3QD2B

Crystal structure of mouse perk kinase domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
332
structure length
271
Chain Sequence
b'ASRYLTDFEPIQCMGRGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQEEMDEPKVYLYIQMQLCRKENLKDWMNRRCSLEDREHGVCLHIFIQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDTHGQVTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYSFSTQMERVRIITDVRNLKFPLLFTQKYPQEHMMVQDMLSPSPTERPEATDIIENAIFENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 2-alpha kinase 3
publication title The structure of the PERK kinase domain suggests the mechanism for its activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 78
structure length 271
sequence length 332
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qd2B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qd2B01
3ZFMA 4BIEA 4YSMA 3TEIA 4DEBA 2XNOA 4G6OA 4ZJJA 1O9UA 4TXCA 3BE9A 5C27A 1MRUA 4EQUA 2BILB 5ETAA 3UO4A 1O6YA 3L9MA 4IAZA 2QLQA 2C6MA 3LIJA 3BEGA 1GZNA 4HVSA 3BLRA 3RALA 4D0XA 1YXSA 4S32A 3QQFA 2OIDA 2WQOA 4IJPA 4I22A 2DWBA 4N0SA 3QCYA 3V51A 3DT1A 3HUCA 5HNBA 3TV7A 2CCIA 5CNOA 1UU9A 4KSPA 4FGBA 4RJ3A 4E7WA 5F1ZA 2OU7A 3FI4A 5EM6A 4O82A 4EOKA 2XMYA 3MY0A 4BICA 4DBNA 3TUBA 3ZO3A 4YLJA 2CN5A 3PPZA 3R7EA 4EJ7A 3ZM9A 2AC3A 1Z5MA 3ZO1A 4O7YA 4D2SA 4M67A 3R7VA 4KABA 1UNGA 5HBEA 3QQGA 3M42A 5AR3A 5HBHA 5DLSA 1CM8A 3WARA 3B2TA 5J9ZA 4WSQA 4ANBA 1PXNA 3FQSA 4BCJA 4ZZMA 5HIDA 4TNBA 4PTCA 5HX8A 3DPKA 5HLWA 4O7SA 3BYMA 1BMKA 1NT2A 2GCDA 5AP6A 4G3EA 4XP0A 3KRRA 4XV1A 5F95A 2C4GA 3IOKA 4QOXA 4R7HA 4AZSA 4YJOA 4RC2A 4DG2E 4B9DA 1FPUA 1SYKA 2PHKA 2PVYA 4IACA 1O6KA 5AP7A 5FG8A 3V8SA 1XR1A 3C4ZA 3BI6A 1ZYSA 2PUUA 2OZOA 4F1MA 3LFBA 5M4UA 2I7QA 1H0WA 1ZXEA 1R0PA 1VYZA 5DBXA 2W99B 4JRVA 4FZ6A 3FMKA 3HMMA 5IA1A 3KULA 5ANEA 3PJ2A 2PULA 4UMQA 4IM3A 5AV0A 2BRHA 2IW6A 3QKLA 3RCDA 4CZUA 5FP5A 3BBWA 4GFGA 5TF9A 3FDNA 3QRTA 4TWPA 4G34A 4MNFA 4JBOA 4C3FA 2JDVA 4D1SA 2AC5A 1LP4A 2OKRA 2VO3A 2C5YA 5CNNA 3EYGA 4L3JA 5HVYA 3I0OA 3TTJA 4DGNA 4O84A 5M55A 3PE2A 2YM7A 3HMNA 4DYMA 2G1TA 2UW9A 1ZARA 3WIKA 3ZDIA 1IA8A 1YQJA 2GDOA 2Z60A 4K0YA 5CASA 3S0OA 4O0WA 4JAIA 3ORMA 2YCRA 2C6TA 3HDMA 1RDQE 4EH2A 1Q8UA 1JPAA 1REJA 1ZAOA 4FK3A 5CEQA 3QYWA 5J1VA 1Y6AA 1R78A 3BX5A 2J2IB 4IWOA 4C2WA 3IOPA 4FEWA 4V05A 3ZSHA 2QR7A 1Y91A 4E93A 3FZSA 5HG5A 1F3MC 3NUAA 3EZRA 5EHYA 3KGAA 5J8IA 4MK0A 4R3CA 4B0GA 3V5LA 3GBZA 4CXAA 3MI9A 4AW2A 3GCPA 4QMQA 3BLQA 1SVGA 2P55A 2QHMA 4BCNA 2W9FB 2XK3A 3A4PA 3OBJA 4MQ2A 3ORKA 3OF0A 2VAGA 2BCJA 3OOMA 2BTRA 4Y46A 5HX6A 3FSKA 3MVHA 4LRJA 3RHKA 3BZ3A 3IW6A 4ARKA 5IG1A 3TDWA 1ND4A 4GG7A 2XEZA 4XP3A 3CR0A 3JVSA 5IQCA 4XG7A 1H07A 3CEKA 5CF6A 3FZTA 1SMHA 3VN9A 3PP0A 1KWPA 1JWHA 1TVOA 4PDOA 1GIIA 4RT7A 3O8PA 2VO0A 2OZAB 3AC3A 2VO6A 3KMWA 1PXPA 2HENA 3HGKA 4FV9A 1G3NA 3L8PA 2HY81 4XG9A 3D5VA 4EHZA 5AEPA 5CALA 5L2TA 1PKGA 3QU0A 3HAMA 4EK6A 4EK8A 2VUWA 4E6CA 2RFSA 5ANOA 4DE4A 1AQ1A 4LFIA 3DS6A 5JGBA 5HKMA 4IB3A 2UW8A 5CENA 3HA8A 3SXFA 1L3RE 4BCIA 4IB0A 4C35A 3KXGA 3NYVA 2RIOA 3WZEA 4ZMEA 3EZVA 3UIMA 1XWSA 1URCA 2EXCX 4NM7A 4AN2A 5HIEA 4ACCA 3PY1A 3SXSA 5J5SA 4PMSA 2WTDA 5CEOA 4F6UA 4YZMA 3RI1A 4F08A 4AUAA 1OB3A 5ETFA 3FZPA 5CEMA 4ANLA 3VUKA 4BGHA 5CVGA 2PMOX 5M57A 3C4XA 4EC9A 2B53A 3I7BA 3BE2A 3SRVB 1ZMWA 3VBWA 4EH3A 3BHYA 4C4IA 4S34A 4YHTA 1QPJA 2C0OA 5HIBA 4TYHB 3GI3A 2YABA 5CS6A 4O81A 3GU6A 4FT3A 3WF9A 1YWNA 3PIZA 5FM3A 4UXQA 4HYUA 5GHVA 5C01A 4JBQA 2I0EA 3PA5A 4D9TA 2HOGA 3QWKA 3UZRA 4KD1A 3GFWA 2R3JA 2ZJWA 4XP2A 2ITTA 4ZTQA 3I1AA 2QOIA 2WQEA 4LV5A 3VS3A 2G15A 5FUTA 4CFXA 4U42A 3AC2A 3TUDA 4ZZNA 5FQDC 3COHA 3F82A 4A07A 1KOBA 1OMWA 4AGDA 2ZB0A 5CAOA 3LXNA 3HP2A 1FVTA 1WMKA 2XM8A 5AMNA 2R3GA 4QQCA 4I6BA 4OLIA 5CSHA 5EQPA 3G33A 4NUSA 3GCQA 3GXLA 4EK5A 3UJGA 4NKSA 2W5AA 3EFWA 5ANGA 4MD7E 4LG4A 3I4BA 4FT5A 3W8LA 3BQCA 3NNUA 4ANOA 4L53A 2PL0A 3OMVA 4DCEA 2QU5A 4CZYB 3NS9A 3AGMA 2NRYA 3G51A 3W2PA 2JIVA 3GU8A 4ZJIA 1YXVA 3RTPA 3N4TA 4J8NA 4EYMA 3IS5A 1XBBA 3EHAA 4HGTA 4BCFA 4O7NA 2PVKA 3ZO2A 3PIXA 3OEZA 4FKTA 5IISA 2YDKA 3CTQA 4CTBA 4X2FA 4L44A 2XRWA 4RX9A 4EONA 4O7ZA 4I0TA 3MTLA 3FPMA 4EUTA 4YC8A 3L9PA 2UVYA 5FM2A 3ZZEA 3LHJA 3QA8A 5CAPA 4GK3A 4ZLYA 4IB1A 4LL5A 4XNEA 2X8EA 3FMDA 3IDBA 3PWDA 5DRDA 2G2IA 3EKKA 3LFEA 3LOKA 2Z7RA 2R2PA 4MNEB 5BVOA 5KMMA 3RK7A 4AT3A 4QMYA 2W1IA 1Y57A 4KWPA 1BI8A 3GB2A 5M4FA 2XIXA 4IFGA 4LGGA 5EM8A 4DAWA 5I3RA 4MXZA 1WVXA 4FT0A 2WIPA 3F3TA 2B9FA 4QPAA 1CSNA 2WELA 3KXXA 4DEAA 3PZEA 2YCFA 3Q4ZA 3FEGA 2YJRA 4HCUA 3LM5A 4RIYA 3TNHA 3WYYA 2XJ1A 4IAAA 4DFUA 4BI1A 1DAYA 2PPQA 2C30A 4YLKA 1BI7A 3L9LA 3BELA 3A4OX 4FIIA 3ROCA 4XG3A 5J1WA 1U5QA 4J96A 4QYEA 3TWJA 2VTLA 4TYIA 3TIZA 1KUTA 2C1BA 3FI2A 1OIQA 2ERZE 3HV4A 3TNPC 4ANNA 3MSSA 4EORA 4ZJVA 4NEUA 2XRUA 3ZSGA 3LQ5A 1PKDA 4EBVA 3LPBA 2HAKA 1OBDA 4CKJA 2PUPA 4OAVB 3R1QA 2PY3A 4I6FA 4IHPA 2BIYA 2OIBA 3DTWA 4J71A 5E9EA 5FXRA 4ORKA 2RF9A 3QTUA 4FZ7A 4X7QA 4BDJA 5A4TA 1H1WA 5HE2A 3LFCA 2G01A 4AGCA 2XJ2A 4DBXA 1M2RA 3VUMA 3MBLA 3SQQA 2CGVA 4XYFA 4GL9A 4PUZA 3II5A 2YLFA 4WRGA 4AFEA 2LGCA 2F7ZE 3OCSA 4O6EA 5CANA 4MVFA 5IQAA 4I4FA 4E4XA 2Y9QA 2PVLA 