3UQCA

Structure of the intracellular kinase homology domain of rv3910 at 2.2 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
246
structure length
246
Chain Sequence
VQLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 65
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uqcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uqcA01
4GJ2A 3JVSA 4H36A 1HCLA 4QYFA 5M4IA 4YO6A 3FZ1A 3AC3A 3IW7A 4ENYA 4TWNA 3UTOA 5KZIA 4X21A 3VQHA 4E5BA 3R2BA 2XKEA 3QTIA 2WD1A 2IW8A 4M67A 2HCKA 3MB7A 2RL5A 2BRGA 2PMNX 4PPBA 3OVVA 4AZWA 2CPKE 4C3FA 2XH5A 1DS5A 4LOQA 4O82A 3OWJA 4MWHA 3FMKA 1PMEA 3MH2A 3UE4A 4D5HA 3WZUA 1UU9A 2VO3A 4L44A 2WZJA 4MHAA 3PPZA 2YM5A 4FTTA 3D7TB 3GU5A 5HLNA 2PHKA 4M0YA 4RX7A 3KMWA 5IG1A 1W84A 2CCIA 3FKNA 4IFCA 4NU1A 1O6KA 2PMLX 1NVQA 5CY3A 2QU6A 4FKVA 4JG7A 3LQ3A 2YDIA 4U9AA 4L7SA 2ZAZA 4BBMA 4PRJA 2R3FA 4EORA 3UIMA 3ORPA 3KVXA 4PNKA 4IVCA 5DEWA 1O6LA 2YM4A 3BEAA 1JPAA 3KMUA 3ZBFA 4Z3VA 2PUUA 3VW6A 3VS1A 4O1OA 3FXWA 4YZDA 1F5QA 1PJKA 3KQ7A 2BDFA 4CFFA 3RP9A 3Q6UA 4JRNA 2IG7A 3E7VA 3PSDA 3PDTA 4MNFA 4PV0A 4WSYA 5ACKA 4EH6A 3G9NA 5IQGA 2PZPA 4NK9A 3TIZA 4D28A 4YPDA 1ZZLA 2GDOA 4DN5A 3R8PA 3NW6A 1OL5A 3D5VA 4G1WA 3UZTA 3IW6A 2GSFA 5EFQA 5CZHA 3TZ8A 3PY3A 3RK9A 2ZMCA 5L2QA 2ZV7A 3H9FA 2WELA 1ZYDA 1YHVA 3WI6A 2ITYA 5CVFA 4DEDA 4F08A 4KKHA 3LJ0A 3VS6A 2OSCA 4IFGA 5HO6A 1KWPA 3DPKA 4YJQA 2EU9A 1B38A 1LEZA 5FM3A 2RG6A 3MY1A 1DAYA 3FQHA 4FNXA 4FZAB 5HIBA 3ZC6A 4EOOA 3C4EA 3R9RA 5M09A 4KRCA 4IEBA 4A9RA 1M2PA 3WYYA 2OK1A 4FL2A 4DHFA 2JFMA 3QCSA 2C1BA 3IPHA 3GU8A 5ETCA 3V51A 4R3RA 2OJGA 2J90A 4UV0A 3U8WA 1VZOA 5CLPA 4WKQA 3SDJA 4BCHA 4U81A 3SX9A 3OP5A 3VAPA 5HQ0A 2H8HA 3SKCA 2W96B 3OCGA 3VN9A 3TM0A 4QP7A 4QP6A 3C1XA 5ANKA 4AZFA 1AD5A 3A7JA 3D94A 3SW4A 5IMXA 4DBXA 3WF7A 5IQCA 4GJ3A 5E8ZA 2JDVA 3PVGA 4TYGA 2WTVA 4RZVA 5CZIA 3LZBA 1R0EA 3ROCA 2HW6A 5JN2A 3PXYA 5KBQA 1I44A 4A07A 4H3BA 5DR9A 3BGPA 2GNFA 2OF2A 4GT5A 3E64A 3U55A 4U0IA 1UNHA 2PUNA 4H39A 3UO4A 2PULA 3ZLXA 4TY1A 4FSTA 4BTKA 4WUAA 3DBEA 3FMJA 4BIBA 3O96A 4Y72A 3NUUA 4ANBA 4S30A 5J5SA 4TN6A 4GK4A 5GHVA 4I0RA 4NUSA 1W7HA 4OGRA 4RMZA 2W1DA 3F3WA 5EW9A 3WE4A 2ZM3A 4TT7A 3ALOA 4P5ZA 1R1WA 3MS9A 5BNJA 2JDOA 2X7OA 3HYHA 3IS5A 2BILB 3EYGA 3FZOA 2QOKA 3QQKA 3TUCA 3OEZA 4O83A 3D5WA 4WNMA 3IOKA 4MX9A 4QP8A 1RQQA 4L3LA 2ETRA 2XJ0A 3CQUA 3RWQA 4QTCA 3FLYA 2CNUA 2HOGA 1FINA 3UQFA 4NZWB 4K33A 4I20A 1ZARA 5E8TA 3FHRA 2CGUA 5DR6A 3WF9A 2YA9A 2ZB1A 1EH4A 3BHUA 5CU3A 2R0IA 4GK3A 5TO8A 3R8VA 4FKWA 5HE1A 3VBTA 5DHJA 1GZNA 4NFMA 3NW7A 2YIWA 4GFGA 2QHMA 2P2HA 4GYIA 2BAQA 4QRCA 2J5EA 5DFPA 4EBWA 2XK3A 5A4CA 2DS1A 3R9OA 5C8NA 3C0HA 1Q8WA 2JEDA 1OBGA 4ZMEA 4R5SA 4DT9A 3D15A 5FRIA 4FTUA 3TV7A 3QKMA 2BZIB 3MH3A 3OY1A 4YJSA 5CQWA 4BYJA 3FY2A 4FNZA 4AF3A 3AXWA 3OCBA 5FP5A 3N4TA 3KRRA 3MESA 3UG2A 2YJSA 4XRJA 4EOPA 2R3KA 3I1AA 5DGZA 2RSVA 1WVYA 2EB2A 5CASA 5IEXA 1K3AA 2OLCA 3R1YA 3Q2JA 4EUTA 5HE0A 5J95A 1TQMA 2CLQA 4RQKA 5FTGA 2GFCA 3CKXA 4FV1A 4YTIA 3GGFA 4KD1A 5DBXA 3I60A 1FQ1B 2QOHA 3HNGA 3OW4A 2HWPA 3V5PA 3BYUA 2GCDA 3AC5A 4A9UA 2JITA 4D1XA 3PY0A 3VS5A 3DV3A 4JG8A 5HE2A 4BDJA 3ZRLA 1ZMUA 5CU2A 5IZFA 2HWOA 4ZOGA 5I3OA 3L8SA 4KKGA 2AC3A 3RALA 4AOIA 2BRBA 2VZ6A 3O50A 3PFQA 5F1ZA 4B8LA 1P14A 4CMOA 3MVMA 3LXNA 2BMCA 4QT1A 3RINA 3DQWA 1BX6A 2VWXA 2YFXA 4GUEA 4YZ9A 5C27A 4U3YA 5A54A 3GNIB 1M7NA 1MQBA 3WARA 3VULA 3LFDA 4GG7A 5AUYA 2UZOA 2PSQA 2XM8A 2QLQA 5H9BA 1JLUE 4EOMA 1UA2A 2YLFA 4GIHA 3LCDA 4QMVA 4DCEA 3OXTA 4O7VA 3BX5A 4AW1A 5CXZA 4RG0A 3ET7A 5D11A 2JKKA 3WE8A 3R6XA 4UMTA 5EDPA 3VQUA 4WNOA 3AD5A 1ZYSA 3OOMA 4AFEA 5BVFA 1ZOEA 4JG6A 4JI9A 4ZP5A 3VBVA 5LMAA 2IO6A 4YTHA 3PIXA 2B54A 3FMDA 2X4ZA 3FMEA 3FBVA 3K3JA 2PL0A 4YJVA 1P2AA 4D2VA 2YCRA 3SG9A 4FI1A 4P2KA 5C01A 3QU0A 3RBWA 4BZOA 3KFAA 3U54A 3SV0A 3M2WA 4IM2A 3V8TA 