5ACKA

Human pdk1 kinase domain in complex with allosteric compound 7 bound to the pif-pocket
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
287
structure length
286
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Discovery of a Potent Allosteric Kinase Modulator by Combining Computational and Synthetic Methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ackA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ackA01
2YDKA 3BV3A 1PRYA 3JR1A 3E7VA 4BCPA 4DFYA 4GT5A 3FQSA 1VZOA 4I23A 1GIJA 3LFDA 5FLFA 1ND4A 3ALNA 4CMOA 2PE2A 3AT2A 4BI2A 2X6DA 3PRIA 2WMVA 2E9NA 2BMCA 2ITWA 5KMLA 3NGAA 2ETMA 2F4JA 5FBNC 5LMKA 3NS9A 4FSYA 2C5VA 3O96A 2JAMA 4O38A 3UQCA 2CJMA 2WMTA 4GYGA 3QD2B 5CSHA 4D5KA 3BBWA 5K4IA 5HNGA 4IACA 3ZDUA 4MHAA 3RPOA 3R30A 3NAXA 4QMQA 4YSMA 4FV9A 1A06A 4G3EA 3KREA 3LFAA 4I6FA 3SRVA 4IZ5A 2PL0A 3B8RA 1Q24A 1YOMA 2CGWA 3GU5A 4J97A 4E4LA 4RVLA 3UP2A 2O3PA 1WFCA 4EWHA 4EH9A 3IW8A 3MIYA 3RJCA 3QHRA 4FKUA 4PV0A 3GU6A 3CPCA 3GNIB 3ZEWA 1GOLA 4APCA 4O96A 3MVHA 5A4QA 2R3FA 4O86A 4RG0A 2JDOA 3QWJA 2HW7A 3RAHA 4QMPA 4FKWA 4ITHA 4O2ZA 4PRJA 5DFPA 4O7WA 1J3HA 3HMPA 1OBGA 2R3IA 5C8NA 5IPJA 4YC8A 4O7YA 3KA0A 3MPMA 4IFCA 4LUDA 2WOUA 2XK3A 3HZTA 5M53A 3OT8A 3OWKA 3ORKA 1FVTA 3UG1A 4EJNA 4MD7E 5KE0A 4YTIA 3MYGA 4YPDA 3BU5A 2UZBA 4NM0A 2R3GA 3FLYA 4HGEA 5DBXA 1H25A 2WIHA 4CFUA 5EM8A 5DA3A 3RAKA 5KMKA 2BFYA 1UU3A 3F69A 3I7CA 2ITTA 5HVKA 4GT3A 5BUIA 2V55A 3QUDA 1XH7A 4YZNA 3E93A 4AT3A 2VWYA 4F1OA 3ORPA 5CQWA 1YHSA 3BV2A 3QX2A 5E1SA 3A99A 4P7EA 1BL6A 4BL1A 4L3LA 3EKNA 3IDBA 4P5QA 3D4QA 4FG9A 3TI1A 4ACMA 4EH7A 3ZS5A 3TUDA 4ZSGA 3FMLA 2UZTA 3FZTA 5IA0A 4L45A 4CD0A 2PULA 5KUPA 3DBFA 4G5JA 4FV1A 3K3JA 3VUGA 4L6QA 4U41A 4N6ZA 4UMRA 2VGPA 3RHXA 3D94A 4QP6A 4IW0A 2X9FA 3FLWA 3R7OA 5C01A 3A7GA 2QVSE 3POZA 3KN5A 4JAJA 4L53A 4R7HA 3RNIA 3RPRA 1HCKA 2R5TA 4AZSA 3AD5A 5CAVA 2XKEA 4CKJA 2WTVA 5BX0A 5DHJA 3R8LA 4EH5A 1OL5A 4N0SA 2PVYA 3FZ1A 3RI1A 2VZ6A 3AGMA 1Y6AA 4OTRA 4GFOA 5HICA 1A48A 3LCOA 3JY0A 3MB6A 3RWQA 3POOA 5ANIA 5HHWA 4BZNA 3G9NA 5AR3A 4F9YA 2BUJA 1PXMA 2Z8CA 4QQCA 3THBA 3ZLWA 2BFXA 4M7IA 4D2PA 1WBVA 5EQEA 1Y57A 3D2IA 3OS3A 4C37A 1PKDA 1VYZA 2OXXA 2ZV9A 4G3DA 5E8VA 5M55A 4GJ3A 3UQGA 2WTJA 5IH4A 2WB8A 4RA5A 3SDJA 3EH9A 3UVQA 5A54A 2WAJA 4GH2A 3QA8A 1J7UA 5EQYA 4PPCA 3EQCA 4U40A 4GK3A 4BHZA 4I5CA 3ZHPC 2B53A 5CU2A 4I4EA 5E8SA 2W0JA 4YZ9A 4GFMA 4JS8A 4RVMA 1G8SA 1M7NA 5A4EA 2XM8A 4I3ZA 4K1BA 3TCPA 1R3CA 4EZ7A 3GCVA 1OBDA 2OKRA 4CLJA 2IZRA 4I5MA 3TJCA 3ZBXA 2R7BA 3CEKA 3G51A 3UYTA 4FTAA 3NCZA 3WYXA 4YPSA 1KWPA 5FRIA 3OZ6A 4IZAA 3Q4CA 3R2YA 3U6JA 1OL1A 2XBJA 1OL7A 3F7ZA 3R9NA 3UIMA 5JFWA 3COIA 4QRCA 4RWKA 3D14A 1E9HA 3R1YA 5A4TA 3S2PA 3TWJA 4QNAA 4IWPA 1PYEA 4A9YA 1IEPA 4AFJA 2P0CA 3RKBA 3CQUA 4OTPA 1O9UA 4FX3A 2PUNA 5CLPA 2BROA 4DTBA 3SX9A 1I44A 4AS0A 4CVAA 4PNIA 4ZSLA 4BZOA 4FV5A 5JH6A 4D2VA 1BX6A 4FSZA 4O2PA 4BDFA 2VTAA 5AWMA 2UVYA 1QL6A 2Y8OA 3O50A 4H3QA 3OCSA 3QA0A 2IG7A 3VUTA 4TYHB 3B2TA 3QXPA 5HCXA 2ZAZA 4PWNA 4QQ5A 3R1QA 4M66A 5IEVA 1URCA 2JBOA 4IM2A 1YVJA 1ZYJA 2XYNA 4AT4A 2JFMA 2VTPA 4O21A 4RWLA 2OJJA 1J1BA 3DKOA 5DH3A 2GMXA 4FZ7A 3HV7A 4NH1A 4YLKA 2W9ZB 5HI2A 2SRCA 3UNZA 3TUBA 2I0YA 4K2RA 4HVDA 3PE2A 1F5QA 5AUWA 3WOWA 5CSVA 3NEWA 3GCQA 5FBOA 5HG8A 2ZB1A 2Y4PA 2VTOA 2BKKA 3EQFA 1H01A 4I22A 3QUPA 4CFFA 4FTJA 3NUNA 3PUPA 3D5VA 5EYDA 4ZJJA 3LE6A 4EK5A 2PVKA 2WQMA 3MH2A 3C9WA 2ITYA 4BC6A 5FM2A 4RZWA 5FG8A 1OPJA 5TKDA 4U8ZA 3FZRA 4BGGA 4YMJA 2BALA 3HA6A 3I5ZA 5E90A 4BCJA 2XNNA 4IX5A 4WOVA 5I9ZA 2OBJA 4FZFB 3Q9XA 1GAGA 3ANQA 4D2SA 4BKJA 4M69B 3WZKA 5CI6A 4F1TA 2JEDA 3FQHA 4J7BA 2WMXA 4C4HA 3ZM9A 3SW7A 3I60A 2VTNA 3N51A 4PMSA 4S30A 3FPQA 3MBLA 5IMXA 1YQJA 1S9IA 3KF7A 4IJ9A 4CRSA 4DHFA 4EQMA 4K9YA 5EH0A 4E26A 2I6LA 2YCSA 1ZWSA 4CSVA 2C6OA 3KF4A 2YM7A 2NRUA 4EK8A 4F4PA 2XNEA 3D0EA 3PVGA 2YCRA 4KS7A 4XP0A 3V8SA 4DLIA 5JT2A 2XYUA 4YU2A 2G15A 3I1AA 5E92A 3O17A 3C0HA 4BBFA 2EXEA 4RQVA 3UDBA 3AT3A 3QZGA 1PXKA 4NJ3A 3ACKA 2BIYA 3DA6A 2R9SA 2VTSA 2OFUA 3PSDA 4BN1A 3RMFA 3FC1X 2CN5A 2GQSA 3EIDA 4X3FB 1OM1A 3VS0A 1PJKA 2PPQA 2WTWA 1OGUA 4OBQA 4XLIA 2QHMA 2B1PA 2X7FA 2VTLA 3WILA 4QMUA 3UNJA 1Q8ZA 5HTIA 3LXNA 3D9VA 3K5UA 4J96A 3UZTA 2Q0BA 4PPAA 3DFAA 3ZXZA 4C34A 5IQCA 3EFJA 4UALA 2OXYA 3O8UA 3ZSGA 3FV8A 5C1QB 5AAEA 5DT0A 4DF3A 5DWRA 1WBSA 4H39A 1O6LA 4I0RA 2REIA 5HU9A 1YI6A 3EN9A 4JRNA 3DAEA 4IVAA 2C47A 4MXXA 4QT1A 4EKKA 3P23A 2GNHA 2HELA 4XP2A 4DGGA 3LJ0A 5CXZA 4HNIA 4DFNA 5JZJA 3IOPA 4O7TA 1OI9A 1RDQE 3FMKA 4LL0A 4DEGA 4IDVA 1XH8A 3COKA 5HVYA 4AU8A 2OIDA 1H07A 2W5AA 1E1XA 2ZYBA 3DAJA 4I1ZA 4BTFA 3TKHA 2BTSA 4WNPA 3ZXTA 5HIEA 3G5DA 4XV9A 3DK6A 4X3JA 5AIRA 3BEGA 3NNWA 3DXPA 5B2KA 1M17A 3FYKX 4BWKA 2O0UA 4BIDA 4C57A 1OL6A 1GNGA 4G9RA 3RINA 4QP4A 5I3RA 4FNZA 2WXVA 5DGZA 4E4NA 3LAUA 3DKGA 1UNHA 5CEMA 4GEOA 4HPTE 5IQGA 2WTDA 4J8NA 3VQUA 2VX1A 5CF4A 3QRJA 5GZ8A 4OTFA 3QFVA 2ACXA 4HYSA 3R04A 3V5QA 4S32A 2WHBA 5L6PA 5BVEA 3C5IA 5J8IA 4QYGA 1BI8A 3GCPA 5CQUA 2PVNA 5JSMA 2RIOA 4NEUA 4DGMA 1BUHA 2IN6A 1H24A 4MBJA 4RZVA 2PZ5A 3NSZA 3BE2A 