5JT2A

Brafv600e kinase domain in complex with chemically linked vemurafenib inhibitor vem-bisamide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
257
Chain Sequence
GSEFDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATEKSRWSILWMAPEVIPYSFQSDVYAFGIVLYELMTGQLPYSNINDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Chemically Linked Vemurafenib Inhibitors Promote an Inactive BRAF(V600E) Conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 257
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jt2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jt2A01
2RIOA 3BBTB 2C5VA 4FTLA 4MAOA 3D7TA 5CXZA 3P79A 3GU7A 3POZA 5IPJA 3PJCA 3S00A 4RJ3A 2Q83A 3TKHA 1FVRA 3UIBA 4AGDA 2UZOA 1Y57A 3R71A 5AM7A 4AX8A 4EOPA 2RF9A 4QMXA 2OSCA 2QOQA 4FYNA 4C62A 1YHWA 4DGLC 5I4NA 5LMKC 1YQJA 3PYYA 3OOMA 4OTRA 4Z3VA 2VX0A 3LVPA 3MH1A 5JFSA 2OBJA 2Y4IB 4XH6A 4FNWA 3ZFYA 4FK6A 3FQEA 4YJRA 1ZWSA 4IDVA 3HA6A 1EH4A 4GV1A 4XNEA 3AGMA 3Q2MA 2VWUA 4AACA 4TYJA 4CCBA 2CNQA 4WUAA 5HOAA 2XRUA 2B54A 3NR9A 3GU8A 4W9WA 1G8AA 3BI6A 2OG8A 5GINE 5D11A 5D1JA 2VNWA 3OC1A 3VBXA 4CYJA 3I6UA 4HGSA 4L9IA 5BNJA 1ZRZA 1YXUA 4RWJA 2VWXA 5M53A 5F20A 3MTFA 4L01A 3NNVA 4XBRA 4ZSAA 3CE3A 3KB7A 1PMEA 3R63A 2QO9A 3ZSGA 3BHUA 3EOCA 4V05A 2WMTA 4IIRA 4BBEA 2C69A 2PL0A 3VUTA 5HICA 2A0CX 3PXKA 1ZZLA 1FQ1B 4C02A 5B2KA 2OWBA 5E8UA 3OY3A 5CVHA 4FSQA 4ITIA 4CKIA 4LI5A 3F61A 3SXFA 2W5AA 5IH5A 5CWZA 5J7BA 4RJ6A 5CEPA 5A4CA 3W2QA 4BTMA 3PIZA 2XJ2A 5ETFA 3MJ1A 2VWWA 3Q53A 4B9DA 2HK5A 4HW7A 2ETRA 5EI2A 5KMKA 3H4JA 4X2GA 5C8KA 1WAKA 4QMVA 3FWQA 4QD6A 3IK3A 5IA5A 3UG2A 4CSVA 3CGFA 4H36A 4LOOA 4PF4A 3UQGA 2O65A 1XWSA 2QO7A 4FK3A 5CZHA 2FUMA 4RX9A 4IFGA 3DKOA 4DEIA 2XIKA 3FLWA 2UZNA 5HG9A 5IUIA 3RALA 4CFFA 2PHKA 3LMGA 3L9NA 3BYMA 4J53A 3VC4A 4AOTA 4BN1A 1J7LA 3P1AA 4GYGA 5GNKA 5IF1A 3V6RA 4BBMA 4K11A 4RBLA 4O81A 2X6EA 2GNHA 4G3GA 4XG7A 4C61A 2HIWA 5I0BA 3A7GA 3W2PA 4RC4A 4YBJA 2OJJA 4MKCA 4X3JA 4U79A 3REPA 3UG1A 2QD9A 4JDIA 3EQHA 4R5YA 3BEAA 4MTAA 5CNNA 2H6DA 5DR6A 5ICPA 4C58A 3I81A 3ORMA 2HAKA 2PZYA 4ZZOA 1FGKA 4PMPA 5IQBA 4BCMA 2QOKA 3QX4A 1W0XC 4PV0A 4JXFA 2AUHA 4XJ0A 2VTQA 5D7VA 5E7RA 3VVHA 5AWMA 4DFUA 4FT5A 1YXVA 4B6LA 3BELA 4BHZA 4DEAA 1YDSE 5BVWA 1DI9A 3UVPA 4BIDA 2WQNA 3QGYA 4W4XA 3ZZEA 4C4HA 3BE9A 3AOXA 2C6TA 3ORKA 3V04A 4RC2A 4CV8A 3KREA 2W1DA 2VX1A 5F1ZA 5M06A 3HRFA 5ANJA 2C3KA 3QCXA 4AZSA 3R04A 2JKKA 2PZPA 2UW9A 3MPMA 4UBAA 5CT7A 1NVRA 2VTLA 2VTMA 2YDIA 4U97A 5CI6A 2ZM1A 5K5NA 3AD5A 1PW2A 4ACDA 3FKLA 1P14A 2OU7A 3FMKA 4I41A 3PSBA 4PPAA 5IISA 5A6NA 3LJ1A 4C4GA 1UWJA 3IDPA 3NUYA 4MQ2A 2PUNA 4MQ1A 4JG6A 4YZBA 4ZSJA 1QPDA 3VS2A 4AN3A 3AG9A 4ANMA 4BI1A 4ANQA 4YJTA 2LAVA 5HBHA 3TG1A 1R1WA 4YUQA 3QZFA 4RC3A 1WBNA 2YWVA 5BVKA 4D28A 3Q9XA 3F3VA 1YRPA 4UYNA 2VO0A 2PUIA 4HGTA 4OT6A 3FHIA 4E4NA 2LGCA 4NJDA 1XJDA 4F09A 1W98A 2ZB0A 2WQMA 4OTGA 1RQQA 5JFVA 2ONLA 2V7AA 3QTUA 3ORTA 5CU3A 5JH6A 2A4LA 5HO8A 4GUEA 3LW0A 3LFDA 2YM7A 3R8UA 4MYGA 3F66A 3FQSA 1Q3WA 2WKMA 4YJOA 3B8RA 4ASXA 4IB5A 4U43A 4EC9A 4XV3A 4PPCA 2QODA 1U5RA 3ACJA 2I1MA 5DR2A 2XNNA 4V01A 5GZ9A 4ZZNA 3NUAA 1PYXA 5CANA 2I6LA 2Z7RA 4NCTA 5F4NA 5AUXA 3W2RA 4CZYB 3N4TA 3GC0A 1T45A 1H1SA 2V55A 4IDTA 3WF9A 4CKRA 3I5ZA 2BZIB 5CI7A 3F2NA 5JRSA 4EK3A 3FI2A 4GVJA 2HOGA 2ITWA 2OXXA 4LOQA 3ZLWA 4AGWA 3VF8A 3VQUA 2XIZA 4X2JA 3UYTA 3UO5A 1ND4A 1Q41A 4TPTA 4BDCA 4PUZA 1TVOA 3QA8A 5KKRC 3VF9A 2G1TA 3QTWA 2JKOA 4N70A 3ATSA 3UZRA 3P4KA 2WU6A 5KMNA 4IQ6A 2YDKA 4YJPA 4RFMA 3NPCA 4FSZA 4RA4A 4YHTA 3F7ZA 5DWRA 1H1WA 3LXLA 3QGWA 5JKGA 4IJ9A 3R7EA 1OL1A 5EQPA 4GG7A 3FEGA 5JFXA 3U4UA 5FXRA 3R9NA 1QCFA 4FZFB 4XG9A 4V0GB 3UTOA 1OL6A 3ZXZA 2ETKA 4QYYA 4I6QA 5AV1A 4QMSA 2F9GA 5CSVA 4BWKA 3U54A 4IADA 3Q96A 1FGIA 5CU2A 3WARA 4XYFA 5IQDA 5M4UA 4O7TA 2Y8OA 5AV2A 3E8CA 3R1YA 3PSCA 3DNDA 4ZMFA 3MWUA 4O6LA 5FP5A 3DKFA 4YP8A 2QG7A 1OPKA 4BYIA 3LCSA 2R0IA 4F0GA 5BVOA 5HLWA 2RFNA 1JPAA 4LGDA 3TACA 3W2CA 5IH4A 4HYHA 3QKKA 3HYHA 3CCNA 4YTFA 3OEZA 5HTBA 5JT2A 2UV2A 3NNWA 4O7ZA 3D2IA 3QC4A 2XA4A 3ENHA 4QP2A 5CSPA 4MWIA 2WMQA 5C4LA 1WVWA 4BYJA 3LMHA 4LL5A 2OICA 1BX6A 4DT8A 2GQRA 4L8MA 4ZJVA 3C51A 3OBJA 2ZJWA 3UE4A 3MB6A 4FT9A 3T9TA 1U59A 5AUWA 4DF3A 1YDRE 3EQBA 5IQEA 5E8TA 3HV6A 1JWHA 4BTKA 1WFCA 1WBVA 3H10A 2EB2A 2BDJA 3BQRA 3G2FA 3NNUA 4J97A 4DG3E 3VHKA 4FSNA 4O2ZA 4C4IA 4FKQA 4PTCA 5CXHA 2OJGA 3A7JA 4FZ6A 3A8XA 5GJFA 4BDGA 2OFUA 4QMNA 2EU9A 3K5UA 4K2RA 2V62A 4NTTA 3QQUA 2F4JA 3D83A 5EQYA 5I9ZA 4BF2A 2UW8A 3VO3A 3W33A 1ERKA 2JDRA 3QYWA 5F94A 2RSVA 5AP1A 4TYGA 5HO7A 2VTNA 3CTJA 2IO6A 3A61A 3S2PA 1KWPA 3F2AA 3L9PA 2YERA 5CEMA 2XNOA 4X6RA 1STCE 5KBQA 4DTBA 3NIZA 5TOZA 3IW5A 3ALNA 5DEWA 4NK9A 4MXYA 5HE1A 4BCGA 3IO7A 4XHKB 1VJYA 4KINA 2E9OA 4BCPA 2XK8A 4EONA 2BMCA 1BI7A 4M14A 3CKWA 3EN7A 4EOKA 2F49A 4HCVA 3E3BX 4QNAA 2Y7JA 5HD7A 3RWQA 3W32A 5JMSA 2GU8A 2GNLA 2CLQA 2BFXA 5M55A 2B0QA 4BCOA 4YZ9A 3KK9A 3F7WA 4XP3A 4AA0A 4E4XA 5I9UA 5L3AA 4Y5HA 4YJSA 4BDJA 3KF7A 2QC6A 3C4XA 1UU7A 3KRXA 2C47A 4U3YA 3LQ3A 3JVRA 1Y8YA 4FV0A 4X2KA 4D2PA 3C0HA 3L8XA 5GZAA 2XMYA 4YURA 3TIYA 5D7AA 2ITVA 2J0JA 