3QD2B

Crystal structure of mouse perk kinase domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
332
structure length
271
Chain Sequence
ASRYLTDFEPIQCMGRGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQEEMDEPKVYLYIQMQLCRKENLKDWMNRRCSLEDREHGVCLHIFIQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDTHGQVTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYSFSTQMERVRIITDVRNLKFPLLFTQKYPQEHMMVQDMLSPSPTERPEATDIIENAIFENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 2-alpha kinase 3
publication title The structure of the PERK kinase domain suggests the mechanism for its activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 78
structure length 271
sequence length 332
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qd2B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qd2B01
3EKKA 4Y95A 4EH7A 3BHYA 1U4DA 3OT3A 5HBHA 4PF4A 1PXKA 3NCZA 1V0BA 5E1EA 4CZTA 2VGOA 3AGMA 2BZKB 4USDA 3DKOA 3ZHPC 2OK1A 4CKJA 2PZYA 1M2QA 3DA6A 2FA2A 4YSMA 5M08A 1CMKE 4IANA 3ZSGA 2ZVAA 4CV9A 3HAMA 3NUAA 5BVWA 4EK6A 2YCQA 3MW1A 2C30A 2IZTA 2XZSA 4XMOA 4ACMA 2ITNA 2C4GA 4IW0A 4HOKA 3DK6A 4CFUA 2ZMDA 2CCIA 2HOGA 4EC9A 2VO6A 4BCIA 2JLDA 4EZ7A 2WKMA 3GXLA 3Q4CA 3VBYA 2ITUA 3LFSA 3QF9A 2XA4A 3R00A 3AD6A 3F2AA 2WTKC 4GU6A 3U6HA 5DOSA 1E9HA 2X2MA 4MXZA 5FQDC 3HP2A 1FPUA 2HY81 3T3UA 4C4GA 3NIZA 4C35A 5BVOA 3UNKA 3ZM9A 4IB0A 3SXSA 3SW7A 2F7ZE 4WNKA 5CS6A 3WZKA 3U9CA 3V8TA 4LRJA 1W84A 3KVWA 3MIYA 4FEQA 3PVWA 3PZEA 2OG8A 4O2ZA 5IEYA 3CP9A 4FNYA 4PWNA 3BCEA 1GAGA 4ZTHA 3PJ8A 3TIYA 4DFLA 5IH6A 1A06A 2RIOA 4X0MA 4O7LA 1OUYA 3M2WA 4HW7A 4FL2A 3ZRKA 1IASA 5HIBA 1PYEA 2VWVA 3QXPA 3VS2A 3KMUA 4BDGA 4FV1A 1YHVA 2WMTA 3AC3A 3NIEA 4C34A 3FMMA 1WBWA 4BKZA 3PA3A 3G15A 2YM4A 5J9LA 1YXXA 1UU8A 4IFGA 2OF4A 5HG8A 1TQPA 2VV9A 3OCTA 4O84A 4H1JA 4K6ZA 1BLXA 2C6OA 3FBVA 4JAJA 2AC3A 5M57A 2F7XE 4IZ7A 4PPAA 5M06A 3MS9A 2NNWB 4YTFA 4M67A 4ZTMA 2OICA 4YTCA 2QOFA 3I5NA 3AC8A 2J50A 1R0PA 5EK7A 4RWLA 4WG4A 3DY7A 3LMHA 3D5XA 5A3XA 3UIXA 4A06A 3DBFA 3UMXA 4CTBA 2WTJA 4FV0A 3RHXA 3WF9A 5HLNA 3BHHA 4ZAUA 4AW1A 1RQQA 1ZZLA 5DN3A 4BZDA 4F6SA 3FMJA 4XX9A 1YDRE 1GOLA 1YXSA 2OKRA 3QUDA 4FTIA 4AXAA 4ZJVA 2QG5A 2XS0A 4FT9A 4WHZA 4XBRA 4R5SA 3QHRA 3KF4A 4C4HA 5A4TA 3AGLA 5CU6A 3O50A 4GL9A 3F5PA 4XG3A 5EFQA 3D9VA 2ZM4A 2WNTA 4UWCA 2PE1A 4A9RA 3D0EA 4Y46A 1MQ4A 4JLCA 3V6SA 2I1MA 4NW6A 5KHWA 2BTRA 4BCPA 3PSCA 4ZTLA 2VX0A 1VR2A 4HZRA 3PP1A 2Q83A 3MFTA 4LM5A 3TNPC 3U87A 2XNMA 4QP8A 3HNGA 4G6OA 1RJBA 3KF7A 4IB3A 3FMNA 4JDHA 5DE2A 5IUIA 3DFCB 4E6QA 5CEPA 3IDBA 3R1YA 3FKLA 4M13A 4I92A 4L44A 3JUHA 5L2SA 4Q5HA 4DTAA 1LEWA 5CEQA 3QRTA 1BL7A 3DKGA 2PVFA 4FKLA 3GEQA 4AOJA 3O7LB 4FOCA 3OCSA 2FSMX 4I23A 4LYNA 5FTGA 3ODYX 3AC5A 2QR7A 3EL8A 3UJGA 3QL8A 4B0GA 2HWOA 2Z7QA 3A2CA 3EYGA 2BDWA 4YJTA 3FSFA 3ZO2A 4MBJA 5BX0A 4FT7A 4RIYA 5AAEA 4MXOA 2YISA 4G2FA 1OITA 4RLKA 1YI4A 2BRGA 4CMUA 4OBOA 5AUTA 5CT0A 4AZWA 2G2IA 2VRXA 4FNXA 5CU3A 4EOOA 2YZAA 3KXXA 4BR3A 2BILB 5FM2A 3NWWA 1GNGA 5L8LA 4QTCA 1OL2A 2R2PA 5LMBA 1Q5KA 3QCQA 2J2IB 1XQZA 4KBKA 5H8GA 4FZFB 5B7VA 2XUUA 5BPYA 5LVMA 2QKWB 2GS7A 3F6XA 3DXQA 4D4VA 2J5FA 4WA9A 2BRBA 2PZRA 2PMIA 5LVPA 4C61A 3AQVA 3OWKA 5CENA 3UQGA 4BL1A 5AM6A 5A6NA 3EKNA 4IXPA 4C59A 1PKGA 2QU5A 2Y6OA 3SX9A 4GFOA 2CHLA 4ZY5A 5IQGA 4HYUA 3DLSA 3EZVA 4PL5A 5BVKA 2ZM3A 4FIIA 4RC4A 4E5AX 3VS1A 4JQ8A 3OP5A 4KKGA 3RJCA 4U9AA 3Q5IA 4RX7A 2ZV7A 4GW8A 3O8TA 1F5QA 4D2WA 1AGWA 3TKIA 3B8QA 2DYLA 2YJRA 5I9VA 2VTAA 3A4PA 3GC8A 2WTIA 4F6WA 5TT7A 3R9NA 4NTSA 4FK3A 5AIRA 3LXPA 4K77A 5FEQA 2XKDA 3ZC5A 1SNXA 3AT4A 2NRUA 4LV5A 4QD6A 5HHWA 5IA3A 3GT8A 2EUFB 3GC9A 3HV4A 2YDKA 3QQFA 5C03A 4M8TA 4LGHA 3GP0A 4UYAA 3PIZA 2QLQA 2W1CA 1ZYDA 3UPZA 3W55A 3D5VA 3QZHA 2XNPA 2WU7A 2FSTX 1H1QA 3C51A 4N57A 3CJGA 3TM0A 5KMKA 4L7FA 4RA4A 4WRGA 1X8BA 1SMHA 2JITA 4FK6A 4V05A 3FJQE 5TF9A 4BCOA 2R0IA 4K1BA 4U3ZA 1DAYA 2WXVA 3DU8A 4MNEA 3FC1X 4FX3A 3DOGA 3Q9ZA 3FHRA 3VC4A 4E6CA 3R9RA 2ETMA 1M14A 2Y4PA 5JGAA 1IA8A 2P3GX 2WMWA 3L1SA 4X3JA 5KHXA 3A8WA 4FKPA 4J71A 5CSWA 3UZRA 4YTIA 4PP7A 4DEIA 4MQ2A 2VZ6A 4W8EA 3E92A 3VUKA 2YABA 5ANOA 4EH2A 5K0XA 3MB7A 4QO9A 3A7JA 2J51A 4QYGA 2UW9A 4DTBA 4XUFA 3T9TA 1NVRA 3ZLWA 3EYHA 3RAKA 1P4FA 4IX4A 4E4XA 1ZYSA 3FI2A 3P4KA 3UGCA 3GQLA 3AT2A 4RIWB 5CNNA 4GYGA 3TNQB 4R3PA 4IAAA 4QRCA 3HRCA 2C6TA 5E9EA 2CN5A 3QLGA 3GU5A 2H8HA 5TOZA 3BYOA 3HMPA 3ZO3A 1JWHA 1S9JA 3QGWA 4JVGA 2P55A 1U5QA 2W5AA 3RM7A 1ATPE 3EQIA 2UVXA 2WAJA 4ZLZA 3EN5A 1XH6A 5CVGA 5HVJA 4UMRA 1YKRA 5JGDA 3B2TA 4KWPA 2RG5A 4FTUA 5ETAA 3ZUTA 5KUPA 5A4CA 3RHKA 3RKBA 5GZ8A 1A9UA 2WPAA 1JPAA 2YEXA 3KMMA 3TKHA 4DBXA 2HXLA 3PFQA 3SDJA 2VTJA 4L67A 2YM3A 5FBOA 4CV8A 4PDOA 3EFLA 4AS0A 2JIVA 3DTWA 3LQ5A 5T6KA 3ENHA 3POOA 1YXUA 2ITQA 3DAJA 3VS0A 4BIBA 3OBJA 3UVRA 2X4ZA 4FV3A 3WARA 3NEWA 4ANMA 3ZEPA 4O27B 4TKSA 4RWIA 4F7NA 5EQEA 3KCKA 3D5UA 4HYSA 5TR6A 4EH5A 5LWMA 1Q8ZA 3IDCA 3LFEA 3NW5A 3VVHA 3QA8A 5IDPA 2GMXA 3MESA 5F94A 5C8MA 3TZMA 4D5KA 2GNLA 3HEGA 3OY3A 2W1ZA 3JR1A 2VTTA 3EN9A 5CF6A 4EOMA 2HELA 4HGLA 4I6QA 1JSTA 2IN6A 3RINA 5AV2A 4QMLA 3D5WA 4TY1A 4FV7A 3A7FA 3TUDA 4IVCA 2YAKA 