2W1CA 1UNGA 1OM1A 3SA0A 3BGZA 4FYOA 3SOAA 3OUNB 2BTSA 3LJ2A 5IH6A 1DI9A 2ETKA 2ZMDA 1CKPA 3MJ1A 3OWLA 3QTWA 3QZGA 4XH6A 2QOIA 4FSZA 3CEKA 4EQMA 4WHZA 3LXKA 4LOPA 5HVJA 2CNQA 3RPOA 4ANSA 1W83A 1CM8A 3K2LA 4D1ZA 2YM3A 3L1SA 3V5LA 4CFWA 3ZEPA 3CP9A 5CEQA 1LP4A 3ORMA 3IDCA 3NCGA 4E20A 1OI9A 3NEWA 5CU0A 3C0IA 4D2TA 2OJ9A 4F64A 3CQEA 1SNUA 5AR5A 2OIBA 3QQJA 3R7GA 3LFFA 4V0GA 1Z57A 4YC8A 4CKIA 2C6DA 4W4VA 5AWMA 3VC4A 3KRXA 4LG4A 1WVWA 3TNHA 3ZCLA 3ZEWA 3O23A 2X7FA 3QA0A 4ZSEA 5DR2A 1R0PA 4TTHB 3FI3A 1F0QA 2B0QA 2JIIA 5AR2A 2UZEA 2VTTA 2UV2A 3ORXA 3P7AA 4ITHA 3WIGA 3ZTXA 4C8BA 4F70A 3U9CA 4IZAA 4BHZA 1GNGA 5A4TA 4FUYA 4IVAA 3MYGA 5CAPA 3H10A 3O7LB 4QMMA 2X7GA 3M42A 3MV5A 5C1QB 4FT7A 5D7AA 3NSZA 3GU6A 3QZFA 4ZTHA 1NVSA 3F5XA 4QYEA 2XNNA 4D0WA 1M14A 4L68A 4IJPA 3HV6A 3DJ6A 4FC0A 1UWHA 3TV6A 3DDPA 2GNJA 4QPSA 1UWJA 3EKNA 1BMKA 2VWVA 3IW8A 1H01A 4E6AA 1YQJA 1GJOA 4G6OA 4OTHA 4V0GB 1OIRA 5AP5A 4DH7A 3DK6A 3ORLA 3LMGA 3Q9WA 3OT3A 3QKLA 3HV3A 2VTJA 2UW0A 3MVJA 3MA3A 4BBFA 2UZWE 3D7ZA 3I6WA 3AC2A 4QPAA 3PSCA 3ROYA 3I0QA 4TYEA 2BZJA 4DGMA 2JDTA 4FGRA 3UYTA 1CSNA 5L2WA 5GINE 1OL6A 5ETFA 4DTBA 3N4UA 1ND4A 2C0OA 2ERKA 5FXSA 4XV2A 5JZJA 3L9NA 3OROA 3BHVA 4PPCA 4KNBA 3R1QA 5DT0A 3RK5A 2JD5A 2GHMA 3E87A 4RC2A 3AC8A 4UMRA 3TNIA 5HG8A 3PLAE 4E7WA 2C5NA 4A9TA 3G90X 4FE2A 1Y57A 3LQ5A 4XV1A 3CY2A 2IVTA 5HBHA 3UOKA 3O8TA 2C47A 3KY2A 5AR7A 4IB1A 2VX0A 4C0TA 2PVNA 4KINA 4KIQA 2WNTA 3UVPA 3AD4A 1PXJA 3AC1A 5EYMA 2VRXA 4IC7A 3C4ZA 3RKBA 2WMAA 1SNXA 4G3CA 3JR1A 1ZMVA 3SQQA 4NKAA 2R3NA 3TJCA 4IAFA 2A19B 3PA5A 1STCE 3JVRA 3PPJA 2Z7QA 2UW3A 3QQLA 3UGCA 4BDHA 4JOAA 5EQEA 2W4KA 5DN3A 3C4FA 3EOCA 1A9UA 5IUIA 5FGKA 1YDSE 3ULZA 4UBAA 5CSPA 4PTGA 3QZHA 2WHBA 3V3VA 2CKQA 4O7ZA 4G3EA 3PXKA 3GFEA 3NYXA 5HG7A 5ANOA 4HCVA 5BYLA 5JFWA 2IZSA 3HP2A 2BAJA 4FSUA 5AP6A 4PP7A 2ITVA 4BI2A 2BIYA 1PKGA 1IAJA 1JSVA 5FTQA 4XLIA 3L9PA 4QYHA 1IASA 4IZ7A 1PRYA 3HX4A 3KGAA 1GIHA 4X2KA 5AAGA 1H1QA 3Q9XA 5LVMA 3TN8A 1JQHA 5ANDA 3FZPA 4IX3A 3SAYA 1JKKA 5EYDA 3GCPA 3CD8A 2OH0E 5BMMA 4CEGA 3TXOA 3I4BA 3OXIA 2QLUA 4HGSA 3MB6A 2J7TA 2QOLA 4IX6A 3HECA 4DEEA 2ZOQA 5BYYA 2XUUA 4L9IA 4HOKA 5T68A 4FOBA 2WMUA 4FKJA 4PNIA 1QPDA 4OT5A 3ZLYA 5AR3A 4G5JA 2IW9A 3ZUUA 4MNEA 3D4QA 3DCVA 2Z8CA 4WO5A 5D1JA 2JFLA 4AW5A 3IGGA 4CTCA 5F94A 4AGWA 2W17A 4Y8DA 3FLZA 1UKHA 4CNHA 4ZZOA 1J3HA 1V1KA 2OIDA 3MFRA 2DUVA 3C4WA 3LAUA 3Q4UA 3R8UA 3W55A 3PPKA 3QRTA 3NUSA 5FBOA 2WFYA 3D14A 3NWWA 4O0WA 4FG7A 3TDVA 2WAJA 3QZIA 3IK3A 5AX9A 4FODA 1OL7A 4BGHA 3KN5A 3QYWA 4U43A 1DM2A 1UKIA 5M08A 4N70A 3NNUA 5E90A 3VRZA 3HDNA 2C6IA 3LFBA 5EM7A 1Q3DA 2H6DA 4ANNA 4E6CA 4FV3A 3LFSA 2Y4PA 4C2VA 3QQGA 5L8LA 2R3MA 2VWBA 2YJRA 3P7BA 4FT9A 4H58A 5K5NA 2O5KA 4YC3A 3DJ7A 4FZ6A 4MD8E 4CG9A 1DAWA 4W4WA 4Y95A 4ZLYA 3FV8A 4QO9A 1GY3A 2XNOA 3ZONA 5AJQA 5AM6A 2VTRA 1KSWA 2UW6A 2UZDA 4NCTC 4XLVA 5K0KA 1OKZA 4MNEB 4QMQA 3LIJA 2BIKB 5E1SA 4FIFA 2VTOA 4P5QA 2C5YA 1XJDA 4GS6A 4RGJA 4QMTA 4FV9A 4FT0A 4KAOA 4E3CA 3LKMA 2ZDUA 3LFCA 3LCSA 3R7OA 4ZSJA 5EW3A 3Q5ZA 4R7HA 2PPQA 5E8VA 3FZTA 3CIKA 3KREA 2GTNA 4GT3A 4PDPA 4TRLA 1KOAA 2YM7A 4CT2A 5GIPE 5LVNA 4RBLA 3HUCA 2HAKA 4BGGA 4CKJA 4AWIA 4QP4A 3KRLA 2CKPA 1GOLA 3AMAA 4L3JA 3UP2A 3DAJA 3PXFA 3RHXA 2UZNA 1MP8A 4WBBB 5BYZA 4L53A 3NR9A 3QUDA 4J97A 4FICA 3PZEA 3ZRKA 3R1SA 3WILA 1ZYJA 3R1NA 4JVGA 2YISA 4BDIA 3NUNA 2XNPA 3F88A 2HZ4A 1Q4LA 4YJRA 3C13A 4JBQA 3T3VA 4O91A 2F49A 3CQWA 5EH0A 2O63A 2VAGA 5T3QA 4EJNA 5M55A 3R7VA 3PVBA 2YERA 3O7LD 3QHRA 4YJOA 2C6TA 2BAKA 5D12A 3R9DA 5L8KA 2PMOX 2YHVA 3EHAA 4BFMA 3NCZA 2W1HA 1FOTA 4ZAUA 2JDSA 3O2MA 4EZ5A 3KN6A 1WAKA 4AG8A 5HTIA 3ALNA 5LCKA 2HENA 2UW4A 4YGAA 2DWBA 2PU8A 3NNXA 1WMKA 4FV6A 3NGAA 4YLLA 5K3YA 2RFSA 4ALUA 3O8PA 1ATPE 4O2ZA 4RIYA 3VS7A 5BVDA 5LMBA 4RC3A 5H8BA 4FKLA 5JT2A 3VWAA 4IAIA 