5JT2A

Brafv600e kinase domain in complex with chemically linked vemurafenib inhibitor vem-bisamide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
257
Chain Sequence
GSEFDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATEKSRWSILWMAPEVIPYSFQSDVYAFGIVLYELMTGQLPYSNINDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Chemically Linked Vemurafenib Inhibitors Promote an Inactive BRAF(V600E) Conformation.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 257
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jt2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jt2A01
3LFSA 4D4RA 2XJ2A 3P23A 4EK4A 4FA2A 1XO2B 2SRCA 3E5AA 4YC3A 2VZ6A 4QMQA 2WU6A 3C4WA 2PVRA 2H96A 4AZEA 1XKKA 4TYEA 2ZM3A 4BCPA 5EM5A 2W1IA 1ZOGA 2QOOA 5D12A 2BMCA 3DV3A 1U4DA 2HWOA 3CXWA 4BTKA 3SGCA 4UZHA 2QOCA 4BKYA 3R8VA 5ANKA 2HXQA 4DTKA 5K4JA 3F3TA 1STCE 3D83A 4LL5A 3I6UA 4YNEA 4BGHA 5IMEA 5DRDA 2C5VA 3ORZA 4I0TA 4OBOA 5FP5A 5HCXA 5CSWA 3BWJA 3QUPA 4L3JA 2O2UA 3VJNA 3DBCA 4I92A 2IJMA 3U54A 2XP2A 2YCSA 4LG4A 4O27B 2V22A 4ZY4A 5EQYA 3ZTXA 4HNFA 3RM6A 4X2NA 4RBLA 2F7ZE 2O63A 5E9EA 3BGZA 5CVGA 2IW9A 4CT1A 5DHJA 2OGVA 4RFMA 4FTOA 4HVHA 3PDTA 4ASDA 2WQNA 4OTHA 2QHNA 2V55A 4XBRA 5FDPA 1NVSA 1K3AA 2XK9A 5HTBA 1IAHA 4PTEA 4GRBA 4OTPA 3EL8A 3RZFA 2Z7QA 3LXNA 5CSXA 3FMMA 4PPCA 4WO5A 3O51A 3R9OA 4Y83A 3LMIA 3D5WA 3UC3A 1QPCA 4F7NA 1PHKA 3PXRA 5FEEA 4RWIA 5BPYA 3Q60A 1Q8ZA 3KCFA 3UGCA 3GU5A 3U9CA 4HGTA 3MN3A 3LQ8A 5CU4A 2HOGA 3AXWA 2G01A 3A7JA 3O8PA 4X21A 4OT5A 3OEFX 3MA3A 4XLIA 3RK7A 3VC4A 3DY7A 4NJ3A 4FTIA 2LAVA 2Q0BA 3RGFA 4FKWA 3TNWA 1UKIA 4CZUA 4MNFA 1PKGA 2W9FB 3QTZA 5BUJA 3BCEA 2HXLA 3RJCA 3D94A 3ORMA 4DGNA 2R3NA 2HENA 3FZSA 4BL1A 4CRLA 4E1ZA 4EOIA 2EU9A 4F9AA 4CKJA 2E9NA 4IH8A 2GMXA 3F3UA 3UNZA 4IDTA 2GNIA 2ITVA 3AT2A 4BKZA 1VZOA 4IEBA 4OBQA 1M7QA 3UYSA 3WBLA 2YN8A 3ZDUA 4LFIA 5HD4A 3PE2A 3MH0A 3PUPA 2C6LA 1OZ1A 2XKFA 3HGKA 4L53A 4WBOA 3LFEA 3QZHA 5FTOA 2YM4A 2C6EA 2XKDA 5HZNA 3DT1A 2OF2A 2XNMA 2IW6A 3KXHA 4A9TA 3NYVA 1OIQA 3WE4A 1PXNA 4D1SA 2UZWE 4H3QA 2GS6A 3MDYA 2AC5A 1WBPA 3KQ7A 2ZV7A 1KSWA 3R7GA 4MK0A 4IBMA 3GEQA 4RWKA 3F7ZA 4C3FA 3GUBA 3MIAA 2ITUA 2XM9A 3Q52A 2P4IA 1MP8A 4YGAA 4FTUA 2I1MA 2G1TA 1GIJA 5J7HA 2BZKB 3MVLA 2YFXA 4U44A 4JI9A 5KMMA 3I7CA 4HZSA 4DGOA 1PMUA 4IJ9A 4ARKA 4YURA 2XIXA 1P4OA 2WQBA 3NPCA 5ETIA 2X7FA 2J50A 5AUWA 2B9IA 3L8SA 1XH7A 3RTPA 2I0EA 4AE9A 4EOQA 3F2NA 3HEGA 2RF9A 5AA8A 3I0OA 4S34A 4KBCA 4C3PA 5FGKA 4DEGA 3NIEA 1TQPA 3POOA 5JN2A 2P2IA 4PNKA 5HVJA 4MBJA 3FZOA 4ZTQA 3UMXA 4AXAA 4YZNA 4KA3A 5CF6A 4QYYA 4MHAA 5CU0A 4GYIA 3S1HA 5HU9A 3FPMA 4ZMFA 5C8NA 2JFLA 3E8EA 3F3WA 1Q4LA 4FT0A 4UMQA 4KABA 1PXOA 4MD9E 4J97A 4PL3A 2PVKA 1OPLA 3U55A 1DAWA 4YJNA 4OAVB 2FYSA 2XYUA 4EWHA 1UA2A 4R1VA 4QMMA 3LFBA 3EQIA 4QYEA 3BU5A 3CTQA 2QVSE 4G5JA 3RWPA 1Q61A 3GQLA 3PLSA 4NCTC 4CNHA 2GS7A 4L01A 4E26A 5J9YA 1QPDA 5GNKA 5EW9A 3UZRA 3KK8A 4K0YA 4IFGA 1B6CB 2UVYA 3JYAA 4LRKA 3VUGA 3HL7A 4FEXA 4O82A 3PJ3A 4ITIA 4YHJA 4AG8A 3JVSA 3FMNA 2HWPA 4BR3A 3GCQA 5I9UA 3BHUA 3LKMA 4FUYA 3D7TA 4FZAB 2BRBA 3QXOA 1YW2A 3O2MA 4QNAA 4FIFA 4CEGA 4CLIA 4EH3A 4QPAA 1O6LA 1GJOA 1M52A 3FMEA 4L42A 4UX9A 2WMUA 3BKBA 4C4GA 4IB3A 3FZRA 1OKWA 4ANLA 3T3VA 1R1WA 4EWQA 3OFMA 4HNIA 4DGMA 5CEKA 5JGDA 2QOKA 2OSCA 4DG3E 4F0IA 4Q9SA 4DLJA 4X2FA 4LI5A 3OUNB 4GVAA 2CLQA 1JKLA 4ACHA 1WMKA 4L68A 4UBAA 3W33A 4EK8A 2QONA 3K3JA 4U8ZA 2WQEA 3DK6A 3DK3A 3QQJA 4Z16A 4O38A 4UWYA 2J0MB 2UVXA 3NR9A 3OF0A 3ORIA 3OT8A 4FI1A 4U80A 3AMYA 3R8UA 3P5KA 4EH8A 5JRQA 3G51A 5CEMA 4I93A 2GHLA 5KMKA 2WMRA 3EQGA 3RK5A 2PZYA 4C7TA 4ZS4A 4LV8A 2WELA 4EOLA 2B1PA 4JIAA 2QO2A 3SA0A 2BKKA 4D5KA 5M55A 3UO6A 4YMJA 3MY1A 3QX4A 4RC4A 5AV4A 2W5HA 3E7VA 3NNWA 2JAMA 5HHWA 3LQ3A 4CG8A 1UNLA 3ANRA 4QMWA 3CY2A 3U8WA 1VJYA 4GT4A 4U43A 4FK6A 2A1AB 3ZUVA 5F9EA 2CNVA 4P5ZA 4PWNA 1SZMA 2O65A 4D2RA 2W4OA 3CGFA 5EFQA 1MRYA 2B9FA 5AWMA 1ZY5A 5K5NA 3M42A 5HEZA 2ZB0A 5IPJA 3COMA 3SDJA 2NRYA 4C02A 1KE5A 2IN6A 4HPUE 4F63A 4AW2A 4MYGA 5CANA 3OCTA 4F7LA 2QNJA 2GTNA 3LW0A 4O7LA 4W9WA 2I0YA 3RPVA 4BCKA 4FEUA 4HGEA 2I40A 3Q04A 4LGDA 4FTLA 3BYSA 1SM2A 5JMSA 3NGAA 3KRRA 3JY9A 3GU6A 4ZSAA 3Q2JA 4EUTA 3MVJA 4IX3A 3IS5A 2XYNA 3EQBA 1Q3WA 4FBXA 4JXFA 4S31A 5AP5A 5IUGA 4XG3A 3A4OX 3SG8A 3IK3A 3FXWA 1A48A 1QPJA 2PU8A 3R1SA 2XIKA 3KGAA 5ACKA 3MI9A 2E9OA 3QZIA 5HG7A 4G3EA 3SXSA 4FT9A 4R3RA 4FKSA 4J53A 2QR8A 5E1SA 5BMMA 3GU8A 3K2LA 3QD2B 1OITA 4WUNA 3TNHA 3ACKA 5DMZA 4D9UA 4AACA 4WHZA 5E8YA 3EZVA 1W7HA 3GOPA 2X81A 4UMTA 1Y8YA 3LM0A 4RT7A 5JQ5A 4UB7A 2W4JA 1REKA 4ASXA 4KIOA 2QURA 3Q32A 2FSMX 3DOGA 5HG5A 1UNHA 3TI1A 4K9YA 4RVKA 5LVPA 5E4HA 2C1BA 3WIKA 4FL2A 1U54A 2CDZA 3KRXA 3NSZA 3FLWA 5EOLA 5J1WA 4BHNA 4XMOA 4QP3A 2B54A 5EQPA 1WFCA 4FV3A 2WU7A 4ZEGA 1V1KA 1WVWA 4KAOA 3FI3A 4XP0A 4HYUA 3ZXTA 4FV9A 1W0XC 2Y4IB 5E92A 3SV0A 5HTIA 4U6RA 2GDOA 5EG3A 2YEXA 3R8ZA 3TZ8A 2EWAA 3R83A 1IA8A 1RDQE 3GC0A 4I0SA 4A06A 4FV7A 4ZZOA 1OIUA 2VWXA 5JGBA 4M84A 1WBTA 1O9UA 5IISA 2EXMA 4A9YA 3EN5A 4YO4A 3C4CA 4C33A 1YWRA 3P78A 2YCFA 4W4YA 1SNUA 5HG8A 1OKYA 3MVMA 3PLAE 4M0YA 3EWHA 2WEVA 4CD0A 