3BE9A 3PZHA 3QZGA 1UU9A 5JN2A 4I21A 3R8MA 1PF8A 4BVUA 4E6DA 5FXSA 5AP4A 3ZRMA 4E7WA 2IZSA 4ANLA 5BVEA 4KABA 5DT0A 3QX2A 1FMOE 4I0RA 5K0KA 2QOCA 3UZPA 4BI0A 5ITAA 2QURA 1FVTA 2OW3A 3QA0A 4FKRA 4P90A 4AGUA 3GCSA 3FLZA 4F9AA 1L8TA 2BDFA 4Y85A 4MD8E 4HVGA 4UMTA 4XG9A 2C68A 4HGTA 1PXNA 3CPBA 3PXYA 3E7OA 4EK8A 4FV2A 4O7ZA 3UODA 3MH3A 4RBLA 2IG7A 5H3QA 3OROA 3FI8A 3ZM4A 4K0YA 4A9UA 3MDYA 5AP1A 3G5DA 4C37A 5CQWA 1CKPA 3P86A 4F9BA 3Q2JA 2VTIA 3AMYA 5CSPA 3UP7A 4MXYA 3VBVA 3QQKA 5IH5A 2WELA 2C3IB 3TZ9A 4E5WA 5FWKK 3QX4A 4F09A 4DH1A 4WD5A 3WF5A 2ONLA 3LFBA 4FT0A 4C57A 1YW2A 3PWDA 4FZ7A 4HGSA 3HA6A 4LRMA 5CSXA 3BELA 2BCJA 4OBPA 1Q8TA 5HCZA 2B0QA 1H07A 3HECA 3F82A 2JDRA 4GRBA 5B2LA 4LGGA 3LXLA 4TYHB 5CEKA 3R30A 2XM8A 3KVXA 3FAAA 2C6LA 2FO0A 4GU9A 4ERWA 4EOLA 2XNEA 4PMTA 4D2SA 4TWOA 4JI9A 4BTKA 3DBDA 4CGAA 3TNWA 3GGFA 4QP7A 3K2LA 2IVUA 4U43A 2V7AA 5DR2A 4BI1A 3R7IA 4IX6A 2LAVA 2C6IA 3KXGA 4G3EA 2BVAA 3PJ1A 5E92A 4BCQA 3NR9A 2JBPA 5CASA 5LJJA 3G33A 3H9RA 3A7HA 1L3RE 4XV2A 3E5AA 3RM6A 4ACHA 2R3OA 4IAIA 2GNFA 3UO5A 2AYPA 3KQ7A 3PJ3A 1URWA 4USEA 4BGGA 3E88A 4W4WA 4XHKB 3MH2A 3BRBA 3EFJA 4IQ6A 5DMZA 3V5PA 5HI2A 4KD1A 4YZCA 2XH5A 4MTAA 5EI2A 2CGWA 4QMZA 4YJRA 5E8TA 1MP8A 1JSVA 1APME 3Q53A 2F2UA 4EH4A 3K5UA 2IPXA 4O0TA 4D55A 4HVDA 4YPDA 4BCMA 4YJNA 3MY5A 4YSJA 3O8UA 3RK7A 4QTBA 4NK9A 3ATTA 1B39A 3QQLA 2JAMA 3OC1A 3R28A 4I20A 5HVYA 2OIQA 4FV9A 2RFDA 3D7ZA 3HA8A 4I6FA 4IVBA 1IAJA 1KE9A 4JG6A 4RX8A 5AX3A 1OPKA 4EH3A 3TZ8A 4EOQA 2PVYA 4M0ZA 3IO7A 4PDPA 4ACCA 3D83A 4ALUA 3LPBA 2B53A 1WBNA 2R3QA 4MVFA 4HPTE 2QG7A 4U80A 5ACBC 1STCE 4APPA 2CKOA 5ETCA 2YDIA 1JKLA 2C1AA 3B8RA 4G6LA 4O0XA 3ZLXA 3ZZEA 4B9DA 1PXIA 4CRLA 1TVOA 4CZYB 3L9PA 3C4XA 1J7UA 2W96B 3RCDA 2HY0A 3OD6X 4M0YA 3D7TA 3FLQA 3QQUA 4PV0A 4XH6A 5EHLA 3RP9A 5C8KA 3DQXA 4GK3A 1I09A 4RT7A 4FGBA 4KUJA 3UOHA 4K2RA 4FUXA 3A62A 2W1GA 4GS6A 1GY3A 4ZY4A 4KA3A 3ITZA 2OBJA 4GCJA 4ANOA 3BU6A 5EW8A 2CPKE 2ITYA 3QTXA 2UZUE 4O6EA 4OR5A 4C4IA 2E9NA 4XV9A 5D41A 4ORKA 4TYHA 1KUTA 2ZB1A 2R7BA 2YM5A 3ZTXA 2UZLA 3KCFA 1LPUA 3JYAA 4JIAA 2BKKA 1VYWA 3JXWA 5C27A 2LGCA 3LOKA 1WBVA 4I41A 1ZMVA 4HYIA 3MVMA 3P78A 4IX5A 4ZY6A 5HO6A 3LCOA 3LFDA 4X21A 4F0GA 4GK4A 4EQUA 1KE5A 3FLWA 3W2RA 5JFXA 5A54A 3P08A 4I1ZA 3UPXA 1UVRA 4ACDA 5LMKC 3UOKA 3GVUA 3EQPA 1GIHA 3GENA 2I7QA 4C7TA 4XEYA 4DFUA 4ACGA 4C3PA 4ARKA 3CE3A 2JEDA 3V3VA 1WVYA 4UY9A 1KV2A 3CQEA 4Y5QA 5TKDA 4C62A 5HZNA 2I0EA 3ZUVA 3QRKA 5I9WA 3R7YA 5CALA 3MPMA 3V04A 5KBQA 5DWRA 2HIWA 4RFZA 5LARA 4F1OA 4YMJA 4A9TA 4U5JA 4DA5A 2Y8OA 2V62A 1E1VA 5C1QB 2XEZA 4X2KA 1K9AA 3I0OA 4JX3A 5KMOA 4NEUA 2E9VA 3OWJA 3I7CA 2CMWA 4OTIA 4JDKA 4YBJA 4D9UA 2NRYA 3ANQA 3ULZA 2PMOX 3W1FA 4GMYA 5JZJA 2GQRA 1UWJA 3BEGA 3IW5A 3DKFA 5F9EA 2E2BA 4FC0A 4L68A 3OFMA 4OUCA 1GZNA 2CKPA 5LWNA 1O9UA 3Q04A 3QWKA 4LUEA 2XP2A 3ID6C 1FOTA 3GOKA 2PK9A 3CLYA 4ZJIA 4BYJA 3ACJA 1ZRZA 4NTTA 1ZXEA 4EK3A 5C8NA 2W4JA 2WTVA 2PE0A 1MRVA 1XH4A 4X6RA 2ZOQA 4HGEA 2BRMA 4JR7A 3F69A 4GG5A 2EXMA 3CTHA 5IA0A 4G5JA 3BEAA 3S4QA 3FZ1A 4W4XA 2Z02A 2W4OA 3UO6A 3NLBA 3MJ1A 3ZSHA 1UU7A 2WMQA 2O5KA 2X81A 3U9NA 5IA1A 5D7VA 5DBXA 3RK9A 4D1SA 2UW8A 3BBWA 5AV1A 3F5UA 2IW6A 1ND4A 5M56A 5CEMA 5JEBA 4K33A 3FKOA 4IVAA 2B9HA 2XKFA 4LL5A 3TEIA 5H9BA 3LVPA 1OPJA 5AR5A 2EVAA 3ENMA 3ZONA 1H0VA 4EOPA 3P0MA 3VWAA 4KS8A 3HV6A 4AGDA 3JVRA 2RF9A 4FE2A 5LCKA 4I6HA 3NYVA 4PDSA 4L42A 5AP6A 2X2LA 3ALOA 4QQJA 4QYHA 3OCGA 4O0VA 5EYKA 3T3VA 4OAVB 4ZXTA 2XRUA 2YERA 5FRIA 3EB0A 4YHTA 2C6DA 3VS4A 5IDNA 4M68A 4QNAA 3KREA 3N4UA 3E8NA 5IF1A 2WD1A 4YZ9A 2G2HA 1J7IA 1YHSA 2FVDA 1PY5A 3EQBA 3VW8A 4BCJA 1OKWA 4XRLA 3C0IA 5EM5A 4FSYA 4GK2A 2GFCA 2UVZA 3HP5A 2E9OA 3DV3A 2IZRA 4YC8A 3O8PA 1YDTE 4F63A 4BDJA 3IQ7A 1HOWA 3G9LX 3C4WA 2YM8A 2HZIA 2Z7RA 3COMA 4G17A 4MAOA 4TL0A 4FSMA 5AEPA 4FNZA 3VIDA 4ALVA 2JIUA 4D4SA 3NCGA 4HYHA 4YHFA 4DFNA 1Q97A 3FDNA 3EWHA 3II5A 4EHGA 4QT1A 5CX9A 3KGAA 1KE6A 3SRVB 1NW1A 4TNDA 3TT0A 3VS3A 5EKOA 2J5EA 5K9IA 4D4RA 4M14A 1H1SA 3B2WA 3FMDA 5C4LA 5BMSA 3AD4A 1HCKA 2WQEA 3QUPA 1YWVA 3VW6A 4C3RA 5CZHA 1ZYCA 2V55A 3CC6A 3BKBA 3LW0A 4FTRA 3RI1A 4HVIA 1KV1A 3WF7A 3H9FA 3PP0A 1K2PA 4XP0A 5IQHA 2YCRA 2W99B 4AP7A 3TL8A 4ZSLA 3TJCA 2YDJA 4PNIA 4B7TA 4FG8A 2R4BA 3OWPA 3DJ7A 1SVEA 5D10A 4NM5A 5GINE 3HGKA 4XCUA 1JLUE 4M84A 4AU8A 3BHUA 3NNWA 1J3HA 2A4LA 4GUEA 3OXTA 5I9UA 4U0IA 2J7TA 2XIZA 5ACKA 4DFYA 2XKCA 3LQ8A 1LP4A 3F5XA 3I7BA 4QMUA 4DH8A 5B0XA 2OZAB 4UZHA 4AAAA 3OOGA 5FXRA 5I9ZA 2YIYA 2R3JA 4UWBA 3BYMA 1YOLA 2VTPA 4EWHA 3FZPA 3SHEA 1RE8A 2QI8A 2CN8A 4DF3A 4S2ZA 3NZ0A 4I94A 3ZDIA 4BWXA 3P5KA 4G3GA 4MF1A 3AT3A 4AE6A 5F1ZA 3DBCA 1WVWA 5HQ0A 3BLRA 3DAEA 3A7IA 4XG4A 4A4XA 4FSTA 1KE8A 3O96A 4P4CA 1H1RA 3E3PA 5AIKA 4E4NA 3RZFA 4F0IA 2Z8CA 2VWWA 4LMNA 2VO0A 1ZOEA 3PG3A 4X2NA 4TWNA 4TPTA 4O7VA 3DS6A 4J52A 4WOVA 3DNDA 1YRPA 4YJOA 2W4KA 4M15A 1OVEA 3EQGA 3GU7A 5EDQA 2YHVA 1XWSA 2HZ4A 4RQKA 3UDBA 1R3CA 1JBPE 2Q0BA 4WRSA 1FMKA 5J79A 4IWQA 3EQDA 4MBIA 3T9IA 4O7RA 4O1OA 4MD9E 4UYNA 2J0LA 3Q96A 4W9XA 5LMAA 3KXMA 4L9IA 2ETRA 5EQPA 2J0MB 1PRYA 3FQHA 2PUIA 3QC4A 3CQWA 3QHWA 1ZLTA 4IC7A 3ORPA 5I4NA 2XK7A 3FL5A 2W1DA 3Q2MA 