5ACKA

Human pdk1 kinase domain in complex with allosteric compound 7 bound to the pif-pocket
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
287
structure length
286
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Discovery of a Potent Allosteric Kinase Modulator by Combining Computational and Synthetic Methods.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ackA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ackA01
3PJ1A 1OB3A 3WF9A 5KKRB 3ZONA 3E63A 3C1XA 1PXMA 3SRVB 4E4LA 4AT3A 4KKHA 4OTHA 4LMUA 4P5QA 4B99A 1JSVA 2NP8A 2BR1A 2W1DA 3VS0A 5H8GA 4BTKA 4KS8A 2X8IA 3VS2A 4FZAB 1XJDA 4DFXE 2B9JA 3B8QA 5ICPA 3I60A 4M66A 4GH2A 5AP5A 3ATSA 2Y7JA 5CSVA 2J6MA 2QD9A 4AA5A 3QLFA 3KVWA 4IIRA 4A9RA 4BFMA 4D0WA 3DQWA 5H3QA 3ZUVA 5HLNA 1J7IA 4FV0A 3PSCA 5E1SA 5DRDA 4O7SA 4O81A 4I6FA 4AGDA 2WTCA 5G6VA 2CGVA 4BDHA 1PKGA 3NCGA 3RTPA 1HOWA 2QCSA 3K5UA 4E1ZA 1ZYJA 1B39A 3QUEA 4ZP5A 2PPQA 2F4JA 2BZIB 4H1JA 3U6JA 2RSVA 4M97A 2OU7A 1G3NA 2QO7A 2HAKA 4QYGA 2WU6A 3UBDA 3RJCA 3UPZA 4ANLA 3T3UA 4CKRA 5IISA 5KMJA 4ZLOA 3UQFA 5M57A 2X0GA 4U41A 4O82A 1CKJA 2AC5A 3BGZA 4YSJA 4EQCA 5HU9A 3TNQB 4ZTRA 3ZLWA 2ZM4A 4BIBA 3QHWA 2CNUA 3O8PA 2IVVA 1ZY5A 2UW6A 1Q8YA 5JFVA 2P2HA 4MWIA 1MRUA 1Z9XA 4EH8A 3NR9A 4CZYB 3LFCA 4G34A 3BEGA 2JIVA 4I4EA 4FIIA 4IB3A 3PRFA 2JEDA 3UOHA 4U45A 5DLSA 4IW0A 4DH3A 3HV3A 2A1AB 5L2SA 3RWPA 4F7JA 3QYWA 4L43A 3PLSA 4G3DA 4FYNA 3FY0A 4BDFA 3LQ5A 3E93A 1UU3A 1FVRA 4YO6A 5CYIA 5CI7A 3RBWA 5CF5A 4H3BA 4DEAA 4GJ2A 5F1ZA 3UIUA 1PKDA 1BKXA 4YC6A 1M2RA 4AOTA 3KK9A 2YWVA 3CKWA 2RG5A 2RL5A 2W5BA 4X6RA 3Q4TA 1JKTA 1U59A 5L2WA 3TI1A 1E1VA 3R9HA 5CZHA 3D7TB 4L45A 1Q97A 4W4YA 4XG7A 3RALA 3GCSA 4J1RA 3TZMA 4ENXA 3SDJA 1Q8TA 5AR3A 4N57A 2PZPA 3OT8A 4WG4A 4G1WA 3UTOA 5HQ0A 4IQ6A 2O3PA 4TNDA 1FGIA 5CAUA 4XEYA 4RWKA 3ZLSA 4YBJA 4ZTSA 3VUDA 3GVUA 4FI1A 1XBCA 4WT6A 4WIHA 5DI1A 4OTDA 3HYHA 1W83A 3CXWA 1M17A 3LFBA 5CQUA 3HMMA 2YM4A 4C59A 3GCUA 4Z7HA 3A7FA 2E9PA 4CG9A 3PVBA 4TWNA 4UMUA 4YJTA 4EQUA 3NNUA 3EFWA 2Y4PA 4FSUA 4L46A 3AGLA 3DLSA 4RJ4A 5AP1A 2HXQA 2W99B 4V01A 3JPVA 1QPJA 3HKOA 1KUTA 4IAKA 4IX5A 1ERKA 2C6EA 3R8VA 1PY5A 5AFVA 1H4LA 2BAQA 2GDOA 2I6LA 3HA8A 3LFAA 4YU2A 2OFUA 4C0TA 3LFEA 3OC1A 5D9HA 5M51A 4P2KA 2NO3A 4Y8DA 1TVOA 2ITPA 2QC6A 4FEQA 1LUFA 2JC6A 5DE2A 3V5TA 2VN9A 4IB0A 1URCA 4RIWB 5HX8A 4FEUA 1XBBA 2HCKA 2OXYA 2XS0A 4ID7A 1KE9A 3GBZA 3RWQA 2IPXA 5I9ZA 1CMKE 4JDKA 2CCIA 2O5KA 4BKYA 4MD9E 4AE6A 4NFMA 4FNWA 3T9TA 2IG7A 3QQUA 5KUPA 1YXVA 4B0GA 4DEBA 2R7BA 2X7FA 3D5XA 5JSMA 2H9VA 3ANQA 3QLGA 3FZRA 4QPSA 3HV4A 4YZ9A 2QOOA 3PVUA 2PVMA 5F95A 4ACGA 5J5TA 1JKKA 2B53A 1QPCA 2QO9A 4E5WA 5BYYA 3HMPA 4J8NA 3CGOA 4I6HA 5A4EA 2PVHA 4KB8A 5CX9A 5IA4A 4L67A 3ZYAA 4NKAA 3R7VA 2BZJA 3VRZA 4EK8A 3MFUA 3RZFA 3EZVA 3KY2A 3ORZA 2W4KA 3H9OA 4ZY5A 3W16A 4IADA 1UNGA 4N70A 1G8AA 1IG1A 1W84A 4XMOA 4BDKA 2OLCA 5I9WA 3DA6A 4UMTA 3W2SA 4BYIA 2QG5A 2E9VA 4NIFB 3OXZA 5CS6A 5JZNA 2YJRA 1ZMUA 3GU5A 4G5PA 4GKIA 3OBJA 2YN8A 4I5PA 4WBOA 3W55A 2VX3A 3AC1A 4I0TA 2WIPA 5AUVA 2I1MA 4UEUA 4N0SA 1Q61A 5ANJA 4CFXA 3U54A 4KIOA 3L9NA 4S34A 3IECA 1JKLA 4RJ6A 4AG8A 3MFSA 3OF0A 4AU8A 4QMLA 1ZY4A 4TTHB 3RNIA 4DEGA 3DAEA 4FKRA 4WUNA 4E8AA 4E3CA 1NVRA 3A8WA 3SOAA 3WIGA 4FTQA 1RQQA 4AAAA 4LGGA 3DBEA 2BAKA 3FQHA 3AC2A 3RMFA 1O9UA 2VUWA 1OI9A 2XCHA 1WBNA 4OBPA 2QLUA 2GPHA 3GENA 4U42A 1R3CA 4ITHA 2F49A 4X2FA 2IZRA 3TKIA 2OBJA 4GG7A 4I3ZA 3TWJA 2CCHA 5E8ZA 4EHZA 5CNOA 2YCSA 2BALA 3SKCA 5K3YA 4KBCA 2ITZA 2R3LA 4FTCA 4IC7A 3VW8A 2OGVA 3ORPA 3R28A 4BWXA 2QU6A 2BILB 2W9ZB 3CTQA 3PY0A 4NJ3A 4IANA 5IH4A 4GIHA 4IWDA 2J4ZA 3PG1A 3QWJA 2XJ2A 3OT3A 4F1OA 4GJ3A 1PYEA 1S9JA 1BX6A 2WMUA 3CCNA 4BB4A 4R78A 3D5WA 3Q96A 1Q41A 2Z7LA 3ZDIA 4EZ3A 3LM0A 3P08A 4YPDA 2PZYA 5CANA 3NVKI 5FG8A 3HLLA 3CQEA 2UVZA 3TNHA 5AP4A 4DTAA 5FXQA 4GUBA 4HVIA 4FZ6A 5ETFA 2XM9A 3QZGA 4PUZA 4AW5A 3WILA 3UG2A 4EOQA 1KE7A 4HW7A 2OZAB 1NVSA 4MTAA 5GJGA 3V5JA 4EH9A 4D4SA 3Q53A 4GVAA 4WNMA 3UDBA 1J91A 3E62A 4O96A 4D1XA 3RK7A 4DH1A 4D1ZA 4JBPA 2VWUA 1ZARA 3CLYA 1J3HA 4WG3A 3R8LA 3O17A 1XQZA 3DTCA 2OJGA 5DEYA 3VS7A 3OEFX 3MI9A 2ZVAA 4I5CA 4O2ZA 3O8TA 2P4IA 2Y4IC 3P7CA 2VWZA 4GFMA 3NRMA 4L44A 2GCDA 4FUYA 1ZLTA 2R3RA 1YHVA 5DIAA 3V8WA 5EQYA 2IWIA 4J71A 4F6SA 2VD5A 2VTQA 3AT4A 3PUPA 3P5KA 2R3KA 4IAYA 3ZM4A 2OXXA 2X7OA 3H0YA 3ZLYA 4D4VA 2IW6A 5C4LA 3G9LX 3BHTA 4IC8A 4IWPA 5HEZA 1DI8A 4FL1A 3VNTA 2JBPA 4FV9A 3ZCLA 4TYGA 3U87A 4GL9A 4CKJA 5EYKA 3QQHA 5LXMA 4O7TA 4QTAA 1O6LA 5BPYA 3AC5A 2O64A 3UC3A 4M14A 4RJ5A 3H4JA 1Y91A 5IG1A 2OK1A 2WAJA 3V04A 2WMXA 4LGDA 5DOSA 2X2LA 3QA0A 5CEQA 5C1QB 2WEIA 1KSWA 4GFOA 1YWVA 2XNMA 4FT5A 2C3IB 3NVMB 3HV7A 4G17A 3QZFA 1JOWB 3ZUTA 4EK4A 4WA9A 3H9FA 3F3ZA 5ITAA 1BI8A 1Q3WA 1ZMVA 3O7LD 4L7FA 5L2QA 3SXFA 3Q4ZA 1DI9A 4OTPA 5K0KA 4EWQA 4RFYA 5IQGA 4D2TA 1ZYSA 4D2PA 2R4BA 3KRRA 3MDYA 3ERKA 4CD0A 5IA1A 2KULA 2UW0A 4XX9A 3U6HA 2HW7A 5KKRC 1YXTA 3ZO3A 4C3PA 2Q0NA 4HPUE 2G01A 4R3RA 3SA0A 2IW9A 1F3MC 3S3IA 5M55A 1AQ1A 2UW3A 4ZJIA 3T3VA 3WF5A 4YNOA 3FI2A 2Q83A 4FTIA 2G2IA 2OG8A 5ANIA 4YURA 5JRQA 3AOXA 