4QMYA 2HZ4A 2IVTA 3PJ3A 4JQ7A 2JIVA 3FBVA 3GCVA 3ZRKA 1RJBA 4LL0A 4H05A 4WG5A 3DK3A 3JPVA 4QTCA 5M44A 4FIIA 4I22A 5AMNA 2WELA 2YLFA 4O96A 1U4DA 1YWNA 2C6KA 4V0GA 3QTQA 5C26A 2EB3A 2P33A 5HTCA 3KCFA 3R8LA 4RQKA 2PU8A 3FI4A 4CMTA 4YR8A 3Q5ZA 4C2WA 2BIYA 4GCJA 3R8VA 3TZ9A 3ZTXA 3PPKA 3O51A 4L46A 4WT6A 4AQCA 4IE9A 4M97A 4BI0A 3LCKA 4F70A 3C1XA 4CFXA 3MVJA 4TTHB 4O7NA 4I94A 5KMJA 4S30A 4W4YA 3E93A 3OWKA 4IH8A 4YZMA 3RPOA 5CU6A 4EH5A 3GCPA 5E9EA 3OW3A 5AX3A 4EORA 1J7IA 4PRJA 3D7ZA 3RAKA 4L45A 1SMHA 3U87A 3LXNA 2XK3A 3W2OA 4TZRA 5LWMA 2JBPA 4HZRA 3IOPA 1GOLA 3W55A 2W05A 4DBNA 1H26A 2WTIA 5F9EA 3PDTA 3MI9A 3PP0A 4QMPA 4M66A 4OTIA 2OJIA 1W83A 2R3NA 5CEOA 2C30A 4I0SA 2PVKA 2X8EA 4J7BA 4HYIA 4M68A 4EQUA 3TTIA 4MHAA 4DT9A 4TN6A 3CY2A 4OTQA 4GJ2A 2CJMA 2W1FA 4I5HA 3G6HA 2C1AA 3D5UA 3EN9A 3NS9A 3QCSA 5A4LA 3W8LA 3BGZA 3FSFA 4FG7A 2NP8A 3O23A 1Q8UA 1SVGA 4FT3A 3LLAA 2OKRA 1X8BA 2IWIA 2XKDA 2YM3A 1O6KA 4CD0A 5DVRA 1JKLA 3BX5A 2CGXA 4I6BA 1K9AA 3SD0A 4JBVA 4AWIA 1XHAA 4GMYA 1MQBA 4KIQA 4BWXA 3FMNA 3D2KA 4S33A 5E8YA 4U44A 2WQEA 2JDTA 4G6OA 1FMOE 2ZV7A 2OF4A 4NFMA 3SC1A 3A7HA 4O7YA 5AV3A 3KVWA 2X8DA 2EWAA 4CZTA 1B39A 2VAGA 3TWJA 2ITZA 2BRGA 5AA9A 4D4SA 1XKKA 5AJQA 3GT8A 5CAQA 3DFCB 3R7VA 2VV9A 4EYJA 5C8MA 3E8DA 2A2AA 2CPKE 5EYMA 5G6VA 4BGQA 1M2PA 3MESA 5DYJA 2WTWA 4YJUA 3QXPA 5DMZA 5IQGA 4N0SA 3R28A 2W4OA 2RL5A 3W8QA 2GS7A 3EN4A 1TQPA 4JX7A 5HEZA 2JFMA 5AP0A 1P4OA 3ZU7A 4JG7A 2X6DA 3IOKA 4O7VA 1Q8TA 1YXXA 3LZBA 4IANA 1YI3A 2PULA 5FG8A 2FSOX 4BKJA 3UDBA 3ENMA 3OVVA 4RQVA 4ACGA 5FEQA 4AFEA 3K2LA 3BLQA 3FLSA 4A9UA 3PUPA 3UIMA 4L7SA 4TWPA 5GJDA 4A06A 1Q4LA 4LMUA 5HQ0A 5IQHA 3PA5A 3QD3A 5IA0A 3GBZA 2WMSA 4BWPA 4ITJA 1ZY4A 5HIEA 4C7TA 3GENA 4FIJA 4DG0E 3CY3A 2A1AB 5EYDA 3UGCA 4D1ZA 3DPKA 3MV5A 4DEEA 2XKEA 3P0MA 3PZHA 2R3OA 4QYFA 3R9DA 4O6EA 2UZLA 5HIBA 3O7LB 5HCXA 3V5PA 2VWVA 4S34A 2WHBA 4F7NA 3PVWA 2WMUA 4FV3A 4YO6A 1QMZA 4IX4A 3PLSA 4EZ3A 4FUXA 1JKTA 5DI1A 1ZOGA 4ARKA 1ZYLA 3ZONA 3OCBA 2FGIA 2HYYA 4L00A 2KULA 5DT4A 4M15A 3ZM4A 4OUCA 3DB6A 4Y8DA 4GIHA 5AR4A 3DLSA 3A4PA 4A4LA 3I0OA 3NIEA 3KMMA 4JVGA 4U40A 2YCFA 2YITA 1UV5A 1ZLTA 4G5JA 4ACCA 4LV5A 1ZYJA 3MY5A 4OT5A 3PJ8A 4QTDA 4YLKA 4RVKA 3EKKA 2W9FB 1JBPE 1LP4A 3COHA 2NPQA 4QYGA 3VW6A 1RW8A 4XRJA 3I4BA 4XV9A 3C13A 3VRYA 2PE0A 3AGLA 5BVNA 3QCYA 2BDFA 2WMBA 3ZZWA 3CKXA 2C0TA 3S3IA 4OGRA 5LVMA 3BV2A 2DQ7X 4D0WA 2VTRA 1GY3A 1PY5A 3TZ7A 4CFUA 3NNXA 4P5QA 4Y73A 3OFMA 2XVDA 2J50A 2W99B 3O17A 2YM4A 1JAMA 4WUNA 3RPSA 3CSVA 2QNJA 4EH2A 1FVVA 4FSWA 3WE4A 4E26A 2ERKA 3TNHA 1J7UA 1I09A 3U6JA 1K3AA 2DS1A 2E9PA 2PVJA 5FD2A 3WYYA 3A99A 2GQSA 4KRDA 4ANOA 4FKTA 4PMMA 3AC3A 5J95A 3SKCA 2IW9A 1OL5A 1U54B 1BYGA 4CVAA 3QQGA 4XUFA 4Z9LA 4ZLYA 3DAKA 3BYOA 4DLJA 4RFZA 1QPCA 4JX3A 4HVIA 3EN5A 3NUPA 4M0ZA 3BE2A 1OKWA 1OMWA 2ESMA 2X4ZA 4W4WA 3RHXA 5L2TA 4DFZE 4GRBA 4PNIA 3B8QA 1YOMA 2J5EA 5K3YA 4E4LA 4NM3A 4P7EA 4AFJA 2ZOQA 4QYEA 5L2QA 2DWBA 3HMMA 3R73A 5KMMA 4J1RA 3P23A 5AUUA 2VTTA 4CTBA 4ACMA 5E8XA 5FUTA 2C5XA 3RBWA 4D2RA 2QOLA 1H1PA 3CTHA 4F7JA 3DK6A 2X7FA 5BMSA 2JBOA 1IAHA 5CAOA 4XCUA 4K18A 2XNGA 4E5BA 5IUGA 5J79A 4YC3A 4Y95A 5HLPA 3R2YA 4ID7A 2QOBA 3NW6A 4L3LA 3RJCA 3VUMA 4A07A 4UMPA 3R7YA 4EH9A 3MTLA 3OP5A 4DFNA 1CKJA 2B9FA 3PE2A 4FIHA 4GU6A 3UJGA 4C33A 3C50A 3QKLA 4XG6A 1W84A 3FXZA 4AN2A 4QTAA 4X0MA 5EYKA 4EH4A 3JR1A 2J51A 4IHPA 4IZAA 1FOTA 3RP9A 4RWLA 2FSMX 4LM5A 5HTIA 3DXQA 2OGVA 3R22A 2W1HA 3DOGA 2ITYA 4FKSA 4JBPA 5BX0A 4FEWA 3T9IA 1ZY5A 2YIWA 5AV4A 3R0TA 5HZNA 3UP7A 4U45A 5A4TA 4K8AA 5ETCA 1H4LA 5CSXA 4GFOA 5FBNC 3K3IA 3T3VA 3RZFA 5J1WA 3ZRMA 4W9XA 5D9HA 3JXWA 3QYZA 3GUBA 4J96A 4F4PA 1GNGA 2C6DA 4PTEA 4J8NA 2JEDA 4KSQA 1E1VA 3BWFA 4A4XA 4KIKB 4R7IA 2WEVA 2R2PA 4WO5A 4PDYA 5ANKA 5C8NA 2VGOA 3NEWA 5IU2A 3FDNA 3P7AA 4S32A 4BCJA 4BIBA 4QO9A 4AW1A 2J2IB 2QCSA 2JKQA 3LFEA 2X8IA 2YM8A 3TUDA 4YZDA 1PXMA 3L9LA 4O7LA 4CFMA 2QVSE 3QUDA 4J71A 3QTIA 4GKHA 4GU9A 1IA8A 2I0YA 4NSTA 3ATTA 2VRXA 3ZBXA 2C6IA 1OECA 2ITOA 2C5YA 4KB8A 3FMEA 4PWNA 4CRLA 4NW6A 2BCJA 3G9NA 3FZTA 4TNBA 4XLIA 1ZZ2A 3GXLA 5CF6A 4ZLOA 3OT8A 2YZLA 3PA3A 4XS2A 3OOGA 3EYHA 4TWOA 3KRJA 1E9HA 2J0IA 4LOPA 5LVPA 5FDXA 3OXIA 4IVDA 3LXPA 5EOBA 5H2UA 5BVEA 5EH0A 4U42A 4YJVA 2GCDA 2CGVA 3H9OA 5E8WA 1MUOA 3RAIA 4DFYA 4R78A 3F9NA 4R77A 5HVYA 2YABA 3UQFA 3KA0A 4IACA 2UZVA 3Q9YA 1YXSA 2B4SB 4QP8A 1LEWA 4WG4A 5AUTA 4WHZA 5IH6A 2IG7A 3MFTA 3QLGA 3TNWA 3AXWA 2UW6A 4O0VA 5AP6A 2XJ0A 4IZYA 3FMDA 5I5ZA 3NZ0A 4ZSGA 3O7LD 3R1NA 1U54A 3ZBFA 3PSDA 3GFWA 2J9MA 3OXTA 1GZNA 4UN0C 3FYJX 2V7OA 3TV7A 2JIUA 3UOLA 4NL0A 3GGFA 3LCOA 3FE3A 5CAVA 4BVUA 3H9RA 5BYZA 5HU9A 3EH9A 2WGJA 1UU9A 2GHGA 4MBLA 2P2HA 4RJ8A 2BZKB 5ANDA 2OK1A 1XBAA 3HX4A 1CTPE 4FTNA 3T3UA 5AP3A 3HV4A 2WMVA 3OCGA 5HG5A 5KO1A 3DGKA 4ZTSA 2W1EA 3FUPA 3LPBA 4E20A 2QURA 4HYUA 3RAHA 5JRQA 2ZV8A 4FIFA 1SNXA 2V5QA 5JGAA 2QOHA 3TZMA 3MW1A 4JI9A 1XH4A 4FTCA 5KCVA 3RINA 3NAYA 4G3EA 3UNZA 2BR1A 3PPJA 3ACKA 4YU2A 1WVYA 3EQCA 4F0IA 1A06A 5T3QA 2VWBA 1O9UA 1T46A 2YIXA 4FUYA 4GUBA 4BDHA 4EHGA 4DG2E 4FGRA 4AW2A 5CQWA 1E1XA 1TQIA 3HNGA 3G6GA 3QQHA 5FTOA 5HCZA 