5EM6A 5FXQA 4DFXE 5HD4A 1Y57A 2OZOA 5K4JA 4O7NA 3SRVA 3UNJA 3MPAA 3WBLA 3QZIA 2G15A 2WU6A 4NIFA 4QMXA 3QCXA 4BCGA 1G8SA 4NYEA 4PTGA 3LQ3A 4RJ7A 5AADA 3FUPA 4XOYA 2WO6A 2O2UA 4GYIA 5K5NA 4IWDA 3KULB 3CY3A 2PZ5A 3FMLA 3EH9A 4CNHA 4DEAA 5CLPA 3IS5A 3NNVA 4ASZA 4BYIA 2FGIA 2QQ7A 1LUFA 3FE3A 4GT5A 5JFWA 1XR1A 2IVTA 3V5TA 4E3CA 1SVHA 4IE9A 4BI2A 2XM9A 2ITWA 3R83A 3HUBA 5A4QA 1ZMUA 4W4VA 5CVHA 3ZFYA 3VJOA 2PU8A 4QMVA 3S0OA 2VUWA 2XJ1A 3HDNA 3RAWA 5E91A 2XEYA 2OXYA 4RX5A 4V01A 2EU9A 3VF8A 4PL4A 4EEVA 4Z3VA 1B6CB 2RG6A 4NL0A 4O7WA 1BI7A 1H08A 1OIUA 4F1TA 4WUNA 5L6PA 2BHEA 4KS7A 3QBNA 2R9SA 1OKYA 3OBGA 5AR7A 5J9YA 1W98A 5K5XA 1ZAOA 3MPTA 4IZYA 4WT6A 5EHOA 5I0BA 4U8ZA 4BCFA 4K8AA 3G6GA 1OIYA 2C6KA 2WQBA 1Q99A 3E63A 4U97A 5DHJA 4Z16A 5JQ5A 2V0DA 2PVHA 4TNBA 5HBJA 1UKIA 3R22A 1H1PA 3WZEA 3HV7A 4GFMA 5AP5A 4BZOA 3BYUA 5CU2A 2C0TA 3IOPA 3WE8A 4TXCA 3F2RA 2GHGA 3WF8A 4XG2A 4U7ZA 4GUBA 3V5QA 5EYDA 1OM1A 3MVLA 5L2QA 3SKCA 4C3FA 3LZBA 4EONA 3K54A 4WSYA 5J5TA 5J8IA 4IACA 3IW6A 1WBTA 3SG8A 3TDWA 4IZ5A 3TDVA 2FB8A 3E64A 4O86A 3FSKA 3D94A 5AR4A 2I6LA 4DGGA 4QTEA 1W8CA 2FYSA 2XVDA 2OH4A 3FY2A 1YI6A 3HZTA 4AGCA 4O83A 3PYYA 4CFWA 3PDTA 2UW6A 4MCVA 3L8XA 4XOZA 3F2NA 5EH0A 5AWMA 4BDFA 3O17A 2PWLA 5DNRA 1G5SA 4BBFA 4D2PA 2FUMA 2WMVA 4IM0A 4J99A 3N4TA 2G1TA 3I0QA 3LM5A 4E4MA 3LFCA 2KULA 3LJ1A 2ITXA 4Q5EA 4QMOA 3PRFA 2J90A 4O0WA 4H1MA 4K9YA 4OGRA 5HBEA 4JBPA 3LCDA 2Y7JA 2V5QA 2W17A 5DVRA 3DXPA 2YCFA 1AD5A 3F66A 3G9NA 4I24A 4S33A 4JOAA 3E93A 3PY1A 3R04A 4QMQA 3U6JA 4IMYA 3P7AA 4OTFA 4DCAA 3Q4UA 2P33A 1IEPA 5ANEA 1W82A 3WZDA 4YJPA 4NM3A 3PY3A 3I1AA 3C0HA 2BR1A 3O0GA 3WYXA 4AN3A 2PL0A 2WOUA 3MTLA 5HX6A 5LCJA 2B9JA 5H2UA 3QRIA 1P14A 4FOBA 2OXXA 4UB7A 3EQCA 4YUQA 3SOCA 2YJSA 1XKKA 5DYJA 2QHMA 5AJQA 3ZC6A 2PUUA 2W1IA 3F9NA 2WMUA 3NRMA 3SXRA 4F7SA 5LVNA 2J0KA 3ATSA 4NKAA 3ZS5A 4ANNA 4BBMA 2BZHB 4FV6A 1XBBA 1HCLA 3FV8A 3BZ3A 4R3CA 5AR3A 4CLJA 1E1XA 3UZTA 3N9XA 3OW4A 3FXXA 2W9FB 5CSVA 4ZSJA 4J1RA 4DG3E 2H6DA 4DGLC 4O7YA 3Q5ZA 3V51A 2X9FA 4EKLA 1H4LA 2PTKA 1FQ1B 3I81A 2IW9A 5IMXA 5EYMA 2W1FA 5DRDA 4QPAA 5M4FA 4AW2A 4C2VA 4R3RA 5AUVA 3VJNA 4FTLA 3L8VA 2JC6A 3VUDA 4NM0A 4TYJA 3D2KA 4NKSA 2UZBA 3BIZA 2E9UA 4NT4A 2WZJA 2OFUA 4CG8A 5BUEA 4WNOA 2HAKA 3F3WA 2JKQA 4IH8A 3SD0A 1PYXA 2DQ7X 5FGKA 2RGPA 4FNWA 5AUUA 4ZEGA 2PSQA 3AC4A 4J95A 1Y8GA 3DDQA 1VYZA 2B54A 3F88A 5H8EA 5HNGA 4GH2A 5AA8A 2ZB0A 1Q61A 3PVBA 4MD7E 3RPSA 5AAGA 5JFSA 1GZKA 2X7GA 2PZIA 3TJDA 4BDHA 4ASEA 1M52A 3UYTA 3NVMB 3KFAA 4ASDA 3C5UA 1H26A 2UZVA 2ITZA 4I5CA 4YZMA 4BGHA 5E8UA 3EN7A 3BX5A 5H8BA 4QMNA 4I5PA 5KZ0A 4W4YA 3BWFA 5M55A 4MNFA 5EI6A 4P5QA 3ORTA 4AW5A 1NY3A 3VQHA 3FXZA 5FEDA 2YIXA 2I0YA 3SA0A 4CQEA 3H0YA 3NUPA 1BUHA 4YBKA 1O6KA 4N4SA 5IU2A 3AC1A 4KNBA 4LOPA 4ENXA 5HE3A 5AAFA 3BWJA 3SC1A 3U8WA 4O6LA 4JBOA 3F3TA 3M1SA 1OUKA 3OW3A 4DFBA 4UBAA 2JAVA 4KKEA 2H34A 4OAUC 3FC2A 4FKJA 4QQTA 5JRQA 4ERKA 5A46A 3Q32A 5E7RA 5AUYA 4Y72A 5CAUA 4LFIA 4L52A 5I3OA 4AFEA 4ENYA 5CU0A 1G8AA 5J1WA 1PXMA 3QYWA 4P7EA 3RTPA 4AGWA 3R9OA 3VBQA 5F20A 4RVMA 3OEZA 5B2MA 4IADA 4PP9A 4AOIA 2HCKA 4FTMA 4CFVA 5CF4A 3PY0A 3VHKA 4FKOA 4C4FA 3SV0A 2WMXA 4UMUA 3S95A 2CCHA 4GG7A 5T68A 2X7OA 3BYSA 3F7WA 5IQBA 2RL5A 1H24A 1BI8A 4H58A 3RAHA 3HMIA 2WQNA 2CGUA 3W2QA 4ZTRA 4XV3A 1F3MC 3CXWA 3NAXA 4JRVA 4BCHA 4E73A 4AA5A 5HCYA 1UWHA 4HJOA 4D1ZA 3ZXTA 5KE0A 5J5SA 4BDEA 3ZRLA 2GHLA 3SVVA 3MFRA 1H00A 5HORA 5EDPA 2B52A 3AOXA 1PXJA 4F9CA 5C9CA 4HVHA 3W8LA 3IW8A 3HAVA 2VD5A 3KRRA 1XJDA 4MHAA 5CEOA 4CRSA 4KRDA 5HD7A 5C4KA 4GJ2A 5AR2A 5E8ZA 3MGYA 4C33A 2PMNX 1U5RA 5EDRA 4S32A 5CXZA 3PVUA 5F4NA 1PMVA 3NS9A 3Q4TA 4IWPA 5KX8A 3C5IA 4N6YA 5LVLA 5KBRA 2QO9A 4U44A 3W10A 3EN6A 4GIHA 5IPJA 3ZFMA 3DT1A 5DRBA 4YU2A 4GSBA 4GKIA 4I0TA 3S00A 2BFYA 4JQEA 2BKZA 3ZLYA 1YOMA 5HTIA 2QD9A 3HDMA 4G5PA 3ET7A 4G1WA 2WMRA 1OPLA 3O71A 4BF2A 4EBVA 4AWIA 1J7LA 1Z57A 4CFMA 2UW3A 4CQGA 5CAPA 3GCUA 3HX4A 1Q3WA 5GJDA 4X2GA 3HV3A 2I0VA 3IECA 4RVKA 5AP3A 3LXKA 2IJMA 3NGAA 2JIIA 2PPQA 5D11A 4QQ5A 5ANDA 1ZARA 5HX8A 4AF3A 2QLUA 3RAIA 5HTBA 3PE2A 2PY3A 4C8BA 4QP9A 1XH5A 2VTSA 5HNBA 1DS5A 5CZIA 2CNUA 5BYZA 3C50A 3RCJA 3NDMA 3QD0A 4EC8A 1GIIA 1FGKA 5I9XA 4RIWA 5HLWA 4L45A 4WKQA 3R1QA 2DS1A 4AT3A 2JKOA 4DG0E 3OUNB 4IFCA 3TV4A 2VGPA 3TIZA 4FKSA 4NCTA 2ITVA 2OWBA 5L2TA 2ZJWA 4H05A 3CBLA 3SQQA 2C6MA 3UC4A 1OMWA 4CT2A 2VNWA 5CNOA 2WMSA 3CGOA 2VTRA 3FHIA 5J1VA 1T45A 4NCTC 4QMYA 5LQFA 3WILA 3FZRA 4BTMA 2HZNA 4UWYA 4BDDA 1FBNA 1UNGA 2ERZE 5AP7A 4IAKA 4XLVA 3CJFA 3BLHA 4RPVA 2P0CA 5HG5A 2OGVA 3PA4A 2NO3A 4UXQA 5ANJA 4FIHA 1FINA 3IG7A 4M66A 4FG9A 4FA2A 5M4CA 2YM7A 1VJYA 3I6WA 1DM2A 3EOCA 3H3CA 4Z7GA 5J9ZA 3ORNA 1JKKA 3BHTA 4FZAB 4GVAA 3QZFA 4MWHA 4OT5A 3BBTB 4A7CA 3R8VA 4YNOA 5JGBA 2EB3A 4YJVA 5CI6A 3LCSA 4ITJA 4FTCA 1OIRA 4M69B 4WNPA 3D4QA 3ELJA 4A4LA 2ZMCA 4RWJA 5HNIX 5M4UA 2RFNA 2BRNA 1XBAA 1Y8YA 2VU3A 4I0SA 1XH8A 1OKZA 4G9CA 4DE4A 1S9IA 1ZMWA 4J8NA 4OTPA 3LFNA 3GI3A 3QQHA 2QODA 2VTMA 3UMWA 3VS6A 4ZTSA 3RNIA 1BX6A 2C5NA 3OWLA 2I0HA 4QMWA 4CFXA 5AV3A 3FXWA 4CT1A 3FMHA 2GQGA 3AMBA 1V0PA 4JIKA 2VTHA 1WAKA 4M3QA 2B7AA 2W06A 4MXAA 3W2PA 4B4LA 3V5JA 