4NM5A 3GEQA 4O0YA 2B0QA 3QUDA 3QTRA 5AAGA 5T68A 4GFGA 5GJFA 2O8YA 5LWMA 2XKDA 4E6CA 4NFNA 3A7HA 3BEAA 3NNWA 2GU8A 4JDJA 4TPTA 2A4LA 4U5JA 1Q99A 2W1EA 5A46A 4D1SA 1VJYA 3VC4A 4DEIA 4C4JA 2J90A 3WI6A 4QQCA 1UWHA 2YCRA 3TN8A 1M14A 5LARA 2UZDA 2Y4IB 4AZFA 5E91A 3P78A 4Z3VA 1Q8UA 4CTBA 3ROYA 3O50A 2GQSA 3N4VA 3ENHA 1H24A 2BTRA 2YDIA 5ANOA 2IJMA 2C6MA 4AN3A 1Y57A 4BCPA 5CEPA 3WE8A 3GC8A 1SNUA 4MYGA 3TJDA 3DTWA 1UU9A 4CYIA 2GTMA 3W8QA 4GEOA 3V5QA 1O6YA 1IR3A 3C9WA 4F1MA 3DLZA 3MA3A 4CFWA 5CI6A 4APCA 4JDHA 3G6GA 2A19B 4ZXTA 2XEZA 3V5PA 2WO6A 5EKNA 2F9GA 2HWPA 2WTIA 3R63A 5HG9A 2H34A 5AUXA 4FIGA 3CC6A 3FWQA 5I9VA 3A8XA 4I24A 4BWPA 2DUVA 3D94A 4ASDA 1J7UA 3E88A 5IA3A 3FDNA 2F57A 3BPRA 3AMBA 3B8RA 3BWFA 3LMHA 4HGTA 5IQDA 4WD5A 3LCKA 4Y95A 2YIYA 3PJ3A 4PMPA 3DKGA 4X21A 3TTJA 2VWXA 4O0XA 4RIXB 3Q9ZA 4FV4A 3II5A 5HE2A 4BKZA 5EM7A 4XG4A 4V04A 3GFWA 5A3XA 4NH1A 3ZC5A 2ITNA 5EOBA 5M4FA 4IX4A 4QD6A 1Q8WA 2HK5A 4W4XA 5HTBA 2C6LA 3RZBA 3LFDA 2BKZA 3KMWA 4QTEA 3WARA 2IVTA 5M07A 1H1SA 2NPQA 3EZRA 3F2NA 5BVEA 3VO3A 1OMWA 4AZSA 4O83A 1V0OA 3IONA 3QF9A 5FM2A 4EH3A 4KBAA 4EUTA 1Y8GA 1GIIA 4QYYA 4YC3A 3W32A 3A62A 5EDRA 4B6LA 2W1IA 3REPA 3PA3A 4IWQA 4YBKA 5CSXA 5J8IA 1Q3DA 4DA5A 3R71A 3ZSGA 4QMSA 5BVOA 4N6ZA 2VO3A 3EFLA 3E64A 5CNNA 1CKPA 4NU1A 3PLAE 4EOKA 4HYIA 4FSMA 4S2ZA 4XLVA 5D11A 5HICA 3VHKA 3NW7A 2BFYA 3I0OA 5CQWA 5ANDA 5BVKA 4GT4A 3IDCA 1WBTA 3P79A 4YTFA 2E9NA 2PY3A 3ACJA 2KTYA 3KL8A 3OW3A 3KCFA 4PMTA 3ZRMA 2OO8X 2BTSA 2A2AA 4XLIA 1MRVA 4PP7A 1K9AA 4J96A 3M42A 4E20A 1QMZA 2J2IB 2LGCA 3FLZA 3I81A 3QU0A 5EK7A 1XH8A 3KCKA 4XP0A 2XBJA 4WRGA 4CEGA 3FC2A 3OCGA 3CY2A 4QQTA 4ZY6A 1NA7A 3MB7A 2WGJA 3VBWA 4W8DA 2C5VA 5EYMA 4APPA 3DJ5A 4QTBA 3CR0A 4GG5A 2JGZA 3R00A 4FBXA 4UMPA 4LOPA 4TKSA 3M11A 4BDCA 2ETRA 5BVWA 3QQLA 5ANKA 2QQ7A 2UW5A 2WMAA 3CJFA 5D10A 2W1FA 3SLSA 2V7AA 4D58A 3Q5IA 4L8MA 4BDBA 4G3GA 2QKWB 2VX1A 4RSSA 4BWKA 4R8QA 3MIAA 4F65A 4O7VA 2W9FB 5KHWA 3OCSA 3BQRA 4C4IA 3R7UA 5E7RA 4UB7A 3SD0A 4X6QC 5GINE 4IAAA 2VGOA 2BKKA 1WAKA 4AA0A 5AWMA 3U4WA 4RFZA 4BHNA 4USDA 2Z60A 2CGWA 2JLDA 3DK7A 3LHJA 3QZHA 4I4FA 5AIKA 2X81A 1M2QA 2XK8A 3BU3A 4C33A 1WFCA 3ZRLA 3RM7A 3ZZEA 3F7WA 3R1NA 3PWYA 4V0GA 4QP1A 2ZV9A 2O0UA 2ZDUA 3BLQA 4EUUA 3DXPA 3UC4A 2CGUA 3KREA 4J98A 2R3NA 5AV0A 3QX4A 5E1EA 5LMAA 4U43A 3A61A 4R3CA 2GSFA 2QONA 1SYKA 4P7EA 3SV0A 3E7VA 1IA9A 2B54A 4KINA 4IAZA 4USEA 4K77A 4DFBA 2V0DA 2ZYBA 2QHNA 4QNAA 3GU6A 4UZDA 1ZOHA 2C6TA 3DPKA 3NDMA 3QQKA 3PSBA 2CKPA 4P90A 2CKOA 4EBVA 3MJ1A 4I41A 4AX8A 1R1WA 4FG7A 2PVJA 3EQBA 5EDQA 5D1JA 4IVDA 5IQEA 4RX7A 3NUSA 4D5KA 2XK6A 4I20A 4K1BA 4HVDA 2PU8A 3OWLA 4FNXA 2UZTA 2PVNA 4FNYA 5AV2A 3RK9A 5JGAA 2J0MB 2VTHA 1P2AA 3ZO4A 3FLSA 4PNKA 4FEXA 4JL9A 2YACA 3DNEA 2G2HA 5HNBA 3L8VA 3PIYA 3SG8A 3FHIA 5IH5A 1GZOA 4GCJA 4LMNA 3H9RA 3PXYA 4DEHA 1QL6A 3Q6WA 3MB6A 1Y8YA 5CEOA 4YMJA 2ZDTA 5KZ0A 4QP4A 5C03A 3RPOA 4C62A 2X8EA 1REJA 2JFMA 4MXCA 3A7IA 5HBJA 4BR3A 1SM2A 4CQGA 2PVRA 5FEEA 3UZPA 4DFLA 3VWAA 5HX6A 4BZDA 4QMVA 5E8SA 5DT3A 4X3JA 4BF2A 4ENYA 3U6IA 5BYLA 5BQ0A 3VUIA 2JKKA 4YTIA 3THBA 2W5HA 4M7IA 3EN4A 3NIZA 5CVGA 3FXZA 4ZLYA 3LKMA 2C6IA 2R3FA 3R7YA 1U54A 5DT4A 5DYJA 2WTVA 3UO6A 4BIEA 4E5BA 4M8TA 4LM5A 3NSZA 3R2BA 4ZTMA 3E8EA 3TG1A 1W8CA 4Y72A 5GNKA 4BTJA 4EORA 2WEVA 3QZIA 5EM8A 3NLBA 5BVNA 3ZBXA 5JQ8A 3OHTA 1PXPA 2R0UA 3HZTA 4JRNA 4QOXA 4BGHA 3VBXA 1ZZLA 5HBHA 4FTLA 3UZTA 2C47A 4LL5A 4MBIA 3VJNA 2WXVA 1JQHA 3KULB 1V0PA 4XBRA 3K54A 4WBBB 5EH0A 4GYGA 4QMYA 4XOZA 5HD7A 4BCNA 5C01A 3EKNA 4TYEA 5HO7A 4F7LA 4L3PA 3MIYA 1BL6A 1LEWA 5CXHA 3W2OA 3FLYA 3LJ1A 2GMXA 4FNZA 1KWPA 4QYEA 4IVBA 5J9LA 2VO6A 3ZFYA 3PXRA 4U40A 3OP5A 3IGOA 4E6AA 5E4HA 4EH2A 3BYSA 3OD6X 4H36A 3MY5A 3DBCA 2W4JA 2VWBA 4PDSA 1UU7A 2CN5A 3JVSA 4B9DA 5IQCA 3FMNA 3FXWA 3IKAA 1PMUA 4DFNA 2QOCA 5CU0A 3B2WA 4O38A 5FQDC 5FDXA 3UZRA 3ZRKA 5ACKA 3LZBA 2XIXA 4ZZOA 2YHVA 5I9UA 3BQCA 4QPMA 4O7ZA 3DDQA 5CVHA 4DFYA 4EHGA 3OXIA 1M52A 3HAMA 4PL5A 3F88A 4XG6A 2G2FA 3IDPA 1YXXA 2FVDA 5LWNA 5CU3A 3PY1A 5FXSA 4DH7A 2UZNA 3LLAA 4MXYA 1UNHA 4FT9A 5BVDA 4EHEA 4ORKA 4PY1A 3FZ1A 4F7SA 2JKMA 2PVFA 3POZA 5CY3A 3QTZA 3E8CA 4GS6A 2XYNA 4FT0A 3EQCA 3I5NA 5HO8A 5HOAA 4R5YA 3UO5A 4RA5A 1Y6BA 3MPAA 2JD5A 3C51A 4DGNA 5IQHA 4FV2A 3E3PA 4HVHA 5BUEA 1Q5KA 2IO6A 5LVLA 2X9EA 3GOKA 5M4UA 1XH6A 4L00A 3LXNA 4F63A 4NT4A 2VNWA 1SNXA 3COIA 4JBVA 5AUWA 2EB2A 4TYHA 3AQVA 2IW8A 5DMZA 3AC8A 3K3IA 3L8SA 3IW7A 5EKOA 5AX9A 4PTEA 2WPAA 2UZVA 5C9CA 4CFUA 4O6LA 4DBXA 4R7IA 4F6WA 3A99A 3MPMA 3QAME 4UXQA 1VYWA 3UMWA 1BUHA 2FYSA 4DEEA 5ANGA 4EC8A 2X39A 4DCEA 4EKLA 5M44A 3W2CA 2YDJA 4L53A 3MVLA 1SMHA 4BTMA 2QHMA 3H10A 4TWOA 3C4WA 5HVKA 2BZHB 2WELA 4YHJA 4E5AX 5CT0A 3NUNA 5FLFA 3WZEA 2XZSA 1M7QA 4DGLC 4ANBA 5LVPA 4FL3A 3V3VA 4KBKA 5IQBA 2CPKE 3ALOA 1QPDA 2YIQA 4Q5HA 4ANMA 3PXFA 4EOJA 3CBLA 4UYAA 3LM5A 5C8KA 4PMSA 3A4PA 4O6EA 5TO8A 2PUPA 4PMMA 4IM0A 3G9NA 2PYWA 1RDQE 5HORA 1BI7A 3ORMA 1U5QA 4HYUA 4O0VA 4C61A 4I0SA 3D14A 2OXDA 3LMIA 4FSNA 5ETAA 3WF7A 2BHEA 1MQ4A 3FYKX 3LVPA 5TT7A 3NUXA 4MH7A 1GZ8A 3HDNA 4B8LA 2YAKA 