5DN3A 4RIWA 2PUUA 2UW7A 3MA6A 4PDOA 3OWLA 4AA4A 4CMUA 5AIRA 3KREA 3D14A 2O5KA 4YP8A 2A19B 3DLZA 4ZJIA 3PJ2A 4KIKB 3FZPA 1BI8A 2VO7A 4MH7A 3QQGA 4H1JA 5ACBC 1H00A 2RFNA 2RKUA 3OWJA 4YPSA 1F3MC 2B9HA 4Y8DA 5IEVA 5JKGA 4M7IA 4L67A 3MFSA 5CF4A 3N4UA 5M07A 3QQFA 2WMAA 4BIEA 3QCYA 2WEIA 4NIFA 4HGLA 5FQDC 5J95A 1DAYA 4Q2AA 4GKHA 2VX1A 3QTUA 4I94A 2O8YA 3RZBA 1JAMA 2XA4A 3TNPC 2FUMA 1WBVA 4EHGA 3V5QA 1NXKA 3DTCA 1BL7A 3CGOA 4I6HA 4KRCA 5CALA 4FYOA 1H27A 2Y6OA 4FTNA 3E8CA 5DVRA 3KF7A 4HVGA 3PSDA 3F88A 2Q83A 1YDTE 3UBDA 3V5JA 5FD2A 1CDKA 5CXHA 4BTMA 4IJPA 3UP2A 1PMNA 3BI6A 4FV0A 4DF3A 2OJ9A 4F09A 4I3ZA 5IU2A 4IACA 4OTFA 2YCRA 4JX3A 2WTWA 4AWIA 4YUQA 2R7BA 3PTGA 2I7QA 3CQWA 1Q99A 4Y95A 4E6QA 4ID7A 4U97A 1YRPA 4R5YA 3UVPA 4CG9A 4O0YA 2YM8A 3KA0A 2JC6A 1RE8A 3PXKA 1YI4A 3SW7A 2C6MA 4I23A 4ZP5A 4H3BA 5LMAA 2DUVA 3HV4A 5E8VA 4F6UA 3PSBA 3KVWA 4OTDA 4EZ5A 3FI4A 3C0GA 3R9RA 5HBEA 1WZYA 2C3KA 2WOTA 4FKLA 1TQMA 5AM7A 3SXFA 3V6SA 1RQQA 4WNMA 1DI8A 1ZY4A 2ETRA 3ZOSA 4AE6A 5I0BA 3JY0A 3E8NA 5FBOA 4USFA 4WRGA 4CFMA 4O0RA 2W1DA 1J7LA 5IQFA 3NUUA 5IDPA 2B55A 2YAAA 2EXCX 5M56A 2XRUA 3OY1A 4RA5A 3E88A 4S33A 4H1MA 5HIDA 2XF0A 4DEBA 4YLLA 3A61A 4ZLYA 1UU9A 3KC3A 3HMIA 2PZIA 1FGIA 2A4LA 2YM7A 1YI3A 3I81A 4IWOA 4BIDA 4DINA 3C0HA 3I6WA 3TV6A 4DH7A 1UU7A 3TUDA 3DXPA 3NNUA 4OR5A 3PA4A 3FBVA 3ZBFA 4QP9A 5B2KA 5CS6A 3DGKA 4R1YA 5CF8A 3D5UA 2R5TA 5DI1A 5DR9A 1M14A 4RC3A 2OXYA 4PPAA 2FSTX 2GFSA 4FZ7A 4ZY5A 4ALVA 2B4SB 2JDVA 2PMOX 4JQEA 4XV3A 5DA3A 4UYNA 2FVDA 4C4HA 5EHYA 3ALOA 4CT2A 4EOOA 3A2CA 5I9WA 2QCSA 5DT0A 3ZC6A 5GIPE 4W4XA 3BBWA 2O0UA 4H39A 4NFMA 3WZJA 4KUJA 3BLRA 4DFLA 3I79A 4F9BA 1PKDA 3DK7A 2XK4A 3JS2A 3ZMMA 4RFZA 3H3CA 4YTCA 2J0JA 4FT5A 4Z7HA 1XJDA 1BX6A 3R7YA 4F6WA 4UN0C 2PVJA 5IF1A 3AMBA 4ZJJA 1IR3A 4G5PA 4GK2A 4LOPA 4U9AA 5AV0A 3VW6A 2ESMA 4GK4A 5EI8A 4TWOA 1QCFA 4O21A 4E7WA 4QQ5A 1ZOHA 4GFMA 5IQIA 2BPMA 4M97A 2RG6A 4D28A 4N4SA 4RQVA 3POZA 2ITNA 4NM7A 2YM6A 4XJ0A 1CMKE 5BYLA 4DE4A 5DFPA 5FG8A 2J0IA 3AC2A 2V0DA 3QYZA 1YXTA 4FX3A 3OOGA 4A9SA 4O2PA 3FZ1A 2XK6A 2BAQA 4X2KA 3O50A 5IZFA 2PVLA 3P7AA 1XH5A 4IANA 4RX7A 4J8MA 4DGLC 5J5SA 3R2BA 1VYZA 4LMNA 4I41A 4BZOA 5L3AA 3AD4A 4YJSA 3QTWA 1MRUA 1SVEA 4FTTA 4H36A 5LCKA 3KN5A 2X1NA 3CBLA 1UNGA 3CR0A 3I7BA 3OBJA 3QYWA 4MXYA 5L2QA 3V04A 4B4LA 4O7YA 3QC4A 5F20A 3CCNA 4GJ2A 4EOMA 3Q9WA 5EHOA 4OGRA 4BCIA 4ZIMA 4QOXA 5LVLA 3BQRA 2JDSA 3DAKA 5IEYA 4CZTA 5IH6A 5C4KA 3OY3A 1OI9A 5A6NA 5AX9A 2WQOA 2F49A 3QF9A 5CYIA 2PPQA 5D7VA 5IG1A 4FODA 4JBPA 1MQ4A 4NZWB 4B8LA 4QTDA 4LRMA 3BGPA 5CT7A 4D4SA 2QOFA 3UE4A 3UOHA 3KMMA 3I60A 3D2IA 4ZY6A 3MYGA 3R71A 3WILA 2ITPA 3NAYA 4TNDA 2OW3A 4IW0A 2GCDA 3QRJA 5C1QB 5BVKA 3E8DA 3MVHA 4IAYA 5LOHA 1KUTA 1M2RA 3Q3BA 5BMSA 3TWJA 1ATPE 3PIZA 4XP3A 2JEDA 3RCJA 4K77A 5EQEA 3PVWA 3NUPA 2J51A 2FO0A 4EH2A 5ANOA 1B39A 2QR7A 4XNEA 4D4YA 5A3XA 2UZTA 3ALNA 3R22A 4WA9A 4F1TA 4ZSEA 3HVCA 4TW9A 3MGYA 4HW7A 1PF8A 2Y7JA 3W2QA 4YJRA 2NNWB 3EQPA 3TIYA 3NUYA 2ACXA 2VTJA 1QMZA 3UG1A 2BIKB 5LWMA 1YXSA 3ENMA 2VTQA 2WKMA 3EFJA 3RNIA 3JVRA 4R77A 5F95A 1CKJA 3RMFA 1YHVA 5CT0A 5C9CA 3AQVA 2JIIA 4I6BA 4V01A 3NW7A 5L8JA 5IQCA 2VWYA 3LFAA 4BIBA 2HK5A 5FXSA 2YWVA 4HOKA 3VF9A 4IDVA 1YOMA 1OMWA 4PTGA 3WI6A 4QTEA 5EYMA 3QUEA 3R30A 3KRLA 4QMZA 3DJ5A 3NW6A 3VVHA 4GW8A 3AOXA 4W8EA 4AF3A 5BVNA 4EJNA 2W17A 2QKRA 4EOJA 5HE3A 2YM5A 4AGUA 3QRTA 2YACA 5HO6A 2VWWA 1S9IA 4NKSA 2UZDA 2C69A 4QQJA 5M44A 4OUCA 4P7EA 4RLLA 5KKRC 2UZEA 4YHFA 4FKIA 4O96A 4YPDA 1JLUE 2P2HA 4WSQA 1YQJA 4ZSLA 3LFNA 5M4FA 2XIRA 4IB0A 2Y6MA 1FMOE 1R0PA 4JBVA 4EK6A 5I9XA 5M08A 3AC3A 5IA5A 1YHWA 5TOZA 5EYDA 3PE1A 2UZUE 4K11A 4PMPA 2X9EA 4EBVA 4AN2A 5K9IA 2VO6A 4O7NA 5D7AA 4ORKA 3JR1A 4KBKA 4BGGA 2BRNA 3AG9A 5D11A 4ANSA 4G2FA 4RA4A 5K0KA 4X6QC 3R02A 4TYHA 5CAVA 2CGVA 1Y57A 4YSJA 5KMOA 2R0UA 3D5XA 2CNQA 1UU3A 3C9WA 3DQXA 2GHGA 3F7WA 2WTDA 3HECA 3VUMA 5TO8A 4CYJA 3HMNA 2I6LA 4EH9A 3QU0A 3FSKA 2OJJA 3DNEA 4FG8A 3VS4A 4JQ7A 2AC3A 5DEYA 3P08A 2YA9A 4MNEA 5KMNA 4G9RA 1LPUA 3R1QA 5TR6A 3ZO4A 4FZFB 3OZ6A 2HY81 4FZDB 4YC6A 5GZAA 3I1AA 5JH6A 4LOQA 2ZAZA 3H4JA 4CFFA 3DTWA 2YIYA 3OTVA 4FNWA 4EHVA 5KX8A 4OTIA 2PUPA 3PVGA 4NSTA 2GQSA 3VF8A 2PVHA 5AP1A 3HA8A 3ORXA 3B2TA 4G3FA 3HKOA 3DFAA 4QTAA 2VTMA 3ODYX 3QTXA 3UO4A 2CGUA 2X2MA 4U81A 1BL6A 3JPVA 3BHHA 4NL0A 3KXMA 2GS2A 4J1RA 4JX7A 3TXOA 3NVKI 4J71A 4MF0A 5E91A 5EI2A 4IB1A 5CAQA 1NVRA 4NT4A 4QMSA 3V5LA 4MEDA 2B52A 4OLIA 3WYYA 4DTBA 5EDPA 3UPZA 2YAKA 4XX9A 4BDFA 3Q5ZA 2ITOA 4B0GA 2R64A 2VWUA 3DFCB 1ZOEA 3COHA 3QTSA 5IH4A 4O7SA 4IE9A 2Z7LA 3W16A 2OZAA 3M2WA 1PXMA 2BDWA 4GG7A 1A9UA 1ZZLA 2V7OA 4R5SA 3QBNA 4RPVA 3ZH8A 4C38A 4C2WA 4FL1A 3VBWA 4PV0A 4EEVA 2UUEA 3MY0A 5ETAA 3RBWA 3GNIB 1E1VA 4FVPA 1JSVA 4FV4A 3ODZX 4TZRA 4YJTA 4N57A 3QKMA 3BX5A 5A46A 5CSHA 2WMWA 2ITQA 2CKQA 2OICA 4KBAA 4AP7A 3VJOA 4IM0A 5TT7A 5M4IA 4MX9A 5B2LA 4QTBA 5CAOA 5I5ZA 4U42A 1J3HA 4LUEA 4M67A 4XP2A 2C30A 4JBQA 3TZ9A 4Z7GA 3KKVA 2OG8A 5E8SA 3AT3A 3BV3A 3DS6A 4G1WA 3L8XA 2J5EA 2PE1A 3Q9ZA 3QL8A 4XRJA 2W06A 3ZO2A 1YXXA 5BUEA 3EMGA 1H1SA 4Y73A 1KE6A 2JKMA 3QKKA 3UP7A 5DYJA 