3IGOA 4N6ZA 4QYYA 4RQVA 3AXWA 4FIFA 3RZBA 2RKUA 2X6EA 2W1HA 3LXNA 1OGUA 1NXKA 2R3KA 5DFPA 5L2IA 4YLKA 2UUEA 2JDVA 3QQGA 2CDZA 4G31A 4PRJA 4IDVA 2YAAA 1YVJA 1JVPP 4X2JA 4QP4A 3A99A 4ZZOA 2AUHA 4EQMA 3HLLA 2BZJA 4LQMA 1T46A 4BTJA 2C6EA 4BIDA 4BHZA 3RGFA 4ITIA 3Q9YA 4HCUA 4AOTA 5HTCA 1UNHA 1AQ1A 4GJ3A 4RC2A 4BZNA 3BYVA 2VWUA 2BAKA 4ID7A 2C5XA 4FBXA 2QU6A 2F9GA 5KMLA 5M44A 4W9WA 4GKHA 3TTIA 3VAPA 5JFVA 3W2SA 2OO8X 3BU5A 3Q9WA 3CQUA 5G6VA 4D2VA 4QOXA 2BIKB 4RLLA 3Q60A 5KNJA 2A19B 5LXMA 3CSVA 4AZFA 4OW8A 3HV5A 5KMNA 5GHVA 1PMUA 4KRCA 4FSZA 4D2TA 3KK9A 5HE0A 4WNMA 3LJ0A 3EIDA 3MN3A 4YZBA 5GJFA 3BV2A 4E93A 4D0WA 1J91A 2R3HA 5FTOA 4E8AA 2HK5A 1Q8WA 3V8SA 4B6LA 5IEVA 3GCVA 5DR6A 5HESA 3OUKA 2UZNA 4FKIA 5LMKA 4FVRA 4KIQA 2XJ2A 1QMZA 2JFLA 2WEIA 1PXOA 4AZTA 1QPJA 3F3ZA 5FTQA 3K3JA 4EHVA 4R1VA 2BFXA 2WMBA 4IDTA 2BZIB 2BDJA 5HE1A 1YHWA 3NUUA 3G90X 3QKMA 4YLJA 4RZWA 5FEEA 5M09A 3H4JA 1PHKA 2PULA 3OXIA 3U4UA 2C5OA 3AD5A 4L7SA 2UZDA 3R73A 5IUHA 5DGZA 4FYNA 4Y8DA 3TWJA 3SG9A 5DT3A 2GNHA 4EJ7A 5E8SA 4G3DA 4FYOA 4OLIA 4EH9A 4R6VA 1BYGA 2R3MA 3E7VA 3LFQA 3QKLA 4RJ3A 4C0TA 2C3KA 1XHAA 1ZY4A 2XKEA 3BGZA 1JKTA 2J4ZA 2XCHA 3CPCA 4JAIA 5JQ8A 2O64A 4L3LA 3RNYA 4QPSA 2QNJA 2XB7A 4C2WA 3V01A 3S1HA 3TUBA 5JSMA 1TKIA 5FDXA 1R0EA 3BI6A 4IB5A 3UTOA 4AUAA 4F08A 5CAOA 4Y83A 1V0OA 1J1BA 2XCKA 2JFMA 2OFVA 2ZV8A 4PMSA 5FM3A 3PSBA 5ICPA 2ITPA 4BB4A 2YACA 2YIWA 5A9UA 1CSNA 5CU4A 3ZXZA 4D58A 4CVAA 5IA5A 1TQMA 2XIYA 4D1XA 5JMSA 1KWPA 2OJGA 4M12A 4YJQA 2PE2A 2DUVA 2VNYA 4FIEA 4YTHA 2XYNA 3R7UA 3D2IA 1URCA 3K5VA 3MY1A 5L6OA 1WBPA 2JBOA 1QL6A 2Z60A 2XBJA 3C4EA 4S31A 2UV2A 2VWIA 4Z55A 2GNJA 4ZZMA 5IZFA 1Y6BA 1JSUA 4M97A 3CTQA 2ZM1A 4U3YA 3QUEA 3MB6A 4CCUA 4FMQA 5HU3A 2Y4IB 3ERKA 2YFXA 4O0SA 4FTTA 3EJ1A 3NNUA 3GNIB 4OTRA 1WBOA 1Q24A 3KRJA 1O6LA 3JVSA 4UXLA 4L00A 1KE7A 2QO2A 4IAFA 5CT7A 5GJGA 1Y6AA 4I5MA 4PNKA 3A7GA 4GVJA 3GU6A 2P2HA 2OI4X 5E8WA 4YHJA 4D4YA 3KB7A 4JNWA 3U54A 2RSVA 4QYFA 4X7QA 4KIOA 1ZOHA 4ANQA 4ZK5A 4II5A 5GZAA 2XK3A 2YCSA 3U51A 3ZO4A 1YDSE 1YOJA 2YWPA 4BWKA 2B9FA 3FZOA 4TWCA 4XG6A 4U41A 2JGZA 3VN9A 4B8LA 4LG4A 4BDIA 3TTJA 4BBEA 5FG8A 4OTWA 3GU4A 2XRWA 3FPQA 4NH1A 5GIOE 2X9EA 3QTUA 3POZA 3TUCA 3WIGA 2HZ0A 4FSRA 4UMQA 3MVHA 3VF9A 3TNIA 2PHKA 3KMWA 3Q6WA 4DLIA 4DTKA 2E9PA 4EJNA 3CS9A 1JOWB 3ZH8A 4TZRA 2FSLX 4EKKA 1NA7A 1R78A 3QRUA 4FKTA 4KB8A 1YXVA 5BUJA 3HMMA 5DG5A 3ORKA 4TRLA 4G3CA 4IB1A 4N70A 3MVJA 4FEWA 4RA5A 4RX9A 2R3IA 4ZS4A 3FYKX 1W83A 4FR4A 3ZMMA 4E4LA 4QP6A 2X0GA 2F4JA 3ACKA 5ETIA 4EOIA 4XNEA 3KXNA 3NSZA 4JBVA 1TQIA 2WMAA 3W18A 3PXQA 4B99A 5KO1A 5CYIA 4EH6A 3UIUA 3OXZA 3CGFA 4EYMA 3E87A 3QCSA 2CSNA 2IZUA 4JQ7A 3JPVA 2B55A 3C4FA 4QNYA 3DQWA 5J7HA 4I93A 3VBXA 2WTDA 3V8WA 4EUTA 5LVOA 3EFWA 5BVFA 4TW9A 4FSUA 3R8PA 4EHEA 2VTQA 4CMOA 2Y6MA 4J7BA 4F7JA 5M53A 3Q3BA 2OLCA 2CNVA 3ZBXA 1CKJA 1H1WA 1OB3A 2WEVA 4RSSA 1MRYA 3KA0A 2GTMA 2F7EE 3PSDA 5JRSA 2VO3A 3VUGA 4EL9A 2CKEA 4JRNA 1GJOA 2GU8A 5E4HA 3KRXA 4MBLA 2XK9A 4ANBA 2QO7A 4FICA 3UQFA 4J96A 2QVSE 2J0IA 2YLFA 2UZEA 3PVGA 4BTFA 2BRHA 3WZUA 5CF8A 4XP2A 2QKRA 4FKUA 4Y73A 3JY0A 3NYXA 5L4QA 3OG7A 2GNGA 1OBDA 4CMTA 1M2RA 4R1YA 4C36A 5HIEA 2VO7A 4S30A 1YWRA 2XK4A 4C4JA 4EZ5A 2Y4IC 4YR8A 4O21A 3DFAA 3IPHA 4IM3A 4XS2A 3ANRA 5B2KA 4U81A 4NZWB 4UV0A 2A1AB 1U59A 1BMKA 1XO2B 3NW7A 4RRVA 1Y91A 3IONA 2J0JA 4IEBA 5EOBA 2B9IA 3ORLA 3QTQA 4YO4A 3LM0A 3NW6A 3DK7A 4N0SA 4UMPA 3WE4A 5IA2A 4R8QA 2YA9A 4EYJA 2CNQA 2C3LA 3OEFX 4JBQA 5HGIA 5LOHA 4JL9A 4ZS0A 3MFUA 5K3YA 4USFA 5KMJA 4JDJA 3G2FA 4EOSA 1U46A 2WTCA 3GB2A 3W16A 3ULIA 3P7CA 4KSQA 1QPCA 4O0YA 3ZBFA 4DEHA 3LFFA 1NVQA 2QOKA 5BNJA 5BQ0A 5HEZA 4D5HA 2GSFA 4YLLA 4EUUA 3UE4A 3FQSA 3PLSA 4QTDA 5FLFA 5KMIA 3MBLA 4K18A 3LJ2A 4I5HA 4JG8A 4Z9LA 4FTOA 5BMMA 2XK8A 5IQAA 4PQNA 4F1MA 3TACA 3ZO1A 4YP8A 2DWBA 4BKYA 3DTCA 4LV8A 3R7OA 3BQRA 2UW5A 3C4ZA 3ZU7A 4F65A 4I4EA 4F64A 4YZNA 2WIPA 1UKHA 2ZYBA 2ZAZA 4AACA 4Y5HA 1MUOA 4QPMA 4FTAA 3LMGA 3QXOA 1NVSA 5AFVA 4RIYB 2V22A 3UBDA 4JDIA 4YZDA 5J7BA 5KMMA 4RFMA 3PXRA 3DB8A 4O96A 3PJCA 2R5TA 5EQYA 2UVYA 3KY2A 2EB2A 5CQUA 5C01A 3IW7A 4FTJA 3RPRA 4BY9E 1IA9A 3T8OA 4KKHA 4FEUA 4IC8A 3H30A 4ZMFA 3VUHA 4QP1A 2IW8A 3V5LA 1OKVA 3EFKA 3PRIA 4O91A 4DINA 3PTGA 2OZAA 3A61A 2OIDA 5A6OA 4WUAA 5F95A 3FEGA 4F99A 2JDTA 2R0UA 3DKCA 3LCKA 4LUDA 3H9OA 3C13A 3E62A 2PVKA 3FYJX 1ZYLA 3P1AA 5EHYA 3AC2A 1OI9A 2CLQA 4ALWA 3RPYA 4G3FA 4CFFA 4KINA 2QOOA 2UW4A 2XNGA 3OY1A 3BHVA 4LI5A 3QWJA 2W5BA 3A8XA 3R9HA 2PVRA 5IEXA 3ORIA 2REIA 3O23A 5C26A 2UW0A 3Q52A 4BCNA 2JDSA 2A0CX 1IRKA 1UV5A 1OBGA 4DGNA 3TI1A 3BPRA 4E6AA 3UQCA 1UNLA 3THBA 2GPHA 4KSPA 4UZDA 4A9YA 3CIKA 3NUNA 5FDPA 4FIGA 1ZY5A 5EI8A 3G0FA 5DI1A 4R7IA 3UOLA 1Q62A 4LRKA 4AN9A 5IISA 3IDPA 4F70A 3EHAA 2ITTA 4EZ3A 2Z7LA 4ZSAA 1JAMA 5D12A 5DLSA 5AX9A 2YN8A 1PJKA 5A14A 2SRCA 2G9XA 3LE6A 4BHNA 4F9WA 4XJ0A 3NAYA 2VWBA 2X8DA 4TT7A 3C1XA 1H0WA 3MYGA 3QTSA 2G2FA 3R8ZA 3UNZA 2C1BA 2YLEA 1LEZA 3L9NA 4FODA 4C4EA 5KKRB 3L8PA 4QQCA 4WO5A 4FEVA 5CF5A 4DT8A 2R3PA 4HPUE 3G0EA 3R7GA 1Q3DA 3QD3A 4L3JA 5M4IA 5DPVA 4FSWA 3VO3A 3G6HA 4XRJA 4BN1A 1H01A 3FWQA 3OMVA 5CEIA 4DH3A 1CTPE 1YI3A 