3TUDA 5I9XA 3EL7A 2PUIA 3GC0A 3HECA 4ZZMA 3RAHA 1UVRA 3BYUA 3HEGA 4AQCA 1O6KA 5EM5A 3V01A 3D9VA 3A7JA 4FG9A 4RJ7A 4U9AA 4ZSEA 1YXSA 3W2RA 2WD1A 4QMUA 2VO0A 1W0XC 2B9FA 3R8ZA 2CDZA 5GZ8A 4JI9A 3R9NA 3EH9A 3MH1A 4J99A 4OTFA 4CYJA 2J9MA 4F09A 5B7VA 1H01A 4WSYA 3I79A 4QMNA 4FKTA 3BGQA 4RC4A 1TKIA 4KIPA 3LCDA 4W4VA 4CSVA 3OVVA 4UMRA 2VO7A 3F5XA 4AF3A 4A9UA 4MXZA 5CSWA 5L8KA 3MV5A 3NYXA 1OBDA 4Q5EA 3DT1A 4NTSA 4LYNA 5BNJA 3Q5ZA 1JNKA 4TN6A 5H8BA 4TYIA 4BCQA 4CKIA 4DYMA 2F7ZE 2G9XA 5AV4A 5FXRA 1T45A 3TIZA 2WMBA 5K4JA 2EUFB 1Y6AA 4EZ5A 2W1HA 5DT0A 4C02A 2C68A 4Z9LA 3Q3BA 3P9JA 3CQUA 1AD5A 4MK0A 3BHHA 2ZB0A 4TL0A 4FL2A 2QI8A 3QRTA 2PL0A 1YVJA 2VV9A 4FV5A 2RFSA 3TKUA 1L3RE 4O7YA 5HG5A 3QC9A 2ONLC 2ITVA 4KIKA 4LV8A 2EVAA 2I0HA 3QX2A 4TXCA 3PYYA 4BN1A 1J7LA 3OS3A 4MF0A 4FVQA 1OBGA 4E4MA 4DH5A 2XB7A 2OZOA 4EYJA 4BCIA 5AR2A 3C13A 2VWVA 2CHLA 4IJPA 5LOHA 1R39A 1FGKA 5J5SA 4FSQA 2W1CA 1PW2A 2R64A 3DGKA 3VJOA 3SG9A 3AGMA 4AFJA 4Q9ZA 3QTUA 4BZNA 4CFMA 3FLQA 3AD6A 3VVHA 1Z5MA 2YIRA 4MBLA 1UV5A 2UZWE 3KA0A 3V8SA 4YLKA 4UZHA 1APME 4IFCA 4KIQA 4RQKA 1CKIA 3KFAA 4BIDA 4CV8A 2GHLA 4JNWA 4ZTQA 1EH4A 3NPCA 3R7EA 3OOMA 5CWZA 2OIQA 5LQFA 3P4KA 5FD2A 1JAMA 4M84A 2XKEA 3SAYA 4B7TA 3BBWA 3EHAA 4UBAA 4D4RA 3HP5A 4Y5HA 3DAKA 4FTRA 1ATPE 1OL1A 1IA8A 1YHWA 3PXQA 3L1SA 3QGWA 2QU5A 4JS8A 1WBSA 2B55A 3TT0A 4CXAA 2W1ZA 2BCJA 4MVFA 2CSNA 2BRGA 2HZNA 4U3YA 4ZLZA 4GW8A 4V0GB 5E8TA 2IVUA 2REIA 3FY2A 2C5NA 3FMDA 2XNNA 3COMA 2VNYA 4O7RA 4X3FA 1VZOA 4QMMA 3C5IA 4D2RA 3U55A 3BELA 3C0GA 4ARKA 5A4TA 3HA6A 4MNEA 3MH0A 2XRWA 4Y83A 2HW6A 4KSPA 4YJOA 3UYTA 5F20A 3S4QA 3KC3A 4QMWA 4JT3A 2C1AA 5GIPE 2GNFA 2AYPA 2WZJA 5LJJA 2PVKA 4JR3A 3V5WA 2XKFA 1OITA 2P33A 4M3QA 4TNBA 1P4OA 3KXNA 4YJUA 4D4YA 3LFQA 1UWJA 3MH3A 2PTKA 2WKMA 4USFA 2R5TA 4C34A 3IW5A 4WKQA 3JS2A 4XG9A 2C6OA 4DINA 2E9OA 4M0ZA 1PXNA 4XYFA 4G3EA 2X6DA 3OG7A 4BVUA 4BCMA 1BMKA 3D83A 4A4OA 4C57A 3NMUF 3QD2B 1RW8A 2XJ1A 3FZPA 4FR4A 3POOA 4IM2A 4RVKA 4WNKA 5A54A 2UW8A 3VS3A 3VUKA 4B4LA 3UVQA 1ZMWA 3K5VA 4OT6A 4E93A 2F2UA 1PYXA 1YI6A 1OKWA 3ODYX 4FX3A 5AP7A 3VBTA 2Z7SA 4EK3A 3EN6A 3Q9YA 2Z7RA 1YWRA 2VTJA 5L2TA 5I5ZA 4QP8A 5L8JA 4RIYA 2RGPA 3UG1A 3TEIA 4PDOA 2PVYA 4PPCA 4YZBA 3RHXA 4BYJA 1YI3A 2R3MA 1L8TA 4RJ3A 3VN9A 3R8MA 5M4CA 2G1TA 3UP2A 5IQFA 1OIUA 5CENA 3Q6UA 4GMYA 4FEWA 1SVEA 2Y0AA 2YJSA 3TACA 3PE2A 4IAIA 4EKKA 4DAWA 4RPVA 4I92A 1U54B 3RAKA 2B1PA 2PE2A 4BBFA 1H26A 1M7NA 2EWAA 1GIHA 3OROA 4YHTA 3ZU7A 4X2KA 5C8NA 4IZYA 3ZLXA 3DXNA 1B6CB 4PDPA 5E8UA 3HVCA 3K2LA 3ZTXA 1H1RA 2PMLX 5J9YA 3F3UA 5AEPA 4K18A 3ANRA 1OM1A 2YCQA 2X4ZA 3C4FA 4XV9A 3CSVA 5KNJA 4JX3A 2F7XE 3EMGA 2VTMA 5D41A 5EQEA 4ZMEA 4M67A 4OTIA 3JXWA 1YQJA 3DJ7A 3MY1A 4JG8A 2WMTA 4K9YA 4NKSA 4E7WA 2XNGA 2YFXA 2WMRA 5E9EA 3IK3A 4P4CA 4M13A 1LEZA 3OXTA 5FM3A 2XIZA 2YLEA 4GK4A 2WHBA 3VRYA 2VU3A 4CLIA 3V6SA 4U7ZA 2OH0E 3H30A 3SGCA 1M2PA 1XHAA 4RC2A 3KRLA 5AP0A 4M12A 4RC3A 4J52A 5DEWA 1KOAA 3SXSA 2JKQA 5HHWA 5AV1A 2BHHA 2QOBA 5M4IA 5IA0A 3HX4A 3MTLA 4QRCA 2JIIA 4GKHA 3KQ7A 1ZZ2A 2CN8A 4NCTA 3S0OA 4ZOGA 2ETKA 3LMGA 4XJ0A 4MQ2A 2NRYA 5ANEA 2OSCA 5EHOA 4ITIA 1WBWA 4DC2A 5A6OA 3S00A 3PJ8A 1J1CA 1VYZA 3DFAA 2H96A 5EFQA 4L3JA 2DS1A 4R3PA 4C8BA 3AC4A 4XG3A 3RI1A 1Z57A 5HE1A 4OUCA 4E6DA 4HVSA 1MUOA 2WMWA 3CTHA 4HYHA 3LW0A 2XVDA 3TKHA 1ZAOA 2XCKA 4LRMA 5EYCA 4MEDA 3SRVA 3SXRA 4QPAA 3RP9A 4DCAA 2QOLA 3OZ6A 3I6WA 5G1XA 2IZUA 2R0IA 1G5SA 3D7ZA 2XNOA 3G0FA 4EH7A 3UNJA 3BYVA 4I21A 5ETIA 4ASEA 4K8AA 4RWLA 1OZ1A 2O63A 3LJ0A 3WZUA 4IBMA 3T9IA 4PX6A 4ZS4A 3JYAA 1GY3A 3OUNB 5FRIA 3UE4A 4FGRA 1OKZA 3A60A 3R6XA 3VS1A 3R30A 5KZIA 2WQBA 4MAOA 4DFZE 3FUPA 4CMTA 4BCHA 3D5VA 3H3CA 3UOJA 4QQJA 4CG8A 3VBVA 4QMTA 1OL5A 2OF2A 2ZAZA 3A2CA 4RVMA 5AUTA 4FEVA 4CZTA 2JDSA 4TYHB 3R02A 2EXCX 5LCJA 5FUTA 1ZYDA 2R3PA 2ZV8A 4GSBA 3QA8A 2YIXA 3QD4A 5D7VA 2V22A 2PMIA 1ZXEA 3PP0A 4D9UA 2YAAA 4PQNA 3JY0A 3Q9XA 3F2AA 4PL4A 4TWPA 4XCUA 3KF7A 3QRUA 4YGAA 3BLHA 1OPJA 1OPLA 3IDBA 4FG8A 4RA4A 3BKBA 3O0GA 4FTNA 5EHYA 4ZSJA 1IRKA 2J0LA 4OTWA 3UQGA 4U79A 2NRUA 4AW1A 1UA2A 4C38A 4FVPA 1CM8A 3FHRA 4FICA 2UW9A 3RINA 2CLXA 2VTOA 4U81A 4ERWA 5CEMA 3NUUA 2GNIA 3U9NA 2WOUA 3FZOA 4IX3A 3OCTA 5HG7A 5E8VA 3LCTA 4FKGA 3LE6A 4JAJA 5AAFA 3MFRA 3KRJA 2V7OA 2QR7A 3O7LB 3IG7A 3KKVA 3PA4A 4KKEA 1YOLA 4LOQA 1E9HA 5CLPA 2DWBA 4NEUA 4FKJA 3VW6A 4QP6A 3GFEA 4R7BA 3UVPA 4JJRA 4NM3A 3EOCA 5FTQA 4C58A 4EQMA 3P23A 2NNWB 3NUPA 3NS9A 2OH4A 4HGLA 3EKKA 2WMSA 5JH6A 3QYZA 4G16A 1NXKA 2ZB1A 1JSUA 3AD4A 3UP7A 3HRBA 5EW9A 1YRPA 4IWOA 3QXPA 2OJJA 2VWIA 5LVOA 3BBTB 3MSSA 4CRLA 4F9AA 1XBAA 5CF6A 4PF4A 2BRHA 1WVYA 3PJCA 1GIJA 2OFVA 2WFYA 2GNLA 4A9TA 5HGIA 4ANNA 2BROA 3KXHA 4EH5A 3TM0A 2W05A 3PPJA 5KMKA 3CEKA 3VBQA 4BY9E 4F0FA 3SOCA 4N4SA 4WO5A 4EL9A 1FVTA 1YDSE 3FQEA 4E6QA 5DH3A 4OAVB 3FMHA 2YCFA 3EQDA 1NY3A 5KMMA 4I23A 5FEDA 4X3FC 3HRFA 2SRCA 4AW2A 5KBRA 1UU8A 1PXOA 4UWYA 3BYMA 5AUZA 3ZH8A 2ITWA 4YZNA 3MS9A 3EQRA 5CU2A 1QCFA 3OFMA 2YM7A 3GUBA 4IX6A 1YWNA 1SVGA 4IDTA 2WB8A 4IEBA 4BDDA 3SW7A 2GQRA 4G6LA 2QG7A 3FJQE 3U4UA 5HE0A 3RPSA 1UKIA 3ORLA 