3II5A 2R7BA 3MW1A 5DNRA 4X2JA 4F0GA 2G2IA 4BICA 4F4PA 3GC0A 5JFVA 4FT5A 4L00A 1REKA 4DA5A 2I7QA 3PXZA 2WMVA 3DA6A 5F4NA 3W33A 2GPHA 4F09A 3H0YA 3KMMA 1OIYA 4RJ8A 4HZRA 3LPBA 3N51A 4JRVA 2B55A 5AUWA 4H1JA 4ACMA 2ITQA 1HOWA 2X8IA 5CANA 2GFSA 4X3JA 5IA0A 1JKSA 3TEIA 3QC9A 4GT4A 4OW8A 4U97A 1YOLA 3IGOA 2RIOA 4UZDA 1KV1A 2GHLA 4E6DA 2JGZA 3QALE 5E91A 2PZYA 1OITA 4MXAA 4CT1A 4NCTA 1Y6BA 2I0VA 5J87A 2XRWA 4JL9A 4F63A 5DMZA 2B53A 3KA0A 4M3QA 2JBPA 5GJGA 2XIYA 3IOPA 3ACKA 4JJRA 4UEUA 4U7ZA 3L8VA 5T6KA 1OIUA 4FG8A 4XP2A 4RIYB 3VBXA 5FWKK 5CF4A 5JK3A 5KMLA 4F7LA 3OY3A 3S4QA 4ACDA 1G3NA 4IWDA 2CN5A 4GG5A 5H2UA 5F20A 1KV2A 2VTLA 4YZCA 3AGLA 3DLZA 4QNYA 4C37A 2YDKA 2V0DA 3FZSA 1KE8A 1YDTE 4K1BA 4XHKB 3UIUA 5ETIA 3FAAA 3FQSA 5E9EA 2P3GX 3A7GA 1OBDA 4UX9A 1UVRA 2EB3A 3BEGA 3VS3A 4XOYA 4RZWA 2I40A 4HYSA 3KK9A 4H3PA 2WU7A 2OXDA 4X2FA 3AGMA 1U4DA 5AADA 2C5OA 2GS7A 2W1EA 3EZVA 5C4LA 4NEUA 2XEYA 3H0ZA 3IKAA 4JIKA 4U5JA 3F2AA 4C4FA 4EOLA 2J2IB 3LE6A 3A61A 3LXLA 1OZ1A 4F99A 3KCFA 4CGAA 4G3FA 1L3RE 4O27B 3IW4A 4EKKA 4FTQA 5CVHA 3GCSA 3BBTB 1KE6A 3GENA 3GI3A 4PDYA 4CSVA 4XCUA 2PTKA 2VO0A 3UYSA 1J7IA 1WBTA 2WPAA 3PVUA 3KXZA 3FXXA 4TYIA 2XK8A 4L3PA 3ZYAA 3DKGA 2UVYA 1WBPA 3NW5A 4C57A 4YHJA 1FVVA 5J8IA 5EHLA 4ERKA 2LGCA 4ZY4A 3V5WA 3OEFX 3QD0A 2QONA 2HZIA 2J6MA 4MAOA 4I22A 4OTPA 2XNEA 4PQNA 3VUGA 3DGKA 4FEXA 2X9EA 5IQFA 5CF5A 3UMWA 4EH2A 5HIDA 4KSQA 2W99B 5KBRA 5IPJA 3R30A 4W9XA 3VF8A 4IB5A 2XM9A 3HRFA 2VNYA 2BZKB 3ELJA 4QYYA 3FMNA 2BKZA 4BF2A 3SW7A 3TACA 3UZRA 3EN7A 2P33A 2CKOA 5ICPA 4N0SA 4RFZA 4BTJA 4EI4A 3KRWA 5JH6A 3PJ1A 1A48A 2O65A 4UZHA 3SXSA 4I5CA 3D0EA 4GL9A 4TWPA 1REJA 4ASZA 3COMA 5IU2A 2BFXA 2UW7A 4BDGA 5HX6A 3Q9ZA 4DEIA 4U3ZA 1SMHA 4TNDA 5FP6A 2ITPA 2YIYA 1I09A 4J7BA 5LVPA 2BCJA 4E6QA 3UNKA 4RQVA 4LRKA 1VR2A 4IVBA 5IQHA 1XH5A 4BCNA 5M4UA 3IQ7A 2C4GA 1JSTA 1BYGA 4QP2A 2Y4IB 5HCYA 3R04A 4ENXA 4DEAA 1R3CA 3AD6A 1M52A 4O0YA 4PWNA 4IWOA 5EM8A 4AA4A 5AIKA 2GU8A 4S32A 3LFNA 3A7FA 3BV2A 1PYEA 3EQGA 4KKEA 4X3FA 3GFWA 3W16A 4IACA 4RX9A 4ZLZA 3RZBA 3QQFA 5EKNA 1WBNA 3OG7A 3D5UA 3PE2A 1ZYLA 5DH3A 2E9OA 4F1TA 5K9IA 2GTMA 3MIAA 1Q97A 3NYOA 1X8BA 3ENHA 5C8KA 3BPRA 1JVPP 1XO2B 2HIWA 3OT8A 2W1GA 4XOZA 5AM7A 5AAEA 3GC9A 2PVRA 3FDNA 5HCXA 1S9IA 4XS2A 5ITAA 4XG6A 2WTKC 5CT7A 3SVVA 4FKGA 2ITNA 2WQNA 3HDMA 5FXQA 3LCTA 3UPZA 2PZ5A 3ZUTA 1Q62A 3C5UA 3E8EA 4QTBA 5EOBA 1URCA 3ZDIA 3R71A 4U42A 4AOTA 2RFDA 2C1AA 3NNVA 4GUBA 4OT6A 4UYNA 5DRBA 4A4OA 2ACXA 4E26A 2YEXA 2J4ZA 2J0JA 3WOWA 3CLYA 3R00A 2YM6A 5B2LA 1XQZA 4ZZMA 1U59A 5IUHA 4X3FB 3MVHA 5CU6A 2XIRA 3I0OA 3DJ5A 4P90A 2G1TA 2WTJA 3UOLA 4DGNA 4FSQA 4FV7A 1HCKA 4HVIA 5D9HA 3F3TA 4G5PA 3PA4A 3R7IA 4Q5EA 3MA6A 2X6EA 2BTRA 2R9SA 3HA8A 4JAIA 4CFUA 4ZSAA 1RDQE 4RWLA 3ZXZA 3AT3A 2W9FB 3QC4A 4YSMA 4O22A 3DAKA 3MI9A 1PYXA 2X2MA 1G8AA 5HU9A 2I1MA 3CGFA 4ANMA 4YJNA 4LV5A 4RVTA 3GP0A 4DFNA 5A9UA 2ZM4A 5I9XA 1IA9A 3A7HA 2R3HA 3C9WA 3EQHA 1DI8A 1H1SA 2H9VA 1E1VA 1PXIA 2XNGA 3R8MA 4EOJA 3QTSA 4FUXA 4HW7A 2FVDA 1W98A 3KVWA 4XX9A 5BVOA 2XK9A 2RG5A 4DEGA 3SHEA 3EN9A 1FMOE 3LW0A 1XBAA 4BDEA 4BWKA 4R1YA 4RIXA 4C34A 4BR3A 4Y46A 4CQEA 5CALA 4QMSA 4M66A 3OUKA 4NYEA 2Y0AA 2J5FA 2W7XA 2I0HA 2CHLA 4FR4A 3UOHA 4MQ2A 1PHKA 3Q6WA 4O84A 3NX8A 1YXVA 5KCVA 3EL8A 3QXOA 3C5IA 3RCDA 3QA8A 4LV8A 2OXYA 4I93A 3IONA 5M4CA 4JDKA 1NA7A 2VWZA 3PY1A 2YITA 4G31A 2SRCA 4LQMA 5HLPA 5L2IA 1OL1A 2O64A 2XKFA 2ITOA 4A9YA 2R0UA 3SLSA 2PVHA 5EDRA 5HNBA 5HVKA 1ZYCA 2O2UA 2OFVA 3VHEA 2YWPA 4FV8A 2CNVA 2X4FA 3SC1A 1RE8A 4O7YA 1YVJA 4PMPA 5CSHA 2J9MA 4FTKA 3AT2A 3JY9A 3QUEA 2EXMA 4G3DA 4YLJA 4AZEA 4CFVA 4TL0A 3O8UA 4HNIA 2X2LA 3NDMA 4LRJA 4NWMA 3LXPA 3I7BA 1PY5A 4DGGA 4GFMA 2B7AA 3ORNA 4RIXB 1RJBA 5EW8A 5CEMA 1Z9XA 1J91A 2GMXA 3EYHA 4J95A 5LVLA 3QLGA 3RM7A 3R8LA 3ZOSA 4D2SA 4F9AA 5BUIA 2W1IA 