3RMFA 3TV7A 5HU9A 3VQUA 4DBNA 3SAYA 2W05A 3E8DA 3ORZA 4G16A 4MNEB 4RG0A 4F4PA 2X7FA 1EH4A 2OF2A 4IJPA 3AMAA 3QYZA 2OSCA 1PXPA 2PYWA 2ETKA 3ZDUA 3EN4A 3GU8A 3KU2A 4O7TA 3OTUA 3FPMA 2PVLA 3KULA 3BE2A 4MWIA 3DBEA 4FVQA 4DT9A 4BFMA 5IG1A 1GZ8A 3KC3A 3VUMA 5BVDA 3WZJA 5HVKA 3MSSA 3ODZX 4R7BA 3R2BA 5FD2A 3NX8A 4RVLA 5CWZA 3PA5A 3R8LA 3PIYA 3RK5A 2XYUA 3UP2A 4FEXA 5IQCA 1MQBA 2F49A 4WSQA 3GCPA 3W32A 4PMPA 5L2WA 5E90A 4PUZA 3IOKA 3DXNA 2XIXA 4NFMA 2XNBA 3FLYA 4QP2A 4OTQA 1K3AA 2GCDA 3Q9XA 3GUBA 2J6MA 1NT2A 3R1SA 4J98A 3BLQA 5A4LA 4IX3A 4RIXB 5HCXA 3S2PA 2A27A 4I6BA 3A60A 4GFGA 5EG3A 2XBAA 4BDKA 3OT8A 4FZ6A 4CKIA 4BC6A 3PUPA 5AM7A 5I5ZA 4I3ZA 3ZLSA 4UALA 4DGOA 4EH8A 3DZQA 4A07A 4OBQA 2ZV2A 4EK4A 2CLXA 3H10A 3OZ6A 3QU0A 4OTGA 1JNKA 1U54B 4NU1A 4BIEA 2EXEA 5I9YA 1IAHA 3R1NA 5IQFA 3CR0A 3HRBA 2UZTA 1SVGA 3GC0A 3R21A 4JXFA 4KIPA 5AUWA 5IH4A 3I5ZA 3MV5A 2VAGA 2VWYA 4W8DA 5G1XA 2BAJA 2C5YA 4AZEA 2HW6A 1RDQE 3IGGA 4BGQA 1WBSA 1GZOA 4LOQA 5CSHA 4CD0A 4PY1A 4KIKB 5CTPA 2QOHA 5L6WL 4HCTA 3KXHA 3LCTA 3NVKI 2XK6A 2C47A 4RFYA 4APCA 1OL6A 4IVDA 3OVVA 4PTCA 4AA0A 4Z7HA 3HRFA 4D2RA 3L9LA 2VX3A 4O2PA 4QMPA 5TE0A 2WHBA 3COHA 3R9DA 1OL1A 4CLIA 3COKA 4U40A 3O2MA 3ZYAA 4AFJA 4NW5A 3NUXA 3DCVA 3FMEA 3LHJA 1CKIA 1KOBA 3DPKA 4FTQA 3TNHA 4MK0A 5KKRC 4JT3A 3DB6A 4FTKA 1P5EA 2Z7SA 2XIRA 3REPA 5BUIA 4B8MA 3HMOA 4S34A 4X6QC 2W7XA 3OS3A 4L43A 4WG5A 4IHPA 3PXFA 5DA3A 5HLPA 3R01A 4FKQA 4YNEA 5CAQA 2JKKA 4BRXA 4QMMA 2JKMA 1H25A 2QCSA 2O8YA 3D14A 3RPOA 4DCEA 4F0FA 4WIHA 3VHEA 4XYFA 3FQEA 5IMEA 2IO6A 2GTNA 3R02A 2YM6A 3R0TA 5E8YA 1R39A 2WQOA 3F3UA 2ITOA 5DH3A 4I4FA 2PZPA 2OXDA 3QRJA 3SLSA 3L9MA 3VUIA 1DI8A 3L8SA 3F5GA 1I44A 4L01A 4PDYA 3M42A 3MIAA 3TG1A 5FUTA 4J97A 2IVVA 1YXTA 3LMIA 2CJMA 4NUSA 4AE9A 2BAQA 5K4IA 1XH9A 3AG9A 1SZMA 3FLSA 1SNUA 4H3QA 4QYEA 3FZSA 2G01A 2WGJA 4L3PA 1B38A 4RIXA 2OJ9A 3QTZA 4NM7A 4YURA 4DITA 3CTJA 3QAME 4IAYA 3NNXA 2GDOA 4DN5A 4HNFA 5EW9A 5KCVA 1FVVA 3LKMA 4EWQA 2QC6A 4H39A 2GQSA 2YWVA 5M51A 4IBMA 5I3RA 3ZOSA 2UZWE 2W9ZB 1A48A 2BROA 5E8VA 5E1SA 3RVGA 3NYNA 2OH0E 2BUJA 2WFYA 5FBNC 1KSWA 2IWIA 3BGQA 1PXLA 2QOQA 1Q8YA 1U54A 2C3JA 4FV5A 5EOLA 2B1PA 5AP2A 5FP6A 4HNIA 4AA4A 5JKGA 4JG7A 4QMSA 4TYEA 3DJ6A 4R77A 3EZRA 2W1EA 4FKGA 4E26A 3DJ5A 3ORXA 1OL7A 3F7ZA 4XLIA 1DI9A 2NPQA 3A4OX 3ZUUA 4R5YA 3CKXA 4KIKA 2QOIA 3TKUA 4O7SA 5IQIA 2O0UA 1J1CA 4FIJA 4HZSA 2FH9A 2X6DA 4MX9A 4O22A 5IA4A 3KK8A 2UZOA 5HO8A 4GV1A 5A4EA 4TN6A 2X2KA 5AUXA 1IG1A 1M17A 4OTHA 2BHHA 4CCBA 4UX9A 2BMCA 3VBTA 2GS2A 5FP5A 4HCVA 4BDAA 3EQHA 4FF8A 2EXCX 2H9VA 1WCCA 4QTAA 3TN8A 4IWOA 4OTDA 4E5BA 4FKVA 3ROYA 4KAOA 5ANGA 4Q9ZA 3PIXA 4MEDA 5JT2A 4C02A 5T3QA 5L3AA 2R7IA 3PE1A 3U55A 3V6RA 4A4OA 4EOKA 4YGAA 4YC3A 3TXOA 3WF6A 2ZV9A 3CCNA 3RALA 2PVNA 1WFCA 4IM2A 3KXZA 5J95A 2R3FA 4DH7A 2F57A 3N4VA 1H8FA 1ZYJA 3JS2A 4DEBA 1WVXA 2XIKA 2GFSA 4PMMA 4WBOA 4O81A 1P2AA 3HKOA 4V0GB 4FUYA 3F61A 4XP3A 5AV0A 4LMUA 3SW4A 5EM7A 3TZ7A 3IW4A 4YO6A 4BDCA 2Y9QA 4GIIA 4EI4A 2GS6A 2QONA 5KZIA 4F6UA 4C38A 2UW7A 3CKWA 1FVRA 1LR4A 1SYKA 3D7TB 1MRUA 4J53A 4MXXA 4RJ5A 2OJJA 4U6RA 4UEUA 5HIDA 4AZSA 4O38A 3RBWA 4Q2AA 2X39A 3P79A 3COIA 2VWZA 1DAWA 2QOLA 3LFAA 3FKNA 2CKQA 3OOMA 1W7HA 2WTWA 4L8MA 4BKJA 3F3VA 3KN5A 3QFVA 3C0GA 3WOWA 4DEGA 2C5VA 3UOJA 3NMUF 1PMNA 4FL1A 4DEEA 3MFSA 4IJ9A 3OHTA 1PKDA 3QD2B 2X8EA 2OU7A 1CDKA 2ONLC 2ZDTA 3HUCA 2YIRA 3MH1A 4ONAA 4U79A 5HOAA 2HWPA 3Q4ZA 1M2PA 3DK3A 2EWAA 3BQCA 3EQRA 3LAUA 3UO4A 1ERKA 3GC7A 4TWPA 5DR9A 2WB8A 5AUZA 3UVQA 3WIKA 4P2KA 5HG7A 2RFEA 3E3BX 2NP8A 2KTYA 1XBCA 4FV8A 1RW8A 3UIMA 4CYJA 5HICA 4D0XA 4XG7A 3R71A 4KBCA 2PMLX 4FKWA 5CVFA 5EM8A 4FSNA 2V7OA 2X8IA 3DZOA 4RGJA 3QGYA 3UG1A 3PPZA 3ZFXA 3GCQA 5AP0A 3QKKA 1H28A 3PG1A 4X3FB 1VZOA 5EYCA 3R7VA 2WOTA 4O0RA 4OT6A 3VS7A 1BKXA 5DEYA 1R1WA 4WBBB 1REJA 5CXHA 3FY0A 3HYHA 4O0UA 3G51A 4FL3A 3TV6A 3C7QA 5IQEA 2FSOX 3R7EA 2Q0NA 1H27A 4L53A 1OL5A 3UYSA 4EK5A 4QMTA 2GNIA 2ACXA 4O1PA 2JD5A 4ZTNA 3QALE 4IAZA 1OZ1A 4G34A 3ZEWA 3PXKA 4JX7A 2F2CB 4CSVA 2WIHA 2XMYA 4GT3A 3U6IA 3FL4A 4NJ3A 4RWKA 5D9HA 4RVTA 2OJFE 3QLFA 5ETFA 4HVSA 4DLJA 5E8XA 4ZSGA 3D15A 3UG2A 3UVPA 3I79A 3KN6A 3R63A 1Q8UA 4TYIA 1YWNA 4E1ZA 3SGCA 2W5HA 4ANSA 4RJ4A 5AA9A 1JQHA 1KOAA 2GHMA 3DBQA 4K11A 4NFNA 5HE2A 4AG8A 5CY3A 2R3NA 3KL8A 4JJRA 1Q4LA 1ZZ2A 4G9RA 2X4FA 2A2AA 5AMNA 3PWYA 4V0GA 3DGKA 4ZIMA 4AN2A 4TYGA 3MWUA 2PVJA 5CANA 2C0OA 3PJ2A 3NYOA 4P5ZA 4ZTQA 1XH7A 5IUGA 2VTOA 1F0QA 3K3IA 4MF0A 5D7AA 4R78A 3C4CA 3C9WA 4DAWA 2H96A 1SM2A 5HO7A 3EL7A 3QTWA 4FSQA 4V04A 1Z5MA 1WMKA 2XF0A 1UU3A 4EHZA 5AR8A 2XNOA 4ZP5A 2YITA 4FTNA 3PPJA 4YC6A 4CEGA 2BTSA 2B4SB 2RFSA 4O82A 4PTEA 3VRYA 1V1KA 1FGIA 3RWPA 4UN0C 2XJ0A 4YJUA 3TCPA 4XBUA 5L8KA 5GZ9A 2QHNA 3BGPA 3P23A 2CGXA 4QP3A 4ZJJA 3HL7A 5EKNA 3VS5A 4F7LA 4ITHA 4LGDA 4NSTA 4M69A 3UIBA 2P2IA 3ORMA 3P9JA 2C0IA 4FT3A 4R7HA 4CZUA 4U42A 4LOOA 2R64A 4AT4A 3PPKA 2YZLA 4DC2A 1JKSA 4BCKA 3ROCA 2QR8A 3MI9A 2HENA 5HG9A 4RC3A 3VBWA 3GOPA 3S3IA 4JR3A 4CKRA 1WZYA 4AX8A 2XNNA 1M7QA 4X3FA 4DFZE 2J9MA 1G3NA 1O6YA 2VX1A 2BALA 4ASXA 3RWQA 3BV3A 2HYYA 3IK3A 4EORA 4X3FC 3MA6A 1REKA 3DDPA 4H3BA 3HVCA 2VN9A 