2WMQA 4X2JA 4IAFA 2CMWA 2VGOA 4UXLA 3ZO3A 3IDPA 2VWZA 3MH1A 4ANQA 4AU8A 4MXZA 2WMVA 4QYFA 4E6DA 3R73A 4P5QA 5KKRB 4PP9A 4X2GA 4EH7A 1WVXA 2BR1A 3BEAA 5FP6A 2XJ1A 3FC2A 5C8KA 4FV2A 5M4UA 3N4VA 3D7TB 5A6OA 5AUUA 3U51A 3BQCA 1PJKA 3GVUA 5AUXA 3NUNA 5C01A 1M2PA 3ZLWA 4DYMA 1GIIA 2VWVA 2XK3A 3CQEA 5HVKA 1J7UA 4PX6A 3OVVA 2BTRA 4J7BA 2BHHA 5J8IA 5BVOA 4O6LA 3VS6A 5IA2A 1OM1A 3A8WA 3G0FA 4RIOA 3R7EA 5AFVA 4AOIA 1SNXA 4BCGA 2Q0NA 3GC9A 4ACGA 2JBPA 3O7LD 2BUJA 2UW4A 2V62A 5DT4A 3SOAA 5M51A 3TG1A 2Y9QA 5HNGA 3FJQE 2XS0A 2YJRA 2OH4A 3BZ3A 3EN9A 4RWJA 4AFJA 4PMMA 3MB7A 5AUTA 4L00A 3V5WA 3DAJA 4BN1A 3VNTA 4DEIA 1GZNA 3SW4A 3RI1A 4V05A 3R2YA 1SYKA 3FXXA 3WF9A 5HI2A 4C2VA 2XBJA 4IAIA 4HCVA 2R3OA 3P79A 4RX8A 4N6YA 2B0QA 5HLNA 1Q24A 1WBSA 3E62A 5DIAA 3PYYA 5A4LA 5CVFA 3VBXA 3S00A 4O0WA 1YHSA 3D4QA 2R3LA 3FUPA 3EN7A 1EH4A 2X2LA 4M3QA 5EI6A 3FWQA 4FV8A 2XKCA 3LJ0A 4KWPA 4RLKA 3PG3A 2ETKA 3DCVA 1P2AA 5FXRA 2WTIA 3HV7A 1GIHA 4QP2A 3UC4A 2W1GA 1PMEA 2PTKA 4JG6A 2OJFE 3EL7A 1DM2A 4I1ZA 4RQKA 5CVHA 4J95A 3BU6A 4GU9A 3VBTA 2UV2A 4DAWA 5KHWA 3E3BX 4G9CA 3PWYA 3OT3A 4C58A 3AC5A 3R9DA 3AGLA 2VN9A 4X0MA 5AAEA 2NP8A 3H30A 3MTFA 3K3IA 4RJ6A 3ULIA 3FXZA 5J1VA 2EB2A 3GU7A 2Z60A 1I09A 3PIYA 5TF9A 1XWSA 5A4TA 4M69A 3THBA 4GK3A 5JK3A 4FICA 5DBXA 1PYEA 4FIHA 1KV1A 1VYWA 2XNNA 4FF8A 3FYKX 2WGJA 3ACJA 3CQUA 4IM2A 5FTGA 2WTCA 2PVFA 2X8IA 3PJ1A 3RAWA 1ZYDA 2OXXA 3IW7A 4J52A 3F2AA 3QQUA 4KSQA 5EHLA 2CCIA 2VTNA 4GU6A 4FE2A 3BIZA 4TPTA 5F1ZA 2NPQA 5JFWA 4LRJA 1U5RA 3TM0A 1JBPE 2G9XA 5HVYA 3GC7A 3MESA 5DLSA 2R3KA 5AADA 4WUAA 3F3VA 4A9RA 3F82A 2QU6A 1M17A 4O91A 3C4XA 5LCJA 4DLIA 4TWPA 4WOVA 4IXPA 5F94A 3DKFA 5FDXA 5CASA 2ZYBA 4RMZA 3ET7A 4FV5A 5BVFA 4FKQA 3OXIA 3AC4A 4OTQA 5D9HA 3VRYA 4BBEA 5ANGA 3L8PA 3N51A 3D0EA 2DYLA 4L6QA 4QMUA 3VBVA 5AV1A 1PY5A 2WTVA 1U54B 4I4EA 5LMBA 3REPA 4FVRA 2C0TA 4IMYA 1W98A 3I4BA 3BYMA 3PXZA 2PYWA 4OBPA 4TN6A 5FWKK 4BDIA 2ETMA 2GNLA 3LCKA 1PXJA 4JS8A 3PA3A 2C1AA 4GJ3A 4RVMA 5GJGA 4RX5A 5JT2A 5KCVA 2GQGA 4CQGA 3HUCA 4QPSA 1O6KA 3C50A 3H9FA 4X3FA 5AP2A 4H3PA 4RZVA 4R3PA 2UVZA 3NS9A 1JQHA 4L8MA 4FIEA 3U4UA 3SC1A 1YDSE 3PP0A 3VW8A 3V3VA 4C35A 3SD0A 2VGPA 2HZ4A 3OWPA 4GL9A 3NYNA 2Y4IC 5A4QA 2UZVA 4I4FA 4IVDA 4RX9A 5HG9A 1YXUA 3OG7A 4ZTMA 3C5IA 4XG8A 4FKUA 4FTMA 4OTGA 3FEGA 3A7FA 4BWPA 1APME 2VTOA 1OKVA 3PRFA 4F1OA 1ZYJA 3QRIA 4RIWB 3NMUF 3VIDA 3EQRA 4HZRA 3ZZWA 3MH3A 4MXXA 3IW6A 3LVPA 4CKIA 4UMRA 5L2TA 3LJ2A 3IW8A 3R28A 5AAFA 3W10A 4YLKA 2BHEA 5L6OA 2JLDA 2VNWA 2PE2A 3BLQA 4JDKA 5A4EA 4DCAA 4QMLA 4NK9A 2Y0AA 4FOCA 5FRIA 1BLXA 4D0XA 4BWKA 4LGGA 5M06A 3L9LA 4R6VA 4RRVA 4UALA 1H25A 4BBMA 3PVBA 3HV5A 4U3YA 1FVVA 4NIFB 2QHMA 3UDBA 1V0OA 2GSFA 4PF4A 4R8QA 4F9WA 2BZHB 3CPBA 3RPRA 4Y85A 3FMKA 4I6QA 4QTCA 4LYNA 5ITAA 4IZAA 3F2RA 2ZV8A 3KULA 4IVCA 4EZ7A 3OHTA 4I5MA 1GY3A 4GFOA 3LCTA 3CTJA 2OU7A 3QCSA 4A07A 2BFYA 2VTLA 5IQBA 2CLXA 5E8TA 5C03A 3GFEA 2H8HA 4H05A 2JKKA 5DR2A 5E8ZA 2PVNA 4C4EA 3NYOA 2X7OA 3SRVA 3HV6A 3WOWA 5DPVA 5KBQA 1R78A 2VTSA 5HESA 4AZFA 2GNHA 2JKOA 4JAIA 4UY9A 4QMYA 5AP3A 4EOPA 4FKJA 4IWQA 3PY1A 3ZSGA 4QT1A 1L3RE 3PVUA 4KIQA 2G2FA 4GG5A 2DWBA 1H07A 2JAVA 3DJ7A 3G5DA 4GH2A 4JLCA 4W8DA 3E63A 1F0QA 3KXNA 3PP1A 5T3QA 3W18A 4BFMA 4FT3A 5AMNA 3LM5A 3NW5A 5HCYA 3PPZA 3WE8A 2W1EA 1J7IA 4NYEA 3UYTA 2PY3A 2X4FA 4FSQA 4JVGA 4OT6A 3ORNA 4Y5HA 3HX4A 4CFVA 4DN5A 4EUUA 3KN6A 2BDFA 1OPJA 2UW3A 3VBYA 4GUBA 4C0TA 4E4XA 3BBTB 4AZTA 2CKPA 4C4FA 2PZRA 4RSSA 3WF8A 4PDSA 4ZK5A 3OW3A 2DS1A 3KXXA 5AJQA 2PMNX 5HX8A 1HCLA 4EONA 2WMXA 4FUXA 2IZUA 4BVUA 5EM6A 1ZARA 1NVQA 2HZNA 2IVTA 2C4GA 2YZAA 2H6DA 3EQHA 3G0EA 4DFYA 3C4EA 2W1CA 4F7JA 4K33A 4PDPA 3K5VA 5LQFA 2YIXA 4AT3A 2C3IB 2J0KA 3PFQA 1OVEA 2XB7A 5GIOE 4I0RA 4LV5A 5BVEA 4C3RA 2R3GA 3F9NA 3VUHA 5L2WA 5HORA 2IZTA 3TTJA 4UEUA 3OTUA 4JDIA 4FOBA 2WAJA 1JPAA 4M0ZA 4E8AA 5HIBA 5A4CA 1KOBA 3IDBA 5KMJA 3MBLA 5J5TA 1V0BA 3KU2A 3QXPA 1KWPA 3EHAA 3LCDA 2OFVA 2R7IA 3CY3A 3MFRA 2ITYA 4K2RA 4DC2A 3EN6A 4DG2E 4EH4A 3DBDA 1Z57A 3DU8A 4NM0A 3MB6A 3QCXA 4BDCA 1T46A 2XMYA 4ZAUA 2VTIA 3OEZA 2IG7A 4XHKB 1DI9A 2WO6A 2XBAA 3QZGA 3VS0A 3Q6UA 4DTAA 4YLJA 2I0HA 4MBIA 4WG5A 4RIXA 3V8TA 5IQHA 3FQEA 3NNVA 2WZJA 3CD8A 3EYHA 3KY2A 3QQKA 4RZWA 4DT8A 4GUEA 4PUZA 4APCA 1KV2A 2OJIA 2OIDA 4YZBA 3MFTA 5L2IA 3RAIA 2C5YA 4NFNA 1FOTA 4BCQA 3Q4UA 3ZM4A 1G8AA 2IWIA 3WF7A 2PE0A 4FSTA 4KS7A 4PMSA 5AR5A 3C7QA 3ZSIA 1XBAA 2XNEA 3NIZA 3P7CA 1XQZA 3GCUA 4RVTA 3WF5A 1YVJA 3ZO1A 2Z7RA 3VS3A 2WPAA 4FV6A 2E9PA 2NO3A 4FSUA 2QU5A 3QFVA 4M66A 4F4PA 4BYJA 3NVMB 4DCEA 3QTRA 5HX6A 2WMSA 2WTJA 4PNIA 2DQ7X 3TT0A 1UWJA 4IZ7A 1YKRA 3QWKA 4F9YA 4USEA 4ZTNA 4ZLOA 1Q97A 2JDOA 2R2PA 3NZ0A 4U0IA 3T9TA 1PXIA 2NRUA 4G17A 5FEDA 5HIEA 2OH0E 3VS5A 4GKIA 4NU1A 3OMVA 4D2SA 2JIUA 3BHVA 4HCTA 4EI4A 4JRVA 4DEAA 2VTPA 2W0JA 2YABA 3HDNA 3IPHA 4BWXA 4W4WA 5CU2A 5H3QA 4PY1A 4CV8A 2CGWA 4IC7A 4CXAA 3NRMA 4E5BA 4O81A 3SVVA 4ZTRA 4A9UA 5I3OA 4IWPA 3V01A 3A7IA 3DZOA 4EH6A 1IAJA 1JOWB 1AQ1A 2ZMCA 5EOBA 4BGQA 3VRZA 5HU3A 3ID6C 1IG1A 4U7ZA 2BDJA 4AX8A 3IGOA 3LOKA 4TYGA 3EB0A 4LM5A 1L8TA 4Z3VA 4IX5A 4RIYA 5I9VA 2ZDUA 