IZ7A 4KIQA 2WQEA 4C36A 3UVRA 3Q60A 4P7EA 3OTUA 3H0YA 4UEUA 4U42A 5T68A 4XP2A 4MNEB 4FX3A 4C57A 4AGWA 4JLCA 3ORPA 4EZ3A 4FKJA 4IVAA 2HXLA 4CZUA 1OITA 2C1AA 1OVEA 3ZYAA 1XBBA 4AQCA 5BPYA 2BCJA 3EWHA 5IPJA 4M66A 3R00A 3QQUA 4BDKA 2C3IB 3PXKA 3F7WA 1F0QA 1XBCA 2F7XE 5AADA 2RFEA 3NX8A 4IW0A 4C4JA 3H3CA 1YI3A 5KMLA 1KOAA 1BL7A 3G9LX 5A4CA 3EKKA 1H00A 4ALVA 3PRIA 4Q2AA 4QMOA 1UU8A 4TW9A 2CSNA 3NAXA 4M13A 2W5BA 4ZLYA 3Q3BA 4TYGA 3I4BA 4A4LA 4IWQA 4ZSJA 1XH5A 4BDJA 2WTDA 3KXZA 4L45A 5CF5A 3BWJA 5DWRA 2XK4A 4QMSA 5FG8A 2V5QA 2C1BA 3Q2MA 3U8WA 3ZRMA 2VWYA 3DFCB 3QQKA 4DGLC 2YM8A 4RC2A 3AD4A 3KU2A 4XBRA 3W10A 2B9HA 4DGOA 2YABA 4FT9A 4A07A 5E8ZA 4AW1A 1OPKA 5KBQA 2WIHA 4RX8A 4ANLA 4BGQA 2WQMA 3HVCA 4YHFA 4HCVA 1ZMUA 5L8JA 1YDSE 4ZOGA 5I9YA 3P4KA 2ITTA 5ETIA 4AZWA 1Q5KA 4E4XA 2W5AA 3R02A 3BHUA 5FEEA 3R83A 4I6QA 4QTDA 3QQJA 4DINA 3FPMA 3I5NA 2RL5A 1XH6A 2XK6A 4BGGA 2Q0BA 4ZTQA 2F57A 4LMNA 3ALOA 1PXMA 5HBJA 1PXIA 2H34A 2QOCA 2X2LA 1R39A 5LMBA 2C3KA 1H1SA 4X2GA 3FLYA 4E6DA 3ZC5A 1SMHA 5JH6A 2WZJA 4K2RA 3HDNA 3DLSA 4K77A 3L8PA 4FV1A 4FKUA 3MDYA 4KKEA 4O0RA 4FNZA 4I93A 3V5PA 5IG1A 2PVMA 4PDOA 3U4WA 1APME 3HV6A 2WB8A 3BYSA 5L2TA 3S3IA 4LRMA 1T46A 2YISA 5BUIA 3EQHA 3ELJA 3OS3A 3S0OA 4EK5A 2Y6MA 3MVJA 3BYOA 3PA5A 3R2YA 4ZJJA 4RIXB 2ERZE 1VYZA 4EI4A 1WBWA 5EH0A 1Q8TA 3DT1A 5L6PA 3C0GA 3UJGA 3R1QA 5LMAA 2C4GA 5F94A 3ODYX 5CU0A 3LCSA 2CN5A 3CE3A 4FOBA 2O63A 4C3FA 2QOKA 2VWUA 3FSKA 3R7UA 2WO6A 2J5EA 4RMZA 5EFQA 4DG2E 2XIZA 1ZMVA 5D11A 4D2RA 3MH2A 4PWNA 3O51A 4R1YA 4USFA 3MTLA 3Q32A 3VS2A 2BIYA 4K8AA 4KIKA 3TZ9A 4BCHA 3WARA 2VTJA 1VZOA 3QZFA 2J0LA 2HELA 2B55A 4L43A 3F82A 4JVGA 2GFSA 5K0XA 3BQCA 2WTKC 3QTQA 4O27B 5JGBA 4MWIA 4F08A 2Y0AA 4BKZA 4CD0A 3NW7A 1SYKA 2ITZA 2R0UA 4CYIA 2EVAA 4JJRA 4EJNA 4F4PA 3FLZA 3QRJA 1VR2A 4FVRA 4XNEA 1H1WA 2ZJWA 4KS7A 2QU5A 2WMTA 5GHVA 5HCXA 3E62A 4GCJA 5ETCA 4E4LA 3RALA 1P4FA 1ZYJA 4QMLA 5J9YA 5E8WA 4O0VA 3KVWA 4ARKA 3TV6A 4IEBA 5EHOA 3HMIA 2VTLA 