3BYOA 1O6YA 2ERZE 3DOGA 2R0IA 2YWPA 1CTPE 5IZFA 3TJDA 2KULA 3QGYA 4TYEA 4JX3A 4G3GA 3QAME 4EC8A 3U54A 2QU5A 5EYKA 4HYIA 1FPUA 4WG3A 4ZTLA 2YLFA 4IVDA 3NYXA 4AE6A 3CQWA 2W96B 3EQHA 3GI3A 3RK7A 2BAQA 4EORA 1WAKA 4MWHA 5E8YA 3BWFA 4E8AA 2WTIA 3VBWA 3RM6A 3Q96A 3SG8A 4KBCA 2BRHA 2XRUA 4DTKA 4EC9A 2HWPA 5KX8A 1OB3A 3MFRA 3KN6A 4KA3A 3OFMA 3C4ZA 4KBAA 4XCUA 3W1FA 5GINE 4JIAA 2YM3A 5CASA 5I9UA 5TT7A 4C02A 4DT9A 2XM9A 3VUHA 3UPXA 5KCVA 4TWCA 5D10A 2A1AB 3BLRA 3W8QA 2J0JA 4EEVA 3BHHA 4XBRA 4GKIA 2F2UA 4ASDA 1XKKA 2C3IB 4QTAA 3DTWA 2JKMA 4MNEB 4XG9A 4I6BA 4YJVA 3LM5A 5KHWA 3D5UA 2GHGA 4ANQA 4Y85A 1KOBA 3D7TA 3Q2MA 4AN3A 5LOHA 2IVTA 3MH0A 1KUTA 3NWWA 5HX6A 4MXOA 4RJ6A 3PDTA 2XF0A 2VTTA 4RIWA 4YHTA 2XK7A 5EM5A 4AA0A 4LGDA 4TYJA 4XG8A 1M52A 4IX4A 2HW6A 3FMMA 5J9ZA 3NVMB 2PVMA 4FEXA 3BKBA 2ZB0A 3NR9A 3ORMA 5EM6A 4IZYA 2VX0A 3QUEA 4Y5QA 3BGPA 4FTIA 3TACA 2IPXA 3CC6A 2OH4A 3GOKA 4D2WA 1YXUA 4JDKA 4FKSA 3SQQA 5J79A 3UO4A 5K9IA 3GU8A 4QQJA 4AFEA 3AC3A 3HRCA 3PZEA 4BTKA 4L3JA 4L52A 4F7NA 2ZM4A 4R8QA 3Q4UA 3QD4A 4ITJA 4FTCA 3M42A 3UIBA 4W8EA 4DT8A 4BIBA 3NZ0A 4FT0A 5AR5A 4CRLA 2YIYA 4X6QC 4FEQA 3BZ3A 4ZEGA 2XK4A 2GNJA 4ZTRA 1NVSA 3IKAA 4OTQA 4DEEA 2A4LA 3QRIA 5CNNA 5CU6A 4CT2A 1GZ8A 4C0TA 5CEQA 4TYIA 3I0QA 4Z7GA 1UA2A 4N70A 5I9XA 3PXQA 1JNKA 4XOZA 3R7YA 4S2ZA 1CKPA 1QMZA 4JBOA 4E6QA 3R01A 2GNFA 1JSTA 4JDHA 3VJOA 3EFKA 3VIDA 1V0PA 2GPHA 4TNBA 4ZJIA 2AUHA 3WF6A 2W1IA 4EH8A 4U45A 1J7IA 1JBPE 3VVHA 3ZFYA 5FEDA 4NIFB 3ZSHA 1B39A 1GZKA 3HGKA 3AC4A 2ZDUA 3QU0A 5AP4A 1OPLA 2JKKA 2PZYA 3AMBA 3EQGA 3QQLA 4FT3A 3E8DA 3A4PA 4Z9LA 3PLSA 4ZK5A 3AMYA 3MI9A 5LVOA 2QOFA 4NFNA 4FSMA 4TTHB 4CEGA 3FMNA 4NL0A 1RQQA 3JY9A 4HYHA 1PXPA 3UJGA 3UZPA 5EDQA 2BRBA 2UW4A 3L9PA 4FMQA 5IA5A 3R00A 4CQGA 3OXIA 3NYOA 4U5JA 5K4JA 2P4IA 4FTMA 4DN5A 2G1TA 3ORXA 1JKTA 3BHTA 3HV6A 5J87A 1KE8A 3KY2A 2XEZA 4KIQA 4A07A 4WT6A 4XH6A 2B7AA 2VTMA 4RA4A 3UOKA 3GVUA 4BDKA 4EOJA 4E1ZA 4ZY5A 5GZ9A 4NWMA 1ZY4A 3GFEA 5AM7A 5D1JA 4NJDA 4D0WA 4DFXE 2G2IA 5EI6A 3W32A 4WIHA 3AD4A 3WI6A 3WF8A 5BVFA 2X4FA 2G2HA 4BKZA 3I5NA 4R77A 4B8LA 1OVEA 3OEFX 1IAJA 3R7UA 2E9VA 1SMHA 3HUBA 3KRXA 3R9RA 1Y8YA 4X6RA 3W2OA 4ACGA 1SNXA 2WZJA 2XNMA 4F6UA 4C7TA 4G5PA 3HKOA 1YXSA 2WU6A 2YLEA 3R73A 4XG3A 5AX9A 4OTIA 3R9DA 4HGTA 1H08A 2VWZA 1P5EA 1H28A 2O65A 2XNPA 4GL9A 4E3CA 2JITA 4G3CA 4O84A 4GG7A 5E8UA 1W98A 5C9CA 3P9JA 2CMWA 4BGQA 2R4BA 3RAWA 4CFXA 4DFZE 4E5AX 3ALOA 2PYWA 4EONA 2F7EE 4YJNA 4C4EA 3P78A 4ZMEA 3OG7A 5LVMA 3NX8A 4K0YA 5DLSA 3QQKA 3FC2A 4GIIA 4K18A 4ACDA 2QURA 3RZFA 4DH3A 1OPKA 4XG4A 1ZXEA 2JIUA 2YM6A 4Z3VA 4XNEA 3AC5A 3OBJA 4ALVA 4FZDB 2QODA 4FSQA 2ITPA 4QP9A 3LLTA 4ENYA 5DEWA 4FI1A 3L9LA 3TKIA 3V8TA 1U5RA 4QTEA 3LQ3A 2JC6A 4U97A 5F1ZA 4L44A 3SXRA 3H9OA 3VF8A 2YJSA 2C3JA 3T9IA 4AN2A 1Q5KA 4R6VA 4JDIA 5JMSA 2R7IA 4ZY4A 3QQUA 4MYGA 4EL9A 2ZM3A 1OKYA 3OOGA 4EOMA 4QTDA 5J95A 2R3HA 4F7SA 3DAKA 5I4NA 5F4NA 1YDSE 2WQNA 2GFSA 4AWIA 1JKKA 2VTQA 4XS2A 5CAOA 5CEOA 4O7LA 2QKRA 5CEPA 1GY3A 3QCXA 1BLXA 3C0IA 4BIEA 2Z7SA 3QC9A 5A4LA 4FYNA 4CCBA 1JVPP 2PMLX 2ZV7A 4YBKA 2WO6A 3CXWA 4U3YA 4F0IA 3D7ZA 4FL2A 4JNWA 2PK9A 4XEYA 4WO5A 3ZONA 3CLYA 4YZDA 5H8BA 4DINA 4BCGA 4LV5A 2XIKA 2GQGA 3TT0A 4CCUA 4RRVA 5HCYA 5K5XA 3OF0A 4XV2A 3F5UA 3QC4A 1W82A 4PTCA 4EZ3A 5ANEA 1OITA 4QTBA 4YP8A 5AJQA 1UV5A 4Y5HA 5CU4A 4FT7A 3VBYA 5BYLA 2VWWA 5DI1A 4FL1A 4RJ3A 3OW4A 4AAAA 3D5XA 3WIGA 5FXRA 4WNMA 3CQEA 1XJDA 3UC4A 1H00A 3H10A 4BYJA 2PUUA 1LEWA 3A8XA 4QPSA 3SC1A 3DB8A 3DNEA 3FLZA 4FNYA 3PVUA 3KULB 2QCSA 4FSUA 4LRJA 5EYMA 5IKWA 5JFXA 1OUYA 5LVLA 3TEIA 2NO3A 3ORIA 3KC3A 3R1SA 4O7NA 4GJ2A 3RHKA 3SD0A 1YOLA 2VV9A 2XKDA 2GNGA 2OH0E 4FSWA 4RIXB 5CVFA 5K5NA 5LMBA 4ZS0A 3DKCA 5CZHA 5F95A 2YJRA 3C4FA 3HV4A 4TPTA 2BDWA 5L2TA 3Q9WA 1M2RA 4I41A 5D9HA 2UW9A 5AV1A 2UZOA 4DH7A 3FI4A 5C8KA 2Z60A 1Q97A 3FKLA 3FWQA 3SXSA 2Y9QA 3KB7A 2X6EA 1ZOEA 3FUPA 4YTFA 3MA3A 4QQTA 3LLAA 3QD0A 4HJOA 4NUSA 2R0UA 4FZAB 3ZOSA 1UKHA 2EWAA 4FIFA 5EG3A 4J52A 5BQ0A 5EW3A 2R3PA 3TNIA 1ZYCA 3DY7A 2P3GX 3LFCA 4G31A 2C0OA 4U3ZA 4RX9A 4E73A 3E7OA 3MS9A 3BX5A 3KVXA 1SM2A 3O2MA 4FEUA 4FTNA 3IO7A 2YM5A 3T9TA 4FZ6A 1OZ1A 5EHOA 3FZOA 3D5WA 4JXFA 2GFCA 2I0VA 3P08A 4XYFA 3PG3A 2XIRA 4CMTA 1IG1A 4DCAA 1QPDA 2XIZA 4UWBA 5K3YA 1G5SA 1KE5A 1Z9XA 2BRGA 2RG5A 2FH9A 4EUUA 5I3OA 3GEQA 3V01A 2W7XA 2CKPA 3PXFA 1Q61A 4YGAA 4BKYA 2B9IA 3FMDA 2B54A 5HBJA 4I20A 3W8LA 4ZS4A 4UYAA 5BPYA 5DRBA 3R7GA 5DEYA 4BVUA 4YO6A 2ITNA 3S4QA 3OBGA 3BQRA 1YOJA 2RKUA 4O83A 2WQEA 2DS1A 3FL4A 3N4VA 3F2NA 1DS5A 4B9DA 3G33A 3EQRA 4RX8A 2I1MA 4YSJA 2PVJA 2F7XE 3F2AA 3I79A 3TN8A 5K0XA 2W17A 1GZOA 2PUPA 3Q5IA 4KB8A 4MXZA 4TYHA 5HE3A 2R2PA 2YAKA 1G8AA 4EOSA 4O0YA 4IWQA 2C6LA 4O6EA 1ZARA 4YNOA 4G17A 4O0RA 2QOCA 3CGOA 2EB2A 2IWIA 4JI9A 3NNUA 3JVSA 2AYPA 4UXQA 5IG1A 3PLAE 2CSNA 4FV0A 2C0IA 3FI3A 4BBEA 5GJFA 5JQ8A 3RWPA 4A4OA 1PXOA 3DGKA 1TQMA 5CAPA 5FWKK 4GYIA 1H1SA 3TZMA 5J9LA 4EOIA 3QLFA 3TNQB 3GXLA 2GNLA 2QG7A 5DR6A 1TQIA 3OMVA 4AN9A 1KSWA 3F3VA 5JRSA 4FKVA 2UW5A 4WSYA 3E8CA 2QG5A 1PF8A 3C5UA 4MD8E 2DYLA 3QZHA 4YJRA 4MEDA 5B2MA 