2B52A 3RPYA 1Q62A 2R3HA 5I9YA 3SG9A 3FY2A 3KRLA 4FYOA 4FTJA 3W1FA 3UPZA 1A9UA 4RX8A 1Y91A 2PVHA 4JLCA 3RM6A 3PRIA 4O91A 2ITUA 3ELJA 2QOIA 3TNPC 4GKIA 4HPTE 4QMOA 4XRLA 3ZUVA 3VBYA 1OBGA 3U55A 1NVQA 3QUEA 4PL3A 1WZYA 4YC8A 4PPBA 3FXXA 4AGUA 5HD4A 1OZ1A 2ZDTA 1ZMUA 4KIKA 5HGIA 2JKMA 3RK5A 2PSQA 4H1JA 4D4VA 4FKLA 5I3RA 4GEOA 4IM0A 3U6HA 2PMNX 4AU8A 3O0GA 1H1QA 4FTAA 5EI6A 4PP7A 5HG8A 2BKKA 4FT0A 3OZ6A 1H0WA 3C5UA 3EL7A 3ULIA 3VS7A 4EOMA 4M12A 4MF0A 5CNOA 3ZO4A 3FZOA 1AD5A 3ZLYA 4D5KA 4UMTA 4HVGA 2YISA 4UEUA 3Q4CA 3DDQA 4R6VA 2W9ZB 3NLBA 3U9NA 4R3PA 3R6XA 3VS4A 1WBOA 4FL3A 4OBQA 2ZDUA 4QPMA 3TEIA 4BDAA 2OW3A 5L8JA 4U8ZA 4CLIA 3NYNA 2QR8A 4KUJA 4R7BA 3F2RA 3Q52A 3WBLA 3TKUA 2Y6OA 4YHFA 4DH8A 4FKUA 5AIRA 4C34A 3U6IA 4N57A 4IM3A 3KXGA 5BUEA 4IVAA 4S31A 4YNEA 3H3CA 3ORNA 1ZYDA 3CQWA 3DU8A 3Q6WA 4YPDA 1IRKA 4APPA 3LQ5A 4EZ5A 4DEHA 3RK9A 4E6AA 4EJ7A 5J7HA 4AF3A 3QL8A 3MH2A 3PY3A 4IB3A 3OTUA 1PXJA 4PTGA 4DHFA 3R7UA 5IG1A 4PL5A 3C0GA 3AMYA 3ID6C 2YM6A 5D41A 4QP4A 5FTGA 2R7IA 1DAYA 4OTHA 3IONA 5HVKA 3RPRA 3OW4A 4MXOA 3JUHA 2CLXA 3OTVA 4CXAA 4EH3A 1PXKA 4Z55A 5M51A 3PVUA 5AR5A 3WILA 3DT1A 2WTDA 5EI8A 3UC4A 3VUHA 5FXSA 4DH7A 3HV3A 3EFLA 4D9UA 2ITNA 2O5KA 2YCRA 4RIYA 4FV8A 3ZSHA 3F3TA 3CR0A 4DCEA 4KD1A 3V8SA 5A4QA 2W5HA 3P9JA 4CFWA 3NUNA 2PZRA 2HXQA 3GC9A 4FT7A 4MF1A 2EXCX 4XG8A 3GU5A 4F64A 4L68A 3BBWA 2RFSA 1XQZA 2CGUA 3V5LA 3DJ7A 5H8BA 1PMNA 3UO6A 1URWA 1G3NA 3ERKA 4ZTNA 5M09A 4M84A 2X9FA 4FMQA 3KXMA 2ITPA 4X6QC 3CBLA 2R3RA 2VU3A 3G51A 1YVJA 2XK7A 5M56A 3EQDA 3DBFA 4BKYA 3ANRA 4DH1A 1WVXA 3O2MA 4YTHA 1KE5A 4V04A 5HI2A 2BRBA 2OZOA 3UOHA 1ZYCA 4O7WA 4I93A 4MCVA 3VRZA 2YDJA 5LCJA 4DEBA 4I20A 1XBCA 2XJ1A 3HMNA 4KA3A 4QMLA 5CF8A 2GDOA 3UP2A 3QD4A 4Q5EA 3Q4TA 4UWYA 5ANEA 1O6LA 4O7RA 4Y83A 2XK9A 5EDPA 3AC8A 2CKOA 2XCHA 1PXNA 2C3IB 4L6QA 3UBDA 2BIKB 3P7CA 3V3VA 5JEBA 1L8TA 4G3CA 5E91A 5H3QA 1M7NA 4EQMA 5EM7A 5IDNA 3MIAA 5AM6A 5JN2A 2VWZA 5L6PA 1NVSA 4WNPA 3BGPA 3ZSIA 3E87A 4ZTQA 1XBBA 2GNGA 2P2IA 3R01A 5EG3A 2C5OA 4R7HA 3JY9A 3MH3A 3QTXA 3GC7A 2IZUA 3QTSA 4KBKA 4ZS0A 2ETMA 5C4KA 1H25A 4LV8A 4O0WA 4PX6A 3UMXA 3QFVA 4WSQA 2R4BA 5L2WA 3HL7A 3II5A 4GJ3A 4JQEA 3C4FA 3D0EA 1B38A 4P5ZA 3PFQA 5TT7A 2WMAA 3DS6A 3VJOA 2H96A 4AT5A 2R9SA 5TE0A 3PXYA 1F5QA 1G5SA 4G16A 3EZVA 2YIQA 3WZJA 3A8WA 2ACXA 2XEYA 2JDSA 3MJ2A 4CFVA 4DBXA 2OJFE 3IDBA 4D4YA 4FGBA 4IFCA 4X2FA 3TXOA 4HVSA 4TT7A 5KMLA 1PXPA 2X7GA 3GQIA 3R7OA 5BYYA 3JYAA 2X39A 4IB1A 2XCKA 3A4OX 4KAOA 4FZDB 4FNXA 1WBPA 2PK9A 4ZSLA 4A4OA 3ZLSA 5CASA 3TKIA 3T8OA 1Y6BA 4WNKA 4D58A 4QQJA 4CG8A 3VS5A 5IDPA 3GI3A 1H00A 4I92A 1MQ4A 2X9EA 2UZBA 5E8SA 5HNIX 1OIUA 5AADA 5LVLA 3EHAA 2QONA 4IMYA 3VBTA 3GU4A 2XYNA 4XLVA 3LMIA 4FNZA 3QWJA 2QHNA 2EUFB 4KABA 4N6YA 4O0UA 3KXNA 3DZQA 3HEGA 3RAWA 4NH1A 4W4VA 1PJKA 3VBQA 3WF6A 1H1RA 2ZV2A 3GNIB 3PWDA 4G1WA 4O7SA 4F1TA 1YHVA 3C4WA 4XMOA 4GT3A 2BKZA 4JT3A 4RIXB 1U5QA 3V5JA 4Y5QA 3IW6A 4E73A 5L2SA 4IAKA 3PIXA 4WOVA 3THBA 3O8UA 3RZBA 4A9YA 4AOIA 4J99A 4X7QA 2BHHA 3DNEA 4IVBA 5KX8A 5HX8A 3GOPA 3IGOA 2IW8A 4L3JA 1ZMVA 4LRMA 3TV6A 1PMVA 3ZC6A 5J87A 4ZY6A 1JQHA 1CKPA 4HCUA 4JIKA 3R1SA 4FSMA 4FOCA 3HP5A 4PMSA 5CX9A 1Q5KA 5DHJA 5FRIA 3WE8A 4EK5A 1ZXEA 4NJ3A 4X3FC 4GK4A 5M4IA 2FSTX 1PXLA 4E6QA 5DGZA 1MRUA 2BVAA 4DTAA 3RPVA 1OIQA 4KS8A 1ZOHA 5J5SA 3P78A 4JS8A 1V1KA 3ET7A 3FZPA 1BUHA 4F99A 5FLFA 4CZUA 2NRYA 3F88A 4C36A 4AW5A 1LR4A 1YWRA 3PIYA 4WRSA 2J5FA 5HO6A 3HAMA 3KN6A 3QTZA 1KUTA 1UNGA 4TYIA 3KCKA 1OKYA 3DTWA 2W4JA 4FOBA 4IAFA 3UC3A 1YOJA 4ASEA 4IXPA 1SVEA 4F0FA 4AE9A 4XV2A 3ZYAA 5J9YA 2BHEA 5FXQA 2RG5A 2IZTA 5LVNA 4ZMEA 3ORXA 3RNYA 4BDKA 3AC2A 2O64A 1XH9A 1NA7A 2XRWA 3ZC5A 3BKBA 1QPEA 2C6MA 4HJOA 2WIPA 4ERWA 3E64A 2XF0A 4MNFA 2PZIA 4I6FA 1OL7A 4PDOA 3AQVA 2PYWA 2UZUE 4KSPA 4LG4A 2R3PA 3ZUUA 4HCTA 2WD1A 3NUUA 3L1SA 2HENA 3FMMA 4HYSA 4NM0A 3TUBA 1ZOEA 4R8QA 2X2KA 4E7WA 5EK7A 3EL8A 4EKLA 1KE7A 3KF4A 2EXEA 3GCSA 3UZPA 3WIGA 5EOLA 4K6ZA 4JRVA 5LMKA 2I7QA 3NRMA 1IR3A 4DFBA 3BRBA 3FSKA 3C5IA 4UMUA 4F63A 4Y85A 4NEUA 3FC1X 4G9RA 1URCA 2J6MA 3AC5A 4J8MA 4O0TA 4BGGA 4C4JA 3F5XA 2WTCA 4ZTRA 4RVLA 4AP7A 3NDMA 5GHVA 4OAUC 4ANLA 3UIXA 3ODYX 3EFJA 3WF8A 5BUJA 4U6RA 2OIDA 4JBQA 2Y6MA 1R0PA 2VGPA 3HV5A 3OD6X 3GCQA 1JLUE 2HWOA 2W06A 2XKCA 4A7CA 1Q8YA 2FH9A 3D15A 5LWNA 4FX3A 1JNKA 1ZAOA 3EIDA 4FIEA 1UA2A 2GFSA 4BDBA 2WQBA 2VO6A 2W1GA 5EKNA 3OY1A 2WAJA 3PXQA 3TCPA 3R02A 4RMZA 4UWBA 3QQKA 4BHNA 5CF4A 5B2MA 4HZSA 2XK4A 3D94A 3HMPA 5ETAA 5EDQA 2GFCA 5J1VA 4I6HA 3FC2A 2RKUA 4HVDA 2XNEA 3TIZA 4FEQA 3NYVA 5J8IA 2KTYA 3MFSA 2QG5A 2WOTA 4O22A 5DRBA 3V5QA 3Q60A 4ZEGA 5CF5A 2XZSA 4FV2A 4O0YA 3VJNA 3N51A 2WTKC 4RIXA 4AT4A 2FVDA 3AMAA 4FTMA 3WZEA 2OF2A 2YFXA 5CENA 4AOJA 2CCHA 3MYGA 2C4GA 3OUKA 3BHYA 4MX9A 2X1NA 3ZEWA 3SXSA 4FKJA 3DAJA 4FSUA 4UZDA 4UMRA 1UU3A 4N4SA 2SRCA 2GNIA 4MVFA 4YSMA 4IAZA 1Q3DA 2VTPA 3CP9A 3MFRA 5A14A 3OBGA 2PMIA 4FZ7A 5I3OA 3N9XA 4YNOA 3KFAA 1R0EA 2PVNA 4QTBA 2DUVA 3DAEA 4WBBB 3R8MA 3HKOA 5KKRB 2J4ZA 4UXQA 2HWPA 3RI1A 3I1AA 5M57A 3GVUA 2YAAA 1GZKA 1VZOA 3EQPA 4OW8A 3LCTA 4BZDA 5CALA 5KUPA 1RDQE 4YJNA 4BCFA 