4H3PA 5L8JA 5J87A 3WYYA 5JK3A 4C58A 4AQCA 1GIJA 3MJ2A 4L46A 5BYYA 5CAVA 3CD8A 5ANIA 3VNTA 3DAKA 3VRZA 3QD4A 4DH5A 3I4BA 3MH0A 5GIPE 1UA2A 4M7IA 1W0XC 2C69A 3FI3A 4CYIA 5CI7A 5AV4A 5IQDA 2BPMA 2VTNA 3FZTA 2YIQA 3ZSIA 3NPCA 4PX6A 4PPCA 3H0ZA 4FG7A 4GT4A 2P4IA 1P4OA 3HMNA 2IVSA 3ZCLA 3GFEA 1Z9XA 4RZVA 5ANKA 4MQ1A 5DIAA 2PUPA 3I6UA 3SXFA 3U4WA 4BWPA 4MYGA 3O7LD 2CGVA 2VTLA 2R3RA 4PL3A 4CXAA 4G6NA 4BICA 2O65A 3O51A 3W2OA 3GQIA 3LLTA 3MY0A 4L6QA 1QPEA 4FGRA 4DYMA 3CY2A 2R3GA 3CEKA 4FI1A 4EBWA 4H36A 2PVMA 2WQMA 3KKVA 4MXCA 4MKCA 4NWMA 3WI6A 4E20A 4U45A 2ESMA 3E8EA 2VWXA 4NJDA 3W33A 4A9SA 4JS8A 4TTHB 4CTCA 4D28A 4XG8A 4EOJA 2O3PA 4D9TA 1VEBA 3ETAA 3W8QA 2R3LA 2WTKB 5HKMA 5BYLA 3VULA 5DT4A 3MTFA 3DNEA 5DEWA 3N51A 5TO8A 4YPSA 4CG9A 3QC9A 1YQJA 2JDOA 4ZSEA 3P7BA 3EQFA 5JZNA 4EQCA 2W0JA 1Q41A 2OIBA 1OIQA 2AC5A 4F9YA 3BU3A 3SOAA 4RMZA 3JY9A 4RJ6A 3M11A 3OF0A 3OTVA 3OCBA 3KRLA 3LLAA 3QTIA 4FV4A 4AW0A 2I40A 3ALNA 3GFWA 4DEDA 5BVNA 3KEXA 3UC3A 2ERKA 4MH7A 1QCFA 4IIRA 4ZMEA 1OECA 3R6XA 4FZDB 3NUYA 3R8UA 3VUTA 2BIYA 2QOBA 4X2FA 1ZOGA 4XV1A 3RPVA 4DGMA 3I60A 3MA3A 3V5WA 3QQJA 3KRWA 5M07A 4RJ8A 4ZLYA 3QTRA 1QPDA 4KBAA 2HW7A 4I22A 4FVPA 4AT5A 4PPBA 4RIOA 4GEOA 3DLZA 4J8MA 1PW2A 4DG2E 2X1NA 3GBZA 5D1JA 1M7NA 4WG3A 1IR3A 2HXQA 5JH6A 1CM8A 3PXZA 4DHFA 5IKWA 2OJIA 4YJSA 3FLNC 3EMGA 2PUNA 1ZWSA 3CD3A 4LL0A 3W2CA 3ZZWA 4FT5A 4CFNA 4NIFB 3FMKA 3NUSA 4IZAA 3PLAE 5GNKA 2Y0AA 4AZVA 4ZLOA 3QCYA 3R2YA 1PMEA 3FI4A 4BDBA 3E8CA 4Q9SA 4ZOGA 3IKAA 2O63A 2Z2WA 2ZDUA 4ZZNA 3LIJA 3Q6UA 1BL6A 5EW3A
chains in the Genus database with same CATH superfamily
3EKKA 4Y95A 4EH7A 3BHYA 1U4DA 3OT3A 5HBHA 4PF4A 1PXKA 3NCZA 1V0BA 5E1EA 4CZTA 2VGOA 3AGMA 3VONA 2BZKB 4USDA 3DKOA 3W0PA 3ZHPC 2OK1A 4CKJA 2PZYA 1M2QA 3DA6A 2FA2A 4YSMA 5M08A 1CMKE 4IANA 3ZSGA 2ZVAA 4CV9A 3HAMA 3NUAA 5BVWA 4EK6A 2YCQA 3MW1A 2C30A 2IZTA 2XZSA 4XMOA 4ACMA 2ITNA 2C4GA 4IW0A 4HOKA 3DK6A 4CFUA 2ZMDA 2CCIA 2HOGA 4EC9A 2VO6A 4BCIA 2JLDA 4EZ7A 2WKMA 3GXLA 3Q4CA 3VBYA 2ITUA 3LFSA 3QF9A 2XA4A 3R00A 3AD6A 3F2AA 2WTKC 4GU6A 3U6HA 5DOSA 1E9HA 2X2MA 4MXZA 5FQDC 3HP2A 1FPUA 2HY81 3T3UA 4C4GA 3NIZA 4C35A 5BVOA 3UNKA 3ZM9A 4IB0A 3SXSA 3SW7A 2F7ZE 4WNKA 5CS6A 3WZKA 3U9CA 3V8TA 4LRJA 1W84A 3KVWA 3MIYA 4FEQA 3PVWA 3PZEA 2OG8A 4O2ZA 5IEYA 3CP9A 4FNYA 4PWNA 3BCEA 1GAGA 4ZTHA 3PJ8A 3TIYA 4DFLA 5IH6A 1A06A 2RIOA 4X0MA 4O7LA 1OUYA 3M2WA 4HW7A 4FL2A 3ZRKA 1IASA 5HIBA 1PYEA 2VWVA 3QXPA 3VS2A 3KMUA 4BDGA 4FV1A 1YHVA 2WMTA 3AC3A 3NIEA 4C34A 3FMMA 1WBWA 4BKZA 3PA3A 3G15A 2YM4A 5J9LA 1YXXA 1UU8A 4IFGA 2OF4A 5HG8A 1TQPA 2VV9A 3OCTA 4O84A 4H1JA 4K6ZA 1W2DA 1BLXA 2C6OA 4LDTA 3FBVA 4JAJA 2AC3A 5M57A 2F7XE 4IZ7A 4PPAA 3W0NA 5M06A 3MS9A 2NNWB 4YTFA 4M67A 4ZTMA 2OICA 4YTCA 2QOFA 3I5NA 3AC8A 2J50A 1R0PA 5EK7A 4RWLA 4WG4A 3DY7A 3LMHA 3D5XA 5A3XA 3UIXA 4A06A 3DBFA 3UMXA 4CTBA 2WTJA 4FV0A 3RHXA 3WF9A 5HLNA 3BHHA 4ZAUA 4AW1A 1RQQA 1ZZLA 5DN3A 4BZDA 4F6SA 3FMJA 4XX9A 1YDRE 1GOLA 1YXSA 2OKRA 3QUDA 4FTIA 4AXAA 4ZJVA 2QG5A 2XS0A 4FT9A 4WHZA 4XBRA 4R5SA 3QHRA 3KF4A 4C4HA 5A4TA 3AGLA 5CU6A 3O50A 4GL9A 3F5PA 4XG3A 5EFQA 3D9VA 2ZM4A 2WNTA 4UWCA 2PE1A 4A9RA 3D0EA 4Y46A 1MQ4A 4JLCA 3V6SA 2I1MA 4NW6A 5KHWA 2BTRA 4BCPA 3PSCA 4ZTLA 2VX0A 1VR2A 4HZRA 3PP1A 2Q83A 3MFTA 4LM5A 3TNPC 3U87A 2XNMA 4QP8A 3HNGA 4G6OA 1RJBA 3KF7A 4IB3A 3FMNA 4JDHA 5DE2A 5IUIA 3DFCB 4E6QA 5CEPA 3IDBA 3R1YA 3FKLA 4M13A 4I92A 4L44A 3JUHA 5L2SA 4Q5HA 4DTAA 1LEWA 5CEQA 3QRTA 1BL7A 3DKGA 2PVFA 4FKLA 3GEQA 4AOJA 3O7LB 4FOCA 3OCSA 2FSMX 4I23A 4LYNA 5FTGA 3ODYX 3AC5A 2QR7A 3EL8A 3UJGA 3QL8A 4B0GA 2HWOA 2Z7QA 3A2CA 3EYGA 2BDWA 4YJTA 3FSFA 3ZO2A 4MBJA 5BX0A 4FT7A 4O4FA 4RIYA 5AAEA 4MXOA 2YISA 4G2FA 1OITA 4RLKA 1YI4A 2BRGA 4CMUA 4OBOA 5AUTA 5CT0A 4AZWA 2G2IA 2VRXA 4FNXA 5CU3A 4EOOA 2YZAA 3KXXA 4BR3A 2BILB 5FM2A 3NWWA 1GNGA 5L8LA 4QTCA 1OL2A 3AKKA 2R2PA 5LMBA 1Q5KA 3QCQA 2J2IB 1XQZA 4KBKA 5H8GA 4FZFB 5B7VA 2XUUA 5BPYA 5LVMA 2QKWB 2GS7A 3F6XA 3DXQA 4D4VA 1ST0A 2J5FA 4WA9A 2BRBA 2PZRA 2PMIA 5LVPA 4C61A 3AQVA 3OWKA 5CENA 3UQGA 4BL1A 5AM6A 5A6NA 3EKNA 4IXPA 4C59A 1PKGA 2QU5A 2Y6OA 3SX9A 4GFOA 2CHLA 4ZY5A 5IQGA 4HYUA 3DLSA 3EZVA 4PL5A 5BVKA 2ZM3A 4FIIA 4RC4A 4E5AX 3VS1A 4JQ8A 3OP5A 4KKGA 3RJCA 4U9AA 3Q5IA 4RX7A 2ZV7A 4GW8A 3O8TA 4FJVA 1F5QA 4D2WA 1AGWA 3TKIA 3B8QA 2DYLA 2YJRA 5I9VA 2VTAA 3A4PA 3GC8A 2WTIA 4F6WA 5TT7A 3R9NA 4NTSA 4FK3A 5AIRA 3LXPA 4K77A 5FEQA 2XKDA 3ZC5A 1SNXA 3AT4A 2NRUA 4LV5A 4QD6A 5HHWA 5IA3A 3GT8A 2EUFB 3GC9A 3HV4A 2YDKA 3QQFA 5C03A 4M8TA 4LGHA 3GP0A 4UYAA 3PIZA 2QLQA 2W1CA 1ZYDA 3UPZA 3W55A 3D5VA 3QZHA 2XNPA 2WU7A 2FSTX 1H1QA 3C51A 4N57A 3CJGA 3TM0A 5KMKA 2NYAA 4L7FA 4RA4A 4WRGA 1X8BA 1SMHA 2JITA 4FK6A 2X0OA 3FJQE 4V05A 5TF9A 4BCOA 2R0IA 4K1BA 4U3ZA 1DAYA 2WXVA 3DU8A 4MNEA 3FC1X 4FX3A 3DOGA 3Q9ZA 3FHRA 3VC4A 4E6CA 3R9RA 2ETMA 1M14A 2Y4PA 4DHZA 5JGAA 1IA8A 2P3GX 2WMWA 3L1SA 4X3JA 5KHXA 3A8WA 4FKPA 4J71A 5CSWA 3UZRA 4YTIA 4PP7A 4DEIA 4MQ2A 2VZ6A 4W8EA 3E92A 3VUKA 2YABA 5ANOA 4EH2A 5K0XA 3MB7A 4QO9A 3A7JA 2J51A 4QYGA 2UW9A 4DTBA 4XUFA 3T9TA 1NVRA 3ZLWA 3EYHA 3RAKA 1P4FA 4IX4A 4E4XA 1ZYSA 3FI2A 3P4KA 3UGCA 3GQLA 3AT2A 4RIWB 