4CYIA 2C5YA 4MQ2A 4MBIA 3EB0A 2WGJA 1L8TA 3ZO2A 3DDPA 4BCOA 5M51A 3CTHA 3TV4A 4M0YA 3H9FA 2WQOA 4UMPA 4IX6A 1LR4A 3HUCA 3C4EA 2CDZA 5IA2A 3R28A 4IB0A 4RJ7A 2X9EA 1F0QA 4D2RA 3K54A 4EYJA 3NW5A 4KAOA 3CGFA 3BGZA 4WD5A 4M69A 3ZH8A 2QOBA 5A46A 3O51A 5ITAA 1FBNA 3Q4TA 3U9CA 2IZUA 3BYMA 2P2HA 4JRVA 4E7WA 3CY3A 5HBEA 5GJGA 4FKQA 5ACBC 4F08A 4RT7A 3OTVA 4DEBA 1T46A 3UOLA 4FTOA 2Y7JA 5DR9A 3VO3A 4C3RA 5L4QA 2OXDA 2B55A 2Y4IB 2ZVAA 3R02A 4TYGA 3AXWA 3F5XA 5E8TA 4MF1A 4H1MA 1RE8A 1MRUA 3RAIA 2Z2WA 3VBTA 4J53A 3R8MA 2V22A 2WFYA 2HOGA 3KXGA 3GGFA 1M2PA 3EWHA 3VULA 1ZAOA 2GHLA 2C6KA 2V62A 3D15A 2W4OA 3LW0A 4QMVA 3DTCA 3QF9A 5DRDA 3U87A 3RBWA 4FEVA 2IW6A 4M15A 4PDPA 5C8MA 3VS6A 2PVFA 5KMMA 3E64A 3RPSA 4OBOA 3FLQA 2QO9A 3ZU7A 4X3FA 4F63A 3VQHA 3HRFA 2YM8A 1UWJA 4FE2A 3MJ2A 5IUIA 2OO8X 2XNBA 1H27A 2IO6A 4BHNA 4MXCA 5DNRA 3PA4A 3UYSA 3G0FA 3HAVA 3A4OX 2W1ZA 3DXNA 3PSBA 3QYZA 3OTUA 4UEUA 2YDIA 4H1JA 4PP9A 2XMYA 2ZMCA 2V5QA 3MPAA 1M7QA 2EXCX 3VUKA 4PQNA 1M14A 3TIZA 4BRXA 3EN4A 5LCJA 1IA8A 3W2RA 4FIGA 4FSTA 4IX3A 3MH3A 4FV4A 2VWXA 3QKMA 3KCKA 3HNGA 4FUXA 4E6AA 3KRRA 3H0ZA 4HPUE 3MGYA 1UWHA 4HCVA 5HIBA 4RX5A 4BDJA 1Q62A 2EB3A 2YAAA 4F0GA 2W5HA 5E1EA 4TZRA 4JR3A 3ZUVA 4NK9A 1H26A 4CFWA 2BDFA 2R3KA 4IAFA 1Q3WA 1Q99A 3H4JA 3FXXA 3LXPA 4XHKB 5LVNA 2OJ9A 3NUYA 4HCTA 4HZRA 1U54B 3N9XA 4FIIA 4A06A 5B0XA 5HO7A 3R1NA 3PXYA 2YA9A 2HAKA 2XUUA 4D55A 4BDBA 2W1EA 2FSTX 3MTFA 4MH7A 3P79A 3AC8A 5EI8A 3SKCA 2ZOQA 4BDAA 1XH6A 2YIQA 3B2WA 1E1VA 4MK0A 5J5TA 3ZFMA 4XJ0A 2W9FB 3RALA 2EVAA 1OIUA 3PY1A 2UW6A 4CMUA 2QOIA 3EYGA 3SXFA 2FVDA 2HCKA 2OZOA 5F94A 2RL5A 3QQJA 4MXYA 4FIJA 5F9EA 4KSPA 3KRWA 2WEVA 5J9YA 2OJIA 3CPBA 3EN5A 3MWUA 4U80A 5DT3A 5CEIA 4RPVA 4FV6A 4JAIA 3EZVA 2Q83A 5IDNA 4R5YA 3LMIA 4OAUC 3AD6A 4BF2A 3HVCA 3PXZA 4R5SA 1LUFA 3DJ5A 2B4SB 4M67A 1R78A 4OTHA 3HYHA 1JWHA 2H9VA 4NTTA 5HESA 4D4SA 4DH5A 1GJOA 3UOJA 4XG6A 4HCUA 5TR6A 3CJGA 1YI3A 2X2LA 5FTGA 4RBLA 3ORLA 4PDOA 2WKMA 3DZOA 4MKCA 3FJQE 3FSFA 4NM7A 4KWPA 2PU8A 4GUEA 1CMKE 3IW5A 4DH8A 5HBHA 4AF3A 4FL3A 4IAKA 5AP3A 3WARA 1DAWA 2ITOA 4I5PA 3UIUA 4DG3E 4G9CA 2RG6A 3ETAA 4EZ5A 5IH5A 2C68A 4V01A 1YKRA 3R8PA 2W4JA 3EOCA 1SNUA 5M09A 3PVWA 3MFUA 4PX6A 5CS6A 1AGWA 3SAYA 1Q8YA 3AGLA 2F9GA 1OUKA 2XZSA 3MTLA 3OUNB 5IQDA 3C4XA 4II5A 4XX9A 3PA5A 3G15A 1W0XC 5FP6A 4ONAA 4CG9A 3AC2A 3UE4A 4YJTA 3ZSIA 5DYJA 2F49A 2J9MA 1U59A 4OLIA 2Q0NA 3VWAA 5CF6A 1UU8A 4UMUA 3ROYA 3TV6A 1PXIA 2W1HA 5JFSA 3F61A 3ZMMA 4CTBA 4ANBA 4MNEA 5AADA 3R8UA 4BWPA 4HW7A 5HX8A 5KBQA 2Y6OA 4L7FA 4FTRA 4BCQA 5E9EA 4QD6A 5AAFA 4D1XA 1BYGA 1SYKA 3ID6C 3CD3A 3O8TA 2C1AA 4FKRA 3TNPC 4EHGA 3HP5A 4XG2A 2OIBA 4FKIA 3C1XA 3EMGA 4J8MA 2I7QA 3IW7A 4DG0E 3DCVA 5HZNA 3EQBA 4HYUA 1KV1A 1MQBA 1VEBA 5ACKA 4ZTMA 1WBOA 2X81A 3EL8A 2C69A 4HZSA 4IHPA 4X2NA 3UVPA 5G6VA 2P55A 4MBLA 2IW8A 2UVXA 4CYJA 1UNLA 2EU9A 3ENHA 2QI8A 5EW9A 4AW1A 2R3QA 2WNTA 2PWLA 5EQPA 2ESMA 3DLSA 1ZYLA 3EQPA 4KABA 3OCTA 4YJQA 4OW8A 4LI5A 5HTCA 3PJ3A 4QPMA 2CNUA 3F2RA 3GOPA 3JS2A 2RFDA 2GQRA 4LGGA 3E8EA 3BLQA 3AT4A 1H1RA 2C6EA 3DQXA 2CGVA 3ODZX 4ANOA 5T3QA 1HCLA 5LQFA 4JJRA 5FDXA 3WZEA 3NUSA 4X2FA 5BVWA 4U79A 2XJ2A 3ACJA 2EXMA 2CKEA 4FG8A 4N4SA 4F70A 3QXOA 5L8LA 3U8WA 2WPAA 3BBTB 2XBAA 4I5HA 4OT6A 3I6WA 4IAYA 2BZJA 5FTOA 1OL2A 1UVRA 1VR2A 3GC8A 1ZMWA 4QYFA 4F9BA 3FMHA 1XBAA 2B9HA 3CBLA 1P4FA 3O0GA 3QHWA 2WIPA 2NP8A 4QOXA 3ZRKA 4FKTA 5GIPE 4TWPA 3W2PA 4NIFA 2NPQA 4GU6A 4XOYA 2JDRA 2NNWB 2HZIA 2LAVA 4F1MA 3LXLA 3FDNA 3K2LA 5M4FA 4PMMA 5B7VA 4G6LA 4LRKA 1R39A 3O8PA 3SGCA 2J0KA 2J0MB 2YACA 3I0OA 2RSVA 1FOTA 2QKWB 3ULZA 4EJ7A 2UZEA 4ZXTA 3DT1A 3GQIA 4M13A 2R3RA 3DBDA 1J91A 3DKFA 4DGNA 2V0DA 2JIVA 2B52A 4BBMA 2ZMDA 4YC3A 2OLCA 2OGVA 4IWDA 2JAVA 3WBLA 4C4IA 4D4VA 4NKAA 3P5KA 2UZDA 5M08A 3QCYA 4S31A 2QO2A 3PXKA 2OJGA 4FTTA 5AFVA 4ENXA 2AC3A 4Q9SA 5CSPA 2CCHA 4ZZNA 4GK2A 4GV1A 2J0LA 2YITA 3W16A 4CV9A 3VC4A 5KHXA 4WA9A 4APPA 3ATTA 4RQKA 4W4WA 5HOAA 3UO5A 3ZLYA 5L2QA 3U4UA 2XCHA 3G2FA 2PVHA 3CJFA 5AUYA 3UMWA 4ZLZA 2VN9A 1EH4A 4HOKA 3W10A 3ELJA 3KRJA 1H4LA 2XEYA 3HMOA 3KK8A 3PYYA 4JX7A 4MVFA 5FD2A 2X2MA 2FSMX 5HO8A 3W55A 5FGKA 5ANGA 4GSBA 1ZMUA 4RVTA 4BB4A 3VUDA 3NUAA 1WCCA 4KIPA 3VF9A 3KMUA 4WBBB 5CTPA 2IW9A 4MXAA 2O2UA 3BU3A 4F9CA 4ERKA 2OU7A 5M44A 3NDMA 3WE4A 3QQFA 1PY5A 1SVGA 2VAGA 5CVHA 5KMIA 2PUIA 4EK6A 4I24A 2QNJA 4BTMA 4D5HA 3NUUA 4XRLA 4FBXA 4CLIA 3C7QA 4DGLC 4HVIA 4NFMA 3WE8A 1OIYA 4G16A 4YJSA 4CFVA 2CLXA 4ZY6A 3HL7A 4PNKA 3JVRA 3VAPA 3CSVA 4YZBA 5ETAA 3GBZA 4WUAA 3BYSA 3OUKA 3PPZA 4KINA 3RPYA 3VJNA 1XH9A 3KMMA 4DFLA 3BYUA 3F88A 2ZV8A 3VHEA 1M2QA 3G6GA 4CZUA 1P4OA 5LWMA 2GDOA 3OVVA 3PJCA 4JQEA 4JT3A 5CF8A 3S95A 2C5XA 5J1VA 3PIYA 3IDCA 3GFWA 4LG4A 1QCFA 2IZTA 4QMXA 1OKVA 3QKLA 3MN3A 3L8PA 4MWIA 4U9AA 5EK7A 3UTOA 4Q9ZA 4CQEA 3UPZA 4UBAA 3OXZA 4FKJA 4UZHA 4E5WA 3S0OA 4JVGA 4GS6A 1CSNA 4UMTA 4OTWA 4RIOA 2WTKB 4WUNA 2R3LA 2X8IA 3H30A 1PMNA 2JIIA 3P0MA 4YJPA 3LQ8A 4C62A 4O7VA 4ARKA 4I0SA 3I81A 3HV3A 1JLUE 4RWJA 4IAZA 3D2KA 2R3NA 4I6HA 4OT5A 2UZVA 5E8ZA 5M4IA 3NYNA 5ETFA 4YC6A 2PSQA 4Z55A 3FI8A 