1UKIA 1GJOA 3E5AA 5IA4A 1UNHA 1DM2A 1PMUA 3ROCA 3D5VA 1CMKE 3E88A 4FKRA 4PDSA 4AAAA 5GZ8A 5LMAA 5IQFA 3OHTA 2H34A 4MH7A 1S9IA 4OTWA 3MBLA 4DGGA 4IWOA 4JR7A 4D5HA 4Y72A 3ZCLA 2Z7QA 2YWPA 3LAUA 5IEVA 4E8AA 2FYSA 5AFVA 4H3QA 3Q5IA 5L6WL 1APME 2OFVA 4FSYA 5HHWA 5A4EA 4BCHA 3HAVA 2JD5A 4JBOA 1WBWA 2WB8A 3SOAA 3DBEA 2XUUA 2Y4IC 4UALA 5HCYA 5DNRA 2AYPA 4NTSA 2CMWA 5CY3A 4MD7E 2GNFA 3KXHA 2BRNA 5K9IA 3U8WA 3I79A 2BZHB 3DCVA 4CRSA 3M2WA 2HW6A 3IW7A 2O0UA 3QXOA 1IA9A 1VYWA 2W0JA 3V5WA 4YC6A 4F7SA 4EL9A 3OEFX 4AZTA 2CKPA 1P4FA 1V0PA 1GZOA 2YM5A 4FNYA 5L4QA 3JS2A 5E8VA 4YTIA 2WU7A 3DQWA 2QKRA 3KXXA 3QHWA 4KIPA 3L9MA 5DPVA 4ENXA 1H27A 4U3ZA 3GQLA 2ITXA 2NO3A 2ONLC 2W5BA 3I6WA 4EBVA 3DDPA 3NMUF 2R7BA 1B6CB 2GMXA 4I0RA 3O71A 3DTCA 4BDFA 4ZP5A 4ZY4A 3HDNA 1MRYA 1FMKA 2XM9A 1OUYA 4LRKA 4JR3A 4AN9A 2HW7A 4NCTC 2YEXA 4OBOA 3MVLA 4W8DA 4XP0A 3NUSA 4RLLA 5CSHA 3W2SA 4E3CA 4M69B 3TTJA 3HRBA 3ULZA 3IPHA 2XS0A 3E62A 3MB7A 5BVDA 5LQFA 2GTNA 3N4UA 3HRCA 2CDZA 3HA8A 3ZMMA 3VS6A 4DGMA 2BROA 2R3LA 1R39A 5LVOA 4MXXA 5JZJA 3TV4A 4XG3A 3F5GA 5CEQA 4TNDA 4HGEA 2OLCA 2OH4A 5AV0A 5AAEA 5EM5A 5CAUA 4CT2A 3FZRA 2R3QA 4XOYA 3OMVA 3CS9A 4D1SA 4EK6A 3BIZA 3FV8A 3WIKA 1Y8GA 3SAYA 2PVMA 1MRVA 3QKMA 3CC6A 2WEIA 2GHMA 2JITA 2VX3A 4U7ZA 3UMWA 4EYMA 5JQ8A 2I0EA 3NX8A 5DT3A 3OUNB 1J3HA 2E9NA 3F5PA 5BYLA 3LHJA 4BL1A 3I0QA 3EQIA 5IEXA 5H8GA 4EK4A 3BHVA 3VUGA 3SOCA 2IW6A 3TNQB 1Q97A 3MA3A 4EH8A 4EEVA 2XIYA 4YGAA 3PA4A 3E63A 4C8BA 3BU6A 3BV3A 4MXCA 5EW8A 3VUKA 2X4FA 4USEA 4QP9A 2FA2A 4YBKA 2OO8X 2UUEA 1AGWA 1V0OA 4RIOA 1REJA 2X7OA 3QHRA 4O2PA 4IX5A 4ERKA 3DXNA 3FMJA 5IA2A 4MD9E 2C3JA 3SG8A 4F6UA 4GSBA 3PG3A 1HOWA 3ODZX 1SNUA 4QPAA 3BYVA 3SV0A 3U4WA 2NNWB 2F7ZE 4QNYA 4F9YA 3PRFA 3DXPA 4LFIA 2VNYA 1KSWA 4F9WA 2XIRA 3FZSA 4AG8A 3MIYA 2B55A 5IZFA 4FTTA 4ZZMA 4RJ4A 1JVPP 2QOOA 1UKHA 2VTHA 3TL8A 5T68A 4DLIA 2CNUA 3TM0A 1DAWA 2C6LA 4NUSA 2BZJA 2WPAA 4L44A 4FEXA 3KN5A 2G2HA 5KHXA 4NT4A 1CKIA 5AP4A 3KRWA 4EHVA 1XR1A 3SXRA 3BWJA 4F65A 2GSFA 2PTKA 3FLNC 3C4EA 3GP0A 5CYIA 4N6ZA 3UVQA 5L8LA 1Y6AA 4GW8A 2OIQA 4UYAA 2OI4X 5A3XA 5KBRA 4YZNA 3PG1A 4BBFA 4KKEA 2C3LA 4D2SA 4LRJA 2RFEA 3HGKA 3U9CA 1REKA 3PY1A 3ZLXA 3TNIA 2B9HA 2ZMDA 2WMXA 2VO3A 3BYSA 3W16A 4GK3A 4RG0A 5DH3A 4RJ7A 5K0KA 4QP7A 5I9VA 5HE0A 3TT0A 4EWHA 4PMTA 2ZMCA 2BALA 3DJ6A 3F3UA 2R3KA 4OBPA 3SHEA 2UZEA 3F3ZA 4C4FA 3O96A 4RLKA 5B0XA 5EYCA 4ZXTA 4EWQA 5AAGA 3V51A 5IQAA 3FHRA 3LJ0A 4M69A 3P86A 4C59A 4F7LA 2BDWA 2UZWE 3RTPA 1JSUA 3O8TA 5AUYA 3VULA 3QD0A 3VS3A 4OTPA 2B7AA 5EFQA 1AQ1A 3IDCA 4D4RA 3WF7A 2BAJA 3I60A 3IKAA 3ORZA 3QF9A 3RHKA 2XK6A 4IBMA 3QTRA 5DOSA 4KRCA 4AA5A 3CJGA 4TYHB 4TKSA 3VW8A 3R21A 4BY9E 5E4HA 2ITQA 3CD8A 3R9HA 1RE8A 5B2LA 1M17A 4DINA 5EDRA 4QP1A 5BVFA 5LMBA 4NM7A 1IASA 5AP5A 3SX9A 3PTGA 2E9VA 2QR7A 2XH5A 2FB8A 2PVLA 3H9FA 5AEPA 1VR2A 3DLZA 4ENYA 5J9ZA 3QC9A 1OGUA 4B7TA 4GFGA 3CPBA 5CTPA 4L52A 2PUPA 2IZRA 5EKOA 5DN3A 1OM1A 3KK8A 5CU4A 4KNBA 4CYIA 2ZAZA 3NW7A 3PVGA 4U41A 1OPJA 5D10A 5GIOE 2QLQA 4KKGA 3P08A 3DBDA 2VZ6A 5IKWA 2HZ0A 5AR8A 4FL1A 3IS5A 4ANBA 4DYMA 1QL6A 4E1ZA 5M4CA 5J5TA 2UW3A 3QAME 3Q3BA 4ZTHA 4HVHA 4JJRA 5HLNA 4RWKA 5JGDA 1BMKA 2CSNA 5J9LA 2OH0E 1KE9A 3F5UA 4MXAA 5IQIA 2O3PA 5CZIA 4MK0A 3ORPA 3FXWA 1PRYA 3A7FA 1MP8A 2VTJA 4YMJA 5A54A 3UODA 2P55A 4DFXE 3OWJA 3V6SA 3QX2A 1YI6A 3TN8A 3EMGA 1YXTA 3NVMB 5G1XA 5A9UA 2JLDA 3RCJA 1IAJA 3VIDA 4UB7A 5ACKA 4QQCA 4ZIMA 4R5SA 3VAPA 2B53A 1OKVA 2XNPA 2JC6A 3ZH8A 3I7BA 4MWHA 5EM8A 1DS5A 4X21A 5LXMA 4BC6A 4LGHA 3KEXA 4IWQA 4O38A 3OWPA 5JK3A 4NIFB 4RFYA 3HDMA 2YCSA 3BHTA 5AUZA 3WZUA 4ZS4A 4QT1A 4L7FA 1JSTA 4FV7A 5CLPA 2VTIA 3QU0A 2W1IA 1XH8A 4O84A 2XEZA 4ZLZA 3QRTA 3BYUA 3L8SA 3LFQA 4JL9A 5E92A 1Z9XA 3WOWA 3VS0A 4F6WA 4DE4A 3HECA 3P7BA 5AP7A 3FJQE 4H39A 4RVMA 3JVSA 2I0VA 4P2KA 4O21A 2QHMA 4FL2A 5CVGA 4ZAUA 1OITA 2QU6A 2CNVA 4FE2A 3AT2A 4QMQA 4EH6A 3VQHA 3R83A 1F0QA 3R9RA 3FMHA 4ZOGA 4DEDA 1NXKA 5HESA 3AC4A 2ZYBA 3KVXA 4EKKA 4E5AX 2AC3A 2YN8A 4FTKA 4IEBA 4QQ5A 4TY1A 4ZJJA 3S0OA 2UZTA 3KC3A 2YAKA 3LFAA 3P5KA 2WXVA 2XM8A 4XX9A 3S95A 5ANGA 3R8PA 4DH3A 4NM5A 5H9BA 3FPQA 2Y0AA 4ANNA 4L3PA 4D2VA 3KL8A 3F69A 4TYHA 4FV9A 4IZ5A 4WA9A 2ZB1A 4AT3A 2CKQA 2HCKA 2UW4A 4D0XA 4IM2A 4QMWA 1H08A 4MBJA 4NU1A 4ZJIA 2EXMA 3NW5A 4MNEB 5M07A 1K2PA 2PY3A 4K9YA 3VHEA 2Q0NA 4FZAB 4U5JA 5HKMA 3KMWA 3ZS5A 2XYUA 3MH0A 4GT5A 3NCGA 1KE6A 3Q9WA 2R3FA 4QMUA 4AZVA 5M4FA 4JDHA 5IEYA 4CQEA 4NYEA 2QKWB 3DFAA 5LCKA 4EOJA 4KWPA 1XH5A 3QZGA 4X2NA 4XG4A 2WTJA 5K4JA 2QI8A 4YPSA 3E3PA 3ZO1A 3ORIA 4FTIA 4EOIA 2O8YA 2O63A 2UW0A 3O50A 5CSWA 2C1BA 2XBAA 4GH2A 1UVRA 3UOJA 4DCAA 3PXZA 1QPJA 1KOBA 4AUAA 2WO6A 4F1OA 2GNJA 3PJ2A 4O86A 3OROA 3DBQA 4DFLA 3ALOA 4PY1A 4WSYA 4E6CA 2YJRA 4FTQA 4G17A 5HU3A 4J52A 5BQ0A 4O0SA 4EI4A 3CEKA 4FG9A 3LFCA 3VNTA 1GIIA 2OXDA 4C37A 3QZHA 4A9SA 4BDIA 3WZKA 4I0TA 4FC0A 4JNWA 4CV9A 4FEVA 3VUIA 5L6OA 3NYOA 3G15A 2REIA 3MVHA 2R3GA 4EZ7A 4FV1A 4WBOA 3TJCA 4JQ8A 1OIRA 2VWIA 4S2ZA 1W8CA 3OCSA 3HUCA 4LQMA 5IA3A 3H0YA 1GIHA 2Y4PA 4HNFA 5AR7A 1FINA 1F3MC 4C38A 4B8LA 4M8TA 4OTDA 1H24A 4F9CA 3TUCA 4NWMA 3FLQA 1GIJA 