4LI5A 3VS6A 5CAPA 3TV7A 2IZTA 4YR8A 4RBLA 3L9PA 5BMMA 4BCJA 1GZNA 1XH4A 2VWWA 5DR9A 4LQMA 4C35A 3ID6C 5L4QA 1XKKA 1YOJA 2WTJA 4KIKB 4JBOA 4NWMA 3JUHA 3VS4A 2Z02A 1NW1A 3TZ7A 3E87A 4BICA 5CAOA 4UYNA 4W9XA 2W17A 3LXKA 4IHPA 3GNIB 5TOZA 2WTWA 5J87A 4AGWA 2FA2A 2VGPA 3HDMA 3PG3A 3DBQA 4L52A 3GU8A 4RG0A 3HGKA 2EXEA 3QKMA 4RIWA 4H3PA 1OUKA 4LFIA 2Z7QA 4EC9A 3QCQA 2CKEA 4WSQA 1IASA 2YDKA 3QTSA 1NT2A 4M68A 2YZLA 3O51A 1Q8ZA 1WBOA 3LOKA 2HZIA 4FIHA 5GHVA 5C27A 4GT3A 5AJQA 4F9WA 4F64A 1X8BA 2WMVA 4BKJA 5BX0A 2X2KA 3TV4A 4L9IA 4PDYA 4RFMA 4A07A 3AT3A 3QGYA 5EI8A 3UNZA 1XH9A 4E4NA 2UW7A 4O2PA 3RVGA 2UZLA 3BU5A 4KA3A 1BL7A 4BGGA 5H2UA 4NL0A 2ZV7A 3QALE 4MX9A 3R9DA 4JXFA 4YJNA 2PZRA 3MN3A 5CSPA 2J7TA 3BHVA 1ND4A 5IUGA 4FMQA 1H08A 5C8MA 2Z2WA 4ACDA 5DVRA 4CMUA 4QYFA 4XRLA 1VEBA 2XRUA 2YM3A 4DLJA 3UODA 5HU3A 5EI6A 3IW8A 5FBNC 3GCQA 3IW6A 4LGHA 3VUHA 1JBPE 4K0YA 3PFQA 5I3RA 1UNLA 4X3FB 4C37A 3TDWA 3M1SA 5I0BA 3I0QA 2XBAA 4JR7A 3KRXA 3MVHA 2HY81 4FIJA 4MNEB 5IKWA 2EXMA 4CV9A 3F7ZA 3G2FA 3HP2A 5J79A 4XP2A 5HBEA 2QOIA 4LUEA 4I6QA 5HIEA 4FSZA 3AMAA 1YDTE 3OMVA 3PA5A 4FT3A 4YZMA 2ZMCA 3KGAA 3BCEA 4OBQA 4WG5A 4YJRA 5A4CA 4RLLA 4NUSA 1JKSA 2FSLX 2O65A 1OIQA 3FBVA 3MA6A 3O71A 4O91A 2R3IA 4J53A 3R1YA 4K2RA 4X2NA 1OPKA 2WIHA 1SZMA 1WZYA 1VR2A 4C2VA 3QXOA 1FBNA 1GAGA 3LQ8A 5E8XA 4OTGA 5IDNA 3Q2JA 5JT2A 4NCTC 4KKGA 2UUEA 1MP8A 2R3QA 4A7CA 1PF8A 4S30A 4O0TA 5AR5A 3CE3A 3R8UA 4AACA 3RAWA 3RPYA 3C7QA 2YM6A 3PZEA 5AM6A 5AMNA 4FF8A 1DAYA 4FTOA 4ERKA 3ZFXA 4XNEA 1H07A 2PWLA 1KV1A 5EI2A 3FPQA 4DF3A 3GCVA 5HI2A 1OIYA 2C5XA 2WMQA 5J1VA 4MQ1A 5IMEA 4D2VA 1ZYLA 4AN2A 3PSDA 5I9YA 3NIEA 3ENMA 3LAUA 3KEXA 2Y6OA 4JIKA 2OZAA 3KK8A 3MTFA 5GJDA 4ZTHA 4NM0A 2J0KA 1PMNA 1OKVA 4BDEA 4OR5A 4YTCA 5HZNA 3IS5A 1FINA 2QOFA 1FMOE 3PZHA 3Q4CA 4I5MA 3GQLA 4KUJA 3PRIA 2IN6A 2OI4X 2RG6A 1DAWA 5IEVA 3HMOA 4BI0A 4EOPA 2BRMA 1P5EA 4OT5A 4IM3A 3HRCA 4F1TA 1W82A 3ZXZA 3FMJA 1T46A 2QODA 1GNGA 3R22A 4CCBA 1G8SA 3FEGA 4YJSA 3I5ZA 1OL7A 3NZ0A 4OTRA 4XUFA 4UY9A 4J95A 3GU4A 5AA8A 4CVAA 2P3GX 4ZIMA 5KHXA 4KS7A 4YC8A 2XIRA 4ZS0A 4U8ZA 4PV0A 4C4HA 4KRDA 4DFUA 4A4LA 4EJ7A 1KV2A 1W7HA 4G9CA 3W33A 4AA4A 5IF1A 5FTGA 3QQGA 2C69A 2C0OA 2VTSA 4DT9A 3NX8A 4IACA 1YDRE 3LIJA 4LRJA 3LXLA 4K11A 4FSRA 4AFEA 1ZOEA 4FV3A 3WZJA 3KF4A 5CU6A 5DN3A 3FC1X 3RPRA 3DQXA 3PVWA 3OWKA 3PXKA 4QMOA 1BLXA 3HUBA 1JLUE 3Q52A 2A27A 2FSMX 3F5GA 3QKKA 2JIUA 3V6RA 4F0IA 4FTMA 3MVMA 4OTQA 1PHKA 5AR7A 4ALWA 4F9YA 4FE2A 3QCXA 5JKGA 2H8HA 3BHUA 3R73A 3F3WA 2R3OA 3SC1A 5DFPA 5A4LA 4XG2A 2W06A 5KX8A 3N4UA 4YO4A 2XJ0A 3HV5A 3ORTA 1V1KA 3FZTA 4BDGA 2R7IA 5HLWA 5M08A 3A4OX 5LMBA 1PJKA 3R0TA 4AE9A 4UX9A 3EYGA 4J7BA 3QD0A 4A06A 2J0IA 4ZZNA 2YERA 2FGIA 2AC3A 3I7CA 3KMMA 3C4EA 3Q04A 4FV6A 3MGYA 3CP9A 4WRSA 3EIDA 5EHLA 3ZC6A 3KXGA 4J97A 2XP2A 5FP5A 4II5A 4ACCA 1XWSA 2BDJA 5AADA 4F6UA 4M69A 4RWJA 5DG5A 4IAFA 3FLNC 2WQMA 3ORIA 5EW3A 4F7NA 2PSQA 2VTLA 5BUIA 5DRBA 3U9CA 2A0CX 4ASZA 3ITZA 4RLKA 1OUYA 2JITA 2XK3A 3G5DA 4UALA 4AWIA 4L6QA 3QD3A 4IE9A 4ZK5A 4DG2E 4A9YA 2X7GA 2Y6MA 4FKWA 2XK7A 4LRKA 3FPMA 4A4XA 5FWKK 3PPKA 3FLWA 4O21A 4ALVA 1RJBA 3NNVA 5D7AA 3R8PA 3R2YA 1PMVA 1SVHA 2JDTA 5DGZA 5B2MA 1MRYA 4CLJA 3DBFA 3RHKA 1WMKA 4HCVA 3AMYA 3SQQA 2ITTA 3C4ZA 2UZBA 1KE5A 5DHJA 1R0EA 3N4TA 5ACBC 4BDAA 4TZRA 1OKYA 3EYHA 1FMKA 4BHZA 2BRBA 1FPUA 3OY1A 1A9UA 3G6HA 1GZKA 2ITUA 5T3QA 3OOGA 4H58A 4L01A 4V05A 4YLLA 1IAJA 2FO0A 4NW6A 4MNFA 4RT7A 4XH6A 2GNHA 4AT4A 4AGCA 3ZFMA 5L6OA 3MBLA 4PNIA 5DR6A 4EJNA 3DY7A 4FV7A 2R3GA 4FSWA 2QR8A 3GI3A 3LJ2A 4RX8A 2XF0A 4I1ZA 3SX9A 2WTDA 1STCE 5HCZA 1I44A 3BE2A 4JDIA 4RIXA 2XNEA 4NZWB 5HCYA 4JG6A 2C3LA 3RAIA 3LCSA 5CEKA 2E2BA 3R01A 2VTPA 4FKVA 1DM2A 3OUKA 5AV3A 5IA2A 4C7TA 2X9FA 3CGFA 4M0YA 5AUYA 2DYLA 2XNBA 4BCOA 3OBGA 3CTJA 3FSKA 4XRJA 5CZIA 1E1XA 1YOMA 2F2CB 4KSQA 3EQIA 3Q60A 3KMUA 4XP3A 2Y8OA 3HV6A 3OTVA 4R5SA 3VQHA 2C30A 2BZKB 2RFEA 2VX0A 4XG8A 3D4QA 3ZO1A 4YUQA 5I4NA 3DXQA 3R9OA 3FI3A 3IW4A 3NYNA 2GFCA 4NW5A 4BCGA 3NUAA 2ZV2A 4BBMA 4FZ7A 2VTTA 3NCZA 2WQEA 3FMMA 4U3ZA 4UMQA 3A7GA 3E92A 3F3TA 5TE0A 2WNTA 5HVJA 4RMZA 5KBQA 4EHVA 2P2IA 5GZ9A 5HIDA 1H28A 4G3FA 5M56A 3FI4A 4D0XA 5KO1A 1QPEA 3NWWA 4F99A 2UZOA 3QQFA 2HOGA 4IZ5A 4CNHA 4D28A 5J9ZA 3TDVA 4CZUA 2BPMA 5IZFA 3PWDA 4FIEA 4H39A 2PE0A 3F9NA 3GC9A 3FL4A 5HO6A 2RIOA 3L9LA 1H8FA 5L2IA 5IEXA 3C4XA 4IB5A 4TW9A 4NK9A 2PHKA 4S31A 2OIDA 4DTKA 4WOVA 4EONA 4IZ7A 4BZOA 5D12A 5E90A 2YLFA 3BI6A 2XK9A 2QO2A 4HYSA 5E8WA 4EK5A 1P14A 4LL0A 4JQ8A 3ORNA 3T8OA 3PPZA 3ZMMA 4PWNA 4O0UA 4AN9A 3PJ2A 4EH4A 4EOSA 4ALUA 4FZDB 5C26A 4KRCA 3F5PA 3Q2MA 3DDPA 5F94A 4ZMFA 4MXAA 2HWOA 3AD5A 4QT1A 4N6YA 5IDPA 2GHGA 3WF8A 2LAVA 5TF9A 4XV1A 2ESMA 4OLIA 4FKLA 3NUYA 3OCBA 3TZ9A 1Q24A 3EQPA 5JN2A 2RF9A 3QTXA 3PP1A 4BI2A 4Y46A 5LVMA 1H0WA 5H9BA 4JAIA 4QMQA 5EQPA 5IA5A 1OVEA 1OGUA 4AS0A 3G15A 4QP7A 4D9TA 4Y73A 2VTRA 4JLCA 3TIYA 4TWCA 4HNFA 4EYMA 3PDTA 3CS9A 3TL8A 3HUCA 4O7NA 4QYHA 3CQWA 4GVJA 4MHAA 3UOLA 4HGEA 4EOMA 3FE3A 3I7BA 3LFNA 3B2TA 1BYGA 1R78A 3K3JA 4KABA 3V8TA 1PXJA 1XR1A 1H27A 1B38A 2BDWA 5DNRA 