4FC0A 4Y72A 2FO0A 2PZRA 2UVZA 3QTIA 4AZVA 4BCFA 3N4TA 1Q41A 4PY1A 3Q6WA 5AP6A 4RJ5A 2QU6A 2XKFA 1BKXA 2Z02A 3Q32A 4G1WA 4IB3A 4C3PA 4L42A 4QMOA 3FY2A 5D7VA 4NW5A 4BY9E 4IEBA 2W1DA 2ONLA 2VRXA 3CY2A 3FXWA 5EM7A 4C38A 3R9OA 1Z57A 2QC6A 2JLDA 2BZHB 3WIKA 2CNVA 1YWNA 3MY1A 4QMSA 4E6CA 2R3MA 2HYYA 3MFTA 4ITIA 3KL8A 2VWBA 4ZJVA 2BDJA 2YZAA 1GIIA 2LGCA 4JIKA 3PJ2A 4W4YA 4NCTC 3FKNA 3PE1A 5HE2A 2GNIA 5L6OA 4QPAA 3KULA 3C4WA 4BCMA 4ZIMA 5KMJA 3CKXA 4JG6A 1ZMVA 4ZOGA 2X7GA 4Z7HA 2XK8A 4RIXA 4K33A 5I9VA 1GZNA 3KXXA 4Y8DA 2OIQA 2YHVA 5L2WA 4XP3A 4B99A 4O1PA 4GKHA 4O7ZA 2QOOA 4TNDA 3HEGA 2OZAB 4MD9E 4I21A 3ZUUA 4ID7A 3RTPA 4BCKA 3CR0A 4PF4A 1H8FA 2J50A 4FOCA 3MY0A 3HAMA 1P14A 2YEXA 5A6NA 4R1VA 2BHHA 4U43A 4C2WA 1WVYA 4QMTA 4ALUA 5JKGA 3RVGA 5KMOA 4CT1A 5BVOA 5LXMA 2PVRA 5I0BA 2A0CX 4OTDA 2J4ZA 2WMBA 2R3OA 4W9XA 3S3IA 2R3JA 4FSRA 3DV3A 2CCIA 5C4LA 1AQ1A 3MVLA 4DA5A 4C4GA 3QTRA 3JUHA 3VUMA 4HVSA 2GS6A 3QGWA 3U6IA 1V1KA 1YWRA 2EUFB 2RFEA 2ZV2A 4B6LA 4N6YA 4DLJA 3QTUA 1H0WA 4PP7A 4FTQA 5HD4A 5CX9A 3HMNA 2J2IB 5JZNA 3M11A 4QMWA 5D41A 2ITQA 3HV5A 4F7JA 3PG1A 3C0GA 4Z16A 2CKQA 5L8JA 2XK6A 2ITXA 2C4GA 2VWIA 1ATPE 2GSFA 3TTJA 5C26A 2WELA 3V5PA 2QHNA 3E87A 4MF0A 1A9UA 1H1WA 4JOAA 4KIKB 3EHAA 5IUHA 2O64A 3F66A 2XP2A 3NPCA 2QR7A 4DBNA 4LQMA 5JGBA 2J7TA 3DJ6A 2E9OA 4UWYA 3CE3A 4FV8A 3LFSA 3R7IA 4C59A 5KMNA 4BI1A 2X0GA 5HVJA 4KUJA 3QTSA 3LXKA 1DI9A 3SOCA 4RFMA 2I40A 4FT9A 3C51A 5HU3A 1NVRA 1MRYA 3PIXA 2FB8A 3ZRLA 2OFVA 4JQ7A 4EQCA 3L8XA 4IVBA 5ANOA 4AW0A 4F7LA 4C4JA 4L01A 1LPUA 3VS2A 4RIYB 5J7HA 2VU3A 3E88A 3UQFA 1CM8A 5BVNA 3NNXA 4M0ZA 5LWNA 5KKRB 1FQ1B 5CVGA 4BWXA 4QMYA 5T6KA 4IC8A 4NU1A 3KXZA 4X21A 1H1PA 5HORA 1NVQA 5LMAA 3EJ1A 2W06A 3BU6A 4FVPA 1IRKA 2ERKA 3BYVA 2UW8A 5HNIX 3BI6A 4L8MA 1G3NA 2FUMA 4L46A 3L1SA 4X2JA 3P7BA 4ZSEA 2XB7A 2GTNA 3PPKA 2P33A 4P2KA 3FLNC 3ZO1A 1NY3A 1CKJA 4D58A 1XH5A 4FR4A 2B9JA 4UWCA 4EOLA 4YHFA 1DM2A 2YABA 2XJ0A 1CKIA 2BCJA 2QONA 2YFXA 4V0GA 3UZRA 5DE2A 4EQUA 2X2KA 3EL7A 4GW8A 4JR7A 2ETKA 1NT2A 4QYEA 1OMWA 5IU2A 4FV2A 3CTJA 2BZIB 3ZZWA 2Y0AA 4FA2A 5IQAA 5D12A 2JBPA 5LCKA 2FA2A 3BE9A 5EHLA 1U4DA 4DG2E 4XMOA 2BAKA 3ZZEA 2CGUA 3EFLA 4OUCA 5HD7A 3WF5A 3O71A 4KKEA 2VNWA 4AW5A 1B6CB 4F65A 4NM5A 3TZ7A 4R7IA 4FTLA 5IA4A 3E62A 3R2BA 5FM3A 3WZUA 1X8BA 2C6MA 4ANMA 4NCTA 4UMQA 2C5NA 5AP2A 3F3ZA 3R0TA 5AUVA 5LARA 5G1XA 4CXAA 3FEGA 5M06A 2C6DA 2DWBA 2UW7A 3IK3A 4R78A 3DBQA 2NRYA 4PDSA 3ZFXA 4ZLOA 2W4KA 4HVHA 4GT4A 5J7BA 1PXLA 4EOKA 4QP2A 3PP1A 1OIRA 4PUZA 4C35A 3SG9A 1S9JA 2FYSA 4X7QA 5A6OA 4AZTA 2YCFA 1W7HA 3P7CA 4DFBA 4CTCA 3O7LD 3P7AA 4X3FC 4YLJA 1WBWA 3TG1A 5L3AA 5EKOA 4C3FA 4NT4A 2OF2A 2IVVA 1REJA 4L00A 2VTHA 4W9WA 4YBJA 4HGSA 2WEIA 4WNOA 4HGLA 3LCSA 4F99A 4ZP5A 2UZUE 1V0OA 1ZYSA 2XIXA 4KNBA 4RJ4A 2OK1A 1KE9A 2E9PA 2YCQA 5D11A 5LJJA 4FF8A 3IW6A 2UW3A 2CLQA 3VRYA 4C2VA 4TN6A 1JSUA 5ANJA 1H0VA 3Q4ZA 5TOZA 4USEA 2CHLA 1XO2B 4OBPA 3D83A 4RC4A 3I6UA 3KCFA 5IQEA 4ANNA 3G6HA 3L9NA 1JQHA 4M12A 4EOOA 5HO6A 2XCKA 3KGAA 3ULIA 2QO7A 3UVRA 4FIEA 4M3QA 2C1BA 4PMTA 1PKGA 5CNOA 3W18A 3QD3A 4FGRA 4XV3A 1JAMA 4EBWA 1HOWA 4AGDA 3LFFA 4FIHA 5EW8A 2W99B 3E92A 3OY1A 4LYNA 4M8TA 4M14A 4LGHA 3EQIA 4YR8A 1U5QA 3RCJA 4PTGA 1MUOA 3DNDA 4WRGA 2XH5A 3DS6A 4M84A 3OWJA 1U54A 2UZNA 3FMEA 2DUVA 3UOHA 2BILB 3NRMA 3Q6UA 4ZTSA 3W2CA 1OIQA 2ITZA 3HP2A 2G2FA 4KS8A 2BIKB 2GCDA 1REKA 2VWUA 1BMKA 2J0IA 4I92A 3PJ8A 2JDSA 4TWNA 5EFQA 3GC7A 3ZDIA 4J95A 4TL0A 3BEAA 1Q8TA 2X8EA 3BHUA 5AIKA 5HE1A 4UX9A 4IADA 4FK6A 3OWPA 4I93A 1YXTA 3V5LA 4R3RA 2QOKA 3Q9ZA 3B8QA 4C61A 5CALA 1Y6BA 3A7HA 1H1QA 3AQVA 4NW6A 4BI0A 1IAHA 4R7BA 1MQ4A 2BKZA 3GC0A 4J1RA 5IEXA 5IH6A 2WTCA 2J51A 3OP5A 4B4LA 3QL8A 4ZTNA 1PW2A 3GU4A 4X2GA 3VHKA 4D9UA 4O91A 5AR2A 3FBVA 2WQBA 2FSOX 3R83A 4DEAA 4PTEA 4A9TA 3Q04A 3OEZA 4ZTQA 3V51A 4ASXA 5HLNA 4O82A 3VBQA 3KVWA 5JK3A 3H3CA 2ZDTA 4RLLA 4V0GB 4AZFA 4TT7A 4JBPA 1FVVA 5DT4A 5BYYA 5TO8A 5ICPA 2JD5A 3EZRA 4RGJA 2HENA 5JEBA 4LUEA 3QQHA 4TWOA 3WF9A 4A4XA 5HGIA 3UBDA 2VD5A 2I0HA 3SVVA 3MH1A 2YIRA 3OD6X 2YM4A 3Q9YA 3DQWA 5EI2A 4YHJA 5CEKA 3ATSA 4UY9A 1YDTE 2JFLA 3ITZA 5AR7A 4U44A 1WZYA 1V0BA 3HX4A 4LL5A 4C36A 4AUAA 4HNFA 3PVBA 3ZRMA 3QYWA 4M97A 5ANKA 5AP0A 3TZ8A 5CAUA 5IF1A 5E4HA 4V04A 3BRBA 2ZM1A 4UXLA 2BR1A 2VO0A 2WMRA 3FHRA 3TL8A 4FGBA 3KU2A 4UYNA 4UN0C 3P4KA 3QCQA 3DZQA 4IE9A 5AMNA 3TDWA 3BLHA 4ANSA 5IISA 5CANA 3KFAA 4UV0A 4QP1A 2XKCA 3UIXA 3LJ2A 4H3PA 3UO6A 5GZAA 5A3XA 4JBQA 3MDYA 5AV3A 5AR8A 3AMAA 3OT3A 3G0EA 2CN8A 3FI2A 2IVUA 3SOAA 3A7IA 4FKLA 4A4LA 2PE1A 4IM0A 3COHA 1ZY5A 2J5EA 4DEDA 2X8DA 2B0QA 2WTKC 2YISA 2KTYA 5FDPA 4IXPA 3PZHA 4A9UA 3TUCA 5AV2A 4AW2A 2BPMA 2H6DA 3CP9A 4GFGA 5BUEA 3HDNA 3C4CA 2QLUA 3E5AA 1Q8UA 5J5SA 4LMNA 3QTXA 2QD9A 4EYMA 1OKWA 4EH6A 2JDVA 4RX7A 2VTIA 5IA1A 3PY0A 3PTGA 3HA8A 3NUXA 3FYJX 2Y6MA 4ASEA 1Y91A 3GCSA 3PA3A 3KXNA 3QRKA 4JLCA 4MX9A 4IMYA 5CU0A 5CAQA 3VS3A 5FP5A 3TV7A 2QOQA 4FSNA 3UG2A 1GIHA 3KMWA 2PMNX 3EN7A 4GVJA 2XK9A 5CYIA 3R7EA 4EBVA 4LOOA 4W4VA 4FODA 4E5BA 2RGPA 5EOLA 4CZYB 4J98A 3P86A 4H3BA 5CSWA 2JDTA 5HQ0A 2XVDA 