2I0HA 4U80A 3BEGA 3A2CA 3BHHA 3DKGA 3BLHA 4M13A 4NIFA 2J7TA 4KIOA 4BRXA 4HOKA 4XBUA 5DG5A 3ZRLA 4F9BA 3R30A 4RVTA 5E1EA 4YO4A 4B99A 5EHOA 3QQJA 4HGLA 3BLRA 5AIKA 3LM5A 3NWWA 4EHEA 2W1ZA 5IUHA 5TR6A 3R2BA 3ZM9A 3A7IA 3PWYA 4CMUA 1Q8ZA 2G9XA 2W96B 2W4KA 2XKFA 4FKIA 4IC8A 4RIYB 3RGFA 2RGPA 4A9RA 5FDPA 5ETIA 2F7EE 3VBWA 2X0GA 4F6SA 3CXWA 2G2FA 5DEYA 2WZJA 3EYGA 1LPUA 3ZEPA 3FAAA 3COMA 4CEGA 4O27B 4W8EA 3HVCA 5FQDC 2BTSA 2R64A 3BU3A 4E4MA 5EHYA 4RA5A 3DQXA 1P5EA 3KXZA 1GZ8A 3TI1A 3COKA 2JAVA 4ZTLA 4ASZA 3AC1A 3OCTA 4RWIA 3SW7A 3IQ7A 2V22A 1YW2A 4ZTMA 1PHKA 2GQGA 4G31A 3BPRA 1KE8A 3L8VA 2Q0BA 4IC7A 4YHJA 5DBXA 4F9AA 2OZAB 4ASDA 5D12A 1M2RA 5EW9A 4I21A 3S4QA 3DJ5A 3EWHA 4J98A 3HMOA 3CD3A 5DIAA 4BDEA 3LFFA 4I1ZA 4RZVA 3RWPA 3VWAA 4ZY5A 1ZARA 3DKCA 4LGGA 3GOKA 4IJPA 4Q2AA 4EC8A 5LOHA 4TYEA 4ACHA 5JGBA 3OG7A 3CTQA 5TKDA 4MNEA 4XOZA 3L8PA 4AZWA 4B8MA 4C2VA 3MA6A 5DT0A 1YDTE 2PVFA 3FL4A 4MXZA 4RJ5A 3ZHPC 4MD8E 3KU2A 4IWDA 3F82A 5AR2A 2OXYA 4C35A 3GU6A 3R7GA 4P4CA 2Y9QA 4GFMA 2WIHA 2WMWA 4D55A 4LYNA 3EQGA 3RCDA 4RX5A 4IB0A 2Z2WA 3EFWA 3MY1A 5HNGA 1Q99A 2R5TA 3DZOA 4BCIA 4YSJA 1XH7A 3G90X 2RFDA 3SLSA 4KS7A 3GB2A 4C3FA 1KOAA 4QTEA 3FPMA 1P2AA 3HLLA 3KULB 2A27A 3IG7A 4RRVA 4USDA 3ZXTA 4FSTA 3LKMA 4OR5A 3UZTA 2HY0A 2EVAA 4IWPA 3UOKA 3RK7A 3V5TA 1UWHA 3D4QA 2CGWA 1NY3A 1VEBA 2F2CB 2OJ9A 3E92A 3AD6A 3EZRA 4P90A 5JFWA 5FBOA 3UPXA 3ZDUA 1H28A 4QRCA 1YKRA 3UIUA 5KMIA 1CSNA 3S1HA 5E90A 4FF8A 4IAAA 4XG2A 2VN9A 4QQTA 4FEUA 3SGCA 3KKVA 4AZEA 2CN8A 3FKNA 3FYKX 3D5WA 2BRMA 3H0ZA 3MGYA 3BQCA 1SVHA 1WBSA 4WIHA 5DR9A 4G2FA 3W18A 3QD2B 3QRJA 2PMOX 5CAPA 3GCUA 4I24A 2JIIA 3NSZA 4PQNA 2C0IA 2G2IA 4ONAA 5KE0A 3ZO2A 4AW0A 4DC2A 4BTJA 4XV1A 5HX6A 4WNOA 3CJFA 3DV3A 4OLIA 5A46A 3QZIA 3WI6A 2OIBA 3V01A 5L8KA 4M67A 1BLXA 2G15A 2XNBA 4DTKA 3DY7A 2PUUA 5AA8A 2HY81 4F08A 5FTQA 4G9CA 3TDVA 5K0XA 3HP2A 4RIWB 5DFPA 1XH6A 4L42A 3RNIA 4IX3A 4K0YA 3E8EA 2GPHA 2UVYA 2C6OA 2WTVA 2XP2A 3K5VA 4QMMA 2W17A 4UZHA 4WD5A 4D2WA 5EM6A 1NW1A 1TKIA 5CVFA 4JAJA 4AZFA 3K3JA 1SYKA 5TO8A 2VTOA 2PE2A 4RT7A 2B1PA 5ACBC 3JY0A 2A19B 1Q61A 4XP2A 4YJQA 5EHLA 2UVZA 2C6EA 4GS6A 4KKHA 1YHSA 3NGAA 5IQCA 2BFYA 3MPAA 4CCUA 4ZK5A 2ZVAA 3PLAE 4O82A 4CLJA 3AD4A 4USFA 2ZV9A 4RSSA 4YTCA 4FIGA 5JZNA 4BZOA 2VD5A 1SM2A 5IMEA 1FVTA 2VTAA 4HNIA 4DGOA 5T6KA 2XB7A 4IAIA 3ETAA 3GEQA 3LOKA 3NYXA 3FI3A 4H3BA 2PMLX 4O0RA 4IX6A 2PVYA 1H8FA 1W82A 2OZAA 4NKAA 5JSMA 4UWCA 2Z7SA 3QQLA 3ZDIA 3Q2JA 1Z5MA 4FVRA 4E6DA 5DE2A 4BB4A 4GIIA 4BTFA 2J0LA 3MS9A 3V8WA 3VN9A 1J1BA 1M7QA 3EB0A 2J0KA 4L67A 3BU5A 2RG6A 3MDYA 4NZWB 2NRUA 5BMMA 1FBNA 1PYEA 4DH5A 1VYZA 4EHZA 4BKZA 3C0IA 5HE3A 2GS2A 3SRVB 3QRIA 5M08A 4BGHA 2VUWA 2CCIA 3I5NA 2Z8CA 3QRUA 4FV6A 5K5XA 1PXOA 1R3CA 3HZTA 4XEYA 5HNBA 4MEDA 1BL7A 4BICA 5C27A 4JOAA 2F2UA 5E8ZA 3PXRA 3G0FA 2XIXA 5AAFA 2IVVA 4H3PA 3SA0A 2ZM3A 2QOCA 4UXLA 2HELA 5IMXA 2YIYA 2UVXA 3QQFA 5B7VA 1UU8A 4F1MA 2X2LA 3SQQA 3VBVA 3KULA 4EJNA 5KZ0A 3E7VA 4RX7A 2QU5A 1PF8A 1U46A 4Z7HA 4CGAA 2W1CA 3AMBA 3QRKA 3LJ2A 3FQHA 4UV0A 2GS6A 3D14A 4D9TA 4LUEA 3NVKI 2PWLA 5C03A 3UVRA 3KMUA 4G3FA 1OUKA 4Y46A 3KRRA 3G0EA 3MPTA 3B2WA 3F6XA 5LARA 3A62A 4C57A 2UZDA 3MN3A 4J95A 3GFEA 4AGCA 4BZNA 2PZ5A 2YJSA 5CT0A 5BUIA 3ORLA 3RKBA 2CHLA 2IVUA 4FBXA 4G6NA 2UW5A 2IN6A 1BL6A 3OS3A 4UY9A 3LXKA 3DA6A 3OXZA 2IVSA 2BUJA 3G33A 1YI4A 4FV4A 2F7XE 3DB8A 4ALWA 4DN5A 3PJ1A 5K4IA 3LFNA 3WZDA 4Q5HA 2PE1A 4I23A 3WF5A 3ZFMA 4QPSA 1IG1A 4EOQA 3E7OA 5JQ5A 3HV7A 4O1OA 5EW3A 4O83A 5IA1A 3A60A 3IGGA 2WMRA 3UYSA 3Q04A 1I44A 2IPXA 3CIKA 4OTFA 4C3PA 4C4EA 4RIWA 3PP1A 3SDJA 3EFKA 3TDWA 2P3GX 4H1MA 1HCLA 5I9XA 4LMNA 2WFYA 4TWCA 2H8HA 4MBIA 1TQMA 3Q4UA 3Q32A 4WRGA 4U0IA 3LFBA 3BGQA 2Z7LA 4QP3A 1FPUA 5DLSA 3PE1A 4D2TA 4CKJA 1KV1A 2AC5A 3E8NA 4M0YA 4QMTA 5AUVA 1Q8WA 4UX9A 5HVJA 4WKQA 3EQFA 2PPQA 2Z02A 3NUXA 4TXCA 3FY0A 2JDVA 2BAQA 2X2MA 3IW8A 3POOA 3SW4A 1Z57A 4FTRA 4EOLA 3FKOA 3H30A 2R3MA 4R1VA 4LUDA 5HBEA 4IZ7A 2C5NA 3FLYA 1ZMWA 1W7HA 4OAVB 2IJMA 2R3JA 3ZO3A 1OBDA 2VO7A 3RM7A 3DBCA 3MY0A 3D5XA 3QCQA 4EOSA 2WOUA 4ORKA 5EQEA 3CQEA 5DA3A 1WMKA 4C0TA 1L3RE 3CQUA 1CM8A 3TZ8A 3LFSA 4JDJA 5FM3A 3RMFA 4QMZA 2W7XA 3HMIA 1G8SA 3Q9ZA 3WYXA 1PKGA 3QLFA 4FODA 4NFNA 5CS6A 3LQ8A 1SZMA 4G6LA 4CT1A 4DGNA 3PPZA 3SRVA 4EUTA 5C1QB 2F57A 4BCNA 4TL0A 5I9WA 2O2UA 3M1SA 1OB3A 1OPLA 3DK7A 3R7IA 3I7CA 3U51A 3CLYA 3OF0A 4FV5A 4A9TA 3UO4A 4DEGA 2H9VA 4YLLA 4Q9SA 3C4ZA 3BZ3A 2FO0A 3ZUTA 5KNJA 3ITZA 1DI8A 4I4EA 3W10A 2YHVA 1ZYSA 2JFLA 3FL5A 3FZ1A 4O1PA 4CTCA 5HIDA 1JSVA 2ERZE 5C9CA 4DITA 2VTSA 4TRLA 4EUUA 1A48A 4X3FB 2XNMA 3LM0A 1S9JA 2C68A 1YWVA 2ITTA 3UNJA 1PKDA 2YIRA 4DA5A 1O6YA 3R00A 5FEEA 4FKPA 5HORA 4EK8A 3Q4ZA 1OVEA 4WG3A 2YACA 3QUPA 4CNHA 3KY2A 2E9UA 3ROYA 4I5CA 2UW7A 3NCZA 4Q9ZA 1GAGA 3HUBA 4JDKA 4YZCA 4D1XA 4BCKA 3GC8A 4I3ZA 3D7TB 4B4LA 4BFMA 4K1BA 3NAXA 5F95A 5KZIA 1UNLA 4I5MA 1H07A 2J0MB 3B2TA 4IAYA 4FKGA 2E2BA 4CQGA 3M42A 4E93A 1PXIA 5HG7A 3CGOA 2P0CA 1BKXA 4GG5A 3Q6UA 4O0XA 4BCQA 4B0GA 2HZIA 2C0OA 4K33A 4AS0A 4GK2A 5AX9A 4G34A 1JOWB 5TF9A 1M14A 3V8TA 3BCEA 4BI2A 2JGZA 4E5WA 3SVVA 3N4VA 