5CNNA 4GYGA 3TNQB 4R3PA 4IAAA 4QRCA 3HRCA 2C6TA 5E9EA 2CN5A 3QLGA 3GU5A 2H8HA 5TOZA 3BYOA 3HMPA 3ZO3A 1JWHA 1S9JA 3QGWA 4JVGA 2P55A 1U5QA 2W5AA 3RM7A 1ATPE 3EQIA 2UVXA 2WAJA 4ZLZA 3EN5A 1XH6A 5CVGA 5HVJA 4UMRA 1YKRA 5JGDA 3B2TA 4KWPA 2RG5A 4FTUA 5ETAA 3ZUTA 5KUPA 5A4CA 3RHKA 3RKBA 5GZ8A 1A9UA 2WPAA 1JPAA 2YEXA 3KMMA 3TKHA 4DBXA 2HXLA 3PFQA 3SDJA 2VTJA 4L67A 2YM3A 5FBOA 4CV8A 4PDOA 3EFLA 4AS0A 2JIVA 3DTWA 3LQ5A 3BL9A 5T6KA 3ENHA 3POOA 1YXUA 2ITQA 3DAJA 3VS0A 4BIBA 3OBJA 3UVRA 2X4ZA 4FV3A 3WARA 3NEWA 4ANMA 3ZEPA 4O27B 4TKSA 4RWIA 4F7NA 5EQEA 3KCKA 3D5UA 4HYSA 5TR6A 4EH5A 5LWMA 1TZDA 1Q8ZA 3IDCA 3LFEA 3NW5A 3VVHA 3QA8A 5IDPA 2GMXA 3MESA 5F94A 5C8MA 3TZMA 4D5KA 2GNLA 3HEGA 3OY3A 2W1ZA 3JR1A 2VTTA 3EN9A 5CF6A 4EOMA 2HELA 4HGLA 4I6QA 1JSTA 2IN6A 3RINA 5AV2A 4QMLA 3D5WA 4TY1A 1W2CA 4FV7A 3A7FA 3TUDA 4IVCA 2YAKA 3BE9A 3PZHA 3QZGA 1UU9A 5JN2A 4I21A 3R8MA 1PF8A 4BVUA 4E6DA 5FXSA 5AP4A 3ZRMA 4E7WA 2IZSA 4ANLA 5BVEA 4KABA 5DT0A 3QX2A 1FMOE 4I0RA 5K0KA 2QOCA 3UZPA 4BI0A 5ITAA 2QURA 1FVTA 2OW3A 3QA0A 4FKRA 4P90A 4AGUA 3GCSA 3FLZA 4F9AA 1L8TA 2BDFA 4Y85A 4MD8E 4HVGA 4UMTA 4XG9A 2C68A 4HGTA 1PXNA 3CPBA 3PXYA 3E7OA 4EK8A 4FV2A 4O7ZA 3UODA 3MH3A 3AKJA 4RBLA 2IG7A 5H3QA 3OROA 3FI8A 3ZM4A 4K0YA 4A9UA 3MDYA 5AP1A 3G5DA 4C37A 5CQWA 1CKPA 3P86A 4F9BA 3Q2JA 2VTIA 3AMYA 5CSPA 3UP7A 4MXYA 3KIOC 3VBVA 3QQKA 5IH5A 2WELA 2C3IB 3TZ9A 4E5WA 5FWKK 3QX4A 4F09A 4DH1A 4WD5A 3WF5A 2ONLA 3LFBA 4FT0A 4C57A 3NFFB 1YW2A 3PWDA 4FZ7A 4HGSA 3HA6A 4LRMA 5CSXA 3BELA 2BCJA 4OBPA 1Q8TA 5HCZA 2B0QA 1H07A 3HECA 3F82A 2JDRA 4GRBA 5B2LA 4LGGA 3LXLA 4TYHB 5CEKA 3R30A 2XM8A 3KVXA 3FAAA 2C6LA 2FO0A 4GU9A 4ERWA 4EOLA 2XNEA 4PMTA 4D2SA 4TWOA 4JI9A 4BTKA 3DBDA 4CGAA 3TNWA 3GGFA 4QP7A 3K2LA 2IVUA 4U43A 2V7AA 5DR2A 4BI1A 3R7IA 4IX6A 2LAVA 2C6IA 3KXGA 4G3EA 2BVAA 3PJ1A 5E92A 4BCQA 3NR9A 2JBPA 5CASA 4QDVA 5LJJA 3G33A 3H9RA 3A7HA 1L3RE 4XV2A 3E5AA 3RM6A 4ACHA 2R3OA 4IAIA 2GNFA 3UO5A 2AYPA 3KQ7A 3PJ3A 1URWA 4USEA 4BGGA 3E88A 4W4WA 4XHKB 2AEGA 3MH2A 3BRBA 3EFJA 4IQ6A 5DMZA 3V5PA 5HI2A 4KD1A 4YZCA 2XH5A 4MTAA 5EI2A 2CGWA 4QMZA 4YJRA 5E8TA 1MP8A 1TFFA 1JSVA 1APME 3Q53A 2F2UA 4EH4A 3K5UA 2IPXA 4O0TA 4D55A 4HVDA 4YPDA 4BCMA 4YJNA 3MY5A 4YSJA 3O8UA 3RK7A 4QTBA 4NK9A 3ATTA 1B39A 3QQLA 2JAMA 3OC1A 3R28A 4I20A 5HVYA 2OIQA 4FV9A 2RFDA 3D7ZA 3HA8A 4I6FA 4IVBA 1IAJA 1KE9A 4JG6A 4RX8A 5AX3A 1OPKA 4EH3A 3TZ8A 4EOQA 2PVYA 4M0ZA 3IO7A 4PDPA 4ACCA 3D83A 4ALUA 4FRFA 3LPBA 2B53A 1WBNA 2R3QA 4MVFA 4HPTE 2QG7A 4U80A 5ACBC 1STCE 4APPA 2CKOA 5ETCA 2YDIA 1JKLA 2C1AA 3B8RA 4G6LA 4O0XA 3ZLXA 3ZZEA 4B9DA 1PXIA 4CRLA 1TVOA 4CZYB 3L9PA 3C4XA 1J7UA 2W96B 3RCDA 2HY0A 3OD6X 4M0YA 3D7TA 3FLQA 3QQUA 4PV0A 4XH6A 5EHLA 3RP9A 5C8KA 3DQXA 4GK3A 1I09A 4RT7A 4FGBA 4KUJA 3UOHA 4K2RA 4FUXA 3A62A 2W1GA 4GS6A 1GY3A 4ZY4A 4KA3A 3ITZA 2OBJA 4GCJA 4ANOA 3BU6A 5EW8A 2CPKE 2ITYA 3QTXA 2UZUE 4O6EA 4OR5A 4C4IA 2E9NA 4XV9A 5D41A 4ORKA 4TYHA 1KUTA 2ZB1A 2R7BA 2YM5A 3ZTXA 2UZLA 3KCFA 1LPUA 3JYAA 4JIAA 2BKKA 1VYWA 3JXWA 5C27A 2LGCA 3LOKA 1WBVA 4I41A 1ZMVA 4HYIA 3MVMA 3P78A 4IX5A 4ZY6A 5HO6A 3LCOA 3LFDA 4X21A 4F0GA 4GK4A 4EQUA 1KE5A 3FLWA 3W2RA 5JFXA 5A54A 3P08A 4I1ZA 3UPXA 1UVRA 4ACDA 5LMKC 3UOKA 3GVUA 3EQPA 1GIHA 3GENA 2I7QA 4C7TA 4XEYA 4DFUA 4ACGA 4C3PA 4ARKA 3CE3A 2JEDA 3V3VA 1WVYA 4UY9A 1KV2A 3CQEA 4Y5QA 5TKDA 4C62A 5HZNA 2I0EA 3ZUVA 3QRKA 5I9WA 3R7YA 5CALA 3MPMA 3V04A 5KBQA 5DWRA 2HIWA 4RFZA 5LARA 4F1OA 4YMJA 4A9TA 4U5JA 4DA5A 2Y8OA 2V62A 1E1VA 5C1QB 2XEZA 4X2KA 1K9AA 3I0OA 4JX3A 5KMOA 4NEUA 2E9VA 3OWJA 3I7CA 2CMWA 4OTIA 4JDKA 4YBJA 4D9UA 2NRYA 3ANQA 3ULZA 2PMOX 3W1FA 4GMYA 5JZJA 2GQRA 1UWJA 3BEGA 3IW5A 3DKFA 5F9EA 2E2BA 4FC0A 4L68A 3OFMA 4OUCA 1GZNA 2CKPA 5LWNA 1O9UA 3Q04A 3QWKA 4LUEA 2XP2A 3ID6C 1FOTA 3GOKA 2PK9A 3CLYA 4ZJIA 4BYJA 3ACJA 1ZRZA 4NTTA 1ZXEA 4EK3A 5C8NA 2W4JA 2WTVA 2PE0A 1MRVA 1XH4A 4X6RA 2ZOQA 4HGEA 2BRMA 4JR7A 3F69A 4GG5A 2EXMA 3CTHA 5IA0A 4G5JA 3W0SA 3BEAA 3S4QA 3FZ1A 4W4XA 2Z02A 2W4OA 3UO6A 3NLBA 3MJ1A 3ZSHA 1UU7A 2WMQA 2O5KA 2X81A 3U9NA 5IA1A 5D7VA 5DBXA 3RK9A 3TMOA 4D1SA 2UW8A 3BBWA 5AV1A 3F5UA 2IW6A 1ND4A 5M56A 5CEMA 5JEBA 4K33A 3FKOA 4IVAA 2B9HA 2XKFA 4LL5A 3TEIA 5H9BA 3LVPA 2XALA 1OPJA 5AR5A 2EVAA 3ENMA 3ZONA 1H0VA 4EOPA 3P0MA 3VWAA 4KS8A 3HV6A 4AGDA 3JVRA 2RF9A 4FE2A 5LCKA 4I6HA 3NYVA 4PDSA 4L42A 5AP6A 2X2LA 3ALOA 4QQJA 4QYHA 3OCGA 4O0VA 5EYKA 3T3VA 4OAVB 4ZXTA 2XRUA 2YERA 5FRIA 3EB0A 4YHTA 2C6DA 3VS4A 5IDNA 4M68A 4QNAA 3KREA 3N4UA 3E8NA 5IF1A 2WD1A 4YZ9A 2G2HA 1J7IA 3BL7A 1YHSA 2FVDA 1PY5A 3EQBA 3VW8A 4BCJA 1OKWA 4XRLA 3C0IA 5EM5A 4FSYA 4GK2A 2GFCA 2UVZA 3HP5A 2E9OA 3DV3A 2IZRA 4YC8A 3O8PA 1YDTE 4F63A 4BDJA 3IQ7A 1HOWA 3G9LX 3C4WA 2YM8A 2HZIA 2Z7RA 3COMA 4G17A 4MAOA 4TL0A 4FSMA 5AEPA 4FNZA 3VIDA 4ALVA 2JIUA 4D4SA 3NCGA 4HYHA 4YHFA 4DFNA 1Q97A 3FDNA 3O5AA 4AXDA 3EWHA 3II5A 4EHGA 4QT1A 5CX9A 3KGAA 1KE6A 3SRVB 1NW1A 4TNDA 3TT0A 3VS3A 3TYKA 5EKOA 3UDTA 2J5EA 5K9IA 4D4RA 4M14A 1H1SA 3B2WA 3FMDA 5C4LA 5BMSA 3AD4A 1HCKA 2WQEA 3QUPA 1YWVA 3VW6A 4C3RA 1ST4A 5CZHA 1ZYCA 2V55A 3CC6A 3BKBA 3LW0A 4FTRA 3RI1A 4HVIA 1KV1A 3WF7A 3H9FA 3PP0A 1K2PA 4XP0A 5IQHA 2YCRA 2W99B 