4FTRA 3F7ZA 2C5XA 4XG3A 5AP7A 1FVRA 1YXUA 3ZO4A 4Z55A 2ITUA 1XWSA 5AIRA 4AXAA 2F7XE 3OCSA 3FHIA 2BR1A 2OZAA 3V8SA 3E88A 5A6OA 2CDZA 3IECA 3CJGA 4HGTA 5EOLA 2HYYA 4XV3A 1Q41A 5GJFA 3W2OA 3GC7A 4DAWA 1SVEA 5AUUA 1Q61A 4O0VA 4AW2A 4XMOA 3DK3A 2G2FA 2QVSE 2H34A 3C51A 3H3CA 4KBCA 4FTOA 5TOZA 4EK8A 1MRUA 2CSNA 5IDNA 5F9EA 5L2TA 1B6CB 4DH8A 3P79A 5LOHA 4OAUC 3ZXTA 2OO8X 1Q8UA 4BI1A 1LUFA 3P4KA 4JR7A 5K4IA 2QR8A 5IQDA 2UZVA 3C0GA 4YZNA 3TZMA 2NP8A 3Q96A 2WTKB 3QQHA 4II5A 4NFNA 3RTPA 4A4XA 4WG4A 4Q9SA 4WA9A 4JLCA 3NIEA 2F57A 4E93A 4FSRA 4O0TA 4C33A 4C2WA 4EH5A 4GVAA 5AA9A 3LM0A 3QAME 5KKRC 3RPVA 1KE5A 4JT3A 1IR3A 4I4FA 4NM3A 1SVHA 2WQBA 3RAHA 4EOQA 5CAVA 5AMNA 3EN5A 3W8LA 4UN0C 3FXZA 2Y6OA 4ANOA 4CXAA 3F82A 4HPTE 4IWQA 1G8SA 2ZJWA 4CV9A 2VWWA 5M44A 2CGWA 5HHWA 4C4JA 2OZAB 3NZ0A 1FPUA 4QNAA 2GNHA 3I79A 5H8GA 1Y91A 5IQIA 4AU8A 1OL2A 3EKKA 4ZSGA 3LLTA 1MRYA 5CNOA 4LGGA 4R7IA 3BKBA 4M97A 3SGCA 4DINA 2G01A 4EOKA 3CXWA 4D2WA 4W4XA 4DH1A 2V5QA 2R3IA 4FVRA 5I9VA 3G51A 5BX0A 3MDYA 2VTSA 5FEDA 3P86A 4A9SA 5AP4A 3U6IA 2V7OA 5CWZA 5I9YA 3LVPA 2CLXA 3C4XA 4LGDA 5IH5A 3ZBXA 1YOMA 4KIOA 3CS9A 3R2YA 3NLBA 2UVZA 4BYIA 3W8QA 4USEA 5EHOA 4FF8A 3Q60A 2XYNA 5EK7A 1YXSA 2R3PA 3LOKA 2QOCA 4IDVA 3FYJX 3TI1A 3ZFXA 3NVMB 5IA4A 4LUDA 3VIDA 2QKRA 4JDIA 1WZYA 4RSSA 4GIIA 5I4NA 2NRYA 2DQ7X 4DLIA 4EH3A 4EK5A 2R7IA 3KXXA 4FSNA 4BL1A 3ODYX 3PRIA 2REIA 4YLKA 5HLWA 3DFAA 4QP1A 1H08A 3GVUA 4MXZA 1LPUA 4M0ZA 2QO9A 3F66A 3OZ6A 4B99A 5FXRA 4G3GA 1M2RA 1YXTA 3A7IA 2V7AA 3P1AA 1U5RA 4O6LA 5IA2A 2GS2A 1KUTA 3UBDA 1FGIA 2E2BA 5KX8A 4LUEA 3HAVA 2V62A 3CGOA 4RX8A 3NUXA 2QURA 4RJ5A 2PE1A 4GFOA 3EN6A 4HNFA 4XG7A 2PVMA 3KF4A 3UP7A 4FNYA 4CZUA 4I0SA 2R3OA 4ERWA 4CZYB 3R7EA 2W5AA 3EQRA 1UU8A 3TTJA 2WGJA 2CN8A 1XBBA 3MFTA 3EQFA 4X2GA 2PZIA 5E7RA 2QOFA 3F5GA 1K2PA 3KC3A 4Z7HA 2P55A 3Q4TA 4TW9A 3UPXA 4OR5A 3HL7A 4AFJA 4E4LA 3C50A 3GCQA 3DKFA 4AACA 3ATTA 4WIHA 5DA3A 4Q9ZA 5IA3A 2XKCA 2P0CA 3KK8A 3POOA 4AN9A 4I24A 5FUTA 2BRHA 3KL8A 4KBKA 2BRMA 3DB6A 2P2IA 5C26A 4O7WA 1PXOA 3B2WA 4BCFA 4K0YA 2OBJA 2WEIA 2Y9QA 4IM3A 4IDTA 3FI2A 3GQLA 3E7OA 4JX3A 4V04A 4DF3A 5CSWA 4QTDA 1Z5MA 2Q0BA 3MTFA 4GV1A 3VS2A 1H25A 1OMWA 3MH1A 5HNGA 4OBQA 4X6RA 4J8NA 2XIXA 3UNJA 2QU5A 3MTLA 4O7TA 3L8PA 3PE1A 3DDQA 2VU3A 2F7ZE 4QPMA 3VO3A 4ITIA 2PYWA 3E63A 5CEOA 5F95A 1Q8TA 4EHEA 3WZKA 5LMKC 4UXQA 4UALA 5CAQA 2Z2WA 3FE3A 3PJ2A 1JNKA 4BCOA 3VUMA 2BDJA 3BZ3A 3LFQA 2J0LA 4EWQA 3TKIA 3BLRA 4R5YA 4ZIMA 3PXRA 5CENA 3UOJA 3FI8A 3AMBA 3RCJA 4RX5A 4IZYA 3RJCA 4PMSA 3WZJA 3W2QA 4QMUA 4ZJJA 3O17A 1Q8ZA 4CRSA 4O2PA 5KKRB 3TG1A 4OBOA 3WF6A 4EC8A 5CF6A 4QQCA 4RA5A 3QL8A 4RJ4A 4BDAA 5BVEA 4C59A 5BVNA 2PY3A 3DAEA 4PL4A 3ZHPC 3RMFA 1YHSA 2PK9A 4I3ZA 4BI0A 2A1AB 5JFSA 4J1RA 3PP1A 4AT4A 3ORIA 4LGHA 4N4SA 3DBQA 4GW8A 2OZOA 3BHHA 4C3RA 1U54A 4NIFA 2GNIA 3QX4A 5EYKA 5EQPA 5K5XA 4BC6A 4FKQA 5JZNA 2J0IA 1W82A 4ID7A 3WF8A 4X7QA 4EC9A 3TWJA 3ZZEA 1Q3WA 2WQMA 5DT3A 2IVSA 1NVRA 5FM2A 3OD6X 4O7SA 3ZFMA 5HTBA 4BIDA 2PE0A 2WTDA 2ZB0A 3PJ8A 2W4JA 5EHYA 4FIIA 2C3LA 4J99A 4RWJA 5AV1A 5HU3A 3ID6C 3VNTA 3MIYA 4O38A 1MUOA 4YO4A 4I5HA 4BCPA 2VV9A 4JNWA 3K54A 5CTPA 4YBJA 1PF8A 3TKUA 3WBLA 2BFYA 4KUJA 5J7BA 5CXHA 3C7QA 2OJIA 3BBWA 4RVLA 2FSOX 1P5EA 3PJCA 5AV3A 4F7NA 4GMYA 4JS8A 3JPVA 3RPYA 3NPCA 2C69A 4QOXA 3MBLA 3UIXA 4ZK5A 4X0MA 4E8AA 3DB8A 1U54B 4NIFB 4PDSA 5J9ZA 1W8CA 3ZMMA 4CLJA 5IF1A 2QQ7A 3G6GA 4FTMA 4RWKA 4ARKA 4CMUA 1VYWA 4M7IA 1QL6A 3SG8A 3H9RA 4CCBA 1QMZA 4O1PA 5GJDA 3EN4A 1JSUA 1Y6AA 5AV2A 4XG9A 4FBXA 4AN2A 2FYSA 3ZSIA 3DZOA 4GVJA 3EIDA 5TF9A 1J7UA 2YDJA 4YNOA 3HMNA 4M84A 3RGFA 2NNWB 5DT4A 2OG8A 3ANRA 1W0XC 2X0GA 4W9WA 2QG5A 2XIZA 4LYNA 3W10A 5JQ8A 4F7JA 1H0VA 4I0TA 4P4CA 5CU4A 5CAOA 5HGIA 2HZ0A 1OPJA 4FIHA 2YAAA 5AP2A 4AT5A 3AQVA 5GIOE 3UDBA 4ZXTA 3FUPA 3HRBA 3I5NA 