4FVPA 1IEPA 2DYLA 1H01A 1OIYA 2YZAA 5L2IA 1BI8A 3R9OA 1M2QA 5DRDA 4EH7A 4HPUE 4U81A 2BPMA 4FTUA 4PNKA 1CDKA 2BRHA 2BTRA 2IZSA 3PVBA 4U9AA 5FEDA 4YLJA 4Z16A 4KBCA 5ITAA 1KV2A 4CG9A 4KBAA 3R8ZA 2V0DA 3LLTA 5FWKK 3ZFXA 2WNTA 1HCKA 3G9LX 4GVAA 2Z60A 4GL9A 2GTMA 5CEIA 3LE6A 2HXLA 4JAIA 3LIJA 5LJJA 4L53A 3C7QA 3G5DA 3MSSA 3QALE 3COIA 5HBJA 3M11A 4JRNA 3OT3A 5ANIA 3QWKA 4CMOA 1OL2A 4PDPA 3EN6A 4QP6A 2I40A 3AT3A 3C9WA 3CPCA 3AT4A 4R3CA 1H0VA 1WBTA 3K54A 5CQUA 4QYHA 3TJDA 4EBWA 5CEKA 4UMQA 2QOFA 3KGAA 4L43A 3C4CA 3EQRA 3R1QA 4AE6A 4H58A 2J90A 4PL4A 3UQCA 2PVRA 1V0BA 4FKOA 4ZSEA 5AP2A 4WNMA 4BDDA 4BR3A 2QO2A 3PY0A 3D9VA 5CU0A 4I5PA 4GT4A 3FLZA 5KHWA 2B9JA 1J1CA 2YA9A 4II5A 5KMOA 2R3IA 5A6OA 4ALVA 5C01A 2GHLA 4FA2A 3VUDA 4G5PA 4JG8A 3IECA 2BAKA 2R0UA 4FKVA 4TW9A 3EJ1A 4NW5A 5FGKA 5BPYA 5ANOA 3MVMA 1R78A 2HZNA 4FVQA 1LEZA 1Q24A 3MFUA 5FM2A 3RVGA 1ATPE 1OKZA 1OI9A 5GJGA 4AA4A 4RPVA 2YCQA 3KQ7A 1LUFA 4FG8A 3O8PA 5E1SA 4K77A 4QOXA 4ALUA 4M3QA 2WTKB 2JDOA 2P4IA 4DAWA 4R1YA 2FSLX 1JKKA 4RZWA 3UNKA 2CN5A 5AR3A 4FI1A 4G3DA 4AXAA 4IVCA 2B9IA 3LCDA 4JIAA 4ANSA 3ANQA 1WCCA 3PZEA 4APCA 3PXFA 4EOOA 4TWNA 3F3WA 4I4FA 4IW0A 5FP6A 3QA0A 4Z7GA 4BIEA 3OWLA 3EKNA 2CKEA 3ZOSA 1JKSA 4C3RA 4CFNA 2QLUA 2VWYA 5GIPE 1J91A 4FTOA 4RGJA 2YLEA 4X3FA 2XBJA 3QBNA 2X81A 3IW4A 3VS1A 4EQCA 3FI8A 4NKSA 2BILB 2G01A 1YOLA 4R3RA 4FKWA 1M52A 4M7IA 5HE2A 2ZM4A 4GYIA 4PP9A 4FICA 4FSRA 4ITHA 2QQ7A 1NT2A 3FMLA 5H8EA 1XO2B 2JAMA 2WQOA 4FR4A
chains in the Genus database with same CATH superfamily
2RIOA 3BBTB 2C5VA 4FTLA 4MAOA 3D7TA 5CXZA 3P79A 3GU7A 3POZA 5IPJA 3PJCA 3S00A 4RJ3A 2Q83A 3TKHA 1FVRA 3UIBA 4AGDA 2UZOA 1Y57A 3R71A 5AM7A 4AX8A 4EOPA 2RF9A 4QMXA 2OSCA 2QOQA 4FYNA 4C62A 1YHWA 4DGLC 5I4NA 5LMKC 1YQJA 3PYYA 3OOMA 4OTRA 4Z3VA 2VX0A 3LVPA 3MH1A 5JFSA 2OBJA 2Y4IB 4XH6A 4FNWA 3ZFYA 3UDZA 4FK6A 1OGYA 3FQEA 4YJRA 1ZWSA 4IDVA 3HA6A 1EH4A 4GV1A 4XNEA 3AGMA 3Q2MA 2VWUA 4AACA 4TYJA 4CCBA 2CNQA 4WUAA 5HOAA 2XRUA 2B54A 3NR9A 3GU8A 4W9WA 1G8AA 3BI6A 2OG8A 5GINE 5D11A 5D1JA 2VNWA 3OC1A 3VBXA 4CYJA 3I6UA 4HGSA 4L9IA 5BNJA 1ZRZA 1YXUA 4RWJA 2VWXA 5M53A 5F20A 3MTFA 4L01A 3NNVA 4XBRA 4ZSAA 3CE3A 3KB7A 1PMEA 3R63A 2QO9A 3ZSGA 3BHUA 3EOCA 4V05A 2WMTA 4IIRA 4BBEA 2C69A 2PL0A 3VUTA 5HICA 2A0CX 3PXKA 1ZZLA 1FQ1B 4C02A 5B2KA 2OWBA 5E8UA 3OY3A 5CVHA 4FSQA 4ITIA 4CKIA 4LI5A 3F61A 3SXFA 2W5AA 5IH5A 5CWZA 5J7BA 4RJ6A 5CEPA 5A4CA 3W2QA 4BTMA 3PIZA 2XJ2A 5ETFA 3MJ1A 2VWWA 3Q53A 4B9DA 2HK5A 4HW7A 2ETRA 5EI2A 5KMKA 3H4JA 4X2GA 5C8KA 1WAKA 4QMVA 3FWQA 4QD6A 3IK3A 5IA5A 3UG2A 4CSVA 3CGFA 4H36A 4LOOA 4PF4A 3UQGA 2O65A 4O4DA 1XWSA 2QO7A 4FK3A 5CZHA 2FUMA 4RX9A 4IFGA 3DKOA 4DEIA 2XIKA 3FLWA 2UZNA 5HG9A 5IUIA 3RALA 4CFFA 2PHKA 3LMGA 3L9NA 3BYMA 4J53A 3VC4A 4AOTA 4BN1A 1J7LA 3P1AA 2X0QA 4GYGA 5GNKA 5IF1A 3V6RA 4BBMA 4K11A 4RBLA 4O81A 2X6EA 2GNHA 4G3GA 4XG7A 4C61A 2HIWA 5I0BA 3A7GA 3W2PA 4RC4A 4YBJA 2OJJA 4MKCA 4X3JA 4U79A 3REPA 3UG1A 2QD9A 4JDIA 3EQHA 4R5YA 3BEAA 4MTAA 5CNNA 2H6DA 5DR6A 5ICPA 4C58A 3I81A 3ORMA 2HAKA 2PZYA 4ZZOA 1FGKA 4PMPA 5IQBA 4BCMA 3PUFC 2QOKA 3QX4A 1W0XC 4PV0A 4JXFA 2AUHA 4XJ0A 2VTQA 5D7VA 5E7RA 3VVHA 5AWMA 4DFUA 4FT5A 1YXVA 4B6LA 3BELA 4BHZA 4DEAA 3BL7A 1YDSE 5BVWA 1DI9A 3UVPA 4BIDA 2WQNA 3QGYA 4W4XA 3ZZEA 4C4HA 3BE9A 3AOXA 2C6TA 3ORKA 3V04A 4RC2A 4CV8A 3KREA 2W1DA 2VX1A 5F1ZA 5M06A 3HRFA 5ANJA 2C3KA 3QCXA 4AZSA 3R04A 2JKKA 2PZPA 2UW9A 3MPMA 4UBAA 5CT7A 1NVRA 2VTLA 2VTMA 2YDIA 4U97A 5CI6A 2ZM1A 5K5NA 3AD5A 1PW2A 4ACDA 3FKLA 1P14A 2OU7A 3FMKA 4I41A 3PSBA 4PPAA 5IISA 5A6NA 3LJ1A 4C4GA 1UWJA 3IDPA 3NUYA 4MQ2A 2PUNA 4MQ1A 4JG6A 4YZBA 4ZSJA 1QPDA 3VS2A 4AN3A 3AG9A 4ANMA 4BI1A 4ANQA 4YJTA 2LAVA 5HBHA 3TG1A 1R1WA 4YUQA 3QZFA 4RC3A 1WBNA 2YWVA 5BVKA 4D28A 3Q9XA 3F3VA 1YRPA 4UYNA 2VO0A 2PUIA 4HGTA 4OT6A 3FHIA 4E4NA 2LGCA 4NJDA 1XJDA 4F09A 1W98A 2ZB0A 2WQMA 4OTGA 1RQQA 5JFVA 2ONLA 2V7AA 3QTUA 3ORTA 5CU3A 5JH6A 2A4LA 5HO8A 4GUEA 3LW0A 3LFDA 2YM7A 3R8UA 4MYGA 3F66A 3FQSA 1Q3WA 2WKMA 4YJOA 3B8RA 4ASXA 4IB5A 4U43A 4EC9A 4XV3A 4PPCA 2QODA 1U5RA 3ACJA 2I1MA 5DR2A 2XNNA 4V01A 5GZ9A 4ZZNA 3NUAA 1PYXA 5CANA 2I6LA 2Z7RA 4NCTA 5F4NA 5AUXA 3W2RA 4CZYB 3N4TA 3GC0A 1T45A 1H1SA 2V55A 4IDTA 3WF9A 4CKRA 3I5ZA 2BZIB 5CI7A 3F2NA 5JRSA 4EK3A 3FI2A 4GVJA 2HOGA 2ITWA 2OXXA 4LOQA 3ZLWA 4AGWA 3VF8A 3VQUA 2XIZA 4X2JA 3UYTA 3UO5A 1ND4A 1Q41A 4TPTA 4BDCA 4PUZA 1TVOA 3QA8A 5KKRC 3VF9A 2G1TA 3QTWA 2JKOA 4N70A 3ATSA 3UZRA 3P4KA 2WU6A 5KMNA 4IQ6A 4FJVA 2YDKA 3VONA 4YJPA 4RFMA 3NPCA 4FSZA 4RA4A 4YHTA 3F7ZA 5DWRA 1H1WA 3LXLA 3QGWA 5JKGA 4IJ9A 3R7EA 1OL1A 5EQPA 4GG7A 3FEGA 5JFXA 3U4UA 5FXRA 3R9NA 1QCFA 3W0PA 4FZFB 4XG9A 4V0GB 3UTOA 1OL6A 3ZXZA 2ETKA 4QYYA 4I6QA 5AV1A 4QMSA 2F9GA 5CSVA 4BWKA 3U54A 4IADA 3Q96A 1FGIA 5CU2A 3WARA 4XYFA 5IQDA 5M4UA 4O7TA 2Y8OA 5AV2A 3E8CA 3R1YA 3PSCA 3DNDA 4O4CA 4ZMFA 3MWUA 4O6LA 5FP5A 3DKFA 4YP8A 2QG7A 1OPKA 4BYIA 3LCSA 2R0IA 4F0GA 5BVOA 5HLWA 2RFNA 1JPAA 4LGDA 3TACA 3W2CA 5IH4A 4HYHA 3QKKA 3HYHA 3CCNA 4YTFA 3OEZA 5HTBA 5JT2A 2UV2A 3NNWA 4O7ZA 3D2IA 3QC4A 2XA4A 3ENHA 4QP2A 5CSPA 4MWIA 2WMQA 5C4LA 1WVWA 4BYJA 5BV3A 3LMHA 