4EK3A 4PL5A 4BDIA 5C03A 3BPRA 4IBMA 3LJ1A 5KO1A 4GRBA 3MESA 5AM6A 4WG4A 2W1GA 2Z7QA 3FLSA 4A9RA 4YUQA 3S00A 5KZIA 3RPVA 5FXQA 1W83A 5HEZA 4YZCA 3OCGA 4QO9A 4RSSA 4LV8A 4G2FA 3QQGA 5AA9A 2W1FA 4ANLA 1FMKA 1JPAA 1ERKA 2PVLA 3RK5A 4F9AA 3SW4A 5HG9A 4CNHA 2YWVA 4RWIA 4FVRA 5CU3A 5GHVA 5C4KA 1PMEA 4BTJA 1OKZA 5L2IA 3IGGA 4JBVA 4BR3A 5L6WL 1U46A 2A27A 3GENA 3KEXA 4YNEA 5HG7A 3UODA 1B38A 4FKOA 4IC7A 2E2BA 3KKVA 4KKHA 4YTHA 4E4MA 4WG5A 3LMHA 3E63A 2H8HA 4KD1A 5HG5A 2XS0A 3SRVB 5HLWA 4KRDA 2RFNA 4GUBA 4IQ6A 3IECA 3OOMA 4CFNA 4O0VA 4AP7A 3NMUF 3DDQA 4AZWA 4U7ZA 4EHVA 3N4UA 2VWVA 2HY0A 5M57A 2XIYA 5E8XA 3V04A 3FXZA 5DVRA 2WMWA 3FHIA 3UP7A 5JQ5A 3R6XA 1J7LA 5I5ZA 2AC5A 2PHKA 2UV2A 1XH4A 3A8WA 4MQ1A 2WMQA 3C13A 4NKSA 3DU8A 4LOQA 4RVKA 4O1OA 3A7FA 2HZ4A 4LRMA 3GC9A 4AA5A 3R9HA 3T3VA 4AGWA 4YURA 4IIRA 4BZDA 2HWOA 2O8YA 1YDRE 3FSKA 4W8DA 4D9TA 3EKKA 3CD8A 3PSCA 3ZLSA 5AV0A 3NIZA 1VYWA 4D1ZA 4GCJA 4AG8A 1QPEA 4I6QA 1JSVA 4EHZA 5HNBA 4EOPA 2QOLA 4AX8A 2HXLA 1DI8A 3F3WA 4FKPA 3ORTA 4JG7A 3II5A 4IWOA 1NW1A 1WBTA 4IAAA 2VO7A 4BYIA 1DAYA 4O7SA 4IM3A 4D0XA 4OGRA 3BHVA 3TNHA 3ZUTA 4KIOA 3Q5ZA 4BDDA 3SV0A 2CPKE 4Y46A 4ACHA 4F6WA 1XWSA 3RK9A 1KOAA 5DIAA 5EKNA 5KNJA 3OY3A 4NYEA 4TW9A 3NNVA 1PMVA 2BRMA 3REPA 3A2CA 2HXQA 4O6LA 3OHTA 4UZDA 5KKRC 3AOXA 3DK7A 3LPBA 1Q3DA 5EOBA 5J1WA 4GU9A 4RJ8A 4BGHA 1RW8A 2IJMA 2UZWE 5HTBA 2X1NA 1ZRZA 3E8NA 3QRTA 5FUTA 2VNYA 1Z5MA 2W05A 3NLBA 3R71A 1UU9A 4FG7A 5HKMA 2WU7A 1JKLA 2UZLA 3MV5A 4ZZMA 5IMEA 1R1WA 5GJDA 1R0EA 4AXAA 3HRBA 5LVPA 3R7VA 2VX3A 1YXXA 2XNOA 2W1CA 2BZKB 4PL3A 5H3QA 2UUEA 3TIYA 4ZMFA 2CNQA 2A2AA 4WRSA 3CCNA 4QMLA 5DOSA 1APME 3F7WA 1TKIA 4F9WA 5DMZA 4O27B 3DBCA 4KBKA 2ONLC 1Y8GA 3LVPA 3DPKA 3LHJA 4R3PA 2WMSA 3BIZA 2V7AA 3GU7A 3VS7A 1KV2A 3QWKA 3ZC5A 4FYOA 4AGCA 3MIAA 4KSQA 4OTGA 4EH2A 4K6ZA 2JKQA 3QX4A 4Q5HA 2GS7A 3RNYA 4BFMA 3OXTA 5H8GA 4NZWB 3W2QA 1WMKA 4D2TA 1ZZ2A 4ZLYA 1YHWA 3MB7A 4AZEA 2JKOA 3I7BA 4I0TA 5AV4A 3ZO3A 1JKSA 3ENMA 2YDJA 3MA6A 5H2UA 4XV1A 2G01A 4JG8A 1BL7A 5JN2A 3MW1A 4DITA 3IQ7A 3O23A 3PY3A 1WBPA 4L3PA 1T45A 3MJ1A 4M68A 3MVJA 3RM7A 4JQ8A 5AUXA 4O0WA 4RLKA 4FICA 3S1HA 3IONA 3Q3BA 2OZAA 3I4BA 4G6OA 2F57A 4IZ7A 3IG7A 1ZLTA 4MTAA 4D1SA 4B8MA 4QP7A 5BVDA 3IW4A 3HLLA 3L9MA 3NVKI 4XBUA 4E93A 4QMNA 4O22A 3ANRA 5L2SA 1MP8A 4ALWA 4JL9A 1VJYA 2BTRA 3G90X 4U6RA 4QP8A 4F6SA 3NUPA 4P4CA 2CKOA 3QTQA 4U81A 4V05A 2PZPA 3V6RA 3ZLXA 4FUYA 5HE0A 5HCZA 3FE3A 3JXWA 4L67A 4XUFA 1K3AA 1PMUA 3KQ7A 1O6KA 3QTZA 4PMPA 5AUUA 2OG8A 4MNFA 1WBNA 3QBNA 2DQ7X 5L8KA 4D4YA 3U55A 3VS1A 3EFWA 5DR2A 2HIWA 4WBOA 3MPTA 3PWYA 4GIHA 2E9UA 3R63A 1FGIA 2O5KA 4DFUA 4BCHA 1P2AA 3PFQA 4O0XA 3LKMA 3C50A 3DB6A 3MFSA 4CKIA 3MVMA 2F7ZE 3F3UA 1R0PA 4D28A 4BICA 2C6TA 1YW2A 3SA0A 3R22A 4ERWA 3JPVA 3VW6A 4LM5A 4KIKA 1WVWA 3UGCA 1PHKA 3F3TA 4P5ZA 3ODYX 4H58A 4D4RA 3Q2JA 4P90A 1ZZLA 2F2CB 4K11A 4GMYA 5I9YA 4DGOA 1FGKA 4TKSA 3AC1A 2X39A 4J71A 5EYCA 5BNJA 3A7JA 5BMMA 4DC2A 4QNYA 4AOIA 1FMOE 4O0SA 3LFQA 3L8SA 3NAYA 4GVAA 3V8WA 5IQHA 2YIWA 2VO6A 2O63A 3DFCB 3EQDA 4CG8A 3ZCLA 3K3IA 1TVOA 3LCDA 3PXRA 5DG5A 3U9NA 3M1SA 3UNKA 4RIYA 5M56A 5CWZA 5M4UA 4IANA 3OCBA 2YN8A 4O7RA 2XRWA 3LFBA 2YIXA 4FKGA 3WZDA 3ZO4A 4GK4A 5AP5A 2H96A 3FL5A 3ROCA 3WF7A 3FMJA 4CGAA 4XG7A 5EHYA 3TNWA 4DEIA 4PDYA 1YXVA 5CENA 4BCIA 4E20A 3QCSA 2C6IA 5IDPA 2Z7RA 2IZSA 3F5GA 3ORZA 2FGIA 4ZSAA 4O0TA 5C27A 1URWA 3GUBA 3ZBFA 4A7CA 4FK3A 4IB1A 5H9BA 2I0EA 3LZBA 4NM3A 3G9LX 5HLPA 1L3RE 1RJBA 1XBCA 3U51A 1JOWB 3F82A 3ERKA 3OW3A 4NTSA 3FAAA 1ZOGA 5AP7A 5FTQA 4G6NA 4QYYA 1QPJA 4DBXA 2PZIA 1IA9A 3QKKA 5E91A 2OF4A 5TE0A 3R8ZA 3FZSA 3PP0A 4GG5A 4K77A 4LMUA 4C4FA 1YI4A 3LMGA 5ETCA 5K0KA 5A14A 4RFYA 4H05A 5D7AA 4DAWA 3IPHA 3VW8A 2GTMA 1TQPA 1PXNA 5AX3A 4TRLA 5T68A 3VS4A 2C3KA 3CS9A 2OICA 4AQCA 1YRPA 5AAGA 3SLSA 2HZNA 4TY1A 4G34A 2ITVA 2Y4IC 3BGQA 4YLLA 3K5VA 3NIEA 1IR3A 4OR5A 4EK4A 3VRZA 3NW6A 4YJOA 2PMOX 4G3FA 4CFMA 4PL4A 4J99A 4BDCA 4FVQA 3GCUA 1XQZA 3LM0A 2J6MA 1YWVA 4R1YA 4IB5A 2QQ7A 2WD1A 4KKGA 3ZYAA 3V6SA 3Q53A 5IQIA 3H0YA 4IJPA 5BVKA 1UNGA 4ZTHA 2WMUA 3VNTA 1QPCA 4L7SA 3GB2A 5B2LA 3EYHA 2VGOA 5IEYA 4IDTA 4C8BA 1ZYDA 5IQBA 3DJ7A 4QTCA 4QYHA 2HZ0A 4FNWA 4EUTA 2R64A 5DPVA 5GIOE 4BDHA 4BDEA 4EH4A 4A9SA 4DH1A 4QMMA 2GU8A 3HECA 1UU7A 2G9XA 3RZBA 4EOQA 4HVGA 4ZAUA 1FVRA 2C5OA 2BHEA 4S34A 1XR1A 3NYVA 1KE7A 4L43A 3UMXA 3V5JA 3TXOA 4B7TA 5JGAA 3TM0A 5JRQA 3V5TA 4QMZA 3V5WA 2OJFE 2PMIA 4MCVA 3VBVA 2PE0A 5A9UA 3QLGA 3PIZA 2V7OA 1Q4LA 3T3UA 3LFNA 3LFEA 1SVHA 4OAVB 3R21A 5FEQA 3ORNA 3LOKA 5KBRA 3M2WA 3OROA 4R3CA 4RFZA 4E6DA 1ZOHA 4U0IA 4EKLA 5DN3A 2ITUA 4EHEA 3T8OA 2VTRA 5HIDA 4BDGA 3DLZA 3SHEA 3VN9A 3DBEA 4MAOA 4I4FA 1F3MC 2HY81 5IA3A 5LMKC 3E3PA 4KRCA 4BCNA 3W33A 3KXMA 3QALE 2A19B 2WMAA 3FY0A 3GT8A 2XJ1A 3CIKA 1YHVA 2ETRA 2XNGA 3LIJA 3LCTA 1I09A 4L68A 4XLVA 3TZ9A 2J90A 5BMSA 4H36A 5CXHA 5E8WA 5AEPA 3LQ5A 3CKWA 3W2SA 3HMMA 4TXCA 4AA4A 4AT5A 4FEWA 3QZIA 1W84A 1MRVA 2IVSA 3IGOA 4FTUA 3Q60A 4WNKA 4Y73A 4E4XA 4AOJA 4Q5EA 2VTJA 3FZPA 5JGDA 5FQDC 5M4CA 2GS2A 5TF9A 2FSLX 4RC2A 3IDPA 2OWBA 3P1AA 