2X4FA 4FV0A 4HCVA 4IADA 4IM2A 3C7QA 5HICA 3MA3A 1YHSA 2YISA 3R00A 2EXMA 3FLQA 5C8KA 4QMOA 2YM4A 1WCCA 2XKCA 2C6IA 3WZKA 2JKQA 4FNZA 4HYSA 4HOKA 2ITXA 3KL8A 3BGZA 3Q4UA 4CGAA 4DLJA 4FZDB 3EJ1A 4YJUA 3LFQA 3TNIA 4D4YA 3E63A 1SVEA 3DQXA 1U54B 4GV1A 4W4XA 4JI9A 3KK8A 3U6HA 4PNIA 4IVDA 4AN3A 4AS0A 5HVKA 5EHOA 1L8TA 3ZLYA 4K2RA 3G90X 4RMZA 3ZMMA 4M69A 1JSTA 3F88A 4RGJA 2DS1A 3AMYA 4BDDA 2J0KA 4QPMA 5EG3A 4U40A 3JPVA 3RAIA 2C3LA 1W7HA 4W9XA 4APCA 3MB6A 2YWVA 4MHAA 5AV3A 1MRVA 4FF8A 3ZBFA 3D14A 3ZXTA 2Z8CA 4CVAA 5B2KA 4ASXA 4XMOA 4KS7A 3D2IA 3KRWA 3FMMA 5DR2A 1K3AA 2CLXA 3HA6A 3PDTA 3CCNA 4NCTA 2BRBA 3D9VA 3ZRLA 4G1WA 5I3OA 4D1XA 2FO0A 4LQMA 2X2MA 3H9RA 5FD2A 4BCOA 5AAGA 4OTFA 4A7CA 4GUBA 1PJKA 4JS8A 5HCXA 5K0KA 3WI6A 4AACA 4CRSA 3CPBA 2EXEA 1J91A 4F99A 4CQEA 2EWAA 1K9AA 2JKMA 1REKA 2ZVAA 5D1JA 5FWKK 3N4VA 2X6EA 5E8YA 5CEIA 2HZ0A 1PYEA 4M12A 4PRJA 4YURA 4D2TA 1UWJA 1ZY5A 1XH4A 4NM3A 3FXZA 1MQBA 4X3FA 4ZY6A 3V6RA 4ACDA 4DG3E 2WQBA 3LJ1A 2W0JA 4GJ3A 5HGIA 5HORA 5EW8A 2F49A 4ZK5A 4IVCA 1P5EA 2C5NA 3B8QA 4QMWA 5B2MA 2XKFA 3DU8A 2JDSA 3MFUA 4FTRA 3GUBA 4GJ2A 2H9VA 4CSVA 4EOSA 4F4PA 4TN6A 3RZFA 5IH4A 5HNGA 2ESMA 4DT9A 3UODA 2NO3A 1ZOGA 1CKJA 2OXXA 3U51A 2NRUA 4QD6A 3UIXA 4HPTE 4QP4A 4EH6A 3AD5A 2GNJA 3OS3A 4C02A 3NPCA 2VWUA 1OI9A 1XO2B 3R1NA 2XVDA 3LFSA 4FZAB 1XH7A 3ZUTA 3IW4A 5D10A 4EQMA 5CQWA 2OIQA 3QXPA 4OGRA 2UW6A 3BEAA 5DRBA 1ZOHA 4MQ1A 5EYCA 2F7XE 4X6QC 4Z7GA 2C47A 2UW5A 1J7UA 4AA5A 4GRBA 2RFDA 2ZB1A 3IGOA 3QZFA 3FKNA 4Q9ZA 3EYHA 2OSCA 4TPTA 5K5NA 4FSTA 2RG5A 4L9IA 4YO6A 4FIJA 3U6JA 2BRGA 1GZOA 3KXMA 1ERKA 2O64A 3PPKA 4UB7A 4F9CA 3G0EA 3NYOA 2BTSA 2OICA 3P79A 4D1ZA 4BCKA 5B2LA 3EN9A 4J53A 5LVOA 4LV8A 2R3FA 3KB7A 3V01A 1RJBA 1YXTA 3LE6A 4QNAA 5ETIA 3KRXA 1FINA 2XP2A 2W05A 2OI4X 3K3JA 2UZLA 2QC6A 3H0ZA 1JAMA 3L8VA 4X6RA 5K5XA 1PXJA 3O8UA 4A06A 4CMUA 4F9YA 4MWHA 3VBYA 4BDCA 1Q41A 5FBNC 4PPCA 3VS5A 3BWJA 2G9XA 2XF0A 4LGDA 5M07A 5HTBA 4GCJA 5IEYA 1BX6A 4O22A 5LMKA 1U46A 4OTWA 4KIKA 3S3IA 3PXKA 3RK9A 4TY1A 2B9IA 4G3DA 3QFVA 3MV5A 3RHXA 2J0LA 3HRBA 3ZFXA 1M52A 2OBJA 4F0IA 2W5HA 4ZLZA 4BFMA 3UBDA 4NWMA 4BHNA 4MEDA 1LEZA 3E92A 2OLCA 3OWKA 2UVZA 3JUHA 4FL3A 4G6LA 5JMSA 4C4GA 5EQEA 2WU7A 3TNWA 5DH3A 5EM7A 4OT6A 4FG9A 4A9RA 2YEXA 5AAEA 1VYWA 4M7IA 2RFEA 3FLNC 2BMCA 2X2LA 3CP9A 2IZRA 4ZMFA 2GMXA 4WD5A 3DKFA 4MWIA 3CC6A 3PXRA 4O21A 4Z55A 3UYTA 2KULA 5LCKA 3WZUA 1ZOEA 3UOKA 4JG7A 1WBOA 1NXKA 3TV6A 1GIHA 3FL4A 3DAKA 3VQHA 2RL5A 3ALNA 4EYJA 3KXHA 2O3PA 4FSRA 1ZYJA 4RA4A 2HZIA 5BMSA 2VTIA 1WBSA 3LM0A 4FIEA 2VNYA 3D7ZA 2CDZA 4YZBA 4A9SA 5I9VA 2ITVA 5DN3A 3GC8A 3EQBA 4L8MA 3PUPA 2J90A 4OTDA 5CAUA 2H34A 4ZSLA 3IONA 3TJDA 4CT1A 5JSMA 2ZOQA 2C6OA 3HV5A 3I81A 2E9UA 4FODA 1PHKA 3NGAA 4IANA 5AADA 4K6ZA 4BDIA 4U81A 5BUIA 2VTSA 1F5QA 4FX3A 3R83A 4ERKA 2PE2A 3EQDA 4LRKA 5GNKA 3WF6A 3GC0A 3IGGA 3NYXA 4OT5A 5EW3A 3H10A 3NNXA 5LJJA 3JR1A 2ITOA 2UZNA 5JFWA 3NR9A 3KCKA 3EH9A 1IG1A 4I5CA 5L4QA 4ANSA 3EWHA 4XG6A 3VHKA 4BTKA 3BHHA 4QP7A 2XNNA 1RE8A 3GOPA 4K1BA 4QMVA 3TNQB 3A8WA 4HZRA 4CG8A 2W5BA 2YERA 3VAPA 4M13A 3AQVA 3D7TB 1ATPE 5CT0A 3ZC5A 4EH7A 5KMNA 2BDWA 3HECA 4AT4A 1ZMUA 5EDQA 3UC3A 1KE7A 5EYMA 4R5YA 4NJDA 2HIWA 5IH6A 3PWYA 2WMTA 3DAJA 3NDMA 4ENXA 1U4DA 3OUNB 4H05A 2IW9A 3WE4A 2YA9A 4GT3A 2ITZA 2UZEA 3R7YA 4WG5A 2JAVA 1M7QA 2QOBA 3S95A 5D11A 2VX1A 4A4OA 4RFYA 4EWHA 3E87A 1H26A 1JSUA 1PW2A 2GFSA 3QCSA 3PA3A 3FSFA 5IQGA 4ACGA 4AOJA 3LQ3A 4Y83A 4ZY4A 4EHVA 4YJSA 5I9WA 4JIKA 5BYLA 1QCFA 4XLVA 5HO6A 4FIFA 1ZYLA 3KY2A 4FIGA 2P33A 3ANQA 4YJTA 4QRCA 4FICA 4ZTLA 4OAUC 5KMKA 3HAVA 1UNLA 2HWPA 4MTAA 4FTIA 2QONA 5BX0A 5HO8A 5I5ZA 3RP9A 2JAMA 3QKKA 5LQFA 2ETKA 4Y5QA 2CKPA 3Q9ZA 2JKOA 4L68A 4AZEA 1A06A 1HCKA 2OJGA 2QOLA 2R3IA 3COIA 3PVUA 3R28A 4U5JA 5AR5A 3RPOA 3V6SA 3THBA 3A2CA 2YIXA 4FEUA 3RINA 4HJOA 4HYHA 4AOIA 4PPBA 3ZLSA 5HLPA 4FZFB 2Z7LA 3GGFA 5EYKA 4E4LA 3TUCA 5ITAA 3CD8A 2CLQA 4ANQA 4DA5A 3PXFA 4JXFA 2JC6A 3KK9A 3ORXA 2XCKA 4MBJA 5EKNA 4EOPA 1JKKA 2XUUA 4K8AA 4DGMA 4N57A 4CT2A 4QP8A 4OBQA 4O7LA 3MYGA 4JBVA 3ROYA 4CYIA 4RRVA 3PRIA 4FL2A 4U3ZA 3MH0A 2IZTA 1OIUA 2VTAA 1H1PA 4NK9A 3U6IA 1OBGA 3NMUF 2Y4PA 1B6CB 4C37A 2QI8A 3ZUVA 3G6GA 1M2PA 2UUEA 2J0JA 3FZRA 3LCOA 3Q52A 4Y73A 4YNOA 5JFSA 4GH2A 1HCLA 2PWLA 3DAEA 3MPMA 3IW7A 2UZOA 5EW9A 4AA4A 3U4WA 4V01A 4QP3A 3WF7A 4RJ8A 3I0QA 4D4RA 3VBTA 3GENA 4R3RA 4UY9A 2RSVA 4MAOA 4BB4A 1M7NA 4R1VA 4E4MA 4U3YA 4NT4A 4Y95A 3FC1X 4ERWA 5EYDA 3A60A 2BVAA 2GNLA 3CY3A 3DJ7A 2CNUA 4FSNA 2BHHA 3SW4A 5ANKA 5T6KA 3CPCA 2XKDA 4JBPA 3R9HA 5M4IA 3E64A 4JR7A 3LCTA 2WGJA 1Q8YA 5GJFA 4D2VA 5H8BA 4C33A 3HRFA 3E8CA 4WO5A 2IZUA 2ITWA 5A6OA 4FYNA 2P2IA 3QX2A 3E3PA 3OTUA 3V5TA 4C7TA 5DIAA 3F2RA 4ZSGA 4AGWA 2C3IB 4GFOA 3LAUA 3BLHA 4CRLA 3R2YA 4QP9A 5BVEA 1Y8YA 1PF8A 2VX0A 3DKOA 4AZFA 3VW6A 3O8TA 5KHXA 4FVRA 3PVGA 4YTIA 2E9PA 3OCGA 1OKVA 4FOBA 3MN3A 4QMZA 2Y6OA 1JBPE 3QWJA 4H1MA 4RIXB 4BVUA 5CQUA 3FL5A 4BDAA 3EL8A 5HD4A 3ULIA 3DXQA 4ALVA 4GUEA 4E73A 2OXYA 5IQFA 3NCZA 3VHEA 3ZC6A 5CEKA 5KMIA 2ITPA 2UW3A 3ORIA 3FAAA 3U8WA 4DLIA 3EFJA 2W4OA 5LVPA 4XHKB 1ZWSA 3PSDA 4FOCA 2VX3A 3HV7A 4EOQA 2W1DA 3CGOA 5IA4A 