1XKKA 3OW3A 3PYYA 4C3PA 2W5HA 3S1HA 2WTIA 4X6QC 3GU7A 2CGXA 3EQIA 5I0BA 3RAKA 4C7TA 4FKUA 5IA1A 4R1VA 1PXNA 5B2MA 3HRCA 4MBIA 4KABA 3PA3A 1KOBA 3WZDA 1GZ8A 5E8XA 2F2UA 4IMYA 2FSMX 1R39A 4EH7A 3HVCA 4FTLA 4DGLC 4ANQA 3G2FA 2WMQA 1OECA 2Y6MA 4XUFA 2Q83A 4HYIA 3TNQB 3HUBA 1QPCA 1SZMA 4NJDA 4AN3A 5IEYA 2C6OA 3E92A 4L43A 4D9UA 2QHNA 3QTUA 4OTIA 4CZTA 2OIQA 2EUFB 4AGCA 2X1NA 3U4WA 3F5PA 3QBNA 4E5WA 2VGOA 3IDPA 3RZFA 5C03A 5TKDA 1OUYA 4D5KA 2FB8A 4PL3A 2R5TA 4YHFA 3MJ2A 4FVQA 4Z9LA 1ZLTA 4FGBA 4JAJA 1H1RA 4B0GA 3BLHA 3R9NA 2IWIA 1ERKA 3CCNA 2X8DA 3OTVA 2BZHB 3V6SA 2OICA 3R21A 3U87A 2XBAA 4QQ5A 3RNIA 4BZDA 3QTQA 4O21A 3KXMA 3P9JA 4F6SA 5HE3A 4HPUE 3E5AA 3EB0A 3V5QA 3DXQA 2IVUA 4WRGA 2UZBA 5B0XA 2JIVA 2WIHA 3T3UA 3W1FA 4L45A 4HVHA 4LMUA 3BYOA 5GZ9A 3BCEA 4FVPA 4BB4A 3G5DA 4K6ZA 1ZZ2A 3V04A 5FEQA 5IDPA 4NT4A 1YI4A 1Q24A 3F7WA 3S00A 3KU2A 3O0GA 4CFXA 5HKMA 1PW2A 3Q5IA 4DFZE 2ZV2A 2XEZA 4GKIA 3VS0A 4G2FA 4R7BA 3KB7A 5HG9A 4A4LA 4EH8A 2J0KA 3HV4A 4TYJA 2HY81 4DGOA 4AAAA 4I92A 4R77A 3ORKA 3ATSA 4FKIA 5C9CA 3EQCA 2YWVA 4FSYA 4JDJA 3ZU7A 3G15A 3G33A 2C6EA 3MPTA 4XJ0A 3THBA 2YCSA 4CYIA 3BWJA 3UO6A 4MYGA 4B7TA 3NYNA 4UB7A 3UQCA 2Z60A 5LWMA 1V0PA 1VYZA 1PXLA 2OH4A 4XNEA 4YTFA 3UC3A 5M4FA 1WBOA 4J96A 1GZOA 3QWJA 4XRLA 4HGLA 4NSTA 2FA2A 4QQTA 2YACA 2AC5A 2Z7LA 3DZQA 3OHTA 4WNPA 4YC6A 2AYPA 5DOSA 3QKKA 5AUZA 5EKOA 3CKWA 5E1EA 2CCHA 2YLEA 1ZRZA 1WBWA 2OGVA 3DBFA 4WT6A 3ITZA 4JIAA 1AQ1A 2QODA 4FIGA 3CSVA 1PMNA 4UWCA 4C61A 4UWBA 3K5VA 5EG3A 3A8WA 5HCZA 4ORKA 2PZRA 3MFUA 4LOOA 3PIZA 3LCKA 4J53A 3FSFA 2FGIA 1NY3A 2VWUA 2WKMA 5CQUA 3PWDA 4RA4A 3COHA 3QTXA 5K0XA 3FQEA 4AE6A 3ANQA 3B8RA 4E1ZA 3HAMA 3DOGA 1WFCA 3RAWA 1YDRE 2VTMA 2QO2A 2QC6A 4MD9E 5GNKA 4AZSA 1JOWB 2VN9A 4I23A 4YBKA 4RVKA 1CKIA 2R3RA 3BI6A 3LJ1A 4USFA 2C0IA 1U46A 3W32A 5KHXA 2VNWA 3CBLA 4M68A 4IZ5A 4TXCA 3Q3BA 4RLKA 1FGKA 4D4YA 5BPYA 3OBGA 2AUHA 3DT1A 2V22A 4FIJA 2VWIA 1WBVA 4UYAA 4D2PA 5HNIX 3NMUF 4A06A 2W06A 3PIYA 4KS8A 4EWHA 4F1MA 5KNJA 5DVRA 4YNEA 2ERZE 1UNLA 1PXKA 1YHWA 2OJFE 2R3JA 4EBVA 4NL0A 4FTNA 5DRDA 2QO7A 3MY0A 1OKWA 2OF4A 3A60A 5DPVA 3BYVA 4LMNA 5AP0A 4CFNA 4RPVA 3HV7A 3U9NA 5HVYA 1NW1A 3MSSA 4NH1A 4BCKA 2IVVA 4NM5A 5C4KA 2WO6A 4G17A 3ODZX 4G9CA 3Q2MA 3QCQA 3CTQA 2EXCX 4FEUA 3R01A 4MBJA 4I5PA 5IH4A 2ONLC 4YJPA 2C6LA 2JKQA 2WXVA 1V0OA 3COKA 5BUEA 4JBVA 4OBPA 4R3CA 4C4IA 4RFYA 4MF1A 1NT2A 2HELA 5IA5A 5IMEA 4IHPA 4RC4A 2UW5A 3HMIA 3LFAA 4A7CA 1H8FA 2QKWB 3E3PA 3ORZA 3F3VA 4ACHA 4FNWA 5JQ5A 5DG5A 3UODA 1G5SA 4QMLA 4UXLA 4EK3A 1SM2A 2UVXA 4DFYA 4MXXA 3VJOA 1YI6A 2BHHA 4ONAA 4MQ1A 1L8TA 4PUZA 2E9VA 3LQ8A 2R3QA 5AA8A 5FBNC 3CPBA 3PXQA 4DBNA 3H9OA 4UWYA 4RT7A 1E1XA 3UJGA 4CV8A 2XVDA 2JLDA 3DS6A 4IB0A 4WOVA 3E8CA 3EFWA 4BN1A 2QOQA 5LJJA 2VX3A 3JXWA 4M69A 3TDWA 2QNJA 3FLNC 4FMQA 3R7YA 4L52A 3TT0A 4G16A 5KMKA 4V05A 4F65A 2FSLX 2ZM1A 3IW5A 4ACGA 3RM6A 3E62A 3GCVA 1H1PA 5HZNA 3W2PA 4DTKA 5AX3A 3BWFA 1H27A 4XG2A 4EYJA 3OWKA 4YZMA 5EI8A 4NJ3A 5HTCA 3DFCB 4PTEA 3GQIA 5L6OA 4UY9A 3HMOA 2R3LA 3LCOA 4ANLA 3P0MA 5I9WA 3CC6A 4FKRA 4YU2A 5A14A 3AG9A 3GU4A 4AP7A 5KMIA 1J1BA 4L6QA 4IAZA 4PF4A 2VUWA 3CTHA 4FL1A 2E9PA 4GYGA 4CQGA 3BHYA 2OW3A 3V5JA 4I6BA 3TTIA 5FTOA 1KE9A 4JXFA 4ZTQA 4OTQA 4DTAA 4BTFA 4ZS4A 3HMPA 1P4FA 5AP1A 4FTIA 3ETAA 4IVDA 2FH9A 3QF9A 4M69B 2OFUA 3T8OA 2OWBA 2R4BA 3KEXA 4Y5QA 4XG4A 4AT3A 2XKDA 5M51A 2XIKA 1XHAA 3HEGA 5ANEA 2RF9A 1LEWA 1PMUA 4BDDA 1XR1A 3N9XA 4YUQA 4HCUA 4IJ9A 3A62A 5L3AA 3QD3A 2OKRA 4O0RA 4ZTSA 2YN8A 4C35A 4KWPA 4JQEA 4ZTMA 4CFMA 3DXPA 3CR0A 2XK6A 2XZSA 1JWHA 1OPLA 2ONLA 4AS0A 1ZWSA 2VTNA 4ZMFA 3R28A 3F69A 5KZ0A 1YWRA 3BHTA 4AA5A 4BVUA 4ZY6A 2PUPA 3QRIA 5L6PA 4IC8A 4S34A 4Y85A 4B4LA 4D4RA 3MPAA 4S2ZA 3FPMA 5C8MA 1RW8A 3ACJA 3W2SA 3U6HA 1UU7A 3NUYA 3UNZA 5M53A 2BDWA 3VVHA 1Q8YA 3ZSGA 1O6YA 