2QC6A 4JR3A 3LIJA 5IA3A 5BVWA 4PL5A 3QLGA 4EQUA 3EJ1A 4YZMA 1PRYA 3FKOA 4JIKA 1T45A 4A4OA 3ORPA 4L3PA 5HBHA 4NW6A 5B2MA 1KE9A 4HYSA 2F9GA 2UW5A 4U79A 3TACA 4C4JA 2XKEA 3GQIA 4EORA 4LL0A 4PTCA 5H2UA 4UMPA 4JG8A 3HUBA 3Q6WA 3AC8A 2PVYA 3W2PA 2YLEA 3ENHA 2QLQA 2OBJA 2Z2WA 3LHJA 3Q9YA 4HVSA 3UQCA 4YZCA 3ZFMA 4ANBA 5BVDA 4QP8A 5CNNA 1XBBA 1Y91A 5CU6A 1FGKA 3ULZA 4ZLZA 2J90A 3PXFA 4FG9A 1G5SA 2XJ0A 5DRBA 3TJDA 2CPKE 4MTAA 3V8WA 5CAUA 4RJ3A 2GQRA 2H9VA 2QLUA 3PXQA 2Y8OA 4MKCA 4U3ZA 2FGIA 1KE8A 2W1FA 3VUTA 4EKKA 1ZMVA 2QO7A 1IASA 4E73A 1H4LA 4GCJA 4Y5QA 5IMXA 4G3GA 3SX9A 3OBGA 2OWBA 2XNPA 5C4LA 1YWVA 3HRBA 5CLPA 1G8SA 1Q8WA 4JDHA 4AGWA 3GENA 4XG7A 1Q3DA 3DBFA 2GNGA 4DH1A 5HLPA 4DFBA 1Y8GA 1G3NA 3VS2A 4Q5HA 2WB8A 3R7UA 4LUDA 5CSPA 4E4MA 3UOLA 4PMTA 5LVMA 4IX6A 5ETFA 2C6KA 2GNJA 4RJ5A 1GNGA 1ZZ2A 2VTAA 4WD5A 4YHTA 2XIYA 3RPYA 3TNIA 2QI8A 3FMJA 3NAXA 4B9DA 4BBFA 2ITWA 4KKHA 3CP9A 3FY2A 2HCKA 3L9PA 2X7GA 3DAEA 4TYHB 4V0GA 5DG5A 2VRXA 1CM8A 3R21A 1Q8TA 4F0GA 5FM3A 5I4NA 2ITTA 3DQWA 5IQDA 1LP4A 1I44A 2V7AA 3R0TA 4C34A 4WIHA 2O64A 4DFZE 3MPMA 3EQFA 3KF4A 2VO0A 5TE0A 3FMHA 4MNEB 2JDRA 4YJUA 2RFSA 3ITZA 5HE1A 4PRJA 4D58A 4N6ZA 2XM8A 4I5CA 2J0LA 2YITA 4A4LA 1R0EA 3OXZA 4KINA 4WBBB 3F66A 1FVRA 4IZYA 5JFSA 3G6GA 3OOMA 3NLBA 3LMHA 2OI4X 4NTSA 4BI2A 4CV9A 3LMGA 4NM5A 4ALUA 1CKIA 4O1OA 4I6FA 4YSMA 4FIGA 1LEZA 2J6MA 1ZRZA 2XH5A 4L52A 3C0IA 3CJFA 4YTHA 2W99B 1PYXA 3VBQA 2XNOA 3B8QA 3WARA 3A62A 5HE0A 3IKAA 5M09A 2UW8A 2ZM4A 3FL4A 2YISA 3QD3A 3GCPA 5AIKA 4YJQA 4BRXA 1ZYCA 4MWIA 5EKNA 2IW8A 4ZJVA 4RJ7A 3FKNA 4L9IA 5EK7A 3VN9A 5K5XA 4DBXA 3H9OA 2OZAB 4O7RA 1HCKA 2F7EE 2OIQA 2X6DA 3BYVA 4CGAA 3R04A 2RFEA 2GPHA 3LPBA 5KMIA 3DDQA 3QTIA 2WNTA 4RGJA 1WBOA 4XG4A 4EK3A 5A14A 5AAGA 2OXDA 4YZ9A 4P90A 4TKSA 3PZHA 4QYHA 5KE0A 4U41A 2F4JA 4E4NA 4DFUA 5HCZA 3FV8A 4QQCA 5D10A 4L7FA 3O17A 2B7AA 4JAJA 2ONLA 2R3RA 3FLSA 1W8CA 2ZM1A 5GHVA 4DEHA 1YOLA 3O96A 3G33A 3FMDA 2GFCA 1XR1A 4L44A 5HD7A 3VUDA 5AA9A 3W8QA 4H58A 3QC9A 2PZ5A 3UZPA 2KULA 1BMKA 5AP6A 3WZDA 3EFKA 4BC6A 5CEPA 4CVAA 3ZM9A 2R0IA 3PWDA 3RINA 4AT5A 4QP4A 4MD8E 3VUKA 3Q2MA 3GT8A 3ORTA 3HMOA 5CTPA 3D7ZA 4CFWA 1ZYLA 4EZ3A 5BQ0A 5LMKA 3QGYA 5G1XA 2IVSA 5I3RA 1FMKA 2BCJA 3QD4A 1KE7A 2G2IA 3ZYAA 5ANJA 4E3CA 3A99A 4L45A 1B38A 3CD3A 4AT4A 5HNBA 3OXTA 3F5UA 4IAZA 2VTHA 3E3PA 4UWBA 4IWDA 5AP0A 4BDHA 3OROA 4XUFA 2BRHA 4DEDA 4PPBA 3G9LX 4IAKA 3VHEA 3RNYA 4BDGA 4YR8A 4XRLA 4ZS0A 1H0WA 4XOZA 2ZOQA 4NWMA 4S30A 4NH1A 3G6HA 4X3FC 4EKLA 3ORLA 2QOLA 4HPTE 4D55A 2KTYA 3QALE 1BI7A 3ORKA 2ITZA 4GVJA 3TL8A 3AMAA 1ND4A 3MW1A 4W4VA 2WIHA 2FA2A 2X6EA 2P0CA 2W5BA 3F5GA 5J79A 3ATTA 4S2ZA 2OLCA 4J96A 4JRNA 2X9FA 2XEYA 4CCUA 4YJVA 4E4LA 4TL0A 3E93A 4LMUA 4AW5A 4RFYA 4YJOA 5ANEA 4WNPA 2CGXA 4IADA 4MXOA 4RJ8A 4EOSA 3BYOA 1KOAA 1ZMUA 4QRCA 4X7QA 3P86A 4R7IA 4CLJA 5AR2A 4CFNA 3TCPA 3RKBA 4AQCA 4D2PA 4EL9A 3O23A 4B8MA 2W7XA 1SMHA 3TDVA 2EUFB 4FGBA 5KO1A 3ZFXA 4O22A 4E5AX 2IPXA 4BDKA 3BHYA 3CIKA 4FSNA 1J1BA 2C0IA 5DNRA 3QA8A 2JD5A 1A06A 4L7SA 4ACDA 4K18A 1Z5MA 2HZ0A 5CEQA 2C3JA 1GAGA 3GCVA 3HNGA 5D1JA 4IAAA 4YJPA 1PW2A 1ZXEA 5HE2A 4AA5A 3CKXA 4E20A 3T3UA 4CCBA 5BNJA 3IDCA 4M69B 4O7ZA 4MCVA 5E1EA 2VX3A 1SVHA 3HDMA 3H0ZA 3QKLA 4AZWA 3FLNC 3GXLA 2VTRA 3P4KA 3SXRA 3ATSA 3GB2A 4E6AA 2IZSA 3QTQA 3LJ1A 5I9YA 3KK9A 4WG3A 5IA1A 4YBKA 3AGMA 3VQHA 5EM7A 2R3JA 5CNOA 4QP7A 1OPKA 4FEQA 1RJBA 3A7HA 1K9AA 4IVAA 4QQTA 4ACMA 2YDIA 4BKJA 4CMOA 4AN3A 3NCZA 4BDEA 4TYJA 3EKKA 3LXPA 5BUIA 2B53A 4F9CA 4QYGA 4N70A 2WOUA 4GIHA 3EOCA 2BALA 5CY3A 3K5UA 2EXEA 3E87A 1QL6A 4GT3A 5IQAA 1OL5A 5AUZA 2J5FA 3CLYA 5L8KA 4FKTA 4XYFA 3NUAA 4IC8A 4BCJA 5J7BA 1BKXA 4AZSA 3LQ5A 4O84A 4KKEA 3PRIA 2PMLX 3M1SA 3UPXA 3PZEA 3AT4A 2F7XE 5AV3A 2XCKA 2W4KA 4I5HA 3AD6A 4UYAA 5KBRA 2PZPA 2ITXA 1OL1A 1PMVA 3QWJA 5EKOA 4DG0E 3A60A 4IFCA 4BTFA 4GFGA 3D2KA 3VULA 3UNKA 3GGFA 3LFQA 3UNJA 3ZU7A 2QG5A 3SHEA 4II5A 4DITA 3QCQA 4EQCA 3SLSA 4X3FB 4M12A 4BCMA 1H01A 4AZVA 5CI6A 3NEWA 4ANOA 2JGZA 4UWCA 3LZBA 4EJ7A 3R7OA 3V6RA 4MQ1A 3ZFYA 3G90X 2QODA 4L46A 2ZDTA 5L6WL 2W9ZB 5F4NA 4JDJA 4TY1A 3UMWA 3UO5A 4CSVA 5LJJA 2RFDA 3PJCA 4JL9A 4EH5A 4C57A 4XBUA 4KSPA 3QZFA 3PG1A 4O7TA 3R1YA 4QMOA 4FSYA 3VUIA 4WT6A 4J98A 2YERA 3VQUA 1YWNA 4XLVA 5J9LA 3V5TA 2F57A 1VEBA 3ZDIA 2R3PA 2YIWA 3RCDA 3ZXZA 5JFXA 1LEWA 2C0OA 3MV5A 4JNWA 5CAPA 5HO8A 2PMIA 3TZMA 3NWWA 4IHPA 5M53A 4JR7A 1Q8UA 4XG2A 2PSQA 3O8UA 4WG4A 5EW3A 4AOJA 3FI2A 5IA4A 4O86A 2X39A 4ITHA 1AGWA 2IVVA 4FK3A 3QHRA 4NM3A 3RWQA 4AUAA 3DKCA 1PXKA 3PXYA 3KULB 2R3HA 4CFUA 2REIA 3KB7A 4MAOA 1XH8A 3ZLYA 5FTQA 3MSSA 4FTKA 5JRSA 3LXKA 2GHMA 3ZEWA 1XBCA 3ROCA 2ZV9A 2WIPA 3O71A 5L2SA 1O6YA 4QNYA 3MIYA 3D9VA 1REJA 4ANNA 3RAKA 2PULA 1GOLA 3V8SA 5L6PA 3K54A 4GV1A 3NUXA 2P33A 4Y72A 1P5EA 3SRVB 4XV9A 4BICA 3MH2A 4GT5A 5FBNC 1U5QA 4R3CA 2J2IB 3E7OA 1UKHA 4WNOA 3U4WA 5KNJA 2UZLA 2BZJA 2PHKA 3A7GA 4R7BA 2C6DA 2C6OA 3CC6A 3QGWA 3R7IA 3R9NA 2P3GX 4AFEA 2PL0A 2WFYA 3BU3A 4GSBA 3UIBA 4M15A 1XH4A 3FY0A 4OTWA 3KVXA 4GEOA 4JG7A 3O8TA 5ANIA 2A27A 5HO7A 3UVRA 5GZ8A 4D1ZA 2VWIA 2X4ZA 2UZBA 4FTRA 5CU3A 4ZZNA 2YHVA 