5LWNA 3SHEA 4KB8A 2CGUA 2QO2A 4UZHA 5AR7A 3K5VA 3KMMA 3PYYA 3CLYA 3ZFYA 4EZ7A 3BHUA 3QA0A 4P90A 4RFZA 4E6DA 4JG8A 1J7IA 3GC7A 2VGPA 4EOIA 3ATSA 2PVFA 3NW5A 4R6VA 4XG8A 4RWJA 3HRCA 5IKWA 4TWCA 4OTHA 5GJDA 5JGAA 5B0XA 3TZ8A 4OTQA 3SG9A 4IWQA 4DTAA 2JDRA 4C61A 3QX4A 5JKGA 4YJNA 3HVCA 4QMMA 4C3PA 3VW8A 2CKOA 1IASA 1ZY4A 3DY7A 3OY1A 4U80A 1WBVA 5DR6A 3IPHA 2JIIA 2UZBA 2BKKA 4NJ3A 5DI1A 2V62A 3UVPA 4BDFA 2FB8A 3SG8A 4EH4A 2CKEA 3DFCB 4G2FA 4NFNA 3HV3A 4G5PA 3R63A 1UWHA 3KXNA 3F6XA 3ODYX 3QD2B 4L3PA 4UYNA 3UC4A 3OWJA 3Q04A 3OCBA 2OZAA 5IA5A 3RZBA 2E2BA 1YWRA 4TTHB 4JVGA 2O5KA 3ZDUA 3F3UA 2NPQA 4YNEA 3JS2A 3DJ5A 4I6QA 3W2RA 2X1NA 3FV8A 2EB2A 4NM0A 4WNPA 3F3WA 3DKGA 4KBKA 4O0VA 1TQPA 2PSQA 4YSJA 5HESA 4CFWA 4G9CA 4A9TA 4WG4A 2QNJA 4L6QA 5BYZA 2PVMA 3RM7A 3ZM4A 3O2MA 4F7NA 2PYWA 3DLSA 5D9HA 5DMZA 3CJFA 2GSFA 1URWA 2C5VA 5EOLA 4F0FA 4ZLOA 1A48A 2RGPA 3HLLA 4O6LA 5EOBA 4EC8A 3ETAA 2QOHA 3UIUA 3VS2A 4KIQA 4EH5A 5HOAA 2BFXA 2XYNA 2JFMA 3AD4A 3UOLA 1T46A 3HP5A 5FEQA 5IH5A 2XNEA 2LAVA 3AGLA 4WIHA 3SRVA 2ZM4A 3OT8A 4JQ7A 3RM6A 2VNWA 2RFNA 4M14A 1V0OA 4JX7A 4AQCA 4AX8A 1UKIA 2PVRA 5IMEA 4UX9A 4HGLA 3LXLA 4E5AX 4KRDA 4TYHA 2WMVA 2W7XA 5AR2A 3EQRA 5A4QA 3LKMA 3D83A 3PJ3A 1T45A 1ZLTA 2JBOA 5AUUA 5CSWA 4RJ5A 2IJMA 3N4UA 2WMBA 3O50A 3QQJA 4RC4A 2YAKA 1E1VA 4D2RA 1KOAA 2VRXA 4IMYA 4DEHA 4CG9A 1U59A 4FKSA 4C4FA 4Z9LA 4S30A 4IC7A 3W33A 4C57A 1YXUA 3KMUA 2WFYA 1JSVA 3HEGA 4KBCA 3UP2A 2VGOA 4H39A 4EQCA 2OJIA 2XIYA 4HW7A 1UA2A 4JR3A 4LMUA 4M15A 3R7OA 1J3HA 1U5RA 3SV0A 3PPJA 2QO9A 3BQRA 4UWYA 2XZSA 1YDRE 1OGUA 4I21A 5AP5A 3ZTXA 4AE6A 2J7TA 2ZMCA 4B8MA 2WTCA 4FTQA 4KKHA 4V04A 2WB8A 3O7LD 3GQLA 3E7OA 3FC2A 4WNOA 5AM6A 4U9AA 5E1EA 4DG0E 3FMEA 2YN8A 3MJ1A 3R21A 4V0GB 5T68A 2NNWB 1JKSA 3QTIA 4OTRA 1QPCA 1G5SA 3SDJA 1PY5A 2BAJA 2JGZA 4L67A 3I7CA 5AR4A 4PDYA 3JY9A 4BCGA 4TW9A 2OF4A 4FNXA 4UMTA 2QCSA 2GTMA 3DQWA 3QC4A 4S2ZA 3CKWA 5K3YA 1Q61A 2QOKA 3QHRA 4FT9A 4J95A 1GZKA 5H9BA 4BBEA 1DS5A 3FLSA 2YWPA 3L8XA 4DEIA 3SA0A 2HZ4A 3VUGA 4FEXA 4RQKA 3CGFA 4WOVA 3Q32A 4PMPA 2XIZA 5E8WA 3BWFA 3C50A 2DUVA 3ZLXA 2BDFA 2E9VA 4AA0A 4PTEA 4IZ5A 4OUCA 2OFUA 3H0YA 5CT7A 2GFCA 4LUDA 2PE1A 3D15A 5CU6A 4AN9A 4BGGA 3C51A 3QUDA 4MNEA 4RA5A 2X81A 3R2BA 3VULA 3UG1A 2BAQA 3BKBA 4IXPA 2FSMX 3NIEA 4LL0A 4LOPA 2HXLA 2P4IA 3VUDA 2VTNA 5KUPA 3NW6A 3OUKA 4OTIA 2X6DA 2PMNX 2V0DA 3MH3A 5CYIA 1SNUA 5EFQA 2XK7A 3P4KA 4ZS0A 2X2KA 3DB6A 3COMA 4RPVA 2YM3A 3C9WA 5FBOA 4PP7A 3TXOA 3LJ2A 4U43A 2J5EA 2WAJA 1OL6A 4I0SA 3R8PA 4W8EA 2ETRA 1FGIA 3MFTA 4BKYA 4DGOA 3QUEA 4XV2A 3NIZA 3TACA 3AMAA 4ZSAA 1XH8A 3P7BA 2J0IA 4F63A 4O38A 3VF8A 4X2NA 5FTGA 3GVUA 3WZJA 3F66A 2KTYA 2AUHA 4IJ9A 5DT0A 3I6WA 3C0HA 3HZTA 4MXOA 4R8QA 5EQYA 3A99A 4MXXA 4BYJA 4IEBA 2ITQA 3Q2JA 3R02A 5D7AA 3UQCA 2EU9A 2W4JA 3AXWA 3F7ZA 4IX6A 4JX3A 5EK7A 3U4UA 3RPRA 3UE4A 1WBWA 5DEWA 4C3RA 1JOWB 3Q9XA 5L6PA 3OG7A 2UZVA 4ZSJA 3OW4A 3T3UA 1NW1A 4ZP5A 2C3JA 3UMXA 5BQ0A 4KKEA 3TKUA 5F94A 4TWNA 1YVJA 3C13A 4WUNA 4JRNA 5TO8A 4YUQA 4RVLA 2ONLC 3NUPA 3NX8A 3C1XA 3VIDA 4Z7HA 2I1MA 3MDYA 1IA9A 3NW7A 5LOHA 2JEDA 3G0FA 2I6LA 2YDJA 3F61A 3H30A 3Q4CA 4OTPA 5F20A 5FDPA 5DYJA 3JY0A 1OL2A 3LXPA 3R6XA 1W0XC 1FOTA 3PTGA 4FV2A 4KSQA 2CCHA 5HE3A 5D7VA 4BKJA 5HBJA 1KE8A 3RBWA 1Q3DA 4WUAA 3QKMA 4QYHA 1YKRA 4BYIA 3QQHA 3PG1A 4ZTSA 1AGWA 1U54A 4D55A 2CN8A 2OH0E 4PL4A 5ACBC 3KREA 4GSBA 4HVHA 2FSOX 3G5DA 3MIAA 4ITIA 5TR6A 2CGXA 4O0SA 2QURA 4IVAA 4NW6A 1Y6BA 2PZ5A 4F7LA 4HVGA 5BMMA 2WMWA 4FTAA 3C4FA 2XCHA 2GS6A 2A0CX 3DKCA 5KBRA 2QOQA 2Y6MA 3PZHA 2Y4IC 5AUXA 3PG3A 4FSQA 2XK6A 3KCFA 5AP4A 3HNGA 4A9UA 3R30A 5GZ8A 5TE0A 3CQEA 2XH5A 3B8RA 3BU6A 4PX6A 4TZRA 3S1HA 1PMNA 2HXQA 5AV2A 4UMUA 2YFXA 3UO6A 1OL7A 3A62A 3HMPA 4QMXA 5IA2A 4G3GA 4MH7A 3Q60A 5CU0A 4CCBA 4N70A 4FKGA 5GIPE 3LLTA 3R9RA 4RWLA 1J1CA 2PVJA 2J6MA 3PVWA 3RK5A 4FV1A 2AYPA 3V04A 4O7WA 4RX5A 4TYGA 3LXKA 5E1SA 4GVJA 3CY2A 2WTVA 3RGFA 2X7GA 4J8MA 4G3FA 4GYGA 2O65A 1VR2A 2QR8A 4GVAA 4C4EA 3ATTA 5IMXA 4IM0A 2BDJA 4FKJA 2HK5A 3AD6A 4FV8A 4RQVA 5F9EA 4UZDA 3S4QA 3FQHA 5AUZA 4QQ5A 2PUIA 3PFQA 4BRXA 1Z9XA 4KINA 3ORZA 4ZOGA 3EMGA 4BI2A 4JIAA 4O2ZA 4FEVA 4MYGA 4ANMA 2R0IA 3ET7A 3JXWA 4B99A 1MRYA 4FTCA 4GG5A 3ODZX 4I23A 4PL5A 5E8VA 4AAAA 2CSNA 2P2HA 3RNYA 5ACKA 4LUEA 3M11A 2GU8A 3FKLA 4X2KA 2X9FA 3WF8A 3P0MA 4G31A 4DN5A 3E62A 3UMWA 5I4NA 4L01A 3UZPA 1OKYA 1YHVA 2WMUA 2O63A 3NUSA 3U9CA 4L52A 3E8NA 2J50A 1CTPE 3GFEA 3NSZA 3OBGA 4L7SA 3MPTA 5ANDA 5FTOA 5HG7A 5CLPA 3W16A 4GU9A 4IDVA 2F7EE 3QRJA 1G8AA 1F0QA 2YCQA 4W9WA 4M0ZA 3A7IA 4NZWB 4UEUA 3ZO4A 3QD4A 4DFYA 5H3QA 1H00A 3BYOA 4ZY5A 2HW6A 3G6HA 3SOCA 3ZYAA 3FBVA 1B39A 4O7VA 2E9NA 4EBWA 2C1AA 2E9OA 4TRLA 2B9JA 1H27A 2VD5A 4RLLA 4LRMA 3FMJA 4HCTA 2EUFB 3Q9WA 4XV9A 4QTEA 3FKOA 5A3XA 1DM2A 1YI3A 2VTQA 2HCKA 5IUGA 5A4CA 3IDPA 3ANRA 4B4LA 4F6WA 2WO6A 2I0HA 4MXAA 4XH6A 3BV3A 5DNRA 4ZS4A 3DBFA 4W4VA 2X7FA 2W1FA 4AF3A 1PXMA 4I0RA 4YTHA 3RKBA 3U9NA 4ACMA 4CEGA 3SGCA 5GINE 4QMPA 2ZV2A 3HDNA 1SZMA 3P5KA 3R8MA 5CVHA 4DTBA 2C0TA 3A61A 4EK3A 2YZLA 2PMLX 3VRZA 3CS9A 2UW7A 4FV7A 4IWPA 4NL0A 3EQGA 1I09A 5BVKA 4QMNA 3UNZA 3I79A 3DCVA 5A4LA 3HKOA 