4AP7A 3TL8A 4ZSLA 3TJCA 2YDJA 4PNIA 4B7TA 4FG8A 2R4BA 3OWPA 3DJ7A 1SVEA 5D10A 4NM5A 5GINE 3HGKA 4BJJA 4XCUA 1JLUE 4M84A 4AU8A 3BHUA 3NNWA 1J3HA 2A4LA 4GUEA 3OXTA 5I9UA 4U0IA 2J7TA 2XIZA 5ACKA 4DFYA 2XKCA 3LQ8A 1LP4A 3F5XA 3I7BA 4QMUA 4DH8A 5B0XA 2OZAB 4UZHA 4AAAA 3OOGA 5FXRA 5I9ZA 2YIYA 2R3JA 4UWBA 3BYMA 1YOLA 2VTPA 4EWHA 3FZPA 3SHEA 1RE8A 2QI8A 2CN8A 4DF3A 4S2ZA 3NZ0A 4I94A 3ZDIA 4BWXA 3P5KA 4G3GA 4MF1A 3AT3A 4AE6A 5F1ZA 3DBCA 1WVWA 5HQ0A 3BLRA 3DAEA 3A7IA 4XG4A 4A4XA 4FSTA 1KE8A 3O96A 4P4CA 1H1RA 3E3PA 5AIKA 4E4NA 3RZFA 4F0IA 2Z8CA 2VWWA 4LMNA 2VO0A 1ZOEA 3PG3A 4X2NA 4TWNA 4TPTA 4O7VA 3DS6A 4J52A 4WOVA 3DNDA 1YRPA 4YJOA 2W4KA 4M15A 1OVEA 3EQGA 3GU7A 5EDQA 2YHVA 1XWSA 2HZ4A 4RQKA 3UDBA 1R3CA 1JBPE 2Q0BA 4WRSA 1FMKA 5J79A 4IWQA 3EQDA 4MBIA 3T9IA 1XMMA 4O7RA 4O1OA 4MD9E 4UYNA 2J0LA 3Q96A 4W9XA 5LMAA 3KXMA 4L9IA 2ETRA 5EQPA 2J0MB 1PRYA 3FQHA 2PUIA 3QC4A 3CQWA 3QHWA 1ZLTA 4IC7A 3ORPA 5I4NA 2XK7A 3FL5A 2W1DA 3Q2MA 4O4EA 5EM6A 5FXQA 4DFXE 1Y57A 2OZOA 5HD4A 5K4JA 4O7NA 3SRVA 3UNJA 3MPAA 3WBLA 3QZIA 2G15A 2WU6A 4NIFA 4QMXA 3QCXA 4BCGA 1G8SA 4NYEA 4PTGA 3LQ3A 4RJ7A 5AADA 3FUPA 4XOYA 2WO6A 2O2UA 4GYIA 5K5NA 4IWDA 4O4DA 3KULB 3CY3A 2PZ5A 3FMLA 3EH9A 4CNHA 4DEAA 5CLPA 3IS5A 3NNVA 4ASZA 4BYIA 2FGIA 2QQ7A 1LUFA 3FE3A 4GT5A 5JFWA 1XR1A 2IVTA 3V5TA 4E3CA 1SVHA 4IE9A 4BI2A 2XM9A 2ITWA 3R83A 3HUBA 5A4QA 1ZMUA 4W4VA 5CVHA 3ZFYA 3VJOA 2PU8A 4QMVA 3S0OA 2VUWA 2XJ1A 3HDNA 3RAWA 5E91A 2XEYA 2OXYA 4RX5A 4V01A 2EU9A 3VF8A 4PL4A 4EEVA 4Z3VA 1B6CB 2RG6A 4NL0A 4O7WA 1BI7A 1H08A 1OIUA 4F1TA 4DDGA 4WUNA 5L6PA 2A98A 2BHEA 4KS7A 3QBNA 2R9SA 1OKYA 3OBGA 5AR7A 5J9YA 1W98A 5K5XA 1ZAOA 3MPTA 4IZYA 4WT6A 5EHOA 5I0BA 4U8ZA 4BCFA 4K8AA 3NFGB 3G6GA 1OIYA 2C6KA 2WQBA 1Q99A 3E63A 4U97A 5DHJA 4Z16A 5JQ5A 1G8KA 2V0DA 2PVHA 4TNBA 5HBJA 1UKIA 3R22A 1H1PA 3WZEA 3HV7A 4GFMA 5AP5A 4BZOA 3BYUA 5CU2A 2C0TA 3IOPA 3WE8A 4TXCA 3F2RA 2GHGA 3WF8A 4JMQA 4XG2A 4U7ZA 4GUBA 3V5QA 5EYDA 1OM1A 3MVLA 5L2QA 3SKCA 3W0QA 4C3FA 3LZBA 4EONA 3K54A 4WSYA 5J5TA 5J8IA 4IACA 3IW6A 1WBTA 3SG8A 3TDWA 4IZ5A 3TDVA 2FB8A 3E64A 4O86A 3FSKA 3D94A 5AR4A 2I6LA 4DGGA 4QTEA 1W8CA 2FYSA 2XVDA 2OH4A 3FY2A 1YI6A 3HZTA 4AGCA 4O83A 3PYYA 4CFWA 3PDTA 2UW6A 4MCVA 3L8XA 4XOZA 3F2NA 5EH0A 5AWMA 4BDFA 3O17A 2PWLA 5DNRA 1G5SA 4BBFA 4D2PA 2FUMA 2WMVA 4IM0A 4J99A 3N4TA 2G1TA 3I0QA 3LM5A 4E4MA 3LFCA 2KULA 3LJ1A 2ITXA 4Q5EA 4QMOA 3PRFA 2J90A 4O0WA 4H1MA 4K9YA 4OGRA 5HBEA 4JBPA 3LCDA 2Y7JA 2V5QA 2W17A 5DVRA 3DXPA 2YCFA 1AD5A 3F66A 3G9NA 4I24A 4S33A 4JOAA 3E93A 3PY1A 3R04A 4QMQA 4DHIB 3U6JA 4IMYA 3P7AA 4OTFA 4DCAA 3Q4UA 2P33A 1IEPA 5ANEA 1W82A 3WZDA 4AXFA 4YJPA 4NM3A 3PY3A 3I1AA 3C0HA 2BR1A 3O0GA 3WYXA 4AN3A 2PL0A 2WOUA 3MTLA 5HX6A 5LCJA 2B9JA 5H2UA 3QRIA 1P14A 4FOBA 2OXXA 4UB7A 3EQCA 4YUQA 3SOCA 2YJSA 1XKKA 5DYJA 2QHMA 5AJQA 3ZC6A 2PUUA 2W1IA 3F9NA 2WMUA 3NRMA 3SXRA 4F7SA 5LVNA 2J0KA 3ATSA 4NKAA 3ZS5A 4ANNA 4BBMA 2BZHB 4FV6A 1XBBA 1HCLA 3FV8A 3BZ3A 4R3CA 5AR3A 4CLJA 1E1XA 3UZTA 3N9XA 3OW4A 3FXXA 2W9FB 5CSVA 4ZSJA 4J1RA 4DG3E 2H6DA 4DGLC 4O7YA 3Q5ZA 3V51A 2X9FA 4EKLA 1H4LA 2PTKA 1FQ1B 3I81A 2IW9A 5IMXA 5EYMA 2W1FA 5DRDA 4QPAA 5M4FA 4AW2A 4C2VA 4R3RA 5AUVA 3VJNA 4FTLA 3L8VA 2JC6A 3VUDA 4NM0A 4TYJA 3D2KA 4NKSA 2UZBA 3BIZA 2E9UA 4NT4A 2WZJA 2OFUA 4CG8A 5BUEA 4WNOA 2HAKA 4O4CA 3F3WA 2JKQA 4IH8A 3SD0A 1PYXA 2DQ7X 5FGKA 2RGPA 4FNWA 5AUUA 4ZEGA 2PSQA 3AC4A 4J95A 1Y8GA 3DDQA 1VYZA 2B54A 3F88A 5H8EA 5HNGA 4GH2A 5AA8A 2ZB0A 1Q61A 3PVBA 4MD7E 3RPSA 5AAGA 5JFSA 1GZKA 2X7GA 2PZIA 3TJDA 4BDHA 4ASEA 1M52A 3UYTA 3NVMB 3KFAA 4ASDA 3C5UA 1H26A 2UZVA 2ITZA 4I5CA 4YZMA 4BGHA 5E8UA 3EN7A 3BX5A 5H8BA 4QMNA 4I5PA 5KZ0A 4W4YA 3BWFA 5M55A 4MNFA 5EI6A 4P5QA 3ORTA 4AW5A 1NY3A 3VQHA 3FXZA 5FEDA 2YIXA 2I0YA 3SA0A 4CQEA 3H0YA 3NUPA 1BUHA 4YBKA 1O6KA 4N4SA 5IU2A 3AC1A 4KNBA 4LOPA 4ENXA 5HE3A 5AAFA 3BWJA 3SC1A 3U8WA 4O6LA 4JBOA 3F3TA 3M1SA 5BV3A 1OUKA 3OW3A 4DFBA 4UBAA 2JAVA 4KKEA 2H34A 4OAUC 3FC2A 4FKJA 4QQTA 5JRQA 4ERKA 5A46A 3Q32A 5E7RA 5AUYA 4Y72A 5CAUA 4LFIA 4L52A 5I3OA 4AFEA 4ENYA 5CU0A 1G8AA 5J1WA 1PXMA 3QYWA 4P7EA 3RTPA 4AGWA 3R9OA 3VBQA 5F20A 4RVMA 3OEZA 5B2MA 4IADA 4PP9A 4AOIA 2HCKA 4FTMA 4CFVA 5CF4A 3PY0A 3VHKA 4FKOA 4C4FA 3SV0A 2WMXA 4UMUA 3S95A 2CCHA 4GG7A 5T68A 2X7OA 3BYSA 3F7WA 5IQBA 2RL5A 1H24A 1BI8A 4H58A 3RAHA 3HMIA 2WQNA 2CGUA 3W2QA 4ZTRA 4XV3A 4AAYA 1F3MC 3CXWA 3NAXA 4JRVA 4BCHA 4E73A 4AA5A 5HCYA 1UWHA 4HJOA 4D1ZA 3ZXTA 5KE0A 5J5SA 4BDEA 3ZRLA 2GHLA 3SVVA 3MFRA 1H00A 5HORA 5EDPA 2B52A 3AOXA 1PXJA 4F9CA 5C9CA 4HVHA 3W8LA 3IW8A 1OGYA 3HAVA 2VD5A 3KRRA 1XJDA 4MHAA 5CEOA 4CRSA 4KRDA 5HD7A 5C4KA 4GJ2A 5AR2A 5E8ZA 3MGYA 4C33A 2XANA 2PMNX 1U5RA 5EDRA 4S32A 5CXZA 3PVUA 5F4NA 1PMVA 3NS9A 3Q4TA 4IWPA 5KX8A 3C5IA 4N6YA 5LVLA 5KBRA 2QO9A 4U44A 3W10A 3EN6A 4GIHA 5IPJA 3ZFMA 3DT1A 5DRBA 4YU2A 4GSBA 4GKIA 4I0TA 3S00A 2BFYA 4JQEA 2BKZA 3ZLYA 1YOMA 5HTIA 2QD9A 3HDMA 4G5PA 3ET7A 4G1WA 2WMRA 1OPLA 3O71A 4BF2A 4EBVA 4AWIA 1J7LA 1Z57A 4CFMA 2UW3A 4CQGA 5CAPA 3GCUA 3HX4A 1Q3WA 5GJDA 4X2GA 3W0RA 3HV3A 2I0VA 3IECA 4RVKA 5AP3A 3LXKA 2IJMA 3NGAA 2JIIA 2PPQA 5D11A 4QQ5A 5ANDA 1ZARA 5HX8A 4AF3A 2QLUA 3RAIA