3D7TB 2HK5A 1UKIA 2W5BA 3A62A 1FINA 4EH3A 4C33A 3FPMA 4K8AA 4ASZA 2B9FA 3CTQA 2OW3A 2BVAA 4FV3A 4Q2AA 5I9WA 2Z7LA 3A61A 2RFSA 4RIWB 4DCEA 5CT7A 5CY3A 1LEZA 3WYYA 3BWJA 3VS5A 5CF5A 1KE6A 1XBBA 2H34A 2VO3A 5CT0A 2YERA 3R8VA 3ET7A 5F20A 1AD5A 1LP4A 4WKQA 4XRJA 4ACCA 4IAIA 2PY3A 4RMZA 3PJ1A 4O0UA 3E3BX 4AOTA 3JYAA 3VBXA 4U42A 3IOKA 5FEEA 1W8CA 3NCGA 2GHMA 3KRLA 3U6HA 2QLQA 1K2PA 3RCDA 5A4CA 3TKUA 3DK3A 4DYMA 3TDVA 5AP1A 4W4XA 4N57A 4DTAA 3A60A 5AR4A 5CSXA 2XA4A 4FOBA 2CGXA 2X4ZA 3Q52A 4FTKA 4CZTA 4DE4A 3LCKA 4NSTA 5GNKA 3QRUA 5JFVA 2P2IA 5BUJA 4I94A 4FT5A 4IVCA 4RC3A 5EDPA 3ZEPA 2YZLA 4USDA 5IQFA 4FNXA 4PPBA 3FKOA 3DXQA 4B0GA 4YO4A 5ANDA 2C3LA 1K9AA 5CI7A 1OECA 2VUWA 4YJUA 5CZIA 4F64A 3KXHA 3GQLA 3PWDA 4X0MA 1CDKA 3EN6A 3FQEA 5BYZA 1PXJA 3RGFA 3PRFA 3U4WA 3AG9A 3IS5A 3TTIA 5AUZA 2BAJA 4WHZA 5KZ0A 2QR8A 3NW7A 4IH8A 4YTCA 4ZZOA 2C0TA 2WOTA 3HMIA 2OSCA 4F0FA 1PYXA 5EDRA 3VUIA 2C30A 4WSQA 2J5FA 3F6XA 4CKRA 4AGUA 1WVXA 3PPJA 2BRNA 3HDMA 3L8VA 4S33A 4LFIA 5FXSA 4Y83A 3ZM4A 4AACA 4F09A 1J1CA 1BI7A 2RF9A 1XHAA 4AE9A 3RP9A 3QZFA 4ZSJA 5M07A 3OWLA 4LOPA 1SVEA 3UC3A 1IASA 2OI4X 4EI4A 1Q8WA 3OC1A 3ZTXA 1NXKA 4ORKA 2QOHA 4UB7A 2UW0A 3H9RA 4Y95A 3F5PA 1SZMA 4X2KA 2PTKA 2X7OA 3MSSA 5ETIA 1STCE 4USFA 4DEHA 4IFGA 1NA7A 3BELA 4FV7A 4L9IA 5AA8A 5IUGA 3O7LB 3QTWA 4QP3A 3WZJA 3KK9A 3BCEA 5AUTA 4O81A 4JDJA 3MY5A 3F9NA 4CV8A 4YZMA 3COMA 3V3VA 4C58A 2ZJWA 5E7RA 2JGZA 3BHYA 3BQCA 3ZC6A 3GP0A 4EWQA 5H8EA
chains in the Genus database with same CATH superfamily
2YDKA 3BV3A 1PRYA 3JR1A 3E7VA 4BCPA 4DFYA 4GT5A 3FQSA 1VZOA 4I23A 1GIJA 3LFDA 5FLFA 1ND4A 3ALNA 4CMOA 2PE2A 3AT2A 4BI2A 2X6DA 3PRIA 2WMVA 2E9NA 2BMCA 2ITWA 5KMLA 2XALA 3NGAA 2ETMA 2F4JA 5FBNC 5LMKA 3NS9A 4FSYA 2C5VA 3O96A 2JAMA 4O38A 3UQCA 2CJMA 2WMTA 4GYGA 3QD2B 5CSHA 4D5KA 3BBWA 5K4IA 5HNGA 4IACA 3ZDUA 3VONA 4MHAA 3RPOA 3R30A 3NAXA 4QMQA 4YSMA 4FV9A 1A06A 4G3EA 3KREA 3LFAA 4I6FA 3SRVA 4IZ5A 2PL0A 3B8RA 1Q24A 1YOMA 2CGWA 3GU5A 4J97A 4E4LA 4RVLA 3UP2A 2O3PA 1WFCA 4EWHA 4EH9A 3IW8A 3MIYA 3RJCA 3QHRA 4FKUA 4PV0A 3GU6A 3CPCA 3GNIB 3ZEWA 1GOLA 4APCA 4O96A 3MVHA 5A4QA 2R3FA 4O86A 4RG0A 2JDOA 3QWJA 2HW7A 3RAHA 4QMPA 4FKWA 4ITHA 4O2ZA 4PRJA 5DFPA 4O7WA 1J3HA 3HMPA 1OBGA 2R3IA 5C8NA 5IPJA 4YC8A 4O7YA 3KA0A 3MPMA 4IFCA 4LUDA 2WOUA 2XK3A 3HZTA 5M53A 3OT8A 3OWKA 3ORKA 1FVTA 4O4FA 3UG1A 4EJNA 4MD7E 5KE0A 4YTIA 3MYGA 4YPDA 3BU5A 2UZBA 4NM0A 2R3GA 3FLYA 4HGEA 5DBXA 1H25A 2WIHA 4CFUA 5EM8A 5DA3A 3RAKA 5KMKA 2BFYA 1UU3A 3F69A 3I7CA 2ITTA 5HVKA 4GT3A 5BUIA 2V55A 3QUDA 1XH7A 4YZNA 3E93A 4AT3A 2VWYA 4F1OA 3ORPA 5CQWA 1YHSA 3BV2A 3QX2A 5E1SA 3A99A 4P7EA 1BL6A 4BL1A 4L3LA 3EKNA 3IDBA 4P5QA 3D4QA 4FG9A 3TI1A 4ACMA 4EH7A 3ZS5A 3TUDA 4ZSGA 3FMLA 2UZTA 3FZTA 5IA0A 4L45A 4CD0A 2PULA 5KUPA 2IF8A 3DBFA 4G5JA 4FV1A 3K3JA 3VUGA 4L6QA 4U41A 4N6ZA 4UMRA 2VGPA 3RHXA 3D94A 4QP6A 4IW0A 2X9FA 3FLWA 3R7OA 5C01A 3A7GA 2QVSE 3POZA 3KN5A 4JAJA 4L53A 4R7HA 3RNIA 3RPRA 1HCKA 2R5TA 4AZSA 3AD5A 5CAVA 2XKEA 4CKJA 2WTVA 5BX0A 5DHJA 3R8LA 4EH5A 1OL5A 4N0SA 2PVYA 3FZ1A 3RI1A 2VZ6A 3AGMA 1Y6AA 4OTRA 4GFOA 5HICA 1A48A 3LCOA 3JY0A 3MB6A 3RWQA 3POOA 5ANIA 5HHWA 4BZNA 3G9NA 5AR3A 4F9YA 2BUJA 1PXMA 2Z8CA 4QQCA 3THBA 3ZLWA 2BFXA 4M7IA 4D2PA 1WBVA 5EQEA 1Y57A 3D2IA 3OS3A 4C37A 1PKDA 1VYZA 2OXXA 2ZV9A 4G3DA 5E8VA 5M55A 4GJ3A 3UQGA 2WTJA 5IH4A 2WB8A 4RA5A 3SDJA 3EH9A 3UVQA 5A54A 2WAJA 4GH2A 3QA8A 1J7UA 5EQYA 4PPCA 3EQCA 4U40A 4GK3A 4BHZA 4I5CA 3W0MA 3ZHPC 2B53A 5CU2A 4I4EA 5E8SA 2W0JA 1TZDA 4GFMA 4JS8A 4RVMA 4YZ9A 1G8SA 1M7NA 5A4EA 2XM8A 4I3ZA 4K1BA 3TCPA 1R3CA 4EZ7A 3GCVA 1OBDA 2OKRA 4CLJA 2IZRA 4I5MA 3TJCA 3ZBXA 2R7BA 3CEKA 3G51A 3UYTA 4FTAA 3NCZA 3WYXA 4YPSA 1KWPA 5FRIA 3OZ6A 4IZAA 3Q4CA 3R2YA 3U6JA 1OL1A 2XBJA 1OL7A 3F7ZA 3R9NA 3UIMA 5JFWA 3COIA 4QRCA 4RWKA 3D14A 1E9HA 3R1YA 5A4TA 3S2PA 3TWJA 4QNAA 4IWPA 3NFGB 1PYEA 4A9YA 1IEPA 4AFJA 2P0CA 3RKBA 3CQUA 4OTPA 1O9UA 4FX3A 2PUNA 5CLPA 2BROA 4DTBA 3SX9A 1I44A 4AS0A 4CVAA 4PNIA 4ZSLA 4BZOA 4FV5A 5JH6A 4D2VA 1BX6A 4FSZA 4O2PA 4BDFA 2VTAA 5AWMA 2UVYA 1QL6A 2Y8OA 3O50A 4H3QA 3OCSA 3QA0A 2IG7A 3VUTA 4TYHB 3B2TA 3QXPA 5HCXA 2ZAZA 4PWNA 4QQ5A 3R1QA 4M66A 5IEVA 1URCA 2JBOA 4IM2A 1YVJA 1ZYJA 2XYNA 4AT4A 2JFMA 2VTPA 4O21A 4RWLA 2OJJA 1J1BA 3DKOA 5DH3A 2GMXA 4FZ7A 3HV7A 4NH1A 4YLKA 2W9ZB 5HI2A 2SRCA 3UNZA 3TUBA 2I0YA 4K2RA 4HVDA 3PE2A 1F5QA 5AUWA 3WOWA 5CSVA 3NEWA 3GCQA 5FBOA 5HG8A 2ZB1A 2Y4PA 2VTOA 2BKKA 3EQFA 1H01A 4I22A 3QUPA 4CFFA 4FTJA 3NUNA 3PUPA 3D5VA 5EYDA 4ZJJA 3LE6A 4EK5A 2PVKA 2WQMA 3MH2A 3UDZA 3C9WA 2ITYA 4BC6A 5FM2A 4RZWA 5FG8A 1OPJA 5TKDA 4U8ZA 3FZRA 4O4EA 4BGGA 4YMJA 2BALA 3HA6A 3I5ZA 5E90A 4BCJA 2XNNA 4IX5A 4WOVA 5I9ZA 2OBJA 4FZFB 3Q9XA 1VLRA 1GAGA 3ANQA 4D2SA 4BKJA 4M69B 3WZKA 5CI6A 4F1TA 2JEDA 3FQHA 4J7BA 2WMXA 4C4HA 3ZM9A 3SW7A 3I60A 4QDVA 2VTNA 3N51A 4PMSA 4S30A 3FPQA 3MBLA 5IMXA 1YQJA 1S9IA 3KF7A 4IJ9A 4CRSA 4DHFA 4EQMA 4DHIB 4K9YA 5EH0A 4E26A 2I6LA 2YCSA 1ZWSA 4CSVA 2C6OA 3KF4A 2YM7A 2NRUA 4EK8A 4F4PA 2XNEA 3D0EA 4BJJA 3PVGA 2YCRA 4KS7A 4XP0A 3V8SA 4DLIA 5JT2A 4LV7A 2XYUA 4YU2A 2G15A 