4LL5A 2OICA 1BX6A 4DT8A 2GQRA 4L8MA 4ZJVA 3C51A 3OBJA 2ZJWA 3UE4A 3MB6A 4FT9A 3T9TA 1U59A 5AUWA 4DF3A 1YDRE 3EQBA 5IQEA 4DDGA 5E8TA 3HV6A 1JWHA 4BTKA 1WFCA 1WBVA 3H10A 2EB2A 2BDJA 3BQRA 3G2FA 3NNUA 4J97A 4DG3E 3VHKA 4FSNA 4O2ZA 4C4IA 4FKQA 4PTCA 5CXHA 2OJGA 3A7JA 4FZ6A 3A8XA 5GJFA 4BDGA 2OFUA 4QMNA 2EU9A 3K5UA 4K2RA 2V62A 4NTTA 3QQUA 2F4JA 3D83A 5EQYA 5I9ZA 4BF2A 2UW8A 3VO3A 3W33A 4AXCA 1ERKA 2JDRA 3QYWA 5F94A 2RSVA 4DHIB 5AP1A 4TYGA 5HO7A 2VTNA 3CTJA 2IO6A 3BL9A 3A61A 3S2PA 1KWPA 3F2AA 3L9PA 2YERA 5CEMA 2XNOA 4X6RA 1STCE 5KBQA 4DTBA 3NIZA 5TOZA 3IW5A 3ALNA 5DEWA 4NK9A 4MXYA 5HE1A 4BCGA 3IO7A 4XHKB 1VJYA 4KINA 2E9OA 4BCPA 2XK8A 4EONA 2BMCA 1BI7A 4M14A 3CKWA 3EN7A 4EOKA 2F49A 4HCVA 3E3BX 4QNAA 2Y7JA 5HD7A 3RWQA 3W0OA 3W32A 5JMSA 2GU8A 2GNLA 2CLQA 2BFXA 5M55A 2B0QA 4BCOA 4YZ9A 3KK9A 3F7WA 4XP3A 4AA0A 4E4XA 5I9UA 5L3AA 4Y5HA 4YJSA 4BDJA 3KF7A 2QC6A 3C4XA 1UU7A 3KRXA 2C47A 4U3YA 3LQ3A 3JVRA 1Y8YA 4FV0A 4X2KA 4D2PA 3C0HA 3L8XA 5GZAA 2XMYA 4YURA 3TIYA 5D7AA 2ITVA 2J0JA 4QMYA 2HZ4A 2IVTA 3PJ3A 4JQ7A 2JIVA 3FBVA 3GCVA 3ZRKA 1RJBA 4LL0A 4H05A 4WG5A 3DK3A 3JPVA 4QTCA 5M44A 4FIIA 4I22A 5AMNA 2WELA 2YLFA 4O96A 1U4DA 1YWNA 2C6KA 4V0GA 3QTQA 5C26A 2EB3A 2P33A 5HTCA 3KCFA 3R8LA 4RQKA 2PU8A 3FI4A 4CMTA 4YR8A 3Q5ZA 4C2WA 2BIYA 4GCJA 3R8VA 3TZ9A 3ZTXA 3PPKA 3O51A 2AEGA 4L46A 4WT6A 4AQCA 4IE9A 4M97A 4BI0A 3LCKA 4F70A 3C1XA 4CFXA 3MVJA 4TTHB 4O7NA 4I94A 5KMJA 4S30A 4W4YA 3E93A 3OWKA 4IH8A 4YZMA 3RPOA 5CU6A 4EH5A 3GCPA 4FRFA 5E9EA 3OW3A 5AX3A 4EORA 1J7IA 4PRJA 3D7ZA 3RAKA 4L45A 1SMHA 3U87A 3LXNA 2XK3A 3W2OA 4TZRA 1W2FA 5LWMA 2XAMA 2JBPA 4HZRA 3IOPA 1GOLA 3W55A 3KIOC 2W05A 4DBNA 1H26A 2WTIA 5F9EA 3PDTA 3MI9A 3PP0A 4QMPA 4M66A 4OTIA 2OJIA 1W83A 2R3NA 5CEOA 2C30A 4I0SA 2PVKA 2X8EA 4J7BA 4HYIA 4M68A 4EQUA 3TTIA 4MHAA 4DT9A 4TN6A 3CY2A 4OTQA 1VLRA 4GJ2A 2CJMA 2W1FA 4I5HA 3G6HA 2C1AA 3D5UA 3EN9A 3NS9A 3QCSA 5A4LA 3W8LA 3BGZA 3FSFA 4FG7A 2NP8A 3O23A 1Q8UA 1SVGA 4FT3A 3LLAA 2OKRA 1X8BA 2IWIA 2XKDA 2YM3A 1O6KA 4CD0A 5DVRA 1JKLA 3BX5A 2CGXA 4I6BA 1K9AA 3SD0A 4JBVA 4AWIA 1XHAA 4GMYA 1MQBA 4KIQA 4BWXA 3FMNA 3D2KA 4S33A 4BJJB 5E8YA 4U44A 2WQEA 2JDTA 4G6OA 1G8JA 1FMOE 2ZV7A 2OF4A 4NFMA 3SC1A 3A7HA 4O7YA 5AV3A 3KVWA 2X8DA 2EWAA 4CZTA 1B39A 2VAGA 3TWJA 2ITZA 2BRGA 5AA9A 4D4SA 1XKKA 5AJQA 3GT8A 5CAQA 3DFCB 3R7VA 2VV9A 4EYJA 2XAOA 5C8MA 3E8DA 2A2AA 2CPKE 5EYMA 5G6VA 4BGQA 1M2PA 3MESA 5DYJA 2WTWA 4YJUA 3QXPA 5DMZA 5IQGA 4N0SA 3R28A 2W4OA 2RL5A 3W8QA 2GS7A 3EN4A 1TQPA 4JX7A 5HEZA 2JFMA 5AP0A 1P4OA 3ZU7A 4JG7A 2X6DA 3IOKA 4O7VA 1Q8TA 1YXXA 3LZBA 4IANA 1YI3A 2PULA 5FG8A 2FSOX 4BKJA 3UDBA 3ENMA 3OVVA 4RQVA 4ACGA 5FEQA 4AFEA 3K2LA 3BLQA 3FLSA 4A9UA 3PUPA 3UIMA 4L7SA 4TWPA 5GJDA 4A06A 1Q4LA 4LMUA 5HQ0A 5IQHA 3PA5A 3QD3A 5IA0A 3GBZA 2WMSA 4BWPA 4ITJA 1ZY4A 5HIEA 4C7TA 3GENA 4FIJA 4DG0E 3CY3A 2A1AB 5EYDA 3UGCA 4D1ZA 3DPKA 3MV5A 4DEEA 2XKEA 3P0MA 3PZHA 2R3OA 4QYFA 3R9DA 4JMQA 4O6EA 2UZLA 5HIBA 3O7LB 5HCXA 3V5PA 2VWVA 4S34A 2WHBA 4F7NA 3PVWA 2WMUA 4FV3A 4YO6A 1QMZA 4IX4A 3PLSA 4EZ3A 4FUXA 1JKTA 5DI1A 1ZOGA 4ARKA 1ZYLA 3ZONA 3OCBA 2FGIA 2HYYA 4L00A 2KULA 5DT4A 4M15A 3ZM4A 4OUCA 3DB6A 4Y8DA 4GIHA 5AR4A 3DLSA 3A4PA 4A4LA 3I0OA 3NIEA 3KMMA 4JVGA 4U40A 2YCFA 2YITA 1UV5A 1ZLTA 4G5JA 4ACCA 4LV5A 1ZYJA 3MY5A 4OT5A 3PJ8A 4QTDA 4YLKA 4RVKA 3EKKA 2W9FB 1JBPE 1LP4A 3COHA 2NPQA 4QYGA 3VW6A 1RW8A 4XRJA 3I4BA 4XV9A 3C13A 3VRYA 2PE0A 3AGLA 5BVNA 3QCYA 2BDFA 2WMBA 3ZZWA 3CKXA 2C0TA 3S3IA 4OGRA 5LVMA 3BV2A 2DQ7X 4D0WA 2VTRA 1GY3A 1PY5A 3TZ7A 4CFUA 3NNXA 4P5QA 4Y73A 3OFMA 4AXDA 2XVDA 2J50A 2W99B 3O17A 2YM4A 1JAMA 4WUNA 3RPSA 3CSVA 2QNJA 4EH2A 1FVVA 4FSWA 3WE4A 4E26A 4BJJA 2ERKA 3TNHA 1J7UA 1I09A 3U6JA 1K3AA 2DS1A 2E9PA 2PVJA 5FD2A 3WYYA 3A99A 2GQSA 4KRDA 4ANOA 4FKTA 4PMMA 3AC3A 5J95A 3SKCA 2IW9A 1OL5A 1U54B 1BYGA 4CVAA 3QQGA 4XUFA 4Z9LA 4ZLYA 3DAKA 3BYOA 4DLJA 4RFZA 1QPCA 4JX3A 4HVIA 3EN5A 3NUPA 4M0ZA 3BE2A 1OKWA 1OMWA 2ESMA 2X4ZA 4W4WA 3RHXA 5L2TA 4DFZE 4GRBA 4PNIA 3B8QA 1YOMA 2J5EA 5K3YA 4E4LA 4NM3A 4P7EA 4AFJA 2ZOQA 4QYEA 5L2QA 2DWBA 3HMMA 3R73A 5KMMA 4J1RA 3P23A 5AUUA 2VTTA 4CTBA 4ACMA 5E8XA 5FUTA 2C5XA 3RBWA 4D2RA 2QOLA 1H1PA 3CTHA 4F7JA 3AKLA 3DK6A 2X7FA 5BMSA 2JBOA 1IAHA 5CAOA 4XCUA 4K18A 2XNGA 4E5BA 5IUGA 5J79A 4YC3A 4Y95A 5HLPA 3R2YA 4ID7A 2QOBA 3NW6A 4L3LA 3RJCA 3VUMA 4A07A 4UMPA 3R7YA 4EH9A 3MTLA 3OP5A 4DFNA 1XMLA 1CKJA 2B9FA 3PE2A 4FIHA 4GU6A 3UJGA 4C33A 3C50A 3QKLA 4XG6A 1W84A 3FXZA 4AN2A 4QTAA 4X0MA 5EYKA 4EH4A 3JR1A 2J51A 4IHPA 4IZAA 1FOTA 3RP9A 4RWLA 2FSMX 4LM5A 5HTIA 3DXQA 2OGVA 3R22A 2W1HA 3DOGA 2ITYA 4FKSA 4JBPA 5BX0A 4FEWA 3T9IA 1ZY5A 2YIWA 5AV4A 3R0TA 5HZNA 3UP7A 4U45A 5A4TA 4K8AA 5ETCA 1H4LA 5CSXA 4LV7A 4GFOA 5FBNC 3K3IA 3T3VA 3RZFA 5J1WA 3ZRMA 4W9XA 5D9HA 3JXWA 3QYZA 3GUBA 4J96A 4F4PA 1GNGA 2C6DA 4PTEA 4J8NA 2JEDA 4KSQA 1E1VA 3BWFA 4A4XA 4KIKB 4R7IA 2WEVA 2R2PA 4WO5A 4PDYA 5ANKA 4DHJA 5C8NA 2VGOA 3NEWA 5IU2A 3FDNA 3P7AA 4S32A 4BCJA 4BIBA 4QO9A 4AW1A 2J2IB 2QCSA 2JKQA 3LFEA 2X8IA 2YM8A 3TUDA 4YZDA 1PXMA 3L9LA 4O7LA 4CFMA 2QVSE 3QUDA 3NFGB 4J71A 1TZDA 3QTIA 4GKHA 4GU9A 1IA8A 2I0YA 