5HU9A 1OECA 4QP1A 4H36A 1YHWA 2VWWA 5L2QA 4R5SA 3F5PA 3AC1A 5EI6A 1NVRA 3EQPA 3SVVA 2WQNA 3F3VA 3O17A 4D4SA 4ASEA 4DGLC 3OVVA 2WKMA 5KMLA 3EFKA 4O0TA 4FNYA 3OTVA 3QRIA 3HV6A 4FV3A 4AWIA 4IZYA 4F9WA 4MF0A 4BZOA 1FQ1B 2JD5A 3IG7A 2WMXA 5H2UA 2YLEA 2Y8OA 3VS7A 1S9JA 1XH9A 3C0GA 4D0WA 5AR8A 3O0GA 4JDJA 3POZA 1OIYA 3OOGA 5HLNA 5KKRC 4FL1A 4X3JA 4EKLA 1LEWA 3RAKA 5CEPA 3UG2A 3NUYA 3E5AA 4HZSA 4CFNA 1JLUE 3FLWA 4D5KA 4YZDA 4XJ0A 3QUPA 3TJCA 4G6NA 4RIWB 2PZRA 3DJ6A 3QQLA 4G5JA 4E3CA 3IW5A 3L8SA 1OM1A 4AGUA 2Y4IB 5I0BA 5JH6A 3I6UA 5C03A 3MVLA 3P08A 4ALUA 4UALA 2QHNA 3RMFA 5JRSA 4LYNA 3WYXA 5M56A 2GPHA 5AIRA 1WVWA 2GQGA 4EOMA 4PL3A 5E8XA 3OY3A 5CI7A 2ZDTA 3G2FA 3VF9A 3UP7A 1OL1A 3KVWA 4BWXA 5LWMA 1NY3A 4XBUA 5IUIA 2FH9A 3RPVA 2GNIA 3TL8A 2VWXA 4WG3A 4ACHA 3OWLA 4PP9A 1R0EA 3R71A 4D28A 4UN0C 4L00A 4QYYA 4MBIA 3EOCA 2VTRA 2XM9A 1H01A 1P4FA 3BYVA 3I60A 3SD0A 3D7TA 5E8SA 3Q53A 4DHFA 4D2PA 3GU7A 3KEXA 3QZHA 3NVMB 4QYGA 3QQKA 4CKIA 3MESA 5J95A 1P2AA 5BVFA 2BZJA 4AXAA 2P0CA 3KF7A 4GT5A 3QRUA 4L42A 4EWQA 1YOLA 2FYSA 4AZVA 1FMOE 1H1SA 1MP8A 4AT5A 2V7OA 3GU4A 3OROA 3R1SA 2WMQA 2WU6A 4WRSA 5AUTA 5M44A 3U55A 4RC3A 3KU2A 4DF3A 3FZ1A 3TI1A 5HU3A 5FLFA 3KA0A 3LCDA 1H28A 4O96A 4BR3A 3DZQA 4GFMA 3G9NA 4NTSA 3RJCA 3ORTA 4FUXA 4ZAUA 4C34A 3QYZA 4JNWA 5L2SA 1XHAA 5A46A 3E7VA 3CQUA 1K2PA 2Q0BA 1Q24A 4MD8E 3VUTA 4QP2A 4HVDA 5M09A 2XS0A 5G1XA 5CI6A 4O83A 2R3QA 1IEPA 2W4KA 2VZ6A 3GNIB 3H4JA 3PY0A 2X8IA 4Y8DA 4IQ6A 3MH1A 4QT1A 3RPSA 1OIRA 3AG9A 2XKEA 3A8XA 3H3CA 1W83A 2W1EA 2FA2A 2GNHA 2GNGA 3A7GA 5C9CA 4EKKA 1FBNA 3PXZA 5FDXA 3UGCA 1UU8A 2PK9A 3AC4A 2BR1A 3FWQA 4O0XA 5IQIA 3R7GA 2J5FA 2F2UA 4FSMA 5HCYA 4BTJA 4UV0A 3D94A 4YC6A 5H8EA 4BKZA 4M0YA 2PVNA 4GU6A 2R3PA 5DGZA 2WZJA 5HVJA 3K2LA 3ACJA 5JEBA 4KNBA 3TN8A 1DI9A 4IIRA 4AG8A 3F7WA 3BU3A 3OXZA 4WHZA 2WTWA 2XJ0A 4L45A 4RVKA 5AX9A 4IE9A 5J7BA 4I5HA 2V7AA 2I40A 2DQ7X 4FSYA 4P5QA 4ZTHA 2QG5A 4MXCA 1XH6A 4XOZA 3T9TA 2GHMA 2VTPA 1R3CA 4IWDA 4HPUE 2BZKB 2HYYA 2OJ9A 1CDKA 2C6DA 3C4CA 1QPDA 2XNGA 4YJVA 3RPYA 4W4WA 5AV1A 5A14A 2YAAA 2IVUA 3HYHA 4ITJA 4K33A 3RWQA 2WIHA 4KIOA 3H9OA 1I44A 4FKRA 4EJNA 1WBNA 2EVAA 3QZIA 1R1WA 2ZAZA 3AC5A 3QAME 4QYFA 1G8SA 4F9BA 4NM5A 4EZ3A 1M17A 2XK4A 3LCKA 2O8YA 4IC8A 1ZMVA 4XX9A 3SC1A 5L3AA 4NIFB 5L8LA 2NP8A 2V22A 2A19B 4LOQA 2R4BA 4IH8A 3HL7A 2C69A 5EM5A 4CFMA 5GZAA 4PDSA 4DH5A 2QOFA 3MIYA 3IDCA 4CYJA 4E5WA 2WOUA 5IQHA 3VWAA 3UZTA 4EH9A 3UTOA 4F7SA 4F1OA 5CAVA 3RWPA 5CU2A 4QMTA 4M3QA 4A9YA 2QVSE 5CVFA 5AP3A 5HE0A 5KKRB 4U6RA 3BGPA 3QTSA 1FGKA 4JDIA 4BBFA 3WBLA 4GK4A 4DFNA 4I93A 3SX9A 4DT8A 4RZVA 1QPEA 3GU5A 4FIHA 4BL1A 4HVIA 4TL0A 3ULZA 5JQ8A 2ITYA 1FMKA 3VJNA 3ORNA 4CFVA 4LM5A 2JFLA 3QBNA 4EHGA 3A7FA 5FEEA 1HOWA 3BIZA 5TT7A 3DGKA 3CJGA 2OGVA 4RJ6A 4I4EA 2UW4A 4EI4A 2VTOA 5CXZA 4H3QA 3PLAE 3FZOA 2YM5A 5BYYA 5DA3A 5HO7A 3DK3A 1OVEA 4H3BA 5I9UA 3R0TA 3FYJX 2R5TA 4YC3A 4NW5A 3JYAA 3BU5A 3LFDA 4RIXA 4CQGA 3G9LX 4TNDA 1Q8TA 5L8JA 3RNIA 3QZGA 5EDRA 4NYEA 3RAWA 3MJ2A 1EH4A 4H3PA 3BCEA 3D4QA 2X0GA 4GIIA 2H6DA 4QMUA 1RQQA 3ENMA 3OWPA 4AZTA 4BDKA 4PWNA 5C1QB 2C5XA 1JVPP 4DGGA 4AE9A 2IN6A 2PUNA 1PMVA 2CGWA 3GCSA 4YBKA 5DHJA 3UDBA 3ZSIA 2WHBA 2QOOA 4QNYA 3DFAA 2WEVA 1WBTA 4DH3A 3LQ8A 4PTGA 1KE9A 1YOMA 3R9DA 4YZNA 4S33A 4E26A 4F65A 3TKIA 5LVLA 2VTMA 5C4KA 5AUWA 5B7VA 1DI8A 3ZRKA 3RVGA 2GQRA 2X4ZA 4HNFA 4RJ7A 2WTJA 4I94A 4O1PA 4QTDA 4CFFA 4HGSA 5AV4A 3KXZA 3MVJA 3QLFA 1V1KA 4Z16A 3V5QA 5E7RA 5GIOE 4CD0A 3ZOSA 1WBPA 4BCMA 4DFZE 2IVVA 5BNJA 2HELA 3FE3A 4QO9A 1H1RA 4X2GA 4AW0A 4H58A 3ZS5A 3CBLA 4YBJA 1OPJA 3BGQA 3T3VA 5M08A 4O27B 5D41A 2R3OA 3R9OA 2C3KA 5J9LA 4A4XA 4J99A 4IZ7A 4L46A 1TKIA 4S31A 3BRBA 2BHEA 4N4SA 2PZIA 1E1XA 4XRJA 4LMNA 4DEEA 4E8AA 1E9HA 5E8TA 5HG9A 4BDBA 4Z3VA 1J7LA 4IAYA 5TKDA 1OUYA 3WIGA 3LZBA 4MD9E 5IA3A 4Q2AA 4DCAA 4RWKA 5CSXA 2V55A 3BBTB 4FTLA 4DTKA 1BYGA 4BC6A 4IX3A 4N6ZA 4F0GA 4FNWA 2X39A 5A6NA 3C5IA 3MW1A 3EN7A 3MFRA 3JVRA 4NSTA 1O6LA 2PMIA 3Q5ZA 4QP6A 4CV8A 1H4LA 4XV3A 4PMTA 4USEA 2X9EA 5TOZA 2ERKA 2OH4A 4KS8A 2BFYA 2F4JA 4YO4A 1XH5A 5K4IA 3DK7A 3CSVA 2A1AB 3FI8A 3EFLA 3D0EA 3CIKA 3TV4A 3V5WA 3L9NA 2B55A 3PJCA 2GTNA 1OPKA 1NA7A 4U0IA 4IDTA 2EB3A 3GT8A 2B54A 4M66A 4FV4A 5IA0A 5E92A 2WEIA 4OW8A 1KE5A 2UZWE 4JOAA 5GJGA 4U79A 4C4HA 2VWZA 4FKOA 4USDA 3NWWA 3EN6A 4YGAA 2XK8A 2W9ZB 4X0MA 2V5QA 1QMZA 3NZ0A 3PXYA 1WAKA 3DXNA 4K18A 2CHLA 3P9JA 3TZMA 1GIJA 3NAXA 1OZ1A 3PJ8A 3TCPA 2YCSA 3W2OA 5J79A 3KULB 3LMHA 2B0QA 5HD7A 1PXLA 2XBAA 3VNTA 4FKUA 4EEVA 1FVRA 2BKZA 4HNIA 5AFVA 4LOOA 3VBXA 3UPZA 4DEGA 3LFFA 2SRCA 2XYUA 4RZWA 5IEXA 5T3QA 3AMBA 3O7LB 3CXWA 2B1PA 1PMUA 2HWOA 5H8GA 1YWVA 3VQUA 5IDNA 2GQSA 4C58A 3GCVA 3TDVA 2REIA 2ZV8A 5AWMA 4JLCA 4U44A 2GHLA 5EH0A 3UVRA 4R7IA 4RX8A 4IBMA 3GP0A 2BRNA 3MY1A 4XEYA 2C6LA 3TT0A 2QKRA 1M14A 4V0GA 5KE0A 3VRYA 2JKKA 2QKWB 3W2SA 5IDPA 3R22A 4JDHA 2VTTA 5LMBA 3CD3A 4PDPA 5HG8A 4RLKA 4U7ZA 3VJOA 3V8WA 5AUYA 3I5ZA 3AT3A 5CAQA 2YIQA 3FPQA 5M4CA 4ZTNA 3VS0A 4UYAA 1CKIA 1RW8A 3V3VA 3V5PA 2ITUA 3ZLWA 5HQ0A 3P7CA 2YITA 3W2CA 3IW8A 5FGKA 2XK9A 4O0UA 5AX3A 2W1HA 2BZHB 2OJJA 5CZHA 2GHGA 4QMSA 4DH7A 3IK3A 2J4ZA 