3NUSA 1YI6A 5DWRA 2VAGA 3DB6A 5E8WA 4BYIA 4FR4A 1OECA 1H1QA 3NNXA 1OL6A 1J91A 3Q5IA 4BDBA 4BI0A 3O0GA 4G3CA 4O1PA 4U5JA 3FYJX 3PSCA 1AD5A 4FTQA 1E1XA 3CJGA 1FVTA 1RW8A 5E8UA 3S0OA 3U6HA 4XG6A 2UZOA 1Q41A 1UU8A 3R9HA 3C4ZA 2R4BA 5KZ0A 5HBJA 2BRGA 1VR2A 1OL7A 2CNUA 4R7HA 3GBZA 3IW4A 2Z8CA 3LE6A 5M57A 1FINA 1NT2A 5AR7A 4D2VA 4IIRA 2GNFA 2R3MA 3OS3A 3Q4CA 4ANMA 3PPKA 3R01A 5FEQA 3U87A 3L8VA 3FLYA 1E9HA 1JNKA 4BF2A 2UW0A 2VTTA 4F08A 3ZONA 3ZRKA 3HLLA 3DPKA 3U6IA 2OO8X 3SQQA 3NCGA 2R3FA 5B0XA 3FZTA 4M13A 4HYHA 4BTJA 3CE3A 3D5VA 3COKA 4IVBA 2E9VA 3ZS5A 2X2KA 4L43A 4HYIA 5EDRA 3UOKA 5I9ZA 2AYPA 5IEXA 3DBQA 1H1PA 4CYIA 3VWAA 3P1AA 2XK8A 3F61A 4ZZMA 4AGDA 3EQDA 2RGPA 5IA0A 5LARA 3Q53A 4AN9A 1LR4A 3FLZA 4C36A 1UVRA 3ZLXA 3OCGA 5HNIX 2JDTA 1U59A 4KS8A 2C6TA 3FHRA 1TKIA 3IQ7A 3OCBA 4QP1A 3BGQA 4RIXB 3O7LB 4FEWA 5DGZA 5BX0A 5CXZA 5JGAA 2C5XA 5BYYA 3ETAA 3TTIA 2W1HA 3BHTA 3RPSA 4D1XA 5H8BA 3EN4A 3KRWA 3PY0A 3BV2A 1TVOA 1YXVA 4FG7A 4FKPA 4ASEA 3U6JA 4N0SA 3QD0A 4CFXA 3UVQA 2BZIB 2FB8A 4BI1A 3F6XA 2A2AA 3A4PA 3IOKA 3QRKA 4U45A 5M4CA 4I5PA 3JUHA 3T8OA 3P7BA 3F69A 4A4XA 3PPJA 3TV7A 3H10A 4I21A 2W05A 1DS5A 2BILB 3PJ8A 5KZIA 2BIYA 3GC8A 5K3YA 2J4ZA 3IO7A 5CENA 4AS0A 2YJSA 4BDJA 5AEPA 1JKSA 4O2ZA 1OIRA 4DGGA 2BVAA 3OUKA 1NA7A 1FPUA 4CQEA 3TUBA 3G15A 3GFWA 5FLFA 3TEIA 3DKOA 1GZOA 5DE2A 5AUYA 2VV9A 5H9BA 5A9UA 2LGCA 2PVMA 4FKVA 3WIGA 3HMPA 4BZDA 4MXAA 3EYGA 2X8DA 4FKGA 4G31A 2I0VA 4PQNA 3EFLA 4L3LA 4B7TA 3UZTA 2OJGA 2BKZA 3UJGA 1WAKA 4KNBA 3TIZA 3MY5A 3WZKA 4O7WA 4O0SA 4R78A 3ANQA 5CX9A 2J7TA 4I20A 2R3QA 2CJMA 3COIA 4ZTLA 2C5NA 2WMTA 2ZVAA 4QO9A 4UXQA 4O83A 4O0XA 2HYYA 2XNGA 4FT7A 2G15A 2QOHA 4MQ2A 1JKKA 2OF4A 4QMXA 3UIXA 4TWCA 3WF6A 3QA0A 4APPA 5CEOA 1Z9XA 3DLSA 4RIYB 3W55A 4CMTA 5HTCA 1LUFA 2CSNA 3Q4ZA 3M11A 4O0VA 3VS1A 1M2QA 1OIYA 3Q9XA 5JZNA 2FSLX 2XRWA 2YIQA 3QX2A 4NTTA 4ALWA 3AC1A 3BE2A 3MTLA 4K6ZA 4CTBA 3HP2A 1K2PA 2XCHA 3HAMA 2OIBA 2WMBA 2YIRA 4S32A 4HVIA 4F70A 3N9XA 3P0MA 2CN8A 3LFFA 3ZUUA 5ETCA 4BY9E 5C26A 3FPQA 3W2CA 4XEYA 1H8FA 3SG9A 4WNKA 1W84A 4FTAA 4TNBA 2CHLA 3S3IA 1MQBA 1JWHA 3DNDA 4E6CA 3ZHPC 3JXWA 4XV2A 3ZUTA 2ONLC 3LCSA 5DR6A 4BCFA 4EK5A 4DT9A 3LFDA 2JBOA 3DJ6A 4D2WA 5FM2A 1URWA 4FEVA 2GU8A 1OGUA 2QO9A 3HRCA 4ZSJA 3DKGA 4BB4A 3RPOA 3QQHA 2PUIA 4BCOA 1NY3A 3FL5A 2C68A 5C8MA 3ERKA 2WD1A 5B7VA 1ZYSA 4TYIA 4ZOGA 3GU4A 3ZCLA 1XH9A 1X8BA 2ZMDA 2ZJWA 5HICA 4EC9A 4F7SA 3TNQB 3WYXA 2W1ZA 1P4FA 4C37A 5GJFA 1WVYA 2XVDA 3F5XA 5LMKC 1FBNA 3OC1A 3RK9A 4ERWA 4K1BA 3FQSA 3U9NA 2C5OA 3UTOA 1GZ8A 4F1MA 4GYGA 4U40A 4QMTA 5L8LA 1OUKA 5GINE 5HQ0A 4J99A 3FE3A 4I24A 2RIOA 3IOPA 5DEWA 5TKDA 5K0XA 4ZMEA 5CZHA 3UG2A 4AAAA 5EM8A 2Z7SA 4BDDA 3IONA 4V0GB 5CQUA 2XIZA 2WTKC 3LAUA 1ZLTA 3ZRLA 4O7VA 5EW8A 1PXPA 2ERZE 3W2RA 4CTCA 3W2OA 4Z9LA 5IQEA 3EZRA 3IECA 3VHKA 4ZTSA 4JBOA 2HW7A 3QAME 1CSNA 4E93A 2F2UA 1SVGA 1ZAOA 2VNYA 3P9JA 2OZOA 3GCSA 3R6XA 4YTIA 3S2PA 3ZBXA 1H24A 2VD5A 5LVOA 3UOJA 2QD9A 2C6IA 3II5A 5EH0A 3ZRMA 4DH8A 4DFXE 4ENXA 5HKMA 2HW6A 1H28A 4YC8A 3CSVA 1Q5KA 4FKOA 4D4VA 3MPAA 1TQIA 2UW6A 2UW9A 4YBJA 4G34A 4GMYA 3OW4A 2CKEA 1OB3A 2BROA 3TZ7A 5CF5A 3L1SA 4JOAA 4DA5A 4KIPA 1Y6BA 1YOJA 2YDJA 3RHKA 3HAVA 2Y4PA 3MJ1A 2B9JA 4RVLA 1ZWSA 3L9NA 4ZXTA 4G6LA 2QOIA 3F5PA 4M14A 2HELA 5EYCA 5CWZA 4M8TA 3DXQA 4QMNA 2VU3A 2BAKA 3LLTA 5HGIA 3DB8A 4JQ8A 1ERKA 1OKZA 5E8XA 3BE9A 3QHWA 4FSRA 4IZ5A 3C5UA 3PA5A 2QKWB 3FAAA 1OBDA 5A54A 5AR4A 5G6VA 3DDPA 3KMUA 4EC8A 4XV1A 3GP0A 3KXGA 4FV1A 1R3CA 4FVQA 3RHXA 4AGCA 5KHXA 2R9SA 4FGRA 2AUHA 4TRLA 5CSVA 4BHZA 2XUUA 4YNOA 3W8LA 2X0GA 3TKHA 2JIVA 2YCQA 4QMVA 2R3IA 4PL4A 4EQMA 3R8LA 4BCHA 1XHAA 4HVDA 1QPEA 5KUPA 2HY0A 3IGGA 4NCTA 2HIWA 4XG9A 4YO6A 3KXZA 1R39A 2E9UA 2XNBA 2YLFA 2JKQA 4FIJA 4IM3A 5EDQA 3KRJA 4UV0A 3ROYA 4EOKA 3EIDA 1W82A 3F3ZA 3KCKA 1U46A 1P14A 3MS9A 5T6KA 4G16A 4A7CA 3KL8A 3OWKA 4QD6A 1H1RA 1JVPP 5EYKA 2OKRA 3FI8A 4DFNA 4O0TA 1OL2A 4FMQA 3H9RA 4QP6A 4FIIA 4LGHA 1V0PA 2WHBA 4K8AA 1MRVA 3HV3A 1WBNA 2A0CX 4RG0A 4G6OA 5IUHA 5AM6A 4LQMA 4AW0A 2WTKB 5AP4A 4DHFA 1Y6AA 4FTJA 4YZDA 5DT3A 3R7VA 4TXCA 5GJDA 2VWBA 2JITA 3BRBA 4V04A 3H0YA 2PWLA 5DH3A 3SAYA 3G2FA 4ZSGA 5FXQA 4BZNA 5CQWA 2YM3A 4AOTA 3EFWA 4B6LA 3I5NA 3FSFA 3RM7A 2XZSA 1H26A 3QUDA 2RSVA 3SKCA 3RALA 3VS7A 3ZC5A 3HZTA 2YZLA 4NKAA 2BTSA 2ZV2A 3MPTA 3CKWA 4F99A 4X6RA 5DOSA 3HP5A 5JFVA 2CCHA 3BYUA 4WRSA 1Q8YA 4HCUA 5K4IA 4NEUA 1IRKA 5AV2A 2J9MA 1JSTA 4P2KA 1IA9A 4KIKA 4DBNA 1BUHA 3T9IA 1CKPA 5AR3A 1W83A 2OK1A 3EH9A 3ELJA 3TKIA 3DXNA 3R63A 4Q5EA 4BDAA 3R1NA 3KFAA 3E92A 2W5AA 2FH9A 2RG5A 2EB3A 3CTHA 3I5ZA 3R00A 4OW8A 3WZUA 1WCCA 2WXVA 3Q96A 3KMWA 1UV5A 3ZZEA 4TTHB 4FSWA 3UQGA 4ACCA 4M68A 4Z55A 3R8PA 1HOWA 3HRFA 4FKRA 4EHZA 4XOYA 3WZEA 3FDNA 4RJ4A 2O3PA 4W9XA 3UQFA 3FHIA 5J9ZA 2EVAA 5GZ9A 2GTMA 2HZIA 1JKTA 1BYGA 4E5WA 3N4TA 2F2CB 5J87A 3IW5A 2QOQA 2G2HA 4F0FA 3E64A 4ONAA 5L4QA 2CN5A 3TKUA 5H8GA 4KD1A 4EYJA 4QPMA 3MWUA 5CI7A 3CS9A 2IZRA 1J1CA 4EYMA 3EKNA 3UIUA 3FQHA 3S4QA 5AR8A 3C13A 3QQLA 3AD5A 4CRSA 4FYNA 4HGSA 4EBWA 4J8NA 4FL3A 4XS2A 5IUIA 4PP7A 3S95A 4C59A 4OAUC 3UODA 4C8BA 2RL5A 3IG7A 