3I1AA 5E92A 3O17A 3C0HA 4BBFA 2EXEA 4RQVA 3UDBA 3AT3A 3QZGA 1PXKA 4NJ3A 3ACKA 2BIYA 3DA6A 2R9SA 2VTSA 2OFUA 3PSDA 4BN1A 3RMFA 3FC1X 2CN5A 2GQSA 3EIDA 3W0NA 4X3FB 1OM1A 3VS0A 1PJKA 2PPQA 2WTWA 1OGUA 4OBQA 4XLIA 2QHMA 2B1PA 2X7FA 2VTLA 3WILA 4QMUA 3UNJA 1Q8ZA 3BLAA 5HTIA 3LXNA 3D9VA 3K5UA 4J96A 3UZTA 2Q0BA 4PPAA 3DFAA 3ZXZA 4C34A 5IQCA 3EFJA 4UALA 2OXYA 3O8UA 3ZSGA 3FV8A 5C1QB 5AAEA 5DT0A 4DF3A 5DWRA 1WBSA 4H39A 1O6LA 4I0RA 2REIA 5HU9A 1YI6A 3EN9A 4JRNA 3DAEA 4IVAA 2C47A 4MXXA 4QT1A 4EKKA 3P23A 2GNHA 2HELA 4XP2A 4DGGA 3LJ0A 5CXZA 4HNIA 4DFNA 5JZJA 3IOPA 4O7TA 1OI9A 1RDQE 3FMKA 4LL0A 4DEGA 4IDVA 1XH8A 3COKA 5HVYA 4AU8A 2OIDA 1H07A 2W5AA 1E1XA 2ZYBA 3DAJA 4I1ZA 4BTFA 3TKHA 2BTSA 4WNPA 3ZXTA 5HIEA 3G5DA 4XV9A 3DK6A 4X3JA 5AIRA 3BEGA 3NNWA 3DXPA 5B2KA 1M17A 3FYKX 4BWKA 2O0UA 4BIDA 4C57A 1OL6A 1GNGA 4G9RA 3RINA 4QP4A 1ST4A 5I3RA 4FNZA 2WXVA 5DGZA 4E4NA 3LAUA 3DKGA 1UNHA 5CEMA 4GEOA 4HPTE 5IQGA 2WTDA 4J8NA 3W0RA 3VQUA 2VX1A 5CF4A 3QRJA 5GZ8A 4OTFA 3QFVA 2ACXA 4HYSA 3R04A 3V5QA 4S32A 2WHBA 5L6PA 5BVEA 3C5IA 5J8IA 4QYGA 1BI8A 3GCPA 5CQUA 2PVNA 5JSMA 2RIOA 4NEUA 4DGMA 1BUHA 2IN6A 1H24A 4MBJA 4RZVA 2PZ5A 3NSZA 3BE2A 3BYOA 1O6YA 2ERZE 3DOGA 2R0IA 2YWPA 1CTPE 5IZFA 3TJDA 2KULA 3QGYA 4TYEA 4JX3A 4G3GA 3QAME 4EC8A 4QDEA 3U54A 2QU5A 5EYKA 4HYIA 1FPUA 4WG3A 4ZTLA 2YLFA 4IVDA 3NYXA 4AE6A 3CQWA 2W96B 3EQHA 3GI3A 3RK7A 2BAQA 4EORA 1WAKA 4MWHA 5E8YA 3BWFA 2XAMA 4E8AA 2WTIA 3VBWA 3RM6A 3Q96A 3SG8A 4KBCA 2BRHA 2XRUA 4DTKA 4EC9A 2HWPA 5KX8A 1OB3A 3MFRA 3KN6A 4KA3A 3OFMA 3C4ZA 4KBAA 4XCUA 3W1FA 5GINE 4JIAA 2YM3A 5CASA 5I9UA 5TT7A 4C02A 4DT9A 2XM9A 3VUHA 3UPXA 5KCVA 4TWCA 1OGYA 5D10A 2A1AB 3BLRA 3W8QA 2J0JA 4EEVA 3BHHA 4XBRA 4GKIA 2F2UA 4ASDA 1XKKA 2C3IB 4QTAA 3DTWA 2JKMA 4MNEB 4XG9A 4I6BA 4YJVA 3LM5A 5KHWA 3D5UA 2GHGA 4ANQA 4Y85A 1KOBA 3D7TA 3Q2MA 4AN3A 5LOHA 2IVTA 3MH0A 1KUTA 3NWWA 5HX6A 4MXOA 4RJ6A 3PDTA 2XF0A 2VTTA 4RIWA 4YHTA 2XK7A 5EM5A 4AA0A 4LGDA 4TYJA 4XG8A 4DDGA 1M52A 4IX4A 2HW6A 3FMMA 5J9ZA 3NVMB 2PVMA 4FEXA 3BKBA 2ZB0A 3NR9A 3ORMA 5EM6A 4IZYA 2VX0A 3QUEA 4Y5QA 3BGPA 4FTIA 3TACA 2IPXA 3CC6A 2OH4A 3GOKA 4D2WA 1YXUA 4JDKA 4FKSA 3SQQA 5J79A 3UO4A 5K9IA 3GU8A 4QQJA 4AFEA 3AC3A 3HRCA 3PZEA 4BTKA 4L3JA 4L52A 4F7NA 2ZM4A 4R8QA 3Q4UA 3QD4A 4ITJA 4FTCA 3M42A 3UIBA 4W8EA 4DT8A 4BIBA 3NZ0A 4FT0A 5AR5A 4CRLA 2YIYA 4X6QC 4FEQA 3BZ3A 4ZEGA 2XK4A 2GNJA 4ZTRA 1NVSA 3IKAA 4OTQA 4DEEA 2A4LA 3QRIA 5CNNA 5CU6A 4CT2A 1GZ8A 4C0TA 5CEQA 4TYIA 3I0QA 4Z7GA 1UA2A 4FRFA 4N70A 5I9XA 3PXQA 1JNKA 4XOZA 3R7YA 4S2ZA 1CKPA 1QMZA 4JBOA 4E6QA 3R01A 2GNFA 1JSTA 4JDHA 3VJOA 3EFKA 3VIDA 2AEGA 1V0PA 2GPHA 4TNBA 4ZJIA 2AUHA 3WF6A 2W1IA 4EH8A 4U45A 1J7IA 1JBPE 3VVHA 3ZFYA 5FEDA 4NIFB 3ZSHA 1B39A 1GZKA 3HGKA 3AC4A 2ZDUA 3QU0A 5AP4A 1OPLA 2JKKA 2PZYA 3AMBA 3EQGA 3QQLA 4FT3A 3E8DA 3A4PA 4Z9LA 3PLSA 4ZK5A 3AMYA 3MI9A 5LVOA 2QOFA 4NFNA 4FSMA 4TTHB 4CEGA 3FMNA 4NL0A 1RQQA 3JY9A 4HYHA 1PXPA 3UJGA 3UZPA 5EDQA 2BRBA 2UW4A 3L9PA 4FMQA 5IA5A 3R00A 4CQGA 3OXIA 3NYOA 4U5JA 5K4JA 2P4IA 4FTMA 4DN5A 2G1TA 3ORXA 1JKTA 3BHTA 3HV6A 5J87A 1KE8A 3KY2A 2XEZA 4KIQA 4A07A 4WT6A 4XH6A 2B7AA 2VTMA 4RA4A 3UOKA 3GVUA 4BDKA 4EOJA 4E1ZA 4ZY5A 5GZ9A 4NWMA 1ZY4A 3GFEA 5AM7A 5D1JA 4NJDA 4D0WA 4DFXE 2G2IA 5EI6A 3W32A 4WIHA 3AD4A 3WI6A 3WF8A 5BVFA 2X4FA 2G2HA 4BKZA 3I5NA 4R77A 4B8LA 1OVEA 3OEFX 1IAJA 3R7UA 2E9VA 1SMHA 3HUBA 3KRXA 3R9RA 1Y8YA 4X6RA 3W2OA 4ACGA 1SNXA 2WZJA 2XNMA 4F6UA 4C7TA 4G5PA 3HKOA 1YXSA 2WU6A 2YLEA 3R73A 4XG3A 5AX9A 4OTIA 3R9DA 4HGTA 1H08A 2VWZA 1P5EA 1H28A 2O65A 2XNPA 3BL7A 4GL9A 4E3CA 2JITA 4G3CA 4O84A 4GG7A 5E8UA 1W98A 5C9CA 3P9JA 2CMWA 4BGQA 2R4BA 3RAWA 4CFXA 4DFZE 4E5AX 3ALOA 2PYWA 4EONA 2F7EE 4YJNA 4C4EA 3P78A 4ZMEA 3OG7A 5LVMA 3NX8A 4K0YA 5DLSA 3QQKA 3FC2A 4GIIA 4K18A 4ACDA 2QURA 3RZFA 3UDTA 4DH3A 1OPKA 4XG4A 1ZXEA 2JIUA 2YM6A 4Z3VA 4XNEA 3AC5A 3OBJA 4ALVA 4FZDB 2QODA 4FSQA 2ITPA 4QP9A 3LLTA 4ENYA 5DEWA 4FI1A 3L9LA 3TKIA 3V8TA 1U5RA 4QTEA 3LQ3A 2JC6A 4U97A 5F1ZA 4L44A 3SXRA 3H9OA 3VF8A 2YJSA 2C3JA 3T9IA 4AN2A 1Q5KA 4R6VA 4JDIA 5JMSA 2R7IA 4ZY4A 3QQUA 4MYGA 4EL9A 2ZM3A 1OKYA 3OOGA 4EOMA 4QTDA 5J95A 2R3HA 4F7SA 3DAKA 5I4NA 5F4NA 1YDSE 2WQNA 2GFSA 4AWIA 1JKKA 2VTQA 4XS2A 5CAOA 5CEOA 4O7LA 2QKRA 5CEPA 1GY3A 3QCXA 1BLXA 3C0IA 4BIEA 2Z7SA 3QC9A 5A4LA 4FYNA 4CCBA 1JVPP 2PMLX 2ZV7A 4YBKA 2WO6A 3CXWA 4U3YA 4F0IA 3D7ZA 4FL2A 4JNWA 2PK9A 4XEYA 4WO5A 3ZONA 3CLYA 4YZDA 5H8BA 4DINA 4BCGA 1G8JA 4LV5A 2XIKA 2GQGA 3TT0A 4CCUA 4RRVA 5HCYA 5K5XA 3OF0A 4XV2A 3F5UA 3QC4A 1W82A 4PTCA 4EZ3A 5ANEA 1OITA 4QTBA 4YP8A 5AJQA 1UV5A 4Y5HA 5CU4A 4FT7A 4DHZA 3VBYA 5BYLA 2VWWA 5DI1A 4FL1A 4RJ3A 3OW4A 4AAAA 3D5XA 3WIGA 5FXRA 4WNMA 3CQEA 1XJDA 3UC4A 1H00A 3H10A 4BYJA 2PUUA 1LEWA 3A8XA 4QPSA 3SC1A 3DB8A 3DNEA 3FLZA 4FNYA 3PVUA 3KULB 2QCSA 4FSUA 4LRJA 5EYMA 5IKWA 5JFXA 1OUYA 5LVLA 3TEIA 2NO3A 2XARA 3ORIA 3KC3A 3R1SA 4O7NA 4GJ2A 3RHKA 3SD0A 1YOLA 2VV9A 2XKDA 2GNGA 2OH0E 4FSWA 4RIXB 5CVFA 5K5NA 5LMBA 4ZS0A 3DKCA 5CZHA 5F95A 2YJRA 3C4FA 3HV4A 4TPTA 2BDWA 5L2TA 3Q9WA 1M2RA 4I41A 5D9HA 2UW9A 5AV1A 2UZOA 4DH7A 3FI4A 5C8KA 