4F70A 4AOJA 3FV8A 3DJ6A 3LQ3A 2XM8A 3EJ1A 1I09A 4K33A 3ZEPA 4Q9SA 4W9WA 5LCKA 4FC0A 2VTIA 5CT7A 3GC7A 2R2PA 4Y85A 3FAAA 4GT5A 2XA4A 3F61A 3JVRA 5AX3A 3ZDUA 5CTPA 3C0HA 2IZSA 3OWJA 5A6NA 5LVNA 3PTGA 3VUGA 4CCUA 3VQUA 4BC6A 4DHFA 5L6WL 1ZYCA 3BE9A 4IH8A 3JY9A 4YPSA 4AGUA 2WU7A 2GFSA 4MXOA 3ROCA 5CALA 4MKCA 3P0MA 3UGCA 2ACXA 2JAVA 4JRVA 3D0EA 4RGJA 1ZRZA 3KRWA 4H3QA 1A06A 4QTDA 4DGMA 2FSTX 2QURA 2I7QA 4O86A 4JIAA 4D2WA 5IUIA 3TNPC 3VBYA 4X0MA 3QCYA 4YZCA 4DITA 2HXLA 2PE1A 2XH5A 4G6NA 5DPVA 3ZS5A 1A48A 3COKA 3R1QA 5KMLA 3L9MA 3UIBA 4MD8E 2P55A 3EFKA 3QRJA 3FZSA 1PXKA 3BWJA 1H1WA 4G9RA 4AP7A 2YITA 3IOKA 3HAVA 1OL6A 3EWHA 1JPAA 1HCLA 3U51A 1XO2B 5AIRA 1XH7A 5HESA 2W7XA 3MYGA 4RVLA 4OAUC 2J5FA 4ACHA 4PL3A 4RWIA 3RPVA 4BL1A 4ZJVA 2RKUA 2G15A 4W8EA 5K9IA 3EL8A 4DG0E 4U44A 5C4KA 4RX9A 3ALNA 3E8NA 4GK3A 3C0IA 3R83A 1U4DA 2VAGA 3NW5A 4I0RA 4GIIA 4C2WA 3ZO2A 2HZ0A 2ERZE 4XOYA 2ITQA 2OIBA 3HL7A 4HGSA 3VULA 3MVJA 4L3LA 3BYOA 2C4GA 3QTIA 5FBOA 3BV2A 1JWHA 2WQNA 3DNDA 3CD8A 3I1AA 3PE1A 3QTQA 3S2PA 4EZ7A 4I93A 3UO4A 5L3AA 4EK6A 2FSOX 1H00A 1OIRA 5F4NA 3LXPA 2OF4A 2PMNX 3UIMA 2GNGA 3NEWA 2FUMA 3WOWA 2ITYA 5HNIX 4RIOA 4HZSA 4C4FA 3G33A 4FKSA 1V0BA 4NSTA 2GS6A 1TQIA 3FSFA 4DH8A 4NTTA 3ZUUA 2CJMA 4WNOA 1LR4A 2JKOA 2R3HA 4G2FA 4TY1A 4ONAA 1FQ1B 2V55A 4FK3A 3ZZWA 4C4EA 4CT1A 4IB1A 3KULA 4Q2AA 4Z55A 4PPAA 2XUUA 2GS2A 1WVXA 4D2SA 4KNBA 5IQIA 3NNXA 3FYJX 2W96B 4U97A 4CRSA 3GGFA 4ZSAA 4EH6A 3DBDA 3EB0A 4YSMA 3UPXA 3WE4A 4RX5A 3FI8A 3FMLA 1F0QA 2X8DA 2VTAA 1GJOA 4FUXA 5AAEA 4S32A 3JR1A 4HCUA 3P1AA 1ZWSA 4O0SA 5K5XA 5KMOA 4YNEA 2B4SB 5FP6A 4FV1A 3RK5A 1OL2A 1JVPP 2QLQA 1KE8A 2R3JA 3EN7A 1AGWA 4TT7A 4L68A 1YKRA 2W1GA 4KWPA 5BMSA 5CVFA 3ULIA 3QC4A 2DQ7X 2YISA 4UV0A 2JBOA 3R04A 1U46A 2UZEA 5EG3A 4FVRA 2YABA 4XHKB 3WIKA 3QFVA 3NYOA 5I3OA 2B52A 4UWCA 2CKQA 3W10A 1WBPA 4ZSGA 4ZY4A 3DB6A 4YHFA 2J50A 3KXZA 4O1PA 3QBNA 3SHEA 2XIYA 1PRYA 4QMPA 5FGKA 4BTFA 2BFXA 3HMIA 5L8LA 1S9IA 4PPBA 3TUBA 2PK9A 4G31A 5K5NA 5JFSA 2BIKB 2XEYA 3KXXA 3O8UA 3BX5A 3LPBA 3OY3A 4HZRA 3GCPA 5HIBA 2PUNA 1REKA 4MF1A 2WTKC 4IMYA 4GU9A 3KB7A 4ACMA 3LFSA 2JDOA 5FDPA 5B2KA 5CSHA 3DFCB 3BU6A 3BRBA 4C3RA 4E26A 2HYYA 4M69B 1WBVA 3ZHPC 5DR2A 3N51A 4FV8A 4FGBA 4GU6A 4FSYA 3MFTA 5HE3A 5HTCA 3PIXA 1F5QA 1FOTA 4H1MA 3G51A 4R1VA 4FKUA 2E9UA 3QRKA 3KN6A 3TJCA 2ITXA 2B9IA 3O2MA 3R9RA 2QOHA 2FB8A 2ZJWA 3G0EA 4FTKA 3VIDA 3UJGA 4HNIA 3F6XA 4PRJA 2W0JA 4UN0C 3DCVA 2BVAA 3D15A 3LLTA 1H1PA 3MPTA 4KD1A 4DLIA 3U8WA 5JMSA 4FT7A 4LOOA 2HELA 3WBLA 3F66A 1LPUA 4F9BA 3R21A 3GOPA 4C3FA 1K3AA 4I6BA 3HNGA 4ZEGA 4BCKA 3Q4UA 2C0IA 3SW4A 4X2GA 4MWHA 4YJPA 4F4PA 5FEQA 3IOPA 4ZJJA 5CXZA 4XBUA 5LMKA 4DGOA 4BBEA 5A9UA 3AG9A 3QL8A 3R1SA 5GZAA 4P5ZA 4CFNA 3ATTA 2XNPA 4IDVA 1TQMA 1KE6A 4Z16A 4FIFA 3AXWA 1YI4A 4OW8A 5CF8A 4FK6A 3FKLA 3ETAA 4HVGA 3DS6A 2X4FA 1PXLA 2C5YA 3KVXA 3BZ3A 2HZ4A 4G3CA 2I40A 2ZM3A 2VRXA 3QUPA 2JDRA 3IGGA 4ZSLA 3E7OA 2C5OA 3KU2A 3BHYA 4JX7A 5M53A 2OICA 3DU8A 4O22A 2R9SA 4CMOA 4NYEA 3D7TA 4H05A 1R0PA 2ERKA 3PXZA 4AT5A 2GQGA 1URWA 4IJ9A 4D5HA 3L8XA 2I0EA 5KMNA 4DBNA 1Q62A 3M2WA 3I4BA 4R7HA 5HKMA 2C6KA 2PZIA 5HG8A 5IQAA 4IVAA 3RKBA 5AA9A 1ZOGA 1FVVA 3P7AA 5CASA 1TQPA 2WTKB 4BCFA 4J8MA 3ZBFA 3NW6A 2RFNA 4HOKA 4R1YA 3W2PA 2PULA 3IQ7A 3NAYA 4DG3E 2X1NA 4TYJA 5E92A 2ETMA 2QOQA 4QP3A 4B8MA 4F0GA 3EN9A 3IO7A 2UZUE 4QP9A 3W2QA 4EOIA 5L6PA 2CNQA 4YLJA 4G6OA 4S33A 5AP6A 2XMYA 5E8YA 2OJFE 4AZVA 2J0JA 4BRXA 4ZAUA 5A14A 5A4QA 5J7BA 3CJGA 5BYZA 4ASXA 1U5RA 5JZJA 4OGRA 1PXIA 4LUDA 2UVYA 4WUAA 5CU4A 3C5UA 4ZTLA 4O84A 2YM5A 2XKCA 2J5EA 2ZM1A 4JVGA 5AR8A 5M06A 5K4IA 3FXXA 4QQ5A 4IFGA 3V5LA 2ZMDA 3DZQA 3GT8A 4FOBA 5EDPA 3TNIA 4YZDA 4O0RA 3LCOA 2Q0BA 5AP3A 4RZVA 4DEDA 4JG7A 4JQEA 5TKDA 4QTCA 2ZOQA 4X7QA 1IAHA 4FKQA 4XS2A 1CDKA 5B0XA 3L8PA 1Q4LA 4GUEA 4PTGA 3ORXA 4CFVA 4O7WA 2PUUA 2YA9A 4L42A 3W18A 3SVVA 4FKIA 3C50A 3CIKA 4R6VA 3MW1A 3O23A 4TRLA 3GP0A 4MXXA 2P0CA 2GNJA 3FQSA 4U0IA 2EU9A 2OWBA 5T6KA 3ELJA 1H25A 3O96A 4JOAA 5BVFA 2XYUA 3D5UA 2X6EA 5ETCA 5J95A 2YIWA 3DKFA 4FODA 3FL5A 5EOLA 1H0VA 3E5AA 5JFXA 3CPCA 1DS5A 3F3VA 1YW2A 2OJIA 2W4OA 5HVYA 3PIZA 3UOKA 2YZAA 1XH5A 2C3JA 3VF9A 2C1BA 1CSNA 4YJVA 4FKOA 4G5JA 5JQ5A 4IXPA 4FA2A 4GK2A 4QP2A 4KAOA 4O0WA 4EOLA 4UXLA 4F08A 5HD4A 4EOOA 3MH2A 2OKRA 4O1OA 4Y5QA 5AR4A 2BMCA 3TCPA 3FKNA 4BI1A 4AW0A 4AZTA 2Y9QA 5JK3A 4CFFA 3S95A 4FTUA 4XV3A 2F7EE 3DK6A 4NIFA 4NM7A 3CKXA 3RNYA 3VUTA 4AUAA 4AXAA 5HNGA 5IMXA 5K0XA 1J1BA 5TR6A 2C0TA 2I0YA 4FOCA 3FMEA 3EQGA 2GHMA 2C6DA 3WYXA 2VTNA 5DBXA 3ZEWA 3DV3A 3NGAA 3ORKA 4HCTA 3GB2A 2UVXA 3ULZA 4AZEA 3EN5A 4CTCA 3BLRA 2B7AA 2B9HA 4JBQA 5DA3A 3V51A 3UYSA 2CGXA 3VS5A 4AOIA 2YM8A 5KE0A 4C4GA 5AUUA 4WNPA 2JAMA 3DK3A 1YXUA 3VF8A 3WF6A 1HCKA 5HTIA 4HJOA 4QMZA 3OEZA 4ANOA 3VUMA 3DOGA 2BRNA 1K2PA 3COHA 4EBWA 4E4XA 3CY3A 5DWRA 1LP4A 4DN5A 2BIYA 1H1QA 3EFJA 4IZAA 3RCDA 3TXOA 3MESA 4XV2A 3GQIA 4DT8A 4PTCA 5HCXA 5KCVA 1PMEA 3MJ2A 3TV6A 3FMKA 3QCSA 2AUHA 3HMNA 3QKLA 4HPTE 4FTTA 1OECA 2BAJA 4GYIA 2QNJA 4LG4A 4CQEA 5IEYA 2ONLA 3UNKA 4F9CA 1W98A 4E73A 5J1WA 