4ENYA 3FMLA 4KKGA 2QG7A 2C47A 5IH5A 3FLQA 5H8EA 3ZEPA 3ZSHA 4ASZA 3CPCA 5HLWA 4FNXA 2XK7A 3B8RA 2X8EA 2QQ7A 2ERKA 4CKRA 3KEXA 2BRMA 2VO3A 4B99A 4FZ6A 1NW1A 3NDMA 4XCUA 3RP9A 3GOKA 2YWPA 4UMUA 5T68A 3R8MA 2UZNA 4GS6A 2XEZA 4YU2A 4FSZA 4TWNA 3TUCA 3OP5A 5JQ8A 1H1WA 4ITJA 3HYHA 1M7NA 2BAJA 3NYXA 2E2BA 4XH6A 3D15A 4O0UA 5E7RA 4AA0A 4D0WA 3UIMA 1IEPA 3NX8A 2VUWA 3BPRA 4MF1A 4X3JA 5IKWA 3MFUA 3W2SA 4F6SA 5IDNA 1H0VA 2H34A 3C4FA 4P4CA 4D2TA 3QRUA 4F64A 3GI3A 3CEKA 3PY3A 4MWHA 3TN8A 4FSMA 4F65A 2OFUA 4RC2A 3ZLSA 2HAKA 5E90A 4G6NA 3TJCA 5LWNA 5FUTA 4AW1A 5KMLA 1F5QA 4JT3A 5LXMA 3RAHA 4CZYB 4MXCA 4USDA 1PXLA 4MVFA 3C51A 4Y46A 4DH3A 3V5PA 4NUSA 5HOAA 3DZQA 3Q4TA 4GIIA 2V5QA 4IQ6A 4YTFA 3FKLA 1XH6A 1OUYA 3BEGA 3DBEA 5C27A 5CEIA 4C61A 5D41A 3L9MA 4FNYA 4ERKA 2ZB1A 3LCOA 3OD6X 4G3DA 2W96B 4RWLA 4MBLA 3PIXA 3C1XA 2PUNA 3LLAA 2IO6A 4UZDA 2WQMA 4FNZA 3VO3A 3W32A 1WBWA 4C62A 1H08A 5JZJA 1ZMWA 1Q62A 3BLHA 1UWHA 3LXLA 4KB8A 4LOOA 4QMPA 5BYZA 4D9TA 4DEEA 5JEBA 4PDYA 4WSYA 3HMMA 1OBGA 4TT7A 4Q9ZA 5JSMA 4FTCA 3DA6A 1S9JA 3SOCA 3A8XA 5AUVA 4C4IA 2PK9A 4IB5A 4I22A 5ICPA 4BCNA 2BFXA 4NW5A 5LVNA 3BELA 1GZKA 3V51A 3VAPA 2CKOA 1JSUA 3EQCA 4HJOA 4MD7E 4WKQA 1FQ1B 3TV4A 4D5HA 2C3LA 4EHEA 5IQGA 2QOBA 1URCA 3W1FA 3BWFA 4IX4A 3B2WA 4NJDA 4ZTHA 5AP7A 3QLFA 1MUOA 2P55A 4O6EA 2FSOX 2IVUA 2VX0A 3I0QA 3OCSA 3G9NA 4KRDA 4OTRA 3FC1X 2YDKA 2Z02A 3TDWA 1CTPE 5AX3A 4FC0A 3MJ2A 3RVGA 2JFMA 1YDRE 5CZIA 5ANDA 4DH5A 3LFCA 3HA6A 4JJRA
chains in the Genus database with same CATH superfamily
3LFSA 4D4RA 2XJ2A 3P23A 4EK4A 4FA2A 1XO2B 2SRCA 3E5AA 4YC3A 2VZ6A 4QMQA 2WU6A 3C4WA 2PVRA 2H96A 4AZEA 1XKKA 4TYEA 2ZM3A 4BCPA 3BLAA 5EM5A 2W1IA 1ZOGA 2QOOA 5D12A 2BMCA 3DV3A 1U4DA 2HWOA 3CXWA 4BTKA 3SGCA 4UZHA 2QOCA 4BKYA 3R8VA 5ANKA 2HXQA 4DTKA 5K4JA 3F3TA 1STCE 3D83A 4LL5A 3I6UA 4YNEA 4BGHA 5IMEA 5DRDA 2C5VA 3ORZA 4I0TA 4OBOA 5FP5A 5HCXA 5CSWA 3BWJA 3QUPA 4L3JA 2O2UA 3VJNA 3DBCA 4I92A 2IJMA 3U54A 2XP2A 2YCSA 4LG4A 4O27B 2V22A 4ZY4A 5EQYA 3ZTXA 4HNFA 3RM6A 4X2NA 4RBLA 2F7ZE 2O63A 5E9EA 3BGZA 5CVGA 2IW9A 4CT1A 5DHJA 2OGVA 4RFMA 4FTOA 4HVHA 3PDTA 4ASDA 2WQNA 4OTHA 2QHNA 2V55A 4XBRA 5FDPA 1NVSA 1K3AA 2XK9A 5HTBA 1IAHA 4PTEA 4GRBA 4OTPA 3EL8A 3RZFA 2Z7QA 3LXNA 5CSXA 3FMMA 4PPCA 4WO5A 3O51A 3R9OA 4Y83A 3LMIA 3D5WA 3UC3A 1QPCA 4F7NA 1PHKA 3PXRA 5FEEA 4RWIA 5BPYA 3Q60A 1Q8ZA 3KCFA 3UGCA 3GU5A 3U9CA 4HGTA 3MN3A 3LQ8A 5CU4A 2HOGA 3AXWA 2G01A 3A7JA 3O8PA 4X21A 4OT5A 3OEFX 3MA3A 4XLIA 3RK7A 3VC4A 3DY7A 4NJ3A 4FTIA 2LAVA 2Q0BA 3RGFA 4FKWA 3TNWA 1UKIA 4CZUA 4MNFA 1PKGA 2AQXA 2W9FB 3QTZA 5BUJA 3BCEA 4O4DA 2HXLA 3RJCA 3D94A 3ORMA 4DGNA 2R3NA 2HENA 3FZSA 4BL1A 4CRLA 4E1ZA 4EOIA 2EU9A 4F9AA 4CKJA 2E9NA 4IH8A 2GMXA 3F3UA 3UNZA 4IDTA 2GNIA 2ITVA 3AT2A 4BKZA 1VZOA 4IEBA 4OBQA 1M7QA 3UYSA 3WBLA 2YN8A 3ZDUA 4LFIA 5HD4A 3PE2A 3MH0A 3PUPA 2C6LA 1OZ1A 2XKFA 3HGKA 4L53A 4WBOA 3LFEA 3QZHA 5FTOA 2YM4A 2C6EA 2XKDA 5HZNA 3DT1A 2OF2A 2XNMA 2IW6A 3KXHA 4A9TA 3NYVA 1OIQA 3WE4A 1PXNA 4D1SA 2UZWE 4H3QA 2GS6A 3MDYA 2AC5A 1WBPA 3KQ7A 2ZV7A 1KSWA 3R7GA 4MK0A 4BJJB 4IBMA 3GEQA 4RWKA 3F7ZA 4C3FA 3GUBA 3MIAA 2ITUA 2XM9A 3Q52A 2P4IA 1MP8A 4YGAA 4FTUA 2I1MA 2G1TA 1GIJA 5J7HA 2BZKB 3MVLA 2YFXA 4U44A 4JI9A 5KMMA 3I7CA 4HZSA 4DGOA 1PMUA 4IJ9A 4ARKA 4YURA 2XIXA 1P4OA 2WQBA 3NPCA 5ETIA 2X7FA 2J50A 5AUWA 2B9IA 3L8SA 1XH7A 3RTPA 2I0EA 4AE9A 4EOQA 3F2NA 3HEGA 2RF9A 5AA8A 3I0OA 4S34A 4KBCA 4C3PA 5FGKA 4DEGA 3NIEA 1TQPA 3POOA 5JN2A 2P2IA 4PNKA 5HVJA 4MBJA 3FZOA 4ZTQA 3UMXA 4AXAA 4YZNA 4KA3A 5CF6A 4QYYA 4MHAA 5CU0A 4GYIA 3S1HA 5HU9A 3FPMA 4ZMFA 5C8NA 2JFLA 3E8EA 3F3WA 1Q4LA 4FT0A 4UMQA 4KABA 1PXOA 4MD9E 4J97A 4PL3A 2PVKA 1OPLA 3U55A 1DAWA 4YJNA 4OAVB 2FYSA 2XYUA 4EWHA 1UA2A 4R1VA 3W0MA 4QMMA 3LFBA 3EQIA 4QYEA 3W0OA 3BU5A 3CTQA 2QVSE 4G5JA 3RWPA 1Q61A 3GQLA 3PLSA 4NCTC 1OGYA 4CNHA 2GS7A 4L01A 4E26A 5J9YA 1QPDA 5GNKA 5EW9A 3UZRA 3KK8A 4K0YA 4IFGA 1B6CB 2UVYA 3JYAA 4LRKA 3VUGA 3HL7A 4FEXA 4O82A 3PJ3A 4ITIA 4YHJA 4AG8A 3JVSA 3FMNA 2HWPA 4BR3A 3GCQA 5I9UA 3BHUA 3LKMA 4FUYA 3D7TA 4FZAB 2BRBA 3QXOA 1YW2A 3O2MA 4QNAA 4FIFA 4CEGA 4CLIA 4EH3A 4QPAA 1O6LA 1GJOA 1M52A 3FMEA 4L42A 4UX9A 2WMUA 3BL9A 3BKBA 4C4GA 4IB3A 3FZRA 1OKWA 4ANLA 3T3VA 1R1WA 4EWQA 3OFMA 4HNIA 4DGMA 5CEKA 5JGDA 2QOKA 2OSCA 4DG3E 4F0IA 4Q9SA 4DLJA 4X2FA 4LI5A 3OUNB 4GVAA 2CLQA 1JKLA 4ACHA 1WMKA 4L68A 4UBAA 3W33A 4EK8A 2QONA 3K3JA 4U8ZA 2WQEA 3DK6A 3DK3A 3QQJA 4Z16A 4O38A 4UWYA 2J0MB 2UVXA 3NR9A 3OF0A 3ORIA 3OT8A 4FI1A 4U80A 3AMYA 3R8UA 3P5KA 4EH8A 5JRQA 3G51A 5CEMA 4I93A 2GHLA 5KMKA 2WMRA 3EQGA 3RK5A 2PZYA 4C7TA 4ZS4A 4LV8A 2WELA 4EOLA 2B1PA 4JIAA 2QO2A 3SA0A 2BKKA 4D5KA 5M55A 3UO6A 4YMJA 3MY1A 3QX4A 4RC4A 5AV4A 2W5HA 3E7VA 3NNWA 2JAMA 5HHWA 3LQ3A 4CG8A 1UNLA 3ANRA 4QMWA 3CY2A 3U8WA 1VJYA 4GT4A 4U43A 4FK6A 2A1AB 3ZUVA 5F9EA 2CNVA 4P5ZA 4PWNA 1SZMA 2O65A 4D2RA 2W4OA 3CGFA 5EFQA 1MRYA 2B9FA 5AWMA 1ZY5A 5K5NA 3M42A 5HEZA 2ZB0A 5IPJA 4DHJA 3COMA 3SDJA 2NRYA 4C02A 1KE5A 2IN6A 4HPUE 4F63A 4AW2A 4MYGA 5CANA 3OCTA 4F7LA 2QNJA 2GTNA 2XALA 3LW0A 4O7LA 4W9WA 2I0YA 3RPVA 4BCKA 4FEUA 4HGEA 2I40A 3Q04A 4LGDA 