3ZU7A 4MKCA 3WF5A 1BL6A 5L2WA 3EN4A 3S00A 4R1YA 1MUOA 2C6EA 1P4OA 4CMTA 4ZTRA 2JBPA 3NRMA 4FKPA 4OBPA 4O1OA 4FR4A 2Z02A 2OF2A 4CCUA 1PXIA 5HE1A 3F5XA 4MXYA 3DDPA 3HUBA 3DBEA 3G15A 5C4LA 4ZIMA 1PXKA 1JNKA 4E1ZA 4FC0A 5A4EA 1BKXA 4J1RA 3C4EA 4U41A 1CMKE 3DNDA 3EN5A 4D4VA 5J9YA 3FYKX 1XQZA 4BCHA 3ORPA 3CTHA 5LVNA 2I0YA 4WSYA 5AJQA 5HHWA 2I0VA 5DWRA 4GIHA 5AIKA 2PVHA 2W06A 2ZYBA 2IPXA 3U54A 4DFXE 2OO8X 3FY0A 3OW3A 4XRLA 4CMOA 3KFAA 1OITA 4BCQA 3O23A 4M8TA 2IW8A 4G9RA 1Q8ZA 2HZNA 3WOWA 4O2PA 3BV2A 4WBBB 4FG8A 3EL7A 5CZIA 3QD3A 2WTIA 3EQFA 4NTTA 2X7OA 2B52A 2YJSA 2P3GX 4FEQA 4I5MA 4E5BA 4I24A 2WMSA 3OC1A 2R3HA 5CXHA 4DEDA 1LR4A 3L1SA 3S2PA 4UBAA 1Q4LA 3D5UA 1OL5A 2CMWA 4JAJA 4TYEA 4KAOA 3F9NA 1Q8WA 2W96B 5M06A 4FKVA 3OFMA 3EIDA 1KSWA 1VZOA 3W32A 5DR9A 3MVMA 2A27A 1Z57A 3FMNA 3NYNA 3FLZA 3RAHA 2VU3A 3P23A 3VVHA 5M51A 2QU6A 4TT7A 1WZYA 2B4SB 2G2HA 4DH1A 5EI8A 2W1GA 4PV0A 3ORLA 4QTAA 3R8UA 3I5NA 4YTCA 2R3KA 4QTCA 3IECA 4UWBA 1BLXA 4YJQA 3PSBA 3VS1A 4C8BA 2VO7A 3QC9A 2WOTA 4YPDA 3PRFA 4O0YA 5F4NA 2VWBA 3IO7A 4O7RA 4NCTC 2VV9A 4Y5HA 5KNJA 4BY9E 1B38A 3Q96A 1SVHA 3QGYA 4FT7A 4P2KA 3ZEWA 2C0IA 2XIRA 2ZMDA 2ZV7A 2ETMA 2QO7A 5HTCA 2A4LA 5CY3A 4Q5HA 3C0IA 2XNMA 4GW8A 4HYIA 4L3LA 4MBLA 4M84A 5EI2A 4DH8A 2UVXA 3ALOA 3OCTA 3MWUA 4FKIA 3TIYA 1OPLA 2QLUA 4I20A 4RVMA 2CNQA 1A9UA 1YXXA 2F9GA 2VWYA 3K54A 4XS2A 4BZNA 3FUPA 3LFAA 4X3FC 2IVTA 4GMYA 1V0BA 3CQWA 3EQCA 4UXLA 2CPKE 2GNFA 4C2VA 2ZM3A 3A7HA 2UW0A 4KA3A 1H0VA 3VS6A 2XEYA 3REPA 2R3LA 3F2AA 5JRQA 1W98A 2OK1A 4YZ9A 4EZ5A 4G17A 2R0UA 2RKUA 5KMJA 2HW7A 1KV2A 3NNWA 2WPAA 4YPSA 4D5HA 4O0RA 1SM2A 5ANIA 3TTIA 3EQHA 3F2NA 4BF2A 5IUHA 4FE2A 2IO6A 1STCE 5CU3A 5IF1A 1H8FA 4PY1A 5L2IA 2J51A 3E3BX 3KKVA 4IAFA 4RX7A 5K4JA 3MPAA 4J7BA 5BVWA 5LVMA 2Y0AA 4GYIA 5DEYA 3PA4A 2QQ7A 1FVVA 3SKCA 4F6SA 1BL7A 3SOAA 3TZ7A 3UOJA 1UU7A 3QRKA 3N51A 5KZIA 5I9ZA 5JK3A 5KHWA 5EKOA 3ZHPC 4BIBA 4YP8A 4PF4A 4C0TA 5DVRA 1WFCA 2YDIA 4IAIA 5I9XA 4YZCA 3DLZA 5DG5A 3ZZWA 5E8ZA 4C4JA 3PE1A 4JT3A 5CU4A 4BTMA 3QL8A 2R64A 2BALA 4EK4A 1ZYCA 3Q5IA 4K9YA 5CSVA 4WNMA 5JQ5A 5HZNA 2WNTA 2RG6A 3KVXA 4RIYB 2FUMA 3F69A 4K11A 4KIPA 3C5UA 4BN1A 3R04A 5CSPA 3ZRMA 3QTWA 4EOLA 4B8LA 1CKPA 2UV2A 3FHRA 3QCXA 5AA8A 5AP2A 4FTOA 4AFJA 3ZUUA 1IR3A 4DITA 3MFSA 3DK6A 3KRJA 3NEWA 3PVBA 5E91A 3RCJA 1ZZ2A 5BVNA 5LCJA 5JN2A 5A9UA 4ASZA 3DDQA 4FKLA 3LLAA 2WMRA 2R3RA 1VJYA 4DINA 4J97A 3QTXA 3UVQA 2IWIA 1IAHA 4XOYA 2YIYA 1YDSE 4GK2A 2CKQA 4EL9A 2YHVA 4G3CA 5A54A 3PIYA 5LMKC 2OG8A 4R78A 4FTNA 2B9HA 1GNGA 4II5A 3UQFA 3QGWA 3UIBA 3FQEA 1W82A 5FRIA 3PJ1A 2C6KA 4FV6A 2O2UA 3TM0A 2HY0A 4FUYA 4MX9A 3LVPA 4EHEA 3CKXA 4XCUA 3FMLA 2IG7A 2H8HA 3E88A 3W1FA 2VWIA 4P7EA 2BAKA 1YOJA 1UU3A 4YJPA 3UQGA 5L8KA 4TYJA 2PTKA 4Y72A 4CNHA 3Q6UA 3OEFX 2BIKB 5FXSA 3W18A 4F70A 4ZZOA 4OBOA 3AT2A 2Y7JA 3DTCA 4IB5A 3LCSA 3W2QA 3V5JA 4CKRA 2Q83A 3BHVA 2WTKC 4XBRA 5ANJA 4DFBA 3DB8A 2OJFE 1ZYDA 4RWIA 5L6OA 1ZZLA 3KN6A 1UVRA 2QODA 3PLSA 4L43A 4WNKA 3QTRA 5AUVA 3DBDA 4AU8A 3HMOA 4FMQA 3LMIA 1J1BA 1UV5A 3ACKA 4IZAA 5AAFA 5JZJA 4BDEA 3E8EA 1X8BA 4IX4A 3OHTA 4KKGA 4M69B 3ZEPA 3HX4A 4FSUA 4Y85A 2XNBA 5IQEA 3C4WA 2W17A 4KRCA 4ENYA 4FKWA 2F2CB 4RVTA 4PNKA 4KUJA 4FTJA 5IEVA 3PSCA 2ONLA 4BWKA 1JQHA 1MQ4A 3BYSA 3O51A 4AW1A 5C8MA 5I9YA 5DT3A 2OXDA 4F64A 5CTPA 2WMAA 5DT4A 4BCPA 3BYUA 2YM6A 4CTCA 4E4NA 3B2WA 3UNKA 4J52A 5DE2A 3WE8A 4F9AA 1KE6A 4GKIA 1M2QA 1GZ8A 3NUXA 1P14A 4R77A 1S9IA 4MF1A 4IAKA 4NH1A 2YIWA 3AOXA 4OTGA 4YMJA 3BPRA 4MCVA 3D5XA 4I92A 2A2AA 4E6QA 2JIUA 3FHIA 4HGEA 4ONAA 3E93A 3UOHA 4ALWA 5EDPA 4BWPA 2R9SA 3DBQA 3NUNA 3QXOA 4UWCA 5CX9A 4RIWA 5IQDA 3IKAA 4UMRA 5IPJA 4X3FB 2Q0NA 1OKWA 3UO5A 5HTIA 1NVSA 1KV1A 4ASDA 2R7BA 1PMEA 4I6HA 4N6YA 3VS4A 5K0XA 2IVSA 5KCVA 5AM7A 3LFNA 3Q2MA 4D2WA 3A7JA 4BHZA 3MS9A 3LW0A 4PQNA 1VEBA 2YM8A 3R9NA 5BUEA 5J7HA 3ENHA 3QLGA 3H9FA 4FTKA 4TKSA 2PE0A 5K9IA 2XBJA 5LXMA 3DNEA 2BRMA 5FTQA 2CNVA 2OFVA 4X2JA 4IFCA 3TG1A 4M97A 4XUFA 3DOGA 3VUHA 3VC4A 4EH8A 3QHWA 4YU2A 3IQ7A 1W84A 4ZTMA 5C26A 1Q99A 3P1AA 4W4YA 3V8TA 3QD0A 5FEDA 4I3ZA 2BZIB 4CLJA 4R7BA 3QTQA 2ACXA 4J98A 5J87A 3QF9A 4H1JA 3GC9A 5IU2A 3TKHA 5KMOA 3Q4TA 2UZUE 2XB7A 4EOOA 4FVQA 2J0MB 2C68A 3UYSA 2VTJA 4R3PA 4WA9A 3FXXA 5L6WL 1H25A 4IW0A 3SLSA 4P5ZA 1YI6A 2QD9A 2WQMA 4QQJA 3SAYA 3SXRA 5BPYA 1GOLA 3TZ9A 2XIKA 5J5TA 3K3IA 1Q62A 1YDTE 2UZDA 3FLYA 4XG4A 4ITHA 3ZONA 4LGHA 3DV3A 3U87A 3W55A 3OXIA 3ZCLA 4ZSEA 4IVBA 4GKHA 3PXQA 2PU8A 2F57A 4BDHA 3MH2A 2XNPA 4FSZA 1PXOA 2FSLX 1WVYA 3MTFA 3SW7A 2OW3A 3ERKA 4I5PA 3ZBXA 5HNIX 2GS7A 3FY2A 4O91A 5E4HA 4GEOA 3VUIA 4ID7A 3POOA 3AC8A 4YHJA 2FSTX 4FYOA 3UNJA 3PP1A 4GT4A 1XJDA 5FXQA 4ZXTA 3DA6A 3T8OA 5AP0A 4BGQA 4F09A 3MB7A 4DFLA 1XBAA 1SNXA 1IRKA 4FI1A 5DPVA 3M2WA 5E8UA 4ZEGA 3UPXA 4DC2A 4NKAA 1JKLA 4JQEA 4AW5A 3NCGA 3EB0A 2ZDUA 3OZ6A 5CF4A 2Z2WA 2BUJA 2R7IA 3NAYA 4GS6A 4RFMA 2VWVA 4U45A 1Y8GA 1TQIA 4I1ZA 5DOSA 3R8ZA 4JDKA 4KIKB 3ID6C 3Q3BA 4XG2A 2YACA 4NFMA 2W1CA 4OR5A 5EHLA 5ETCA 4F7JA 4JQ8A 2Z7SA 3R7IA 4E20A 3DZOA 4UMPA 1NVQA 3ELJA 4WBOA 3VBQA 4G16A 3MGYA 5JGDA 2X8DA 2YIRA 2JLDA 3DXPA 4AZWA 3PY3A 3LMGA 3P86A 4E6AA 3CTJA 