4I5HA 3NYVA 4YTHA 4FTJA 3RCJA 3TZ8A 3R7OA 4DE4A 5M09A 3ZM9A 2PVLA 3NAXA 5EW8A 5EM6A 3UMXA 3MY0A 4NJDA 3P7BA 4FYOA 2O2UA 5FTOA 4R77A 3F2RA 4EEVA 2V5QA 3E3BX 3QWKA 4O7LA 2JDVA 1UKHA 4Z7GA 4M15A 3BV3A 3ODZX 2GTNA 1CTPE 4RIYB 4RJ8A 3LFFA 3ZOSA 3GU7A 5AM7A 4FTAA 4CGAA 5IU2A 2EB3A 2PMOX 3DAJA 3DKCA 3H0ZA 4RZWA 2HY0A 2VZ6A 4RQVA 3DB8A 3Q32A 2HENA 4L7SA 4UWBA 4BDIA 2QVSE 2H6DA 2FH9A 3ZXTA 2OW3A 3W1FA 3OW4A 3CD3A 4FSTA 5CF4A 3GXLA 3VAPA 4EWHA 4K6ZA 4BGQA 5JGDA 2ITOA 3ZSHA 5JGBA 5F9EA 3TNWA 4A9SA 2V62A 3I6UA 1WVWA 2CNVA 4MBJA 2I0VA 3AT2A 3F82A 3OTUA 3R7IA 2JFLA 5CAVA 3W8LA 4I22A 4LV5A 3RM6A 5BUJA 3MWUA 5CAQA 2Z8CA 3F5UA 2C3KA 2UV2A 3QQJA 3PY3A 2QOKA 1P4FA 4QMXA 4FZFB 2YWPA 3PVGA 4O27B 2OJ9A 3P86A 5EYDA 3AC3A 1RE8A 3UIXA 5JFWA 3TTIA 4C36A 4ANQA 3D2KA 3N9XA 4OBOA 1KOBA 4ANSA 3EQFA 4I94A 3G90X 3QTWA 2GS7A 4FKPA 3F69A 4X2JA 4DGGA 1JSTA 3E8DA 4CT2A 5KMIA 3D2IA 3IPHA 2IVSA 4QNYA 4D55A 4ITJA 5HLPA 4MCVA 5CEIA 4U80A 4GRBA 4QO9A 5B2LA 5IUHA 4GV1A 5IH6A 5GIOE 2CLQA 2HIWA 3ET7A 5IPJA 3RGFA 2QKRA 1IEPA 2XIKA 4IVCA 4YP8A 5H8EA 4W4WA 1WCCA 3C4CA 2J51A 4AZWA 2RFDA 3UVRA 2BUJA 5AP2A 4ZTNA 4PP9A 3KN5A 1MQBA 3WZDA 3DZOA 3TUCA 1YHSA 2YEXA 2PZ5A 3DKOA 3BGPA 2CMWA 2W5AA 3EQHA 3FKOA 3OWPA 3QRIA 5LMKC 3ZSIA 2WOTA 1NVQA 3BIZA 3KXMA 4BDJA 3WYYA 4RVTA 2UW4A 5J7HA 4JQ7A 4RRVA 3ACKA 4MD7E 5JEBA 4WHZA 2XK4A 3QHRA 3Q9WA 3WZKA 4DTBA 2WQOA 4EI4A 5JRSA 3UQCA 4U6RA 1GOLA 2BDFA 2X2MA 3R7GA 3S1HA 3CPBA 3VHEA 2VWYA 4YJQA
chains in the Genus database with same CATH superfamily
3PJ1A 1OB3A 3WF9A 5KKRB 3ZONA 3E63A 3C1XA 1PXMA 3SRVB 4E4LA 4AT3A 4KKHA 4OTHA 4LMUA 4P5QA 4B99A 1JSVA 2NP8A 2BR1A 2W1DA 3VS0A 5H8GA 4BTKA 4KS8A 2X8IA 3VS2A 4FZAB 1XJDA 4DFXE 2B9JA 3B8QA 5ICPA 3I60A 4M66A 4GH2A 5AP5A 3ATSA 2Y7JA 5CSVA 2J6MA 2QD9A 4AA5A 3QLFA 3KVWA 4IIRA 4A9RA 4BFMA 4D0WA 3DQWA 5H3QA 3ZUVA 5HLNA 1J7IA 4FV0A 3PSCA 5E1SA 5DRDA 4O7SA 4O81A 3W0SA 4I6FA 4AGDA 2WTCA 5G6VA 2CGVA 4BDHA 1PKGA 3NCGA 3RTPA 1HOWA 2QCSA 3K5UA 4E1ZA 1ZYJA 1B39A 3QUEA 4ZP5A 2PPQA 2F4JA 2BZIB 4H1JA 3U6JA 2RSVA 4M97A 2OU7A 1G3NA 2QO7A 2HAKA 4QYGA 2WU6A 3PFYA 3UBDA 3RJCA 3UPZA 4ANLA 3T3UA 4CKRA 5IISA 5KMJA 4ZLOA 2IEWA 3UQFA 5M57A 2X0GA 4U41A 4O82A 1CKJA 2AC5A 3BGZA 4YSJA 4EQCA 5HU9A 3TNQB 4ZTRA 3ZLWA 2ZM4A 4BIBA 3QHWA 2CNUA 3O8PA 2IVVA 1ZY5A 2UW6A 1Q8YA 5JFVA 2P2HA 4MWIA 1MRUA 1Z9XA 4EH8A 3NR9A 4CZYB 3LFCA 4G34A 3BEGA 2JIVA 4I4EA 4FIIA 4IB3A 3PRFA 2JEDA 3UOHA 4U45A 5DLSA 4IW0A 4DH3A 3HV3A 2A1AB 5L2SA 3RWPA 4F7JA 3QYWA 4L43A 3PLSA 4G3DA 4FYNA 3FY0A 4BDFA 3LQ5A 3E93A 1UU3A 1FVRA 4YO6A 5CYIA 5CI7A 3RBWA 5CF5A 4H3BA 4DEAA 4GJ2A 5F1ZA 3UIUA 1PKDA 1BKXA 4YC6A 1M2RA 4AOTA 3KK9A 2YWVA 3CKWA 2RG5A 2RL5A 2W5BA 4X6RA 3Q4TA 1JKTA 1U59A 5L2WA 3TI1A 1E1VA 3R9HA 5CZHA 3D7TB 4L45A 1Q97A 4W4YA 4XG7A 3RALA 3GCSA 4J1RA 3TZMA 4ENXA 3SDJA 1Q8TA 5AR3A 4N57A 2PZPA 3OT8A 4WG4A 4G1WA 3UTOA 5HQ0A 4IQ6A 2O3PA 4TNDA 1FGIA 5CAUA 4XEYA 4RWKA 3ZLSA 4YBJA 4ZTSA 3VUDA 3GVUA 4FI1A 1XBCA 4WT6A 4WIHA 5DI1A 4OTDA 3HYHA 4AXFA 1W83A 3CXWA 1M17A 3LFBA 5CQUA 3HMMA 2YM4A 4C59A 3GCUA 4Z7HA 3A7FA 2E9PA 4CG9A 3PVBA 4TWNA 4UMUA 4YJTA 4EQUA 3NNUA 3EFWA 2Y4PA 4FSUA 4L46A 3AGLA 3DLSA 4RJ4A 5AP1A 2HXQA 2W99B 4V01A 3JPVA 1QPJA 3HKOA 1KUTA 4IAKA 4IX5A 1ERKA 2C6EA 3R8VA 1PY5A 5AFVA 1H4LA 2BAQA 2GDOA 2I6LA 3HA8A 3LFAA 4YU2A 2OFUA 4C0TA 3LFEA 3OC1A 5D9HA 4MUQA 5M51A 4P2KA 2NO3A 4Y8DA 1TVOA 2ITPA 2QC6A 4FEQA 1LUFA 2JC6A 5DE2A 3V5TA 2VN9A 4IB0A 1URCA 4RIWB 5HX8A 4FEUA 1XBBA 2HCKA 2OXYA 2XS0A 4ID7A 1KE9A 3GBZA 3RWQA 2IPXA 5I9ZA 1CMKE 4JDKA 2CCIA 2O5KA 4BKYA 4MD9E 4AE6A 4NFMA 4FNWA 3T9TA 2IG7A 3QQUA 5KUPA 1YXVA 4B0GA 4DEBA 2R7BA 2NYAA 2X7FA 3D5XA 5JSMA 2H9VA 3ANQA 3QLGA 3FZRA 4QPSA 3HV4A 4YZ9A 2QOOA 3PVUA 2PVMA 5F95A 4ACGA 3O5AA 5J5TA 1JKKA 2B53A 1QPCA 2QO9A 4E5WA 5BYYA 3HMPA 4J8NA 3CGOA 4I6HA 5A4EA 2PVHA 4KB8A 5CX9A 5IA4A 4L67A 3ZYAA 4NKAA 3R7VA 2BZJA 3VRZA 4EK8A 3MFUA 3RZFA 3EZVA 3KY2A 3ORZA 2W4KA 3H9OA 4ZY5A 3W16A 4IADA 1UNGA 4N70A 1G8AA 3AKKA 1IG1A 1W84A 4XMOA 4BDKA 2OLCA 5I9WA 3DA6A 4UMTA 3W2SA 4BYIA 2QG5A 2E9VA 4NIFB 3OXZA 5CS6A 5JZNA 2YJRA 1ZMUA 3GU5A 4G5PA 4GKIA 3OBJA 2YN8A 4I5PA 4WBOA 3W55A 2VX3A 3AC1A 4I0TA 2WIPA 5AUVA 2I1MA 4UEUA 4N0SA 1Q61A 5ANJA 4CFXA 3U54A 4KIOA 3L9NA 4S34A 3IECA 1JKLA 4RJ6A 4AG8A 3MFSA 3OF0A 4AU8A 4QMLA 1ZY4A 4TTHB 3RNIA 4DEGA 3DAEA 4FKRA 4WUNA 4E8AA 4E3CA 2XARA 1NVRA 3A8WA 3SOAA 3WIGA 4FTQA 1RQQA 4AAAA 4LGGA 3DBEA 2ZFYA 2BAKA 3FQHA 3AC2A 3RMFA 1O9UA 2VUWA 1OI9A 2XCHA 1WBNA 4OBPA 2QLUA 2GPHA 3GENA 4U42A 1R3CA 4ITHA 2F49A 4X2FA 2IZRA 3TKIA 2OBJA 4GG7A 4I3ZA 3TWJA 2CCHA 5E8ZA 4EHZA 5CNOA 2YCSA 2BALA 3SKCA 5K3YA 3W0MA 4KBCA 2ITZA 2R3LA 4FTCA 4IC7A 3VW8A 2OGVA 3ORPA 3R28A 4BWXA 2QU6A 4DF3A 2BILB 2W9ZB 3CTQA 3PY0A 4NJ3A 4IANA 5IH4A 4GIHA 4IWDA 2J4ZA 3PG1A 3QWJA 2XJ2A 3OT3A 4F1OA 4GJ3A 1PYEA 1S9JA 1BX6A 2WMUA 3CCNA 4BB4A 4R78A 3D5WA 3Q96A 1Q41A 2Z7LA 3ZDIA 4EZ3A 3LM0A 3P08A 4YPDA 2PZYA 5CANA 3NVKI 5FG8A 3HLLA 3CQEA 2UVZA 3TNHA 5AP4A 4DTAA 5FXQA 4GUBA 4HVIA 4FZ6A 5ETFA 2XM9A 3QZGA 4PUZA 4AW5A 3WILA 3UG2A 4EOQA 1KE7A 4HW7A 2OZAB 1NVSA 4MTAA 