3HRCA 2C0OA 3RCJA 4IM0A 3LAUA 2A4LA 3AT3A 3VBWA 2CGUA 2FH9A 3DAEA 4JRNA 2JDRA 5FTQA 4L44A 2Y4PA 1WBSA 4UN0C 3I7CA 2PMLX 5JZNA 4XCUA 3K5VA 4IAKA 4Q5HA 3OTVA 1NVRA 1M2RA 1ZY5A 4WBBB 1M17A 3DAJA 1G3NA 4U5JA 5CZIA 4YZNA 5B2LA 4S32A 3ZUTA 4FVPA 2XF0A 4IB3A 4NKSA 4F0GA 2G1TA 2BRNA 4M69A 3ORMA 4L42A 2R3IA 1PMNA 4NFMA 1O9UA 3T9IA 2OJFE 4EH5A 4XMOA 4N0SA 3ZSIA 3IW8A 3G6HA 3BYUA 5L2WA 4E93A 3FL4A 5CT7A 3PLSA 2QR8A 4OR5A 3AOXA 3TNQB 3ZLYA 2X8DA 4ACHA 4QYGA 3OEFX 3TUDA 3COKA 2GDOA 3HRFA 3THBA 4EWHA 1DAWA 4HVHA 3PA3A 3GCUA 3W32A 2XBJA 1KE7A 4II5A 4CSVA 4O0XA 3AXWA 2QU6A 4ANQA 5JFSA 1XH9A 2OK1A 2GPHA 5B7VA 3MB7A 2Z2WA 4QYYA 1PXLA 3D4QA 1PHKA 4MTAA 4XRJA 3T8OA 3WYXA 4BTMA 3R04A 3AG9A 2H96A 3E87A 3E92A 3FDNA 3PP0A 4X6QC 4APPA 3UP7A 4BTJA 3ORNA 4NKAA 2G9XA 4L8MA 4IANA 3ZOSA 2F4JA 2XCKA 2XIRA 3DBEA 2PMNX 3P79A 4FG7A 4A06A 3NUXA 4KIKB 3KXHA 5BVDA 3NZ0A 3V3VA 1PKDA 5CEMA 1OL1A 1WVWA 3ORZA 4FTJA 3HMNA 4KWPA 5EW9A 4OTPA 4NM3A 4O4CA 3V5WA 4EOKA 1CKPA 3MSSA 3QF9A 3OW3A 3FKNA 4MCVA 4UWCA 3QHRA 2FB8A 3GI3A 1XO2B 3IW6A 4I0SA 2JBOA 4L68A 2R3MA 5F20A 1XBAA 2VTRA 2J9MA 2RF9A 4UWBA 3E8DA 4YTCA 2EXMA 2QHNA 2OIBA 2ZDUA 2R9SA 2HWPA 4UZHA 1K3AA 2UVYA 2YDKA 3ZSHA 1R0EA 2XKEA 4IM3A 2W4OA 1BL6A 4H3PA 5B2MA 2XKCA 2BZHB 2W96B 4QMMA 1E1XA 1WMKA 4PPCA 3F5PA 3LMGA 3NUNA 4R7HA 5K4JA 4I5HA 3LM5A 3ZSGA 4ZY6A 1GNGA 5A46A 3FQSA 2DUVA 3AT4A 4Y72A 4EK4A 1Q8ZA 5F9EA 4EZ7A 3FY2A 3UGCA 5TOZA 2HY0A 4GL9A 2WKMA 5HBHA 4LMUA 2PVYA 1OIYA 3PVGA 2FSTX 3VUIA 2XYUA 4DBNA 1OKYA 2ITQA 5LWMA 3EN7A 4OAUC 3GGFA 2JC6A 3K2LA 4TPTA 5DBXA 1KE9A 1WAKA 2UW4A 3EZVA 3CKWA 3HV7A 3QKLA 4FSYA 2YM6A 3LHJA 3RPOA 3ZRLA 3F3TA 2BDWA 3MW1A 2JDSA 3VVHA 3WF8A 4LL0A 4C2WA 4BWXA 4BB4A 5H9BA 4EQUA 3ZLSA 3ZXTA 4IFCA 3TT0A 3L1SA 3BRBA 1YHVA 4M69B 2VWVA 3MH1A 5FM2A 3VQHA 2JFMA 5CU6A 2EB2A 3UTOA 4D55A 5LCJA 4DGMA 4DEGA 5CAOA 4K0YA 4LGDA 3PE1A 5AP3A 4G1WA 2HAKA 1Q97A 4IJPA 3V8TA 3R21A 4GVAA 2C6OA 1Q61A 2X0PA 4W4YA 4BDIA 3PUPA 3BU5A 3GQIA 3R8PA 3F69A 