3KC3A 1PYXA 4FGRA 5AP1A 3VBVA 4JG6A 1XBCA 2R3NA 2UZTA 3D2KA 3OP5A 1GY3A 3GQIA 3OD6X 1GAGA 3F3ZA 4X21A 3FMHA 5KZ0A 4FSWA 3AT4A 5D12A 1H24A 5G6VA 5HCZA 5KBQA 3D5WA 2WTKB 4FTMA 1LUFA 2WD1A 4CZTA 4FK6A 1GJOA 1OUKA 3R1YA 4A4LA 3EQIA 3BHTA 3R7UA 4TWOA 2XA4A 4L7FA 4XLIA 4LI5A 1UNHA 1OKZA 4RG0A 4EUUA 4QQTA 2WXVA 1YW2A 4PPAA 5BVDA 1IAJA 4FTUA 5E90A 3EKNA 3O96A 4FVPA 1APME 3OT3A 4JJRA 1JKTA 4Q9SA 2OWBA 3E8DA 3FXWA 3MY5A 5CF8A 3R8LA 3F5UA 4RBLA 4YHFA 1YI4A 5IZFA 1AD5A 4NIFA 5DFPA 5JFXA 3KRLA 2QG7A 4FV5A 4BZDA 3QTZA 3KN5A 5LMAA 3QQUA 3Q9YA 4USFA 4B6LA 4JL9A 4K77A 5C8NA 5KO1A 2ITNA 1BUHA 4WKQA 4YLLA 3NUUA 3GOKA 4PMMA 1LPUA 2O0UA 4FG7A 4EOJA 4AP7A 3NVKI 2YZAA 4QTBA 4O7TA 1ZRZA 3R01A 5JFVA 3HMIA 5FP6A 3W8QA 1YRPA 4BDGA 3T9IA 2JDOA 4WT6A 3QCQA 1Q3WA 2DYLA 4BBMA 5M53A 4D58A 1V0PA 2QOCA 3COKA 4RIOA 4C59A 3P7AA 5KX8A 5IQBA 3VO3A 4RJ4A 5ICPA 4CFUA 2VN9A 3FI3A 1TQMA 3ZXZA 4BIDA 2BROA 2W1ZA 3CE3A 4IX5A 2GS2A 1Q97A 4FBXA 4P4CA 3M1SA 5GZ9A 4BTFA 4FA2A 2ZV9A 2FVDA 1UKHA 3KF4A 3DBCA 4YR8A 2CJMA 2J9MA 3W10A 4YTFA 3GCUA 1W8CA 3WILA 4O86A 4APPA 3P78A 2VTHA 4QMLA 3QALE 5JT2A 4CLIA 1H08A 5HI2A 2PZYA 4RSSA 1H1QA 1Q5KA 3WZDA 4B7TA 4U97A 3Q6WA 3R73A 3NLBA 4YJRA 5BUJA 5AA9A 3ZH8A 2R3MA 3FJQE 4W8DA 2C5OA 1QL6A 3ITZA 3NNVA 4I41A 4F1TA 4AOTA 2FGIA 3K5UA 4M68A 4CV9A 3LJ0A 3MA6A 4FKQA 2IZSA 3GEQA 4BI0A 1XKKA 2JITA 2ZM1A 3N9XA 3OXTA 3KQ7A 3R8VA 5CF5A 4C36A 4Q5EA 1PRYA 1R39A 5LARA 2Z7QA 4D9UA 2G2FA 2BPMA 2H96A 3O71A 5CWZA 5JZNA 4FTTA 5HEZA 2JDTA 4KBAA 4U8ZA 4C38A 4QPSA 4C62A 4NU1A 2PZPA 2B7AA 1DAWA 3F5GA
chains in the Genus database with same CATH superfamily
3ZFMA 2NYAA 4BIEA 4YSMA 3TEIA 4DEBA 2XNOA 4G6OA 4ZJJA 1O9UA 4TXCA 3BE9A 5C27A 1MRUA 4EQUA 2BILB 5ETAA 3UO4A 1O6YA 3L9MA 4IAZA 2QLQA 2C6MA 3LIJA 3BEGA 1GZNA 4HVSA 3BLRA 3RALA 4D0XA 1YXSA 4S32A 3QQFA 2OIDA 2WQOA 4IJPA 4I22A 2DWBA 4N0SA 3QCYA 3V51A 3DT1A 3HUCA 5HNBA 3TV7A 2CCIA 5CNOA 1UU9A 4KSPA 4FGBA 4RJ3A 4E7WA 5F1ZA 2OU7A 3FI4A 5EM6A 4O82A 4EOKA 2XMYA 3MY0A 4BICA 4DBNA 3TUBA 3ZO3A 4YLJA 2CN5A 3PPZA 3R7EA 4EJ7A 3ZM9A 2AC3A 4I6LA 1Z5MA 3ZO1A 4O7YA 4D2SA 4M67A 3R7VA 4KABA 1UNGA 5HBEA 3QQGA 3M42A 5AR3A 5HBHA 5DLSA 1CM8A 3WARA 3B2TA 5J9ZA 4WSQA 4ANBA 1PXNA 3FQSA 4BCJA 4ZZMA 5HIDA 4TNBA 4PTCA 5HX8A 3DPKA 5HLWA 4O7SA 3BYMA 1BMKA 1NT2A 2GCDA 5AP6A 4G3EA 4XP0A 3KRRA 4XV1A 5F95A 2C4GA 3IOKA 4QOXA 4R7HA 4AZSA 4YJOA 4RC2A 4DG2E 4B9DA 1FPUA 1SYKA 2PHKA 2PVYA 4IACA 1O6KA 5AP7A 5FG8A 3V8SA 1XR1A 3C4ZA 3BI6A 1ZYSA 2PUUA 2OZOA 4F1MA 3LFBA 5M4UA 2I7QA 1H0WA 1ZXEA 1R0PA 1VYZA 5DBXA 2W99B 4JRVA 4FZ6A 3FMKA 3HMMA 5IA1A 3KULA 5ANEA 3PJ2A 2PULA 4UMQA 4IM3A 5AV0A 2BRHA 2IW6A 3QKLA 3RCDA 4CZUA 5FP5A 3BBWA 4GFGA 5TF9A 1OGYA 3FDNA 3QRTA 4TWPA 4G34A 4MNFA 4JBOA 4C3FA 2JDVA 4D1SA 2AC5A 1LP4A 2OKRA 2VO3A 2C5YA 5CNNA 3EYGA 4L3JA 5HVYA 3I0OA 3TTJA 4DGNA 4O84A 5M55A 3PE2A 2YM7A 3HMNA 4DYMA 2G1TA 2UW9A 1ZARA 3WIKA 3ZDIA 1IA8A 1YQJA 2GDOA 2Z60A 4K0YA 5CASA 3S0OA 4O0WA 4JAIA 3ORMA 2YCRA 2C6TA 3HDMA 1RDQE 4EH2A 1Q8UA 1JPAA 1REJA 1ZAOA 4FK3A 5CEQA 3QYWA 5J1VA 1Y6AA 1R78A 3BX5A 2J2IB 4IWOA 4C2WA 3IOPA 4FEWA 4V05A 3ZSHA 2QR7A 1Y91A 4E93A 3FZSA 5HG5A 1F3MC 3NUAA 3EZRA 5EHYA 3KGAA 5J8IA 4MK0A 4R3CA 4B0GA 3V5LA 3GBZA 4CXAA 3MI9A 4AW2A 3GCPA 4QMQA 3BLQA 1SVGA 2P55A 2QHMA 4BCNA 2W9FB 2XK3A 3A4PA 3OBJA 4MQ2A 3ORKA 3OF0A 2VAGA 2BCJA 3OOMA 2BTRA 4Y46A 5HX6A 3FSKA 3MVHA 4LRJA 3RHKA 3BZ3A 3IW6A 4ARKA 5IG1A 3TDWA 1ND4A 4GG7A 2XEZA 4XP3A 3CR0A 3JVSA 5IQCA 4XG7A 1H07A 3CEKA 5CF6A 3FZTA 1SMHA 3VN9A 3PP0A 1KWPA 1JWHA 1TVOA 4PDOA 1GIIA 4RT7A 3O8PA 2VO0A 2OZAB 3AC3A 2VO6A 3KMWA 1PXPA 2HENA 3HGKA 4FV9A 1G3NA 3L8PA 2HY81 4XG9A 3D5VA 4EHZA 5AEPA 5CALA 5L2TA 1PKGA 3QU0A 3HAMA 4EK6A 4EK8A 2VUWA 4E6CA 2RFSA 5ANOA 4DE4A 1AQ1A 4LFIA 3DS6A 5JGBA 5HKMA 4IB3A 2UW8A 5CENA 3HA8A 3SXFA 1L3RE 4BCIA 4IB0A 4C35A 3KXGA 3NYVA 2RIOA 3WZEA 4ZMEA 3EZVA 3UIMA 1XWSA 1URCA 2EXCX 4NM7A 4AN2A 5HIEA 4ACCA 3PY1A 3SXSA 5J5SA 4PMSA 2WTDA 5CEOA 4F6UA 4YZMA 3RI1A 4F08A 4AUAA 1OB3A 5ETFA 3FZPA 5CEMA 4ANLA 3VUKA 4BGHA 5CVGA 2PMOX 5M57A 3C4XA 4EC9A 2B53A 3I7BA 3BE2A 3SRVB 1ZMWA 3VBWA 4EH3A 3BHYA 4C4IA 4S34A 4YHTA 1QPJA 2C0OA 5HIBA 4TYHB 3GI3A 1W2CA 2YABA 5CS6A 4O81A 3GU6A 4FT3A 3WF9A 1YWNA 3PIZA 5FM3A 4UXQA 4HYUA 5GHVA 5C01A 4JBQA 2I0EA 3PA5A 4D9TA 2HOGA 3QWKA 3UZRA 4KD1A 3GFWA 2R3JA 2ZJWA 4XP2A 2ITTA 4ZTQA 3I1AA 2QOIA 2WQEA 4LV5A 3VS3A 2G15A 5FUTA 4CFXA 4U42A 3AC2A 3TUDA 4ZZNA 5FQDC 3COHA 3VONA 3F82A 4A07A 1KOBA 1OMWA 4AGDA 2ZB0A 5CAOA 3LXNA 3HP2A 1FVTA 1WMKA 2XM8A 5AMNA 2R3GA 4QQCA 4I6BA 4OLIA 5CSHA 5EQPA 3G33A 4NUSA 3GCQA 3GXLA 4EK5A 4O4FA 3UJGA 4NKSA 2W5AA 3EFWA 5ANGA 4MD7E 4LG4A 3I4BA 4FT5A 3W8LA 3BQCA 3NNUA 4ANOA 4L53A 2PL0A 3OMVA 4DCEA 2QU5A 4CZYB 3NS9A 3AGMA 2NRYA 3G51A 3W2PA 2JIVA 3GU8A 4ZJIA 1YXVA 3RTPA 3N4TA 4J8NA 4EYMA 3IS5A 1XBBA 3EHAA 4HGTA 4BCFA 4O7NA 3AKJA 2PVKA 3ZO2A 3PIXA 3OEZA 4FKTA 5IISA 2YDKA 3CTQA 4CTBA 4X2FA 4L44A 2XRWA 4RX9A 4EONA 4O7ZA 4I0TA 3MTLA 3FPMA 4EUTA 4YC8A 3L9PA 2UVYA 5FM2A 3ZZEA 3LHJA 3QA8A 5CAPA 4GK3A 4ZLYA 4IB1A 4LL5A 4XNEA 2X8EA 3FMDA 3IDBA 3PWDA 5DRDA 2G2IA 3EKKA 3LFEA 3LOKA 2Z7RA 2R2PA 4MNEB 5BVOA 5KMMA 3RK7A 