2Z60A 1Q97A 4AXDA 3FKLA 3FWQA 3SXSA 2Y9QA 3KB7A 2X6EA 1ZOEA 3FUPA 4YTFA 3MA3A 4QQTA 3LLAA 3QD0A 4HJOA 4NUSA 2R0UA 4FZAB 3ZOSA 1UKHA 2EWAA 4FIFA 5EG3A 4J52A 5BQ0A 5EW3A 2R3PA 3W0SA 3TNIA 1ZYCA 3DY7A 2P3GX 3LFCA 4G31A 2C0OA 4U3ZA 4RX9A 4E73A 3E7OA 3MS9A 3BX5A 3KVXA 1SM2A 3O2MA 4FEUA 4FTNA 3IO7A 2YM5A 3T9TA 4FZ6A 1OZ1A 5EHOA 3FZOA 3D5WA 4JXFA 2GFCA 2I0VA 3P08A 4XYFA 3PG3A 2XIRA 4CMTA 1IG1A 4DCAA 1QPDA 2XIZA 4UWBA 5K3YA 1G5SA 1KE5A 1Z9XA 2BRGA 2RG5A 3NFFB 2FH9A 4EUUA 5I3OA 3GEQA 3V01A 2W7XA 2CKPA 3PXFA 1Q61A 4YGAA 4BKYA 4AXEA 2B9IA 3FMDA 2B54A 5HBJA 4I20A 3W8LA 4ZS4A 4UYAA 5BPYA 5DRBA 3R7GA 5DEYA 4BVUA 4YO6A 2ITNA 3S4QA 3OBGA 3BQRA 1YOJA 2RKUA 4O83A 4AXFA 2WQEA 2DS1A 3FL4A 3N4VA 3F2NA 1DS5A 4B9DA 3G33A 3EQRA 4RX8A 2I1MA 4YSJA 2PVJA 2F7XE 3F2AA 3I79A 3TN8A 5K0XA 2W17A 1GZOA 2PUPA 3Q5IA 4KB8A 4MXZA 4TYHA 5HE3A 2R2PA 2YAKA 1G8AA 4EOSA 4O0YA 4IWQA 2C6LA 4O6EA 1ZARA 4YNOA 4G17A 4O0RA 2QOCA 3CGOA 2EB2A 2IWIA 4JI9A 3NNUA 3JVSA 2AYPA 4UXQA 5IG1A 3PLAE 2CSNA 4FV0A 2C0IA 3FI3A 4BBEA 5GJFA 5JQ8A 3RWPA 4A4OA 1PXOA 3DGKA 1TQMA 5CAPA 5FWKK 4GYIA 1H1SA 3TZMA 5J9LA 4EOIA 3QLFA 3TNQB 3GXLA 2GNLA 2QG7A 5DR6A 1TQIA 3OMVA 4AN9A 1KSWA 3F3VA 5JRSA 4FKVA 2UW5A 4WSYA 3E8CA 2QG5A 1PF8A 3C5UA 4MD8E 2DYLA 3QZHA 4YJRA 4MEDA 5B2MA 4CYIA 2C5YA 4MQ2A 4MBIA 3EB0A 2WGJA 1L8TA 3ZO2A 3DDPA 4BCOA 5M51A 3CTHA 3TV4A 4M0YA 3H9FA 2WQOA 4UMPA 4IX6A 1LR4A 3HUCA 3C4EA 2CDZA 5IA2A 3R28A 4IB0A 4RJ7A 2X9EA 3KIOC 1F0QA 4D2RA 3K54A 4EYJA 3NW5A 4KAOA 3CGFA 3BGZA 4WD5A 4M69A 3ZH8A 2QOBA 5A46A 3O51A 5ITAA 1FBNA 3Q4TA 3U9CA 2IZUA 3BYMA 2P2HA 4JRVA 4E7WA 3CY3A 5HBEA 5GJGA 4FKQA 5ACBC 4F08A 4RT7A 3OTVA 4DEBA 1T46A 3UOLA 4I6LA 4FTOA 2Y7JA 5DR9A 3VO3A 4C3RA 5L4QA 2OXDA 2B55A 2Y4IB 2ZVAA 3R02A 4TYGA 3AXWA 3F5XA 5E8TA 4MF1A 4H1MA 1RE8A 1MRUA 3RAIA 2Z2WA 3VBTA 4J53A 3R8MA 2V22A 2WFYA 2HOGA 3KXGA 3GGFA 1M2PA 3EWHA 3VULA 1ZAOA 2GHLA 2C6KA 2V62A 3D15A 2W4OA 3LW0A 4QMVA 3DTCA 3QF9A 5DRDA 3U87A 3RBWA 4FEVA 2IW6A 4M15A 4PDPA 5C8MA 3VS6A 2PVFA 5KMMA 3E64A 3RPSA 4OBOA 3FLQA 2QO9A 3ZU7A 4X3FA 4F63A 3VQHA 3HRFA 2YM8A 1UWJA 4FE2A 3MJ2A 5IUIA 2OO8X 2XNBA 1H27A 2IO6A 4BHNA 4MXCA 5DNRA 3PA4A 3UYSA 3G0FA 3HAVA 3A4OX 2W1ZA 3DXNA 3PSBA 3QYZA 3OTUA 4UEUA 2YDIA 4H1JA 4PP9A 2XMYA 2ZMCA 2V5QA 3MPAA 1M7QA 2EXCX 3VUKA 4PQNA 1M14A 3TIZA 4BRXA 3EN4A 5LCJA 1IA8A 3W2RA 4FIGA 4FSTA 4IX3A 3MH3A 4FV4A 2VWXA 3QKMA 3KCKA 3HNGA 4FUXA 4E6AA 3KRRA 3H0ZA 4HPUE 3MGYA 1UWHA 4HCVA 5HIBA 4RX5A 4BDJA 1Q62A 2EB3A 2YAAA 4F0GA 2W5HA 5E1EA 4TZRA 4JR3A 3ZUVA 4NK9A 1H26A 4CFWA 2BDFA 2R3KA 4IAFA 1Q3WA 1Q99A 3H4JA 3FXXA 3LXPA 4XHKB 5LVNA 2OJ9A 3NUYA 4HCTA 4HZRA 1U54B 3N9XA 4FIIA 4A06A 5B0XA 5HO7A 3R1NA 3PXYA 2YA9A 2HAKA 2XUUA 4D55A 4BDBA 2W1EA 2FSTX 3MTFA 4MH7A 3P79A 3AC8A 5EI8A 3SKCA 2ZOQA 4BDAA 2NYAA 1XH6A 2YIQA 3B2WA 1E1VA 4MK0A 5J5TA 3ZFMA 4XJ0A 2W9FB 3RALA 2EVAA 1OIUA 3PY1A 2UW6A 4CMUA 2QOIA 3EYGA 3SXFA 2FVDA 2HCKA 2OZOA 5F94A 2RL5A 3QQJA 4MXYA 4FIJA 5F9EA 4KSPA 3KRWA 2WEVA 5J9YA 2OJIA 3CPBA 3EN5A 3MWUA 4U80A 5DT3A 5CEIA 4RPVA 4FV6A 4JAIA 3EZVA 2Q83A 5IDNA 4R5YA 3LMIA 4OAUC 3BL9A 3AD6A 4BF2A 3HVCA 3PXZA 4R5SA 1LUFA 3DJ5A 2B4SB 4M67A 1R78A 4OTHA 3HYHA 1JWHA 2H9VA 4NTTA 5HESA 4D4SA 4DH5A 1GJOA 3UOJA 4XG6A 4HCUA 5TR6A 3CJGA 1YI3A 2X2LA 5FTGA 4RBLA 3ORLA 4PDOA 2WKMA 3DZOA 4MKCA 3FJQE 3FSFA 4NM7A 4KWPA 2PU8A 4GUEA 1CMKE 3IW5A 4DH8A 5HBHA 4AF3A 4FL3A 4IAKA 5AP3A 3WARA 1DAWA 2ITOA 4I5PA 3UIUA 4DG3E 4G9CA 2RG6A 3ETAA 4EZ5A 5IH5A 2C68A 4V01A 1YKRA 3R8PA 2W4JA 3EOCA 1SNUA 5M09A 3PVWA 3MFUA 4PX6A 5CS6A 1AGWA 3SAYA 1Q8YA 3AGLA 2F9GA 1OUKA 2XZSA 3MTLA 3OUNB 5IQDA 3C4XA 4II5A 4XX9A 3PA5A 3G15A 1W0XC 5FP6A 4ONAA 4CG9A 3AC2A 3UE4A 4YJTA 3ZSIA 5DYJA 2F49A 2J9MA 1U59A 4OLIA 2Q0NA 3VWAA 5CF6A 1UU8A 4UMUA 3ROYA 3TV6A 1PXIA 2W1HA 5JFSA 3F61A 3ZMMA 4CTBA 4ANBA 4MNEA 5AADA 3R8UA 4BWPA 4HW7A 5HX8A 5KBQA 2Y6OA 4L7FA 4FTRA 4BCQA 5E9EA 4QD6A 5AAFA 4D1XA 1BYGA 1SYKA 3ID6C 3CD3A 3O8TA 2C1AA 4FKRA 3TNPC 4EHGA 3HP5A 4XG2A 2OIBA 4FKIA 3C1XA 3EMGA 1G8KA 4J8MA 2I7QA 3IW7A 4DG0E 4AAYA 3DCVA 5HZNA 3EQBA 4HYUA 1KV1A 1MQBA 1VEBA 5ACKA 4ZTMA 1WBOA 2X81A 3EL8A 2C69A 4HZSA 4IHPA 4X2NA 3UVPA 5G6VA 2P55A 4MBLA 2IW8A 2UVXA 4CYJA 1UNLA 2EU9A 3ENHA 2QI8A 5EW9A 4AW1A 2R3QA 1TFFA 2WNTA 2PWLA 5EQPA 2ESMA 3DLSA 1ZYLA 3EQPA 4KABA 3OCTA 4YJQA 4OW8A 4LI5A 5HTCA 3PJ3A 4QPMA 2CNUA 3F2RA 3GOPA 3JS2A 2RFDA 2GQRA 4LGGA 3E8EA 3BLQA 3AT4A 1H1RA 2C6EA 3DQXA 2CGVA 3ODZX 4ANOA 5T3QA 1HCLA 5LQFA 4JJRA 5FDXA 3WZEA 3NUSA 4X2FA 5BVWA 4U79A 2XJ2A 3ACJA 2EXMA 2CKEA 4FG8A 4N4SA 4F70A 3QXOA 5L8LA 3U8WA 2WPAA 3BBTB 2XBAA 4I5HA 4OT6A 3I6WA 4IAYA 2BZJA 5FTOA 1OL2A 1UVRA 1VR2A 3GC8A 1ZMWA 4QYFA 4F9BA 3FMHA 1ST0A 1XBAA 2B9HA 3CBLA 1P4FA 3O0GA 3QHWA 2WIPA 2NP8A 4QOXA 3ZRKA 4FKTA 5GIPE 4TWPA 3W2PA 4NIFA 2NPQA 4GU6A 4XOYA 2JDRA 2NNWB 2HZIA 2LAVA 4F1MA 3LXLA 3FDNA 3K2LA 5M4FA 4PMMA 5B7VA 4G6LA 4LRKA 1R39A 3O8PA 3SGCA 2J0KA 2J0MB 2YACA 3I0OA 2RSVA 1FOTA 2QKWB 3ULZA 4EJ7A 2UZEA 4ZXTA 3DT1A 3GQIA 4M13A 2R3RA 3DBDA 1J91A 3DKFA 4DGNA 2V0DA 2JIVA 2B52A 4BBMA 2ZMDA 4YC3A 2OLCA 2OGVA 4IWDA 2JAVA 3WBLA