4BWPA 3HP5A 1JKLA 4U80A 4OTGA 3I7CA 2PUIA 2OU7A 4FV4A 2X81A 4JBPA 5CAUA 4FK6A 4IH8A 4K77A 3EZRA 3UVQA 3TUBA 5J9LA 4N57A 1OVEA 1URWA 2Z7SA 4YR8A 4Z16A 3RWPA 2A0CX 2OI4X 3GEQA 4IAKA 2WU6A 2OXXA 4GKHA 4S31A 3ORTA 4QMZA 3EQBA 3TZ7A 4L01A 3VBYA 1H0WA 4M12A 4TWCA 2ITTA 5CEIA 2PVYA 4MEDA 3ZM4A 2YCFA 4ZSLA 3VUHA 1VEBA 4M8TA 3KXNA 2V55A 4FX3A 2WB8A 5JGDA 2G2HA 2QOOA 3OWPA 5HX8A 4TKSA 2GS6A 1PXMA 3W2RA 3RK7A 1Y8YA 3KRJA 2PVJA 4YMJA 5FDPA 3P5KA 2BVAA 3O71A 1H4LA 4C38A 2B9JA 2W05A 1S9JA 1BI7A 2OJJA 5HBJA 2YIRA 3RNYA 5FD2A 2EVAA 3MPMA 4CD0A 4CVAA 2WQOA 4EHZA 4K8AA 2UW9A 3QWKA 5L4QA 2F9GA 3L9MA 1OUKA 1ZMWA 4RIWA 3RPRA 4AZVA 5HI2A 4CCUA 2RGPA 2ZV9A 4NM0A 3PVWA 2W1FA 5AV0A 5LARA 1M17A 3LLAA 3OXZA 3G0EA 3VJNA 3JUHA 2XNMA 3EMGA 3PG3A 3QGWA 3QCYA 4EYMA 1MQ4A 3TNPC 4KBAA 3TKHA 4WSQA 2H96A 4WBOA 4DG3E 4FZ7A 4DG0E 3O51A 5B7VA 5A6NA 1YRPA 2XF0A 5ANJA 4ZJVA 2YABA 2A2AA 4BIEA 3BYMA 4FK3A 2VWYA 5KMNA 3DQXA 4U45A 3OMVA 5CNNA 2ETMA 4BWXA 2XA4A 4DH3A 3DBDA 5DYJA 2YM8A 4ASDA 1O9UA 4F0IA 4FTCA 5DWRA 2B9HA 2GQRA 3FWQA 2R64A 3D2KA 2I6LA 4ZS0A 3ULIA 1MRVA 4TYHA 5JRQA 3FY0A 3SRVA 5EQYA 4DLJA 2CGVA 4KIKA 5LWNA 4FKPA 2B9FA 4KSPA 5HBEA 4TWOA 4BRXA 4D9TA 1IAHA 3ZRMA 5K4JA 2HXLA 4OTFA 1YOJA 3DKCA 1V0BA 2B52A 4RIWB 4XBUA 3H30A 3L9LA 2LAVA 4C4GA 4EOIA 4FKOA 1APME 3QUPA 2RKUA 4WG5A 3TCPA 4EOSA 3KULA 2PVLA 4XP0A 5IISA 3D2IA 2JIUA 4NTSA 3RI1A 4RLLA 2ITZA 4K2RA 5A3XA 3EWHA 5ETAA 3OS3A 4LL5A 5LQFA 4O81A 1YWVA 2HK5A 3M1SA 4I6FA 4DFUA 4DEBA 2NO3A 1TQPA 4IANA 3IO7A 5KMJA 4BDKA 1OPKA 4FZDB 4MTAA 5CYIA 1KE7A 4K11A 4YZBA 4F0FA 5J9YA 3CJFA 1J1CA 2JAMA 3CY3A 2J50A 4HYUA 4S33A 4Z7GA 4ZTRA 2PE2A 4H05A 4F9BA 1XH4A 1H07A 2RFEA 2IN6A 1OKVA 1H00A 1QPEA 3D5XA 3OOGA 4JBOA 4UMUA 3PJ3A 5HO7A 5LVOA 4YHTA 1JBPE 3GCUA 4TYHB 4TZRA 4YJUA 2HW7A 4XEYA 3SRVB 5HIEA 4KIKB 2VO6A 3FLWA 3AC4A 3BELA 4I5MA 4IM0A 5CS6A 3F3UA 1NXKA 3I81A 2WMBA 1SYKA 4FEWA 3DBCA 2XCKA 4H1MA 4Q5HA 5ANIA 4F6UA 1Y8GA 3ENMA 4DH5A 5FG8A 3KULB 2YZLA 5E8UA 4DYMA 3P08A 3VHKA 4I6HA 2JKMA 3NYVA 4LFIA 4IIRA 4G34A 4PMMA 4USDA 3S2PA 3F6XA 4ALVA 3WF5A 2Z02A 4EZ3A 3FL4A 2UZLA 3CPCA 1CTPE 2R3GA 3GXLA 4HGEA 2C30A 4NM7A 4WG3A 3NVKI 5A4LA 3F2NA 2GQGA 4FOCA 1WBSA 2O8YA 3NS9A 4ITJA 4KIPA 4DITA 3NUAA 3NUPA 2GNGA 1Q99A 4ZLOA 4G6LA 3QQUA 3ZLSA 4BDCA 2J51A 4HVSA 2Z7RA 4ASEA 4U6RA 4EHVA 4J71A 5HESA 3QRKA 3FKLA 3ZFYA 2CMWA 3U4UA 4F9CA 4I21A 4MXYA 4DE4A 5JRSA 3WYXA 4GU6A 4D58A 1M2QA 3VUTA 1F3MC 2IZTA 4GCJA 5EI6A 4QYGA 5AR4A 4APPA 4CLIA 4DFLA 3AT4A 4FEVA 2EWAA 1FBNA 2BKKA 2J0MB 2I0YA 1PXPA 4MBLA 2VD5A 1BKXA 4X2NA 4ZTLA 4BZNA 1JAMA 3DXNA 4MVFA 4UMQA 4N6ZA 1CDKA 4OTDA 4E4XA 4MF0A 2WQEA 1IA8A 1ZOGA 2FO0A 1TVOA 4C02A 1BL7A 2WMTA 2W1ZA 2BRNA 1OB3A 3HA6A 3ZS5A 2YIQA 1TKIA 5M07A 5JKGA 1IRKA 4G9RA 1WCCA 4GK2A 3NAXA 3E3BX 3OCTA 4O0SA 4QTAA 5CX9A 5HD7A 1IEPA 4IADA 5DI1A 4BCQA 1BL6A 2XP2A 5EYCA 5E4HA 1UV5A 4J98A 3P7CA 2X8EA 5JGAA 5CI6A 2C5VA 3NNWA 3ZUVA 2PVFA 2ITXA 2NRUA 1ZY4A 3SXFA 4DEHA 3VUIA 4E73A 3F3ZA 5AV4A 3PG1A 3KF7A 2G9XA 4GU9A 2QR7A 4MXCA 4D1SA 2VTAA 4YTCA 5I3RA 1SVGA 5CSXA 3VS4A 3UO5A 2O0UA 4QMNA 3FKOA 4G6NA 4BDFA 2PWLA 3GBZA 3EFKA 2C6MA 4GRBA 3WZEA 1FMKA 4DG2E 4EQUA 4EQCA 5E92A 3QRUA 5BQ0A 3DNDA 4FSWA 2C3IB 5B2KA 3TUDA 3UC4A 2B9IA 5E8WA 2JKOA 3K3IA 2X2KA 5E8SA 4AX8A 3M11A 1Q5KA 2R2PA 4BDBA 4CRLA 1QCFA 3S0OA 4PDOA 3QD4A 5I9UA 2ITWA 3Q53A 4I4EA 3T9TA 4AGUA 2BUJA 3ZSHA 2WMXA 4E4MA 4BCJA 3RAIA 4QP3A 5BUJA 4BTMA 3PLSA 3IG7A 1LR4A 3CTJA 4IAAA 2X39A 2C3KA 3EQPA 1AGWA 2QD9A 3OFMA 1JKTA 4UMPA 2F4JA 1BLXA 4QMXA 5IKWA 5M57A 1BI8A 3AMYA 5EM5A 2HZNA 3BGQA 3ZZWA 4ALWA 4XG8A 3DKOA 4W8EA 5HO8A 3RHKA 2BHEA 3UVRA 5BMSA 3EJ1A 4XYFA 4WRSA 4ZTNA 3FLSA 4BHNA 4I41A 4WNKA 4TPTA 3W2CA 4DCAA 2VTHA 3G9LX 2X6DA 3QLFA 1CMKE 4WUNA 3FC2A 4FZFB 1VJYA 2WMRA 3PP0A 5D7VA 4DC2A 3BU3A 4P7EA 4BCGA 2B4SB 