4FTLA 3BYSA 1SM2A 5JMSA 3NGAA 3KRRA 3JY9A 3GU6A 4ZSAA 3Q2JA 4EUTA 3MVJA 4IX3A 3IS5A 2XYNA 3EQBA 1Q3WA 4FBXA 4JXFA 4S31A 5AP5A 5IUGA 4XG3A 3A4OX 3SG8A 3IK3A 3FXWA 1A48A 1QPJA 2PU8A 3R1SA 2XIKA 3KGAA 5ACKA 3MI9A 2E9OA 3QZIA 5HG7A 4G3EA 3SXSA 4FT9A 4R3RA 4FKSA 4J53A 2QR8A 5E1SA 5BMMA 3GU8A 3K2LA 3QD2B 1OITA 4WUNA 3TNHA 3ACKA 5DMZA 4D9UA 4AACA 4WHZA 5E8YA 3EZVA 1W7HA 3GOPA 2X81A 4UMTA 1Y8YA 3LM0A 4RT7A 5JQ5A 4UB7A 2W4JA 1REKA 4ASXA 4KIOA 2QURA 3Q32A 2FSMX 3DOGA 5HG5A 3W0QA 1UNHA 3TI1A 4K9YA 4RVKA 5LVPA 5E4HA 2C1BA 3WIKA 4FL2A 1U54A 2CDZA 3KRXA 3NSZA 3FLWA 5EOLA 5J1WA 4BHNA 4XMOA 4QP3A 2B54A 5EQPA 4JMQA 1WFCA 4FV3A 2WU7A 4ZEGA 1V1KA 1WVWA 4KAOA 3FI3A 4XP0A 4HYUA 3ZXTA 4FV9A 1W0XC 2Y4IB 5E92A 3SV0A 5HTIA 4U6RA 2XAMA 2GDOA 5EG3A 2YEXA 3R8ZA 3TZ8A 2EWAA 3R83A 1IA8A 1RDQE 3GC0A 4I0SA 4A06A 4FV7A 4ZZOA 1OIUA 2VWXA 2AEGA 3PFYA 5JGBA 4M84A 1WBTA 1O9UA 5IISA 2EXMA 4A9YA 3EN5A 4YO4A 3C4CA 4C33A 1YWRA 3P78A 2YCFA 4W4YA 1SNUA 5HG8A 1OKYA 3MVMA 3PLAE 4M0YA 3EWHA 2WEVA 4CD0A 5DN3A 4RIWA 2PUUA 2UW7A 3MA6A 4PDOA 3OWLA 4AA4A 4CMUA 5AIRA 3KREA 3D14A 2O5KA 4YP8A 2A19B 3DLZA 4ZJIA 3PJ2A 4KIKB 3FZPA 1BI8A 3KIOC 2VO7A 4MH7A 3QQGA 4H1JA 5ACBC 1H00A 2RFNA 2RKUA 3OWJA 4YPSA 1F3MC 2B9HA 4Y8DA 5IEVA 5JKGA 4M7IA 4L67A 3MFSA 5CF4A 3N4UA 5M07A 3QQFA 2WMAA 4BIEA 3QCYA 2WEIA 4NIFA 4HGLA 5FQDC 5J95A 1DAYA 4Q2AA 4GKHA 2VX1A 3QTUA 4I94A 2O8YA 3RZBA 1JAMA 2XA4A 3TNPC 2FUMA 1WBVA 4EHGA 3V5QA 1NXKA 3DTCA 1BL7A 3CGOA 4I6HA 4KRCA 5CALA 4FYOA 1H27A 2Y6OA 4FTNA 3E8CA 5DVRA 3KF7A 4HVGA 3PSDA 3F88A 2Q83A 1YDTE 3UBDA 3V5JA 5BV3A 5FD2A 1CDKA 5CXHA 4BTMA 4IJPA 3UP2A 1PMNA 3BI6A 4FV0A 4DF3A 2OJ9A 4F09A 4I3ZA 5IU2A 4IACA 4OTFA 2YCRA 4JX3A 2WTWA 4AWIA 4YUQA 2R7BA 3PTGA 2I7QA 3CQWA 1Q99A 4Y95A 4E6QA 4ID7A 4U97A 1YRPA 4R5YA 3UVPA 4CG9A 4O0YA 2YM8A 3KA0A 2JC6A 1RE8A 3PXKA 1YI4A 3SW7A 2C6MA 2IF8A 4I23A 4ZP5A 4H3BA 5LMAA 2DUVA 3HV4A 5E8VA 4F6UA 3PSBA 3KVWA 4OTDA 4EZ5A 3FI4A 3C0GA 3R9RA 5HBEA 1WZYA 2C3KA 2WOTA 4FKLA 1TQMA 5AM7A 3SXFA 3V6SA 1RQQA 4WNMA 1DI8A 1ZY4A 2ETRA 3ZOSA 4AE6A 5I0BA 3JY0A 3E8NA 5FBOA 4USFA 4WRGA 4CFMA 4O0RA 2W1DA 1J7LA 5IQFA 3NUUA 5IDPA 2B55A 2YAAA 2EXCX 5M56A 2XRUA 3OY1A 4RA5A 3E88A 4S33A 4H1MA 5HIDA 2XF0A 4DEBA 4YLLA 3A61A 4ZLYA 1UU9A 3KC3A 3HMIA 2PZIA 1FGIA 2A4LA 2YM7A 1YI3A 3I81A 4IWOA 4BIDA 4DINA 3C0HA 3I6WA 3TV6A 4DH7A 1UU7A 3TUDA 3DXPA 3NNUA 4OR5A 3PA4A 3FBVA 3ZBFA 4QP9A 5B2KA 5CS6A 3DGKA 4R1YA 5CF8A 3D5UA 2R5TA 5DI1A 5DR9A 1M14A 4RC3A 2OXYA 4PPAA 2FSTX 2GFSA 4FZ7A 4ZY5A 4ALVA 2B4SB 2JDVA 2PMOX 4JQEA 4XV3A 5DA3A 4UYNA 2FVDA 4C4HA 5EHYA 3ALOA 4CT2A 4EOOA 3A2CA 5I9WA 2QCSA 5DT0A 3ZC6A 5GIPE 4W4XA 3BBWA 2O0UA 4H39A 4NFMA 3WZJA 4KUJA 3BLRA 4DFLA 3I79A 4F9BA 1PKDA 3DK7A 2XK4A 3JS2A 3ZMMA 4RFZA 3H3CA 4YTCA 2J0JA 4FT5A 4Z7HA 1XJDA 1BX6A 3R7YA 4F6WA 4UN0C 2PVJA 5IF1A 3AMBA 4ZJJA 1IR3A 4G5PA 4GK2A 4LOPA 4U9AA 5AV0A 3VW6A 2ESMA 4GK4A 5EI8A 4TWOA 1QCFA 4O21A 4E7WA 4QQ5A 1ZOHA 4GFMA 5IQIA 2BPMA 4M97A 2RG6A 4D28A 4N4SA 4RQVA 3POZA 2ITNA 4NM7A 2YM6A 4XJ0A 1CMKE 4AXFA 5BYLA 4DE4A 5DFPA 5FG8A 2J0IA 3AC2A 2V0DA 3QYZA 1YXTA 4FX3A 3OOGA 3UDSA 4A9SA 4O2PA 3FZ1A 2XK6A 2BAQA 4X2KA 4F78A 3O50A 5IZFA 2PVLA 3P7AA 1XH5A 4IANA 4RX7A 4J8MA 3AKJA 4DGLC 5J5SA 3R2BA 1VYZA 4LMNA 4I41A 4BZOA 5L3AA 3AD4A 4YJSA 3QTWA 1MRUA 1SVEA 4FTTA 4H36A 5LCKA 3KN5A 2X1NA 3CBLA 1UNGA 3CR0A 3I7BA 3OBJA 3QYWA 4MXYA 5L2QA 3V04A 4B4LA 4O7YA 3QC4A 5F20A 3CCNA 4GJ2A 4EOMA 3Q9WA 5EHOA 4OGRA 4BCIA 4ZIMA 4QOXA 5LVLA 3BQRA 2JDSA 3DAKA 5IEYA 4CZTA 5IH6A 5C4KA 3OY3A 1OI9A 5A6NA 5AX9A 2WQOA 2F49A 3QF9A 5CYIA 2PPQA 5D7VA 5IG1A 4FODA 4JBPA 1MQ4A 4NZWB 4B8LA 4QTDA 4LRMA 3BGPA 5CT7A 4D4SA 2QOFA 4I6LA 3UE4A 3UOHA 3KMMA 3I60A 3D2IA 4ZY6A 3MYGA 3R71A 3WILA 2ITPA 3NAYA 4TNDA 2OW3A 4IW0A 2GCDA 3QRJA 5C1QB 5BVKA 3E8DA 3MVHA 4IAYA 5LOHA 1KUTA 1M2RA 3Q3BA 5BMSA 3TWJA 1ATPE 3PIZA 4XP3A 2JEDA 3RCJA 4K77A 1TFFA 5EQEA 3PVWA 3NUPA 2J51A 2FO0A 4EH2A 5ANOA 1B39A 2QR7A 4XNEA 4D4YA 5A3XA 2UZTA 3ALNA 3R22A 4WA9A 4F1TA 4ZSEA 3HVCA 4TW9A 3MGYA 4HW7A 1PF8A 2Y7JA 3W2QA 4YJRA 2NNWB 3EQPA 3TIYA 3NUYA 2ACXA 2VTJA 1QMZA 3UG1A 2BIKB 5LWMA 1YXSA 3ENMA 2VTQA 2WKMA 3EFJA 3RNIA 3JVRA 4R77A 5F95A 1CKJA 3RMFA 1YHVA 5CT0A 5C9CA 3AQVA 2JIIA 4I6BA 4V01A 3NW7A 5L8JA 5IQCA 2VWYA 3LFAA 4BIBA 2HK5A 5FXSA 2YWVA 4HOKA 3VF9A 4IDVA 1YOMA 1OMWA 4PTGA 3WI6A 4QTEA 5EYMA 2XAOA 3QUEA 3R30A 3KRLA 4QMZA 3DJ5A 3NW6A 3VVHA 4GW8A 3AOXA 4W8EA 4AF3A 5BVNA 4EJNA 2W17A 2QKRA 4EOJA 5HE3A 2YM5A 4AGUA 3QRTA 2YACA 5HO6A 2VWWA 1S9IA 4NKSA 2UZDA 2C69A 4QQJA 3W0RA 5M44A 4OUCA 4P7EA 4RLLA 5KKRC 2UZEA 4YHFA 4FKIA 4O96A 4YPDA 1JLUE 2P2HA 4WSQA 1YQJA 4ZSLA 3LFNA 3NFFB 5M4FA 2XIRA 4IB0A 2Y6MA 1FMOE 1R0PA 4JBVA 4EK6A 5I9XA 5M08A 3AC3A 5IA5A 1YHWA 5TOZA 5EYDA 3PE1A 2UZUE 4K11A 4PMPA 2X9EA 4EBVA 4AN2A 5K9IA 2VO6A 4O7NA 5D7AA 4ORKA 3JR1A 4KBKA 4BGGA 2BRNA 3AG9A 5D11A 4ANSA 4G2FA 4RA4A 5K0KA 4X6QC 3R02A 4TYHA 5CAVA 2CGVA 1Y57A 4YSJA 5KMOA 2R0UA 3D5XA 2CNQA 1UU3A 3C9WA 3DQXA 2GHGA 3F7WA 2WTDA 3HECA 3VUMA 5TO8A 4CYJA 3HMNA 2I6LA 4EH9A 3QU0A 3FSKA 4O4FA 2OJJA 3DNEA 4FG8A 3VS4A 4JQ7A 2AC3A 5DEYA 2XARA 3P08A 2YA9A 