3NFGB 4AT3A 4QMYA 2W1IA 1Y57A 4KWPA 1BI8A 3GB2A 5M4FA 2XIXA 4IFGA 4LGGA 5EM8A 4DAWA 5I3RA 4MXZA 1WVXA 4FT0A 2WIPA 3F3TA 2B9FA 4QPAA 1CSNA 2WELA 3KXXA 4DEAA 3PZEA 2YCFA 3Q4ZA 3FEGA 2YJRA 4HCUA 3LM5A 4RIYA 3TNHA 3WYYA 2XJ1A 4IAAA 4DFUA 4BI1A 1DAYA 2PPQA 2C30A 4YLKA 1BI7A 3L9LA 3BELA 3A4OX 4FIIA 3ROCA 4XG3A 5J1WA 1U5QA 4J96A 4QYEA 3TWJA 2VTLA 4TYIA 3TIZA 1KUTA 2C1BA 3FI2A 1OIQA 2ERZE 3HV4A 3TNPC 4ANNA 3MSSA 4EORA 4ZJVA 4NEUA 2XRUA 3ZSGA 3LQ5A 1PKDA 4EBVA 3LPBA 2HAKA 1OBDA 4CKJA 2PUPA 4OAVB 3R1QA 2PY3A 4I6FA 4IHPA 2BIYA 2OIBA 3DTWA 4J71A 5E9EA 5FXRA 4ORKA 2RF9A 3QTUA 4FZ7A 4X7QA 4BDJA 5A4TA 2ZFYA 1H1WA 5HE2A 3LFCA 2G01A 4AGCA 2XJ2A 4DBXA 1M2RA 3VUMA 3MBLA 3SQQA 2CGVA 4XYFA 4GL9A 4PUZA 3II5A 2YLFA 4WRGA 4AFEA 2LGCA 2F7ZE 3OCSA 4O6EA 5CANA 4MVFA 5IQAA 4I4FA 4E4XA 2Y9QA 2PVLA 2X4FA 4FV0A 4HCVA 4IADA 4IM2A 3C7QA 5HICA 3MA3A 1YHSA 2YISA 3R00A 2EXMA 3FLQA 5C8KA 4QMOA 2YM4A 1WCCA 2XKCA 2C6IA 3WZKA 2JKQA 4FNZA 4HYSA 4HOKA 2ITXA 3KL8A 3BGZA 3Q4UA 4CGAA 4DLJA 4FZDB 3EJ1A 4YJUA 3LFQA 3TNIA 4D4YA 3E63A 1SVEA 3DQXA 1U54B 4GV1A 4W4XA 4JI9A 3KK8A 3U6HA 4PNIA 4IVDA 4AN3A 4AS0A 5HVKA 5EHOA 1L8TA 3ZLYA 4K2RA 3G90X 4RMZA 3ZMMA 4M69A 1JSTA 3F88A 4RGJA 2DS1A 3AMYA 4BDDA 2J0KA 4QPMA 5EG3A 4U40A 3JPVA 3RAIA 2C3LA 1W7HA 4W9XA 4APCA 3MB6A 2YWVA 4MHAA 5AV3A 1MRVA 4FF8A 3ZBFA 3D14A 3ZXTA 2Z8CA 4CVAA 5B2KA 4ASXA 4XMOA 4KS7A 3D2IA 3KRWA 3FMMA 5DR2A 1K3AA 2CLXA 3HA6A 3PDTA 3CCNA 4NCTA 2BRBA 2X0QA 3D9VA 3ZRLA 4G1WA 5I3OA 4D1XA 2FO0A 4LQMA 2X2MA 3H9RA 5FD2A 4BCOA 5AAGA 4OTFA 4A7CA 4GUBA 1PJKA 4JS8A 5HCXA 5K0KA 3WI6A 4AACA 4CRSA 3CPBA 2EXEA 1J91A 4F99A 4CQEA 2EWAA 1K9AA 2JKMA 1REKA 2ZVAA 5D1JA 5FWKK 3N4VA 2X6EA 5E8YA 5CEIA 2HZ0A 1PYEA 4M12A 4PRJA 4YURA 4D2TA 1UWJA 1ZY5A 1XH4A 4NM3A 2IF8A 3FXZA 1MQBA 4X3FA 4ZY6A 3V6RA 4ACDA 4DG3E 2WQBA 3LJ1A 2W0JA 4GJ3A 5HGIA 5HORA 5EW8A 2F49A 4ZK5A 4IVCA 1P5EA 2C5NA 4AQKA 3B8QA 4QMWA 5B2MA 2XKFA 3DU8A 2JDSA 3MFUA 4FTRA 3GUBA 4GJ2A 2H9VA 4CSVA 4EOSA 4F4PA 4TN6A 3RZFA 5IH4A 5HNGA 2ESMA 4DT9A 3UODA 2NO3A 1ZOGA 1CKJA 2OXXA 3U51A 2NRUA 4QD6A 3UIXA 4HPTE 4QP4A 4EH6A 3AD5A 2GNJA 3OS3A 4C02A 3NPCA 2VWUA 1OI9A 1XO2B 3R1NA 2XVDA 3LFSA 4FZAB 1XH7A 3ZUTA 3IW4A 5D10A 4EQMA 5CQWA 2OIQA 3QXPA 4OGRA 2UW6A 3BEAA 5DRBA 1ZOHA 4MQ1A 5EYCA 2F7XE 4X6QC 4Z7GA 2C47A 2UW5A 1J7UA 4AA5A 4GRBA 2RFDA 2ZB1A 3IGOA 3QZFA 3FKNA 4Q9ZA 3EYHA 2OSCA 4TPTA 5K5NA 4FSTA 2RG5A 4L9IA 4YO6A 4FIJA 3U6JA 2BRGA 1GZOA 3KXMA 1ERKA 2O64A 3PPKA 4UB7A 4F9CA 3G0EA 3NYOA 2BTSA 2OICA 3P79A 4D1ZA 4BCKA 5B2LA 3EN9A 4J53A 5LVOA 4LV8A 2R3FA 3KIOC 3KB7A 3V01A 1RJBA 1YXTA 3LE6A 4QNAA 5ETIA 3KRXA 1FINA 2XP2A 2W05A 2OI4X 3K3JA 2UZLA 2QC6A 3H0ZA 1JAMA 3L8VA 4X6RA 5K5XA 1PXJA 3O8UA 4A06A 4CMUA 4F9YA 4MWHA 3VBYA 4BDCA 1Q41A 5FBNC 4PPCA 3VS5A 3BWJA 2G9XA 2XF0A 4LGDA 5M07A 1G8JA 5HTBA 4GCJA 5IEYA 1BX6A 4O22A 5LMKA 1U46A 4OTWA 4KIKA 3S3IA 3PXKA 3RK9A 4TY1A 2B9IA 4G3DA 3BL9A 3QFVA 3MV5A 3RHXA 3W0NA 2J0LA 3HRBA 3ZFXA 1M52A 2OBJA 4F0IA 2W5HA 4ZLZA 3W0OA 4BFMA 3UBDA 4NWMA 4BHNA 4MEDA 1LEZA 3E92A 2OLCA 3OWKA 2UVZA 3JUHA 4FL3A 4G6LA 5JMSA 4C4GA 5EQEA 2WU7A 3TNWA 5DH3A 4F78A 5EM7A 4OT6A 4FG9A 4A9RA 2YEXA 5AAEA 1VYWA 4M7IA 2RFEA 3FLNC 2BMCA 2X2LA 3CP9A 2IZRA 4FJVA 4AAYA 2GMXA 4WD5A 3DKFA 4ZMFA 4MWIA 3CC6A 3PXRA 4O21A 4Z55A 3UYTA 2KULA 5LCKA 3WZUA 1ZOEA 3UOKA 4JG7A 1WBOA 1NXKA 3TV6A 1GIHA 3FL4A 3DAKA 3VQHA 2RL5A 3ALNA 4EYJA 3KXHA 2O3PA 4FSRA 1ZYJA 4RA4A 2HZIA 5BMSA 2VTIA 1WBSA 3LM0A 4FIEA 2VNYA 3D7ZA 2CDZA 4YZBA 4A9SA 5I9VA 2ITVA 5DN3A 3GC8A 3EQBA 4L8MA 3PUPA 2J90A 1TZDA 4OTDA 5CAUA 2H34A 4ZSLA 3IONA 3TJDA 4CT1A 5JSMA 2ZOQA 3UDSA 2C6OA 3HV5A 3I81A 2E9UA 4FODA 1PHKA 3NGAA 4IANA 5AADA 4K6ZA 4BDIA 4U81A 5BUIA 2VTSA 1F5QA 4FX3A 3R83A 4ERKA 2PE2A 3EQDA 4LRKA 5GNKA 3WF6A 3W0QA 3GC0A 3IGGA 3NYXA 4OT5A 5EW3A 3H10A 3NNXA 5LJJA 3JR1A 2ITOA 2UZNA 5JFWA 3NR9A 3KCKA 3EH9A 1IG1A 4I5CA 2AQXA 5L4QA 4ANSA 4QDEA 3EWHA 4XG6A 3VHKA 4BTKA 3BHHA 4QP7A 2XNNA 1RE8A 3GOPA 4K1BA 4QMVA 3TNQB 3A8WA 4HZRA 4CG8A 2W5BA 2YERA 3VAPA 4M13A 3AQVA 3D7TB 1ATPE 5CT0A 3ZC5A 4EH7A 5KMNA 2BDWA 3HECA 4AT4A 1ZMUA 5EDQA 3UC3A 1KE7A 5EYMA 4R5YA 4NJDA 2HIWA 5IH6A 3PWYA 2WMTA 3DAJA 3NDMA 4ENXA 1U4DA 3OUNB 4H05A 2IW9A 3WE4A 2YA9A 4GT3A 2ITZA 2UZEA 3R7YA 4WG5A 2JAVA 1M7QA 2QOBA 3S95A 4LV7A 5D11A 2VX1A 4A4OA 4RFYA 4EWHA 3E87A 1H26A 1JSUA 1PW2A 2GFSA 3QCSA 3PA3A 3FSFA 5IQGA 4ACGA 4AOJA 3LQ3A 4Y83A 4ZY4A 4EHVA 4YJSA 5I9WA 4JIKA 5BYLA 1QCFA 4XLVA 5HO6A 4FIFA 1ZYLA 3KY2A 4FIGA 2P33A 3ANQA 4YJTA 4QRCA 4FICA 4ZTLA 4OAUC 5KMKA 3HAVA 1UNLA 2HWPA 4MTAA 4FTIA 2QONA 5BX0A 5HO8A 5I5ZA 3RP9A 2JAMA 3QKKA 5LQFA 2ETKA 4Y5QA 2CKPA 3Q9ZA 2JKOA 4L68A 4AZEA 1A06A 1HCKA 2OJGA 2QOLA 2R3IA 3COIA 3PVUA 3R28A 4U5JA 5AR5A 3RPOA 3V6SA 3THBA 3A2CA 2YIXA 4FEUA 3RINA 4HJOA 4HYHA 4AOIA 4PPBA 3ZLSA 4LDTA 5HLPA 4FZFB 2Z7LA 3GGFA 5EYKA 4E4LA 3TUCA 5ITAA 3CD8A 2CLQA 4ANQA 4DA5A 3PXFA 4JXFA 2JC6A 3KK9A 3ORXA 2XCKA 4MBJA 5EKNA 4EOPA 1JKKA 2XUUA 4K8AA 4DGMA 4N57A 4CT2A 4QP8A 4OBQA 4O7LA 3MYGA 4JBVA 3ROYA 4CYIA 4RRVA 3PRIA 4FL2A 4U3ZA 3MH0A 2IZTA 1OIUA 2VTAA 1H1PA 4NK9A 3U6IA 1OBGA 3NMUF 2Y4PA 1B6CB 4C37A 2QI8A 3ZUVA 3G6GA 1M2PA 2UUEA 