5M56A 1IG1A 5FEEA 3UIBA 2YZAA 4Y83A 2F2CB 4O0XA 4ZY5A 3E8NA 4F7SA 5JSMA 3DU8A 4KS7A 4IXPA 3E8DA 4BKJA 4MK0A 1E9HA 3ZO1A 4HVDA 3R0TA 5H3QA 4BKYA 4YSJA 2Y8OA 2HY0A 3TV4A 5CF8A 2IJMA 4DT8A 3HMMA 4L7FA 3E93A 2IW6A 4KRDA 2IZRA 3FYKX 3DTCA 4FTJA 4W8DA 5G1XA 3F9NA 4IX4A 4IAYA 2RFNA 4U40A 4E5AX 2XJ2A 3SXRA 4FSMA 4YURA 5KO1A 1OIQA 3BQCA 4M15A 5A46A 5GZAA 1OGUA 4RWIA 1U5QA 5CEPA 4XP3A 1R78A 3FMLA 4PL5A 2XK7A 4QQJA 4PX6A 5I5ZA 4AA0A 3G0FA 4HYHA 3LHJA 5CSVA 1B39A 5J7HA 5KUPA 3LMIA 2HXQA 3R63A 5JGBA 2GQSA 3BU5A 4F9WA 1YW2A 5A4EA 4RIOA 4L42A 3ZO2A 2GHGA 4FV0A 4K9YA 4U41A 3COIA 5KE0A 4F6WA 3SD0A 5A4QA 4F9YA 2UUEA 3OF0A 2XBJA 2DYLA 3AOXA 3SOCA 3QGYA 4O7NA 3HLLA 4E4NA 4PY1A 3QHWA 3PZHA 3Q04A 3ZLWA 3NAYA 2QCSA 1XBCA 3NIZA 3VRYA 4EUUA 3I5ZA 3UZPA 3ZH8A 4OAVB 3Q4CA 4L8MA 5AUVA 5TR6A 3LM5A 3R8ZA 3TJDA 4EEVA 1K9AA 5J5TA 5FDXA 4FG9A 2W4OA 4IB3A 5BVKA 5LMKA 2JC6A 3ZC5A 1YWNA 1PMVA 3F61A 2XS0A 3QFVA 3V8WA 1YKRA 4MH7A 3V6RA 3VF9A 3BU6A 2C68A 3GUBA 3LFEA 4B6LA 2X9FA 3R02A 5FQDC 3GOPA 5HORA 3DLSA 3PRFA 4RJ6A 5TE0A 1H26A 2B1PA 3T9IA 1GAGA 4EONA 5EDQA 4RJ3A 1CKJA 3BQRA 2CKEA 4F1OA 2ZDTA 3ZM9A 5CVGA 3F5UA 4FEQA 3P78A 4PMTA 5LCJA 4BY9E 5AFVA 3FZRA 4JQ8A 4AZTA 3UG1A 3Q32A 3GT8A 3QX2A 4CKRA 3H4JA 4GH2A 2WIPA 4M13A 3D83A 4D2RA 5IUGA 2PMIA 5H8EA 1UU3A 5CI7A 1YI3A 2PVKA 2C3JA 4HJOA 2YIXA 4AUAA 1XH7A 2Q0NA 4D55A 3R7UA 4J52A 4LM5A 5ANGA 4IE9A 3R83A 4KA3A 3S3IA 2G15A 4W4YA 2ZVAA 4JR3A 3PSBA 5AUTA 3B8QA 2KULA 3TZ9A 4AE9A 4FKTA 5G6VA 3BIZA 3V5TA 3HV5A 4Q2AA 3ERKA 3A2CA 4YJTA 4CYJA 3ZDUA 3D9VA 5AEPA 4H3QA 3N4VA 1XH8A 4O6EA 3GOKA 4BBEA 5IQEA 1H1WA 2VGPA 2CJMA 2VTIA 3PUPA 3KXHA 4EL9A 4YP8A 1H24A 4FKSA 3MWUA 5FLFA 3TNWA 4EK6A 4BGQA 5DLSA 2O3PA 5AUXA 5HD4A 5LXMA 3MH0A 3QTRA 4OTRA 3DTWA 4L46A 4R6VA 5KMMA 3FLQA 1XH6A 4JDHA 3RVGA 1BUHA 2UW8A 4AW0A 3REPA 3UQGA 4BCMA 4HCTA 4YPSA 5JFXA 4ZJIA 2BPMA 2VTQA 4V01A 1GZKA 4ACCA 3QTZA 3EL7A 3JY0A 4PPAA 1PKDA 2WTCA 5BVWA 5DIAA 4FA2A 5AP3A 4MCVA 3BE2A 3V01A 5ACBC 4EHGA 4IX5A 3U6JA 3P23A 2JDRA 4NW6A 4K18A 5DEYA 3FI4A 3JYAA 4RJ7A 1ZXEA 1P4OA 2F7EE 3ZO3A 3FMHA 4OLIA 2JBOA 3TIYA 2Y4IC 3PWYA 3VUKA 1WVXA 4PP9A 5KMOA 2E9UA 2C0TA 4CMTA 4QMOA 1T45A 2XK4A 3KXGA 3U51A 4LRMA 3KKVA 2JAVA 3VBQA 4DFXE 2XB7A 3FJQE 4ZZNA 4FL3A 1YXXA 5CEKA 4O96A 4AOJA 4WD5A 5KHWA 3I6UA 3DNEA 2I0EA 3OBJA 3EFLA 4MD7E 2ZYBA 5E8YA 3LMHA 5M06A 4NTTA 4B9DA 5JMSA 4EK4A 4C4HA 4OTWA 5L6WL 2BROA 2WTWA 3C4CA 3K5UA 4O7RA 4U79A 2A27A 2FUMA 4I94A 4IQ6A 2WMWA 3OTUA 1XH9A 2QOBA 4FYNA 2QG7A 5TT7A 2E9NA 4C58A 4APCA 4JX7A 3UMXA 4OUCA 2VO7A 4IWPA 4EKLA 1GIJA 4QD6A 3F2RA 4N6YA 5HEZA 4C36A 2VX1A 1ZY5A 4HZSA 1H28A 3GC8A 4FIEA 3BYSA 5HICA 2XJ1A 4J8MA 5D41A 3TL8A 3G6HA 3BRBA 3QCXA 2ESMA 4U8ZA 4FV5A 3CE3A 4O7LA 2GNLA 5J1VA 4I1ZA 2XRUA 4LL0A 5HOAA 4X3FC 3CD3A 4FTAA 4EJ7A 3MVLA 3R9HA 3EFJA 3A8XA 3MY5A 3QXPA 3RPSA 1FVTA 3VBWA 4BKZA 4FT3A 2W9ZB 5L2SA 3QD2B 4RFMA 3FC1X 3L8XA 4NW5A 2UZTA 2XYUA 4R8QA 3FPQA 3POZA 5HG5A 4QP9A 5IEVA 2YAKA 3A4OX 3FL5A 4O0UA 3WIKA 1J7LA 1ZAOA 4QMWA 3Q52A 2WOTA 4NKSA 3B2TA 3MGYA 5AAFA 3BLQA 4Y73A 4I6QA 1ZOHA 2QI8A 1OKYA 4FV2A 4MWIA 5EI2A 3KCKA 3R73A 1M7QA 4GSBA 3OC1A 2W0JA 4KB8A 2A4LA 3EQDA 3PTGA 4Y5HA 3FEGA 5J1WA 4BCIA 2Y7JA 2IZUA 4EH9A 4RRVA 5EM6A 4B8MA 1TQIA 3A99A 3S95A 4ASXA 3MFSA 4L67A 3IDBA 4C4EA 4GEOA 4D0XA 2YCQA 5AR8A 3FSKA 2WEVA 4CTBA 5DE2A 4EZ7A 1A06A 2BALA 4PTCA 5CT0A 3Q4ZA 4XV9A 4IW0A 4MXOA 2XNBA 4D4VA 4R3PA 5JEBA 4QMYA 3VW8A 2NPQA 2WMSA 4AQCA 2KTYA 4LI5A 2EXEA 2W5BA 4ZEGA 5I9ZA 2XMYA 5IQBA 4AGDA 4XBRA 3D7TA 3DK7A 1QPJA 3BE9A 3HZTA 4MKCA 4QMPA 5D10A 3A4PA 4RVMA 4O86A 2IPXA 3GB2A 1GIIA 3W18A 2UZUE 3HKOA 3EH9A 2XCHA 2ZV8A 3VUDA 4JQ7A 2C6KA 3QYZA 3DY7A 4U44A 4IBMA 4QTEA 3NRMA 5GZ8A 5J79A 1T46A 3FMMA 4CG8A 4M14A 2WOUA 2FSTX 2P4IA 3HGKA 4TNBA 4D4SA 4R78A 4C62A 5IQAA 4DFBA 3BV3A 5L8JA 3JS2A 3R22A 3QRJA 3Q9YA 3MN3A 4HVGA 2VTPA 4EH4A