5HESA 1W0XC 1OIRA 3NGAA 1W83A 3UQCA 1PXPA 4PP7A 3ZUUA 5DE2A 3FLWA 5LMKC 2ITWA 4X6RA 4EOJA 2OSCA 2IN6A 2Q0NA 3QQLA 4WIHA 4AE9A 1F5QA 3R1SA 3MFRA 5HGIA 3I1AA 4FG9A 2UZEA 4KKGA 4GFGA 4G3EA 2W4JA 4EL9A 4M8TA 4D4VA 3PWDA 3KB7A 5DMZA 1LEWA 3KN6A 4JR7A 5M51A 3RM7A 4A9RA 2VWIA 1BYGA 3OC1A 2XEZA 3VRYA 3BU6A 5CLPA 1DAYA 4JDIA 4NJDA 4FGBA 2WXVA 3A4OX 3G0EA 3OCTA 3CY2A 2UW7A 3IK3A 4E6CA 2BZIB 5EM5A 5EYKA 1QPDA 1NVQA 4NH1A 4FSZA 2QLUA 5CNOA 5CXHA 3UG1A 3QTRA 3KMMA 4G34A 1WFCA 4X21A 2SRCA 5DA3A 2C3JA 4KS8A 3I60A 4EH8A 4PDPA 5DT0A 3OG7A 4EONA 5F4NA 4X7QA 3H9RA 3MFTA 4QMYA 3GU8A 4O96A 4I23A 5E92A 1IG1A 2R3LA 5CVFA 4UMQA 4Y85A 5AA8A 4W8EA 3OWKA 1CM8A 1M2PA 4FSTA 4BIEA 3GC9A 3QTUA 2OJ9A 3QRTA 3IECA 2WTKB 4ACGA 4BDEA 2FSLX 4LOQA 5HNGA 1CKJA 4RFYA 4J52A 4BL1A 3IGOA 3PXFA 5L3AA 4F0IA 3W2SA 4QT1A 2ZMCA 3ROCA 5JGAA 4W4WA 3ZO2A 3PIZA 4P4CA 2I0VA 4DCEA 3UVQA 4PP9A 3SXFA 3UOJA 2QNJA 3LFCA 2REIA 1E1VA 3LXPA 3NLBA 4JRVA 5CAVA 4F6UA 3AT2A 5EI6A 1IA8A 5A4LA 3OCGA 3KMUA 3O23A 4EK6A 3R28A 3Q5IA 3C1XA 4YNEA 5AR7A 3ZLWA 4D2VA 5JFXA 4U41A 4DFLA 1H0VA 1URCA 3DXNA 3V01A 4E5WA 3OD6X 2AQXA 3KA0A 2R7BA 4OTHA 4FKQA 2R3JA 3DAKA 1YRPA 2FSOX 3B8QA 2UZWE 1AD5A 1KE6A 5L4QA 3FZSA 1Q99A 3NNVA 5J1VA 5K9IA 4ALWA 3AC1A 2OG8A 3MH3A 1JBPE 2JBPA 2C6EA 2QG5A 2FO0A 3QTWA 4FC0A 4I4FA 4UXLA 5AP1A 3VBTA 3WZKA 4FTQA 4PY1A 4FIFA 5AV2A 1I44A 2GFCA 4YBKA 4HJOA 1YXXA 3FMMA 3CIKA 3LPBA 3PJ8A 5GNKA 4KSPA 5JQ8A 4ACMA 2YLEA 2C5OA 2H9VA 5HE0A 3PP1A 5DR2A 4RX9A 2YIWA 3Q9YA 3MJ1A 5E8YA 2HXQA 5CEPA 2QODA 4EH3A 3ZU7A 4HPTE 2QOIA 1BI8A 5CEIA 2VTHA 3DS6A 5LMKA 5CVHA 3ZUVA 1U59A 4FSMA 1ZYDA 5ANKA 2PMOX 2XBAA 2XP2A 1HCLA 4FKWA 4U80A 4EHGA 2J51A 4D1ZA 3D0EA 3FUPA 3QCXA 2WQBA 3A62A 1OIQA 4BI1A 5J5SA 1PXNA 4XOZA 1R0PA 2OJGA 3AGMA 2XH5A 5TO8A 5C8KA 4RWKA 4S34A 3ORKA 2J2IB 3KK9A 1BKXA 4F09A 2J6MA 4X3FC 4DEAA 2UW0A 4XG6A 3S00A 3AC2A 4KNBA 3ZBFA 4EKLA 2BDJA 5ACKA 3BKBA 3PRFA 3VC4A 5DHJA 5DT4A 4QQTA 2W05A 3F6XA 3FL5A 4QP7A 4AA4A 4L3LA