5GJGA 3V5JA 4EH9A 4D4SA 3Q53A 4GVAA 4WNMA 3UDBA 1J91A 3E62A 4O96A 4D1XA 3RK7A 4DH1A 4D1ZA 4JBPA 2VWUA 1ZARA 3CLYA 1J3HA 4WG3A 3R8LA 3O17A 1XQZA 3DTCA 2OJGA 5DEYA 3VS7A 3OEFX 3MI9A 2ZVAA 4I5CA 4O2ZA 3O8TA 2P4IA 2Y4IC 3P7CA 2VWZA 4GFMA 3NRMA 4L44A 2GCDA 4FUYA 1ZLTA 2R3RA 2X0QA 1YHVA 5DIAA 3V8WA 5EQYA 2IWIA 4J71A 4F6SA 2VD5A 2VTQA 3AT4A 3PUPA 3P5KA 2R3KA 4IAYA 3ZM4A 2OXXA 2X7OA 3H0YA 3ZLYA 4D4VA 2IW6A 5C4LA 3G9LX 3BHTA 4IC8A 4IWPA 5HEZA 1DI8A 4FL1A 3VNTA 2JBPA 4FV9A 3ZCLA 4TYGA 3U87A 4GL9A 4CKJA 5EYKA 3QQHA 5LXMA 4O7TA 4QTAA 1O6LA 5BPYA 3AC5A 2O64A 3UC3A 4M14A 4RJ5A 3H4JA 1Y91A 5IG1A 2OK1A 2WAJA 3V04A 2WMXA 4LGDA 5DOSA 2X2LA 3QA0A 5CEQA 5C1QB 2WEIA 1KSWA 4GFOA 1YWVA 2XNMA 4FT5A 2C3IB 3NVMB 3HV7A 4G17A 3QZFA 1JOWB 3ZUTA 4EK4A 4WA9A 3H9FA 3F3ZA 5ITAA 1BI8A 1Q3WA 1ZMVA 3O7LD 4L7FA 5L2QA 3SXFA 3Q4ZA 1DI9A 4OTPA 5K0KA 4EWQA 4RFYA 5IQGA 4D2TA 1ZYSA 4D2PA 2R4BA 3KRRA 3MDYA 3ERKA 4CD0A 5IA1A 2KULA 2UW0A 4XX9A 3U6HA 2HW7A 5KKRC 1YXTA 3ZO3A 4C3PA 2Q0NA 4HPUE 2G01A 4R3RA 3SA0A 2IW9A 1F3MC 3S3IA 5M55A 1AQ1A 2UW3A 4ZJIA 3T3VA 3WF5A 4YNOA 3FI2A 2Q83A 3TYKA 4FTIA 2G2IA 2OG8A 5ANIA 4YURA 5JRQA 3AOXA 4NM5A 3GEQA 4O0YA 2B0QA 3QUDA 3QTRA 5AAGA 5T68A 4GFGA 5GJFA 2O8YA 5LWMA 2XKDA 4E6CA 4NFNA 3A7HA 3BEAA 3NNWA 2GU8A 4JDJA 4TPTA 2A4LA 4U5JA 1Q99A 2W1EA 5A46A 4D1SA 1VJYA 3VC4A 4DEIA 4C4JA 2J90A 3WI6A 4QQCA 1UWHA 2YCRA 3TN8A 1M14A 5LARA 2UZDA 2Y4IB 4AZFA 5E91A 3P78A 4Z3VA 1Q8UA 4CTBA 3ROYA 3O50A 2GQSA 3N4VA 3ENHA 1H24A 2BTRA 2YDIA 5ANOA 2IJMA 2C6MA 4AN3A 1Y57A 4BCPA 5CEPA 3WE8A 3GC8A 1SNUA 4MYGA 3TJDA 3DTWA 1UU9A 4CYIA 2GTMA 3W8QA 4GEOA 3V5QA 1O6YA 1IR3A 3C9WA 4F1MA 3DLZA 3MA3A 4CFWA 5CI6A 4APCA 4JDHA 3G6GA 2A19B 4ZXTA 2XEZA 3V5PA 2WO6A 5EKNA 2F9GA 2HWPA 2WTIA 3R63A 5HG9A 2H34A 5AUXA 4FIGA 3CC6A 3FWQA 5I9VA 3A8XA 4I24A 4BWPA 2DUVA 3D94A 4ASDA 1J7UA 3E88A 5IA3A 3FDNA 2F57A 3BPRA 3AMBA 3B8RA 3BWFA 3LMHA 4HGTA 5IQDA 4WD5A 3LCKA 4Y95A 2YIYA 3PJ3A 4PMPA 3DKGA 4X21A 3TTJA 2VWXA 4O0XA 4RIXB 3Q9ZA 4FV4A 3II5A 5HE2A 4BKZA 5EM7A 4XG4A 4V04A 3GFWA 5A3XA 4NH1A 3ZC5A 2ITNA 5EOBA 5M4FA 4IX4A 4QD6A 1Q8WA 2HK5A 4W4XA 5HTBA 2C6LA 3RZBA 3LFDA 2BKZA 3KMWA 4QTEA 3WARA 2IVTA 5M07A 1H1SA 2NPQA 3EZRA 3F2NA 5BVEA 3VO3A 1OMWA 4AZSA 4O83A 1V0OA 3IONA 3QF9A 5FM2A 4EH3A 4KBAA 4EUTA 1Y8GA 1GIIA 4QYYA 4YC3A 3W32A 3A62A 5EDRA 4B6LA 2W1IA 3REPA 3PA3A 4IWQA 4YBKA 5CSXA 5J8IA 1Q3DA 4DA5A 3R71A 3ZSGA 4QMSA 5BVOA 4N6ZA 2VO3A 3EFLA 3E64A 5CNNA 1CKPA 4NU1A 3PLAE 2AQXA 4EOKA 4HYIA 4FSMA 4S2ZA 4XLVA 5D11A 5HICA 3VHKA 3NW7A 2BFYA 3I0OA 5CQWA 5ANDA 5BVKA 4GT4A 3IDCA 1WBTA 3P79A 4YTFA 2E9NA 2PY3A 3ACJA 2KTYA 3KL8A 3OW3A 3KCFA 4PMTA 3ZRMA 2OO8X 2BTSA 2A2AA 4XLIA 1MRVA 4PP7A 1K9AA 4J96A 3M42A 4E20A 1QMZA 2J2IB 2LGCA 3FLZA 3I81A 3QU0A 5EK7A 1XH8A 3KCKA 4XP0A 2XBJA 4WRGA 4CEGA 3FC2A 3OCGA 3CY2A 4QQTA 4ZY6A 1NA7A 3MB7A 2WGJA 3VBWA 4W8DA 2C5VA 5EYMA 4APPA 3DJ5A 4QTBA 3CR0A 4GG5A 2JGZA 3R00A 4FBXA 4UMPA 4LOPA 4TKSA 3M11A 4BDCA 2ETRA 5BVWA 3QQLA 5ANKA 2QQ7A 2UW5A 2WMAA 3CJFA 5D10A 2W1FA 3SLSA 2V7AA 4D58A 3Q5IA 4L8MA 4BDBA 4G3GA 2QKWB 2VX1A 4RSSA 4BWKA 4R8QA 3MIAA 4F65A 4O7VA 3W0OA 2W9FB 5KHWA 3OCSA 3BQRA 4C4IA 3R7UA 5E7RA 4UB7A 3SD0A 4X6QC 5GINE 4IAAA 2VGOA 2BKKA 1WAKA 4AA0A 5AWMA 3U4WA 4RFZA 4BHNA 4USDA 2Z60A 1G8JA 2CGWA 2JLDA 3DK7A 3LHJA 3QZHA 4I4FA 5AIKA 2X81A 1M2QA 2XK8A 3BU3A 4C33A 1WFCA 3ZRLA 3RM7A 3ZZEA 3F7WA 3R1NA 3PWYA 4V0GA 4QP1A 2ZV9A 2O0UA 2ZDUA 3BLQA 4EUUA 3DXPA 3UC4A 2CGUA 3KREA 4J98A 2R3NA 5AV0A 3QX4A 5E1EA 5LMAA 4U43A 3A61A 4R3CA 2GSFA 2QONA 1SYKA 4P7EA 3SV0A 3E7VA 1IA9A 2B54A 4KINA 4IAZA 4USEA 4K77A 4DFBA 2V0DA 2ZYBA 2QHNA 4QNAA 3GU6A 4UZDA 1ZOHA 2C6TA 3DPKA 3NDMA 3QQKA 3PSBA 2CKPA 4P90A 2CKOA 4EBVA 3MJ1A 4I41A 4AX8A 4O4CA 1R1WA 4FG7A 2PVJA 3EQBA 5EDQA 5D1JA 4IVDA 5IQEA 4RX7A 3NUSA 4D5KA 2XK6A 4I20A 4K1BA 4HVDA 2PU8A 3OWLA 4FNXA 2UZTA 2PVNA 4FNYA 5AV2A 3RK9A 5JGAA 2J0MB 2VTHA 1P2AA 3ZO4A 3FLSA 4PNKA 4FEXA 4JL9A 2YACA 3DNEA 2G2HA 5HNBA 3L8VA 3PIYA 3SG8A 4F78A 3FHIA 5IH5A 1GZOA 4GCJA 4LMNA 3H9RA 3PXYA 4DEHA 1QL6A 3Q6WA 3MB6A 1Y8YA 5CEOA 4YMJA 2ZDTA 5KZ0A 4QP4A 5C03A 3RPOA 4C62A 2X8EA 1REJA 2JFMA 4MXCA 3A7IA 5HBJA 4BR3A 3NFGB 1SM2A 4CQGA 2PVRA 5FEEA 3UZPA 4DFLA 3VWAA 5HX6A 4BZDA 4QMVA 5E8SA 5DT3A 4X3JA 4BF2A 4ENYA 3U6IA 5BYLA 5BQ0A 3VUIA 2JKKA 4YTIA 3THBA 2W5HA 4M7IA 3EN4A 3NIZA 5CVGA 3FXZA 3W0QA 4ZLYA 3LKMA 2C6IA 2R3FA 3R7YA 1U54A 5DT4A 5DYJA 2WTVA 3UO6A 4BIEA 4E5BA 4M8TA 4LM5A 3NSZA 3R2BA 4ZTMA 3E8EA 3TG1A 1W8CA 4Y72A 5GNKA 4BTJA 4EORA 2WEVA 3QZIA 5EM8A 3NLBA 5BVNA 3ZBXA 5JQ8A 3OHTA 1PXPA 2R0UA 3HZTA 4JRNA 4QOXA 4BGHA 3VBXA 1ZZLA 5HBHA 4FTLA 3UZTA 2C47A 4LL5A 4MBIA 3VJNA 2WXVA 1JQHA 3KULB 1V0PA 4XBRA 3K54A 4WBBB 5EH0A 4AXEA 4GYGA 4QMYA 4XOZA 5HD7A 4BCNA 5C01A 3EKNA 4TYEA 3PUFC 5HO7A 4F7LA 4L3PA 3MIYA 1BL6A 1LEWA 5CXHA 3W2OA 3FLYA 3LJ1A 2GMXA 4FNZA 1KWPA 4QYEA 4IVBA 5J9LA 2VO6A 3ZFYA 3PXRA 4U40A 3OP5A 3IGOA 4E6AA 5E4HA 4EH2A 3BYSA 3OD6X 4H36A 3MY5A 3DBCA 2W4JA 2VWBA 4PDSA 1UU7A 2CN5A 3JVSA 4B9DA 4QDVA 5IQCA 3FMNA 3FXWA 3IKAA 1PMUA 4DFNA 2QOCA 5CU0A 3B2WA 4O38A 5FQDC 5FDXA 