2J0JA 3FZRA 3LCOA 3Q52A 4Y73A 4YNOA 5JFSA 4GH2A 1HCLA 2PWLA 3DAEA 3MPMA 3IW7A 2UZOA 5EW9A 4AA4A 3U4WA 4V01A 4QP3A 3WF7A 4RJ8A 3I0QA 4D4RA 3VBTA 3GENA 4R3RA 4UY9A 2RSVA 4MAOA 4DDGA 4BB4A 1M7NA 4R1VA 4FRFA 4E4MA 4U3YA 4NT4A 4Y95A 3FC1X 4ERWA 5EYDA 3A60A 2BVAA 2GNLA 3CY3A 3DJ7A 2CNUA 4FSNA 2BHHA 3SW4A 5ANKA 5T6KA 3CPCA 2XKDA 4JBPA 3R9HA 5M4IA 3E64A 4JR7A 3LCTA 2WGJA 1Q8YA 5GJFA 4D2VA 5H8BA 4C33A 3HRFA 3E8CA 4WO5A 2IZUA 2ITWA 5A6OA 4FYNA 2P2IA 3QX2A 3E3PA 3OTUA 3V5TA 4C7TA 5DIAA 3F2RA 4ZSGA 4AGWA 1XMLA 2C3IB 4GFOA 3LAUA 3BLHA 4CRLA 3R2YA 4QP9A 5BVEA 1Y8YA 1PF8A 2VX0A 3DKOA 4AZFA 3VW6A 3O8TA 5KHXA 4FVRA 3PVGA 4YTIA 2E9PA 3OCGA 1OKVA 4FOBA 3MN3A 4QMZA 2Y6OA 1JBPE 3QWJA 4H1MA 4RIXB 4BVUA 5CQUA 3FL5A 4BDAA 3EL8A 5HD4A 3ULIA 3DXQA 4ALVA 4GUEA 4E73A 2OXYA 5IQFA 3NCZA 3VHEA 3ZC6A 5CEKA 5KMIA 2ITPA 2UW3A 3ORIA 3FAAA 3U8WA 4DLIA 3EFJA 2W4OA 5LVPA 4XHKB 1ZWSA 3PSDA 4FOCA 2VX3A 3HV7A 4EOQA 2W1DA 3CGOA 5IA4A 5LWNA 3SHEA 4KB8A 2CGUA 2QO2A 4UZHA 5AR7A 3K5VA 3KMMA 3PYYA 3CLYA 3ZFYA 4EZ7A 3BHUA 3QA0A 4P90A 4RFZA 4E6DA 4JG8A 1J7IA 3GC7A 2VGPA 4EOIA 3ATSA 2PVFA 3NW5A 4R6VA 4XG8A 4RWJA 3HRCA 5IKWA 4MUQA 4TWCA 4OTHA 5GJDA 5JGAA 5B0XA 3TZ8A 4OTQA 5BV3A 3SG9A 4IWQA 4DTAA 2JDRA 4C61A 3QX4A 5JKGA 4YJNA 3HVCA 4QMMA 4C3PA 3VW8A 2CKOA 1IASA 1ZY4A 3DY7A 3OY1A 4U80A 1WBVA 5DR6A 3IPHA 2JIIA 2UZBA 2BKKA 4NJ3A 5DI1A 2V62A 3UVPA 4BDFA 2FB8A 3SG8A 4EH4A 2CKEA 3DFCB 4G2FA 4NFNA 3HV3A 4G5PA 3R63A 1UWHA 3KXNA 3F6XA 3ODYX 3QD2B 4L3PA 4UYNA 3UC4A 3OWJA 3Q04A 3OCBA 2OZAA 5IA5A 3RZBA 2E2BA 1YWRA 4TTHB 4JVGA 2O5KA 3ZDUA 3F3UA 2NPQA 4YNEA 3JS2A 3DJ5A 4I6QA 3W2RA 2X1NA 3FV8A 2EB2A 4NM0A 4WNPA 3F3WA 3DKGA 4KBKA 4O0VA 1TQPA 2PSQA 4YSJA 1TFFA 5HESA 4CFWA 4G9CA 4A9TA 4WG4A 2QNJA 4L6QA 5BYZA 2PVMA 3RM7A 3ZM4A 3O2MA 4F7NA 2PYWA 3DLSA 5D9HA 5DMZA 3CJFA 2GSFA 1URWA 2C5VA 5EOLA 4F0FA 4ZLOA 1A48A 2RGPA 3HLLA 4O6LA 5EOBA 4EC8A 3ETAA 2QOHA 3UIUA 3VS2A 4KIQA 4EH5A 5HOAA 2BFXA 2XYNA 2JFMA 3AD4A 3UOLA 1T46A 3HP5A 5FEQA 5IH5A 2XNEA 2LAVA 3AGLA 4WIHA 3SRVA 2ZM4A 3OT8A 4JQ7A 3RM6A 2VNWA 2RFNA 4M14A 1V0OA 4JX7A 4AQCA 4AX8A 1UKIA 2PVRA 5IMEA 4UX9A 4HGLA 3LXLA 4E5AX 4KRDA 4TYHA 2WMVA 2W7XA 5AR2A 3EQRA 5A4QA 3LKMA 3D83A 3PJ3A 1T45A 1ZLTA 2JBOA 5AUUA 5CSWA 4RJ5A 2IJMA 2XAOA 3N4UA 2WMBA 3O50A 3QQJA 4RC4A 2YAKA 1E1VA 4D2RA 1KOAA 2VRXA 4IMYA 4DEHA 4CG9A 1U59A 4FKSA 4C4FA 4Z9LA 4S30A 4IC7A 3W33A 4C57A 1YXUA 3KMUA 2WFYA 1JSVA 3HEGA 4KBCA 3UP2A 2VGOA 4H39A 4EQCA 2OJIA 2XIYA 4HW7A 1UA2A 4JR3A 4LMUA 4M15A 3R7OA 1J3HA 1U5RA 3SV0A 3PPJA 2QO9A 3BQRA 4UWYA 2XZSA 1YDRE 1OGUA 4I21A 5AP5A 3ZTXA 4AE6A 2J7TA 2ZMCA 4B8MA 2WTCA 4FTQA 4KKHA 4V04A 2WB8A 3O7LD 3GQLA 3E7OA 3FC2A 4WNOA 5AM6A 4U9AA 5E1EA 4DG0E 3FMEA 2YN8A 3MJ1A 3R21A 4V0GB 5T68A 2NNWB 1JKSA 3QTIA 4OTRA 1QPCA 1G5SA 3SDJA 1PY5A 2X0PA 2BAJA 2JGZA 4L67A 3I7CA 5AR4A 4PDYA 3JY9A 4BCGA 4TW9A 2OF4A 4FNXA 4UMTA 2QCSA 2GTMA 3DQWA 3QC4A 4S2ZA 3CKWA 5K3YA 1Q61A 2QOKA 3QHRA 4FT9A 4J95A 1GZKA 5H9BA 4BBEA 1DS5A 3FLSA 2YWPA 3L8XA 4DEIA 3SA0A 2HZ4A 3VUGA 4FEXA 4RQKA 3CGFA 4WOVA 3Q32A 4PMPA 2XIZA 5E8WA 3BWFA 3C50A 2DUVA 3ZLXA 2BDFA 2E9VA 4AA0A 4PTEA 4IZ5A 4OUCA 2OFUA 3H0YA 5CT7A 2GFCA 4LUDA 2PE1A 3D15A 5CU6A 4AN9A 4BGGA 3C51A 3QUDA 4MNEA 4RA5A 2X81A 3R2BA 3VULA 3UG1A 2BAQA 3BKBA 4IXPA 2FSMX 3NIEA 4LL0A 4LOPA 2HXLA 2P4IA 3VUDA 2VTNA 5KUPA 3NW6A 3OUKA 4OTIA 2X6DA 2PMNX 2V0DA 3MH3A 5CYIA 1SNUA 5EFQA 2XK7A 3P4KA 4ZS0A 2X2KA 3DB6A 3COMA 4RPVA 2YM3A 3C9WA 5FBOA 4PP7A 3TXOA 3LJ2A 4U43A 2J5EA 2WAJA 1OL6A 4I0SA 3R8PA 4W8EA 2ETRA 1FGIA 3MFTA 4BKYA 4DGOA 3QUEA 4XV2A 3NIZA 3TACA 3AMAA 4ZSAA 1XH8A 3P7BA 2J0IA 4F63A 4O38A 3VF8A 4X2NA 5FTGA 3GVUA 3WZJA 3F66A 2KTYA 2AUHA 4IJ9A 5DT0A 3I6WA 3C0HA 3HZTA 4MXOA 4R8QA 5EQYA 4JMQA 3A99A 4MXXA 4BYJA 4IEBA 2ITQA 3Q2JA 3R02A 5D7AA 3UQCA 2EU9A 2W4JA 3AXWA 3F7ZA 4IX6A 4JX3A 5EK7A 3U4UA 3RPRA 3UE4A 1WBWA 5DEWA 4C3RA 1JOWB 3Q9XA 5L6PA 3OG7A 2UZVA 4ZSJA 3OW4A 3T3UA 1NW1A 4BJJB 4ZP5A 2C3JA 3UMXA 5BQ0A 4KKEA 3TKUA 5F94A 4TWNA 1YVJA 3C13A 4WUNA 4JRNA 5TO8A 4YUQA 4RVLA 2ONLC 3NUPA 3NX8A 3C1XA 3VIDA 4Z7HA 2I1MA 3MDYA 1IA9A 3NW7A 5LOHA 2JEDA 3G0FA 2I6LA 2YDJA 3F61A 3H30A 3Q4CA 4OTPA 5F20A 5FDPA 5DYJA 4DHIB 3JY0A 1OL2A 3LXPA 3R6XA 1W0XC 1FOTA 3PTGA 4FV2A 4KSQA 2CCHA 5HE3A 5D7VA 4BKJA 5HBJA 1KE8A 3RBWA 1Q3DA 4WUAA 3QKMA 4QYHA 1YKRA 4BYIA 3QQHA 3PG1A 4ZTSA 1AGWA 1U54A 4D55A 2CN8A 2OH0E 4PL4A 5ACBC 3KREA 4GSBA 4HVHA 2FSOX 3G5DA 3MIAA 4ITIA 2AEGA 5TR6A 2CGXA 4O0SA 2QURA 4IVAA 4NW6A 1Y6BA 2PZ5A 4F7LA 4HVGA 5BMMA 2WMWA 4FTAA 3C4FA 2XCHA 1XMMA 2GS6A 2A0CX 3DKCA 5KBRA 2QOQA 2Y6MA 3PZHA 2Y4IC 5AUXA 3PG3A 4FSQA 2XK6A 3KCFA 5AP4A 3HNGA 4A9UA 3R30A 5GZ8A 5TE0A 3CQEA 2XH5A 3B8RA 3BU6A 4PX6A 4TZRA 3S1HA 1PMNA 2HXQA 5AV2A 4UMUA 2YFXA 3UO6A 1OL7A 3A62A 3HMPA 4QMXA 5IA2A 3BL7A 4G3GA 4MH7A 3Q60A 5CU0A 4CCBA 4N70A 4FKGA 5GIPE 3LLTA 3R9RA 4RWLA 1J1CA 2PVJA 2J6MA 3PVWA 3RK5A 4FV1A 2AYPA 3V04A 4O7WA 3TYKA 4RX5A 4TYGA 3LXKA 5E1SA 4GVJA 3CY2A 2WTVA 3RGFA 2X7GA 4J8MA 4G3FA 4GYGA 2O65A 1VR2A 2QR8A 4GVAA 4C4EA 3ATTA 5IMXA 4IM0A 2BDJA 4FKJA 2HK5A 3AD6A 4FV8A 4RQVA 5F9EA 4UZDA 3S4QA 3FQHA 5AUZA 4QQ5A 2PUIA 3PFQA 4BRXA 1Z9XA 4KINA