4MNEA 5KMNA 4G9RA 1LPUA 3R1QA 5TR6A 3ZO4A 4FZFB 3OZ6A 2HY81 4FZDB 4YC6A 5GZAA 3I1AA 5JH6A 4LOQA 2ZAZA 3H4JA 4CFFA 3DTWA 2YIYA 3OTVA 4FNWA 4EHVA 5KX8A 4OTIA 2PUPA 3PVGA 4NSTA 2GQSA 3VF8A 2PVHA 5AP1A 3HA8A 3ORXA 3B2TA 4G3FA 3HKOA 3DFAA 4QTAA 3NFGB 2VTMA 3ODYX 3QTXA 3UO4A 2CGUA 2X2MA 4U81A 1BL6A 3JPVA 3BHHA 4NL0A 3KXMA 2GS2A 4J1RA 4JX7A 3TXOA 3NVKI 4J71A 4MF0A 5E91A 5EI2A 4IB1A 5CAQA 1NVRA 4NT4A 4QMSA 3V5LA 4MEDA 2B52A 4OLIA 3WYYA 4DTBA 5EDPA 3UPZA 2YAKA 4XX9A 4BDFA 3Q5ZA 2ITOA 4B0GA 2R64A 2VWUA 3DFCB 1ZOEA 3COHA 3QTSA 5IH4A 4O7SA 4IE9A 2Z7LA 3W16A 2OZAA 3M2WA 1PXMA 2BDWA 4GG7A 1A9UA 1ZZLA 2V7OA 4R5SA 3QBNA 4RPVA 3ZH8A 4C38A 4C2WA 4FL1A 3VBWA 4PV0A 4EEVA 2UUEA 3MY0A 5ETAA 3RBWA 3GNIB 1E1VA 4FVPA 1JSVA 4FV4A 3ODZX 4TZRA 4YJTA 4N57A 3QKMA 3BX5A 5A46A 5CSHA 2WMWA 2ITQA 2CKQA 2OICA 4KBAA 4AP7A 4DDGA 3VJOA 4IM0A 5TT7A 5M4IA 4MX9A 5B2LA 4QTBA 5CAOA 5I5ZA 4U42A 1J3HA 4LUEA 4M67A 4XP2A 2C30A 4JBQA 3TZ9A 4Z7GA 3KKVA 1G8JA 2OG8A 5E8SA 3AT3A 3BV3A 3DS6A 4G1WA 3L8XA 2J5EA 2PE1A 3Q9ZA 3QL8A 4XRJA 2W06A 3ZO2A 1YXXA 5BUEA 3EMGA 1H1SA 4Y73A 1KE6A 2JKMA 3QKKA 3UP7A 5DYJA 2WMQA 4X2JA 4IAFA 2CMWA 2VGOA 4UXLA 3ZO3A 3IDPA 2VWZA 3MH1A 4ANQA 4AU8A 4MXZA 2WMVA 4QYFA 4E6DA 3R73A 4P5QA 5KKRB 4PP9A 4X2GA 4EH7A 1WVXA 2BR1A 3BEAA 5FP6A 2XJ1A 3FC2A 5C8KA 4FV2A 5M4UA 3N4VA 3D7TB 5A6OA 5AUUA 3U51A 3BQCA 1PJKA 3GVUA 5AUXA 3NUNA 5C01A 4QEBA 1M2PA 3ZLWA 4DYMA 1GIIA 2VWVA 2XK3A 3CQEA 5HVKA 1J7UA 3W0PA 4PX6A 3OVVA 2BTRA 4J7BA 2BHHA 5J8IA 5BVOA 4O6LA 3VS6A 5IA2A 4QDVA 1OM1A 3A8WA 3G0FA 4RIOA 3R7EA 5AFVA 4AOIA 1SNXA 4BCGA 2Q0NA 3GC9A 4ACGA 2JBPA 3O7LD 2BUJA 2UW4A 2V62A 5DT4A 3SOAA 5M51A 3TG1A 2Y9QA 5HNGA 3FJQE 2XS0A 2YJRA 2OH4A 3BZ3A 3EN9A 4RWJA 4AFJA 4PMMA 3MB7A 5AUTA 4L00A 3V5WA 3DAJA 4BN1A 3VNTA 4DEIA 1GZNA 3SW4A 3RI1A 4V05A 3R2YA 1SYKA 3FXXA 3WF9A 5HI2A 4C2VA 2XBJA 4IAIA 4HCVA 2R3OA 3P79A 4RX8A 4N6YA 2B0QA 5HLNA 1Q24A 1WBSA 3E62A 5DIAA 3PYYA 5A4LA 5CVFA 3VBXA 3S00A 4O0WA 1YHSA 3D4QA 2R3LA 3FUPA 3EN7A 1EH4A 2X2LA 4M3QA 5EI6A 3FWQA 4FV8A 2XKCA 3LJ0A 4KWPA 4RLKA 3PG3A 2ETKA 3DCVA 1P2AA 5FXRA 2WTIA 3HV7A 1GIHA 4QP2A 3UC4A 2W1GA 1PMEA 2PTKA 4JG6A 2OJFE 3EL7A 1DM2A 4I1ZA 4RQKA 5CVHA 4J95A 3BU6A 4GU9A 3VBTA 2UV2A 4DAWA 5KHWA 3E3BX 4G9CA 3PWYA 3OT3A 4C58A 3AC5A 2XANA 3R9DA 3AGLA 2VN9A 4X0MA 5AAEA 2NP8A 3H30A 3MTFA 3K3IA 4RJ6A 3ULIA 2A98A 3FXZA 5J1VA 2EB2A 3GU7A 2Z60A 1I09A 3PIYA 5TF9A 1XWSA 5A4TA 4M69A 3THBA 4GK3A 5JK3A 4FICA 5DBXA 1PYEA 4FIHA 1KV1A 1VYWA 2XNNA 4FF8A 3FYKX 2WGJA 3ACJA 3CQUA 4IM2A 5FTGA 3TYKA 2WTCA 2PVFA 2X8IA 3PJ1A 3RAWA 1ZYDA 2OXXA 3IW7A 4J52A 3F2AA 3QQUA 4KSQA 5EHLA 2CCIA 2VTNA 4GU6A 4FE2A 3BIZA 4TPTA 5F1ZA 2NPQA 5JFWA 1ST4A 4LRJA 1U5RA 3TM0A 1JBPE 2G9XA 5HVYA 3GC7A 3MESA 5DLSA 2R3KA 5AADA 4WUAA 3F3VA 4A9RA 3F82A 2QU6A 4LV7A 1M17A 4O91A 3C4XA 5LCJA 4DLIA 4TWPA 4WOVA 4IXPA 5F94A 3DKFA 5FDXA 5CASA 2ZYBA 4RMZA 3ET7A 4FV5A 2X0PA 5BVFA 4FKQA 3OXIA 3AC4A 4OTQA 5D9HA 3VRYA 4BBEA 5ANGA 3L8PA 3N51A 3D0EA 2DYLA 4L6QA 4QMUA 3VBVA 5AV1A 1PY5A 2WTVA 1U54B 4I4EA 5LMBA 3REPA 4FVRA 2C0TA 4IMYA 1W98A 3I4BA 3BYMA 3PXZA 2PYWA 4OBPA 4TN6A 5FWKK 4BDIA 2ETMA 2GNLA 3LCKA 1PXJA 4JS8A 3PA3A 2C1AA 4GJ3A 4RVMA 5GJGA 4RX5A 5JT2A 1W2CA 5KCVA 2GQGA 4CQGA 3HUCA 4QPSA 1O6KA 3C50A 4DDIA 3H9FA 4X3FA 5AP2A 4H3PA 4RZVA 4R3PA 2UVZA 3NS9A 1JQHA 4L8MA 4FIEA 3U4UA 3SC1A 1YDSE 3PP0A 3VW8A 1XMMA 3V3VA 4C35A 3SD0A 2VGPA 2HZ4A 3OWPA 4GL9A 3NYNA 2Y4IC 5A4QA 2UZVA 4I4FA 4IVDA 4RX9A 5HG9A 1YXUA 3OG7A 4ZTMA 3C5IA 4XG8A 4FKUA 4FTMA 4OTGA 3FEGA 3A7FA 4BWPA 1APME 2VTOA 1OKVA 3PRFA 4F1OA 1ZYJA 3QRIA 4RIWB 3NMUF 3VIDA 3EQRA 4HZRA 3ZZWA 3MH3A 4MXXA 3IW6A 3LVPA 4CKIA 4UMRA 5L2TA 3LJ2A 3IW8A 3R28A 5AAFA 3W10A 4YLKA 2BHEA 5L6OA 2JLDA 2VNWA 2PE2A 3BLQA 4JDKA 5A4EA 4DCAA 4QMLA 4NK9A 2Y0AA 4FOCA 5FRIA 1BLXA 4D0XA 4BWKA 4LGGA 5M06A 3L9LA 4R6VA 4RRVA 4UALA 1H25A 4BBMA 3PVBA 3HV5A 4U3YA 1FVVA 4NIFB 2QHMA 3UDBA 1V0OA 2GSFA 4PF4A 4R8QA 4F9WA 2BZHB 3CPBA 3RPRA 4Y85A 3FMKA 4I6QA 4QTCA 4LYNA 5ITAA 4IZAA 3F2RA 2ZV8A 3KULA 4IVCA 4EZ7A 3OHTA 4I5MA 1GY3A 4GFOA 3LCTA 2OU7A 3CTJA 3QCSA 4A07A 2BFYA 2VTLA 5IQBA 2CLXA 5E8TA 5C03A 3GFEA 2H8HA 4H05A 2JKKA 5DR2A 5E8ZA 2PVNA 4C4EA 3NYOA 2X7OA 3SRVA 3HV6A 3WOWA 5DPVA 5KBQA 1R78A 2VTSA 5HESA 4AZFA 2GNHA 2JKOA 4JAIA 4UY9A 4QMYA 5AP3A 4EOPA 4FKJA 4IWQA 3PY1A 3ZSGA 4QT1A 1L3RE 3PVUA 4KIQA 2G2FA 4GG5A 2DWBA 1H07A 2JAVA 3DJ7A 3G5DA 4GH2A 4JLCA 4W8DA 3E63A 1F0QA 3KXNA 3PP1A 5T3QA 3W18A 4BFMA 4FT3A 5AMNA 3LM5A 3NW5A 5HCYA 3PPZA 3WE8A 3AKKA 2W1EA 1J7IA 4NYEA 3UYTA 2PY3A 2X4FA 4FSQA 4JVGA 4OT6A 3ORNA 4Y5HA 3HX4A 4CFVA 4DN5A 4EUUA 3KN6A 2BDFA 1OPJA 2UW3A 3VBYA 4GUBA 4C0TA 4E4XA 3BBTB 4AZTA 2CKPA 4C4FA 2PZRA 4RSSA 3WF8A 4PDSA 4ZK5A 3OW3A 3UDZA 2DS1A 3KXXA 5AJQA 2PMNX 5HX8A 1HCLA 4EONA 2WMXA 4FUXA 2IZUA 4BVUA 5EM6A 1ZARA 1NVQA 2HZNA 2IVTA 2C4GA 2YZAA 2H6DA 3EQHA 3G0EA 4DFYA 3C4EA 2W1CA 4F7JA 4K33A 4PDPA 3K5VA 5LQFA 2YIXA 4AT3A 2C3IB 2J0KA 4AXEA 3PFQA 1OVEA 2XB7A 5GIOE 4I0RA 4LV5A 5BVEA 4C3RA 2R3GA 3F9NA 3VUHA 5L2WA 5HORA 2IZTA 3TTJA 4UEUA 3OTUA 4JDIA 4FOBA 2WAJA 1JPAA 4M0ZA 4E8AA 5HIBA 5A4CA 1KOBA 3IDBA 5KMJA <