3UZRA 3ZRKA 5ACKA 3LZBA 2XIXA 4ZZOA 2YHVA 5I9UA 3BQCA 4QPMA 4O7ZA 3DDQA 5CVHA 4DFYA 4EHGA 3OXIA 1M52A 3HAMA 4PL5A 3F88A 4XG6A 2G2FA 2XALA 3IDPA 1YXXA 2FVDA 5LWNA 5CU3A 3PY1A 5FXSA 4DH7A 2UZNA 3LLAA 4MXYA 1UNHA 4FT9A 5BVDA 4EHEA 2AEGA 4PY1A 3FZ1A 4ORKA 4F7SA 2JKMA 2PVFA 3POZA 5CY3A 3QTZA 3E8CA 4GS6A 2XYNA 4FT0A 3EQCA 3I5NA 5HO8A 5HOAA 4R5YA 3UO5A 4RA5A 1Y6BA 3MPAA 2JD5A 3C51A 4DGNA 5IQHA 4FV2A 3E3PA 4HVHA 5BUEA 1Q5KA 2IO6A 5LVLA 3BL7A 2X9EA 3GOKA 5M4UA 1XH6A 4L00A 3LXNA 4F63A 4NT4A 2VNWA 1SNXA 3COIA 4JBVA 5AUWA 2EB2A 4TYHA 3AQVA 2IW8A 5DMZA 3AC8A 3K3IA 3L8SA 3IW7A 5EKOA 5AX9A 4PTEA 2WPAA 2UZVA 5C9CA 4CFUA 4O6LA 4DBXA 4R7IA 4F6WA 3A99A 3MPMA 3QAME 4UXQA 1VYWA 3UMWA 1BUHA 2FYSA 4DEEA 5ANGA 4EC8A 2X39A 4DCEA 4EKLA 5M44A 3W2CA 2YDJA 4L53A 3MVLA 1SMHA 4BTMA 2QHMA 3H10A 4TWOA 3C4WA 5HVKA 2BZHB 2WELA 4YHJA 4E5AX 5CT0A 3NUNA 5FLFA 3WZEA 2XZSA 1M7QA 4DGLC 1W2CA 4ANBA 5LVPA 4FL3A 3V3VA 4KBKA 5IQBA 2CPKE 3ALOA 1QPDA 2YIQA 4Q5HA 4ANMA 3PXFA 4EOJA 3CBLA 4UYAA 3LM5A 5C8KA 4PMSA 3A4PA 4O6EA 5TO8A 2PUPA 4PMMA 4IM0A 3G9NA 2PYWA 1RDQE 5HORA 1BI7A 3ORMA 1U5QA 4HYUA 4O0VA 4C61A 4I0SA 3D14A 2OXDA 3LMIA 4FSNA 5ETAA 3WF7A 2BHEA 1MQ4A 3FYKX 3LVPA 5TT7A 3NUXA 4MH7A 1GZ8A 3HDNA 4B8LA 2YAKA 3TUDA 4AQKA 5I9XA 3EL7A 2PUIA 3GC0A 4FJVA 3HECA 4ZZMA 3RAHA 1UVRA 3BYUA 3HEGA 4AQCA 1O6KA 5EM5A 3V01A 3D9VA 3A7JA 4FG9A 4RJ7A 4U9AA 4ZSEA 1YXSA 3W2RA 2WD1A 4QMUA 2VO0A 1W0XC 2B9FA 3R8ZA 1OGYA 2CDZA 5GZ8A 4JI9A 3R9NA 3EH9A 3MH1A 4J99A 4OTFA 4CYJA 2J9MA 4F09A 5B7VA 1H01A 4WSYA 3I79A 4QMNA 4FKTA 3BGQA 4RC4A 1TKIA 4KIPA 3LCDA 4W4VA 4CSVA 3OVVA 4UMRA 2VO7A 3F5XA 4AF3A 4A9UA 4MXZA 5CSWA 5L8KA 3MV5A 3NYXA 1OBDA 4Q5EA 3DT1A 4NTSA 4LYNA 5BNJA 3Q5ZA 1JNKA 4TN6A 5H8BA 4TYIA 4BCQA 4CKIA 4DYMA 2F7ZE 2G9XA 5AV4A 5FXRA 1T45A 3TIZA 2WMBA 5K4JA 2EUFB 1Y6AA 4EZ5A 2W1HA 5DT0A 4C02A 2C68A 4Z9LA 3Q3BA 3P9JA 3CQUA 1AD5A 4MK0A 3BHHA 2ZB0A 4TL0A 4FL2A 2QI8A 3QRTA 2PL0A 1YVJA 2VV9A 4FV5A 2RFSA 3TKUA 1L3RE 4O7YA 5HG5A 3QC9A 2ONLC 2ITVA 4KIKA 4LV8A 2EVAA 2I0HA 3QX2A 4TXCA 3PYYA 4BN1A 1J7LA 3OS3A 4MF0A 4FVQA 2A98A 4E4MA 4DH5A 1OBGA 2XB7A 2OZOA 4EYJA 4BJJA 4BCIA 5AR2A 3C13A 2VWVA 2CHLA 4IJPA 5LOHA 1R39A 1FGKA 5J5SA 4FSQA 2W1CA 1PW2A 2R64A 3DGKA 3VJOA 3SG9A 3AGMA 4AFJA 4Q9ZA 3QTUA 4BZNA 4CFMA 3FLQA 3AD6A 3VVHA 1Z5MA 2YIRA 4MBLA 1UV5A 2UZWE 3KA0A 3V8SA 4YLKA 4UZHA 1APME 4IFCA 4KIQA 4RQKA 1CKIA 3KFAA 4BIDA 4CV8A 2GHLA 4JNWA 4ZTQA 1EH4A 3NPCA 3R7EA 4O4BB 3OOMA 5CWZA 2OIQA 5LQFA 3P4KA 5FD2A 1JAMA 4M84A 2XKEA 3SAYA 4B7TA 3BBWA 3EHAA 4UBAA 4D4RA 3HP5A 4Y5HA 3DAKA 4FTRA 1ATPE 1OL1A 1IA8A 1YHWA 3PXQA 3L1SA 3QGWA 2QU5A 4JS8A 1WBSA 2B55A 3TT0A 4CXAA 2W1ZA 2BCJA 4MVFA 2CSNA 2BRGA 2HZNA 4U3YA 4ZLZA 4GW8A 4V0GB 5E8TA 2IVUA 2REIA 3FY2A 2C5NA 3FMDA 2XNNA 3COMA 2VNYA 4O7RA 4X3FA 1VZOA 4QMMA 3C5IA 4D2RA 3U55A 3BELA 3C0GA 4ARKA 5A4TA 3HA6A 4MNEA 3MH0A 2XRWA 4Y83A 2HW6A 4KSPA 4YJOA 3UYTA 5F20A 3S4QA 3KC3A 4QMWA 4JT3A 2C1AA 5GIPE 2GNFA 2AYPA 2WZJA 5LJJA 2PVKA 4JR3A 3V5WA 1ST0A 2XKFA 1OITA 2P33A 4M3QA 4TNBA 1P4OA 3KXNA 4YJUA 4D4YA 3LFQA 1UWJA 3MH3A 2PTKA 2WKMA 4USFA 2R5TA 4C34A 3IW5A 4WKQA 3JS2A 4XG9A 2C6OA 4DINA 2E9OA 4M0ZA 1PXNA 4XYFA 4G3EA 2X6DA 3OG7A 4BVUA 4BCMA 1BMKA 3D83A 4A4OA 4C57A 3NMUF 3QD2B 1RW8A 2XJ1A 3FZPA 4FR4A 3POOA 4IM2A 4RVKA 4WNKA 5A54A 2UW8A 3VS3A 3VUKA 4B4LA 3UVQA 1ZMWA 3K5VA 4OT6A 4E93A 2F2UA 1PYXA 1YI6A 1OKWA 3ODYX 4FX3A 5AP7A 3VBTA 2Z7SA 4EK3A 3EN6A 3Q9YA 2Z7RA 1YWRA 2VTJA 5L2TA 5I5ZA 4QP8A 5L8JA 4RIYA 2RGPA 3UG1A 3TEIA 4PDOA 2PVYA 4PPCA 4YZBA 3RHXA 4BYJA 1YI3A 2R3MA 1L8TA 4RJ3A 3VN9A 3R8MA 5M4CA 2G1TA 3UP2A 5IQFA 1OIUA 5CENA 3Q6UA 4GMYA 4FEWA 1SVEA 2Y0AA 2YJSA 3TACA 3PE2A 4IAIA 4EKKA 4DAWA 4RPVA 4I92A 1U54B 3RAKA 2B1PA 2PE2A 4BBFA 1H26A 1M7NA 2EWAA 1GIHA 3OROA 4YHTA 3ZU7A 4X2KA 5C8NA 4IZYA 3ZLXA 3DXNA 1B6CB 4PDPA 5E8UA 3HVCA 3K2LA 3ZTXA 1H1RA 2PMLX 5J9YA 3F3UA 5AEPA 4K18A 3ANRA 1OM1A 2YCQA 2X4ZA 3C4FA 4XV9A 3CSVA 5KNJA 4JX3A 2F7XE 3EMGA 2VTMA 5D41A 5EQEA 4ZMEA 4M67A 4OTIA 3JXWA 1YQJA 3DJ7A 3MY1A 4JG8A 2WMTA 4K9YA 4NKSA 4E7WA 2XNGA 2YFXA 2WMRA 5E9EA 3IK3A 4P4CA 1XMLA 4FRFA 4M13A 1LEZA 3OXTA 5FM3A 2XIZA 2YLEA 4GK4A 2WHBA 3VRYA 2VU3A 4CLIA 3V6SA 4U7ZA 2OH0E 3H30A 3SGCA 1M2PA 1XHAA 4RC2A 3KRLA 5AP0A 4M12A 4RC3A 4J52A 5DEWA 1KOAA 3SXSA 2JKQA 5HHWA 5AV1A 2BHHA 2QOBA 2X0OA 5M4IA 5IA0A 3HX4A 3MTLA 4QRCA 2JIIA 4GKHA 3KQ7A 1ZZ2A 2CN8A 4NCTA 3S0OA 4ZOGA 2ETKA 3LMGA 4XJ0A 4MQ2A 2NRYA 5ANEA 2OSCA 5EHOA 4ITIA 1WBWA 4DC2A 5A6OA 3S00A 3PJ8A 1J1CA 1VYZA 3DFAA 2H96A 5EFQA 4L3JA 2DS1A 4R3PA 4C8BA 3AC4A 4XG3A 3RI1A 1Z57A 5HE1A 4OUCA 4E6DA 4HVSA 1MUOA 2WMWA 3CTHA 2IF8A 4HYHA 3LW0A 2XVDA 3TKHA 1ZAOA 2XCKA 4LRMA 5EYCA 4MEDA 3SRVA 3SXRA 4QPAA 3RP9A 4DCAA 2QOLA 3OZ6A 3I6WA 5G1XA 2IZUA 2R0IA 1G5SA 3D7ZA 4DHJA 2XNOA 3G0FA 4DHIB 4EH7A 3UNJA 3BYVA 4I21A 5ETIA 4ASEA 4K8AA 4RWLA 1OZ1A 2O63A 3LJ0A 3WZUA 4IBMA 3T9IA 4PX6A 4ZS4A 3JYAA 1GY3A 3OUNB 5FRIA 3UE4A 4FGRA 1OKZA 3A60A 3R6XA 3VS1A 3R30A 5KZIA 2WQBA 4MAOA 4DFZE 3FUPA 4CMTA 4BCHA 3D5VA 3H3CA 3UOJA 4QQJA 4CG8A 3VBVA 4QMTA 1OL5A 2OF2A 2ZAZA 3A2CA 4RVMA 5AUTA 1XMMA