4NSTA 3ATTA 3BLAA 2VRXA 3ZBXA 2C6IA 1ST0A 1OECA 2ITOA 2C5YA 4KB8A 3FMEA 4PWNA 4CRLA 4NW6A 2BCJA 3G9NA 3FZTA 4TNBA 4XLIA 1ZZ2A 3GXLA 5CF6A 4ZLOA 3OT8A 2YZLA 3PA3A 4XS2A 3OOGA 3EYHA 4TWOA 3KRJA 1E9HA 2J0IA 4LOPA 5LVPA 5FDXA 3OXIA 4IVDA 3LXPA 5EOBA 5H2UA 5BVEA 5EH0A 4U42A 4YJVA 2GCDA 2CGVA 3H9OA 5E8WA 1MUOA 3RAIA 4DFYA 4R78A 3F9NA 4R77A 5HVYA 2YABA 3UQFA 3KA0A 4IACA 2UZVA 3Q9YA 1YXSA 2B4SB 4QP8A 1LEWA 4WG4A 5AUTA 4WHZA 5IH6A 2IG7A 3MFTA 3QLGA 3TNWA 3AXWA 2UW6A 4O0VA 5AP6A 2XJ0A 4IZYA 3FMDA 5I5ZA 3NZ0A 4ZSGA 3O7LD 3R1NA 1U54A 3ZBFA 3PSDA 3GFWA 2J9MA 3OXTA 1GZNA 4UN0C 3FYJX 2V7OA 3TV7A 2JIUA 3UOLA 4NL0A 3GGFA 3LCOA 3FE3A 5CAVA 4BVUA 3H9RA 5BYZA 5HU9A 3EH9A 2WGJA 1UU9A 2GHGA 4MBLA 2P2HA 4RJ8A 2BZKB 5ANDA 2OK1A 1XBAA 3HX4A 1CTPE 4FTNA 3T3UA 5AP3A 3HV4A 2WMVA 3OCGA 5HG5A 5KO1A 3DGKA 4ZTSA 2W1EA 3FUPA 3LPBA 4E20A 2QURA 4HYUA 3RAHA 5JRQA 2ZV8A 4FIFA 1SNXA 2V5QA 5JGAA 2QOHA 3TZMA 3MW1A 4JI9A 1XH4A 4FTCA 5KCVA 3RINA 3NAYA 4G3EA 3UNZA 2BR1A 3PPJA 3ACKA 4YU2A 1WVYA 3EQCA 4F0IA 1A06A 5T3QA 2VWBA 1O9UA 1T46A 2YIXA 4FUYA 4GUBA 4BDHA 4EHGA 4DG2E 4FGRA 4AW2A 5CQWA 1E1XA 1TQIA 3HNGA 3G6GA 3QQHA 5FTOA 5HCZA 2B52A 3RPYA 1Q62A 2R3HA 5I9YA 3SG9A 3FY2A 3KRLA 4FYOA 4FTJA 3W1FA 3UPZA 1A9UA 4RX8A 1Y91A 2PVHA 4JLCA 3RM6A 3PRIA 4O91A 2ITUA 3ELJA 2QOIA 3TNPC 4GKIA 4HPTE 4QMOA 4XRLA 3ZUVA 3VBYA 1OBGA 3U55A 1NVQA 3QUEA 4PL3A 1WZYA 4YC8A 4PPBA 3FXXA 4AGUA 5HD4A 1OZ1A 2ZDTA 1ZMUA 4KIKA 5HGIA 2JKMA 3RK5A 2PSQA 4H1JA 4D4VA 4FKLA 5I3RA 4GEOA 4IM0A 3U6HA 2PMNX 4AU8A 3O0GA 1H1QA 4FTAA 5EI6A 4PP7A 5HG8A 2BKKA 4FT0A 3OZ6A 1H0WA 3C5UA 3EL7A 3ULIA 3VS7A 4EOMA 4M12A 4MF0A 5CNOA 3ZO4A 3FZOA 1AD5A 3ZLYA 4D5KA 4UMTA 4HVGA 2YISA 4UEUA 3Q4CA 3DDQA 4R6VA 2W9ZB 3NLBA 3U9NA 4R3PA 3R6XA 3VS4A 1WBOA 4FL3A 4OBQA 2ZDUA 4QPMA 3TEIA 4BDAA 2OW3A 5L8JA 4U8ZA 4CLIA 3NYNA 2IEWA 2QR8A 4KUJA 4R7BA 3F2RA 3Q52A 3WBLA 3TKUA 2Y6OA 4YHFA 4DH8A 4FKUA 5AIRA 4C34A 3U6IA 4N57A 4IM3A 3KXGA 5BUEA 4IVAA 4S31A 4YNEA 3H3CA 3ORNA 1ZYDA 3CQWA 3DU8A 3Q6WA 4YPDA 1IRKA 4APPA 3LQ5A 4EZ5A 4DEHA 3RK9A 4E6AA 4EJ7A 5J7HA 4AF3A 3QL8A 3MH2A 3PY3A 4IB3A 3OTUA 1PXJA 4PTGA 4DHFA 3R7UA 5IG1A 4PL5A 3C0GA 3AMYA 3ID6C 2YM6A 5D41A 4QP4A 5FTGA 2R7IA 1DAYA 4OTHA 3IONA 5HVKA 3RPRA 3OW4A 4MXOA 3JUHA 2CLXA 3OTVA 4CXAA 4EH3A 1PXKA 4Z55A 5M51A 3PVUA 5AR5A 3WILA 3DT1A 2WTDA 5EI8A 3UC4A 3VUHA 5FXSA 4DH7A 3HV3A 3EFLA 4D9UA 2ITNA 2O5KA 2YCRA 4RIYA 4FV8A 3ZSHA 3F3TA 3CR0A 4DCEA 4KD1A 3V8SA 5A4QA 2W5HA 3P9JA 4CFWA 3NUNA 2PZRA 2HXQA 3GC9A 4FT7A 4MF1A 2EXCX 4XG8A 3GU5A 4F64A 4L68A 3BBWA 2RFSA 1XQZA 2CGUA 3V5LA 3DJ7A 5H8BA 1PMNA 3UO6A 1URWA 1G3NA 3ERKA 4ZTNA 5M09A 4M84A 2X9FA 4FMQA 3KXMA 2ITPA 4X6QC 3CBLA 2R3RA 2VU3A 3G51A 1YVJA 2XK7A 5M56A 3EQDA 3DBFA 4BKYA 3ANRA 4DH1A 1WVXA 3O2MA 4YTHA 1KE5A 4V04A 5HI2A 2BRBA 2OZOA 3UOHA 1ZYCA 4O7WA 4I93A 4MCVA 3VRZA 2YDJA 3ML1A 5LCJA 4DEBA 4I20A 1XBCA 2XJ1A 3HMNA 4KA3A 4QMLA 5CF8A 2GDOA 3UP2A 3QD4A 4Q5EA 3Q4TA 4UWYA 5ANEA 1O6LA 4O7RA 4Y83A 2XK9A 5EDPA 3AC8A 2CKOA 2XCHA 1PXNA 2C3IB 4L6QA 3UBDA 2BIKB 3P7CA 3V3VA 5JEBA 1L8TA 4G3CA 5E91A 5H3QA 1M7NA 4EQMA 5EM7A 5IDNA 3MIAA 5AM6A 5JN2A 2VWZA 5L6PA 1NVSA 4WNPA 3BGPA 3ZSIA 3E87A 4ZTQA 1XBBA 2GNGA 2P2IA 3R01A 5EG3A 2C5OA 4F78A 4R7HA 3JY9A 3MH3A 3QTXA 3GC7A 2IZUA 3QTSA 4KBKA 4ZS0A 2ETMA 5C4KA 1H25A 4LV8A 4O0WA 4PX6A 3UMXA 3QFVA 4WSQA 2R4BA 5L2WA 3HL7A 3II5A 4GJ3A 4JQEA 3C4FA 3D0EA 1B38A 4P5ZA 3PFQA 5TT7A 2WMAA 3DS6A 3VJOA 2H96A 4AT5A 2R9SA 5TE0A 3PXYA 1F5QA 1G5SA 4G16A 3EZVA 2YIQA 3WZJA 3A8WA 2ACXA 2XEYA 2JDSA 3MJ2A 4CFVA 4DBXA 2OJFE 3IDBA 4D4YA 4FGBA 4IFCA 4X2FA 3TXOA 4HVSA 4I6LA 4TT7A 5KMLA 1PXPA 2X7GA 3GQIA 3R7OA 5BYYA 3JYAA 2X39A 4IB1A 2XCKA 3A4OX 4KAOA 3AKJA 4FZDB 4FNXA 1WBPA 2PK9A 4ZSLA 4A4OA 3ZLSA 5CASA 3TKIA 3T8OA 1Y6BA 4WNKA 4D58A 4QQJA 4CG8A 3VS5A 5IDPA 3GI3A 1H00A 4I92A 1MQ4A 2X9EA 2UZBA 5E8SA 5HNIX 1OIUA 5AADA 5LVLA 3EHAA 2QONA 4IMYA 3VBTA 3GU4A 2XYNA 4XLVA 3LMIA 4FNZA 3QWJA 2QHNA 2EUFB 4KABA 4N6YA 4O0UA 3KXNA 3DZQA 3HEGA 3RAWA 4NH1A 4W4VA 1PJKA 3VBQA 3WF6A 1H1RA 2ZV2A 3GNIB 3PWDA 4G1WA 4O7SA 4F1TA 1YHVA 3C4WA 4XMOA 4GT3A 2BKZA 4JT3A 4RIXB 1U5QA 3V5JA 4Y5QA 3IW6A 4E73A 5L2SA 4IAKA 3PIXA 4WOVA 3THBA 3O8UA 3RZBA 4A9YA 4AOIA 4J99A 4X7QA 2BHHA 3DNEA 4IVBA 5KX8A 5HX8A 3GOPA 3IGOA 2IW8A 4L3JA 1ZMVA 4LRMA 3TV6A 1PMVA 3ZC6A 5J87A 4ZY6A 1JQHA 1CKPA 4HCUA 4JIKA 3R1SA 4FSMA 4FOCA 3HP5A 4PMSA 5CX9A 1Q5KA 5DHJA 5FRIA 3WE8A 4EK5A 1ZXEA 4NJ3A 4X3FC 4GK4A 5M4IA 2FSTX 1PXLA 4E6QA 5DGZA 1MRUA 2BVAA 4DTAA 3RPVA 1OIQA 4KS8A 1ZOHA 5J5SA 3P78A 4JS8A 1V1KA 3ET7A 3FZPA 1BUHA 2AQXA 4F99A 5FLFA 4CZUA 2NRYA 3F88A 4C36A 4AW5A 1LR4A 1YWRA 3PIYA 4WRSA 2J5FA 5HO6A 3HAMA 3KN6A 3QTZA 1KUTA 1UNGA 4TYIA 3KCKA 1OKYA 3DTWA 2W4JA 4FOBA 4IAFA 3UC3A 1YOJA 4ASEA 4IXPA 1SVEA 4F0FA 4AE9A 4XV2A 3ZYAA 5J9YA 2BHEA 5FXQA 2RG5A 2IZTA 5LVNA 1G8KA 3ORXA 3RNYA 4BDKA 2NYAA 3AC2A 4ZMEA 2A98A 2O64A 1XH9A 1NA7A 2XRWA 3ZC5A 3BKBA 1QPEA 2C6MA 4HJOA 2WIPA 4ERWA 3E64A 2XF0A 4MNFA 2PZIA 4I6FA 1OL7A 4PDOA 3AQVA 2PYWA 2UZUE 4KSPA 4LG4A 2R3PA 3ZUUA 3P5JC 4HCTA 2WD1A 3NUUA 3L1SA 2HENA 3FMMA 4HYSA 4NM0A 3TUBA 1ZOEA 4R8QA 2X2KA