chains in the Genus database with same CATH superfamily
4GJ2A 3JVSA 4H36A 1HCLA 4QYFA 5M4IA 4YO6A 3FZ1A 3AC3A 3IW7A 4ENYA 4TWNA 3UTOA 5KZIA 4X21A 3VQHA 4E5BA 3R2BA 2XKEA 3QTIA 2WD1A 2IW8A 2XALA 4M67A 2HCKA 3MB7A 2RL5A 2BRGA 2PMNX 4PPBA 3OVVA 4AZWA 2CPKE 4C3FA 2XH5A 1DS5A 4F78A 4LOQA 4O82A 3OWJA 4MWHA 3FMKA 1PMEA 3MH2A 3UE4A 4D5HA 3WZUA 1UU9A 2VO3A 4L44A 2WZJA 4MHAA 3PPZA 2YM5A 4FTTA 3D7TB 3GU5A 5HLNA 2PHKA 4M0YA 4RX7A 3KMWA 5IG1A 1W84A 2CCIA 3FKNA 4IFCA 4NU1A 1O6KA 2PMLX 1NVQA 5CY3A 2QU6A 4FKVA 4JG7A 4DDIA 3LQ3A 2YDIA 4U9AA 4L7SA 2ZAZA 4BBMA 4PRJA 2R3FA 4EORA 3UIMA 3ORPA 3KVXA 4PNKA 4IVCA 2XAOA 5DEWA 1O6LA 2YM4A 3BEAA 1JPAA 3KMUA 3ZBFA 4Z3VA 2PUUA 3VW6A 3VS1A 4O1OA 3FXWA 4YZDA 1F5QA 1PJKA 3KQ7A 2BDFA 4CFFA 3RP9A 3Q6UA 4JRNA 2IG7A 3E7VA 3PSDA 3PDTA 4MNFA 4PV0A 4WSYA 5ACKA 4EH6A 3G9NA 5IQGA 2PZPA 4NK9A 3TIZA 4D28A 4YPDA 1ZZLA 2GDOA 4DN5A 3R8PA 3NW6A 1OL5A 3D5VA 4G1WA 3UZTA 3IW6A 2GSFA 5EFQA 5CZHA 3TZ8A 3PY3A 3RK9A 2ZMCA 5L2QA 2ZV7A 3H9FA 2WELA 1ZYDA 1YHVA 3WI6A 2ITYA 5CVFA 4DEDA 4F08A 4KKHA 3LJ0A 3VS6A 2OSCA 4IFGA 5HO6A 1KWPA 3DPKA 4YJQA 2EU9A 1B38A 2X0PA 1LEZA 5FM3A 2RG6A 3MY1A 1DAYA 3FQHA 4FNXA 4FZAB 5HIBA 3ZC6A 4EOOA 3C4EA 3R9RA 5M09A 4KRCA 4IEBA 4A9RA 1M2PA 3WYYA 3UDTA 2OK1A 4FL2A 4DHFA 2JFMA 3QCSA 2C1BA 3IPHA 3GU8A 5ETCA 3V51A 4R3RA 2OJGA 2J90A 4UV0A 3U8WA 1VZOA 5CLPA 4WKQA 3SDJA 4BCHA 4U81A 3SX9A 3OP5A 3VAPA 5HQ0A 2H8HA 3SKCA 2W96B 3OCGA 3VN9A 3TM0A 4QP7A 4QP6A 3C1XA 5ANKA 4AZFA 1AD5A 3A7JA 3D94A 3SW4A 5IMXA 4DBXA 3WF7A 5IQCA 4GJ3A 5E8ZA 2JDVA 3PVGA 4TYGA 2WTVA 4RZVA 5CZIA 3LZBA 1R0EA 3ROCA 2HW6A 5JN2A 3PXYA 5KBQA 1I44A 4A07A 4H3BA 5DR9A 3BGPA 2GNFA 2OF2A 4GT5A 3E64A 4JMQA 4U0IA 1UNHA 3U55A 2PUNA 4H39A 3UO4A 2PULA 3ZLXA 4TY1A 4FSTA 4BTKA 4WUAA 3DBEA 3FMJA 4BIBA 3O96A 2AQXA 3NUUA 4Y72A 4S30A 4ANBA 4TN6A 5J5SA 4GK4A 5GHVA 4I0RA 4NUSA 1W7HA 4OGRA 4RMZA 2W1DA 3F3WA 5EW9A 3WE4A 2ZM3A 4TT7A 3ALOA 1ST4A 4P5ZA 1R1WA 3MS9A 5BNJA 2JDOA 2X7OA 3HYHA 3IS5A 2BILB 3EYGA 3FZOA 2QOKA 3QQKA 3TUCA 3OEZA 1XMMA 3D5WA 4WNMA 4O83A 3IOKA 4MX9A 4QP8A 1RQQA 4L3LA 2ETRA 2XJ0A 3CQUA 3RWQA 4QTCA 3FLYA 2CNUA 2HOGA 1FINA 3UQFA 4NZWB 3UDZA 4K33A 4I20A 1ZARA 5E8TA 3FHRA 2CGUA 5DR6A 3WF9A 2YA9A 2ZB1A 1EH4A 3BHUA 5CU3A 2R0IA 4GK3A 5TO8A 3R8VA 4FKWA 5HE1A 3VBTA 5DHJA 1GZNA 4NFMA 3NW7A 3O5AA 2YIWA 4GFGA 2QHMA 2P2HA 4GYIA 2BAQA 4QRCA 2J5EA 5DFPA 4EBWA 2XK3A 5A4CA 2DS1A 3AKJA 3R9OA 5C8NA 3C0HA 1Q8WA 2JEDA 1OBGA 4ZMEA 4R5SA 4DT9A 3D15A 5FRIA 4FTUA 3TV7A 3QKMA 2BZIB 3MH3A 3OY1A 4YJSA 5CQWA 4BYJA 3FY2A 4FNZA 4AF3A 3AXWA 3OCBA 5FP5A 3N4TA 3KRRA 3MESA 3UG2A 2YJSA 4XRJA 4EOPA 2R3KA 3I1AA 5DGZA 2RSVA 1WVYA 2EB2A 5CASA 5IEXA 1K3AA 2OLCA 3R1YA 3Q2JA 4EUTA 5HE0A 5J95A 1TQMA 2CLQA 4RQKA 5FTGA 2GFCA 3CKXA 4FV1A 4YTIA 3GGFA 4KD1A 5DBXA 1TFFA 3I60A 1FQ1B 2QOHA 3HNGA 3OW4A 2HWPA 3V5PA 4QDEA 3BYUA 2GCDA 3AC5A 4A9UA 2JITA 4D1XA 3PY0A 3VS5A 3DV3A 4JG8A 5HE2A 4BDJA 3ZRLA 1ZMUA 5CU2A 5IZFA 2HWOA 4ZOGA 5I3OA 3L8SA 4KKGA 2AC3A 3RALA 4AOIA 2BRBA 2VZ6A 3O50A 3PFQA 5F1ZA 4B8LA 1P14A 4CMOA 3MVMA 3LXNA 2BMCA 4QT1A 3RINA 3DQWA 1BX6A 2VWXA 2YFXA 4GUEA 4YZ9A 5C27A 4U3YA 5A54A 3GNIB 1M7NA 1MQBA 3WARA 3VULA 3LFDA 4GG7A 5AUYA 2UZOA 2PSQA 2XM8A 2QLQA 5H9BA 1JLUE 4EOMA 1UA2A 2YLFA 4GIHA 3LCDA 4QMVA 4DCEA 3OXTA 4O7VA 3BX5A 4AW1A 2XAMA 5CXZA 4RG0A 3ET7A 5D11A 2JKKA 3WE8A 3R6XA 4UMTA 5EDPA 3VQUA 4WNOA 3AD5A 1ZYSA 3OOMA 4AFEA 5BVFA 1ZOEA 4JG6A 4JI9A 4ZP5A 3VBVA 5LMAA 2IO6A 4YTHA 3PIXA 2B54A 3FMDA 2X4ZA 3FMEA 3FBVA 3K3JA 2PL0A 4YJVA 1P2AA 4D2VA 2YCRA 3SG9A 4FI1A 4P2KA 5C01A 3QU0A 3RBWA 4BZOA 3KFAA 3U54A 3SV0A 3M2WA 4IM2A 3V8TA 2W1CA 1UNGA 1OM1A 3SA0A 3BGZA 4FYOA 3SOAA 3OUNB 2BTSA 3LJ2A 5IH6A 1DI9A 2ETKA 2ZMDA 1CKPA 3MJ1A 3OWLA 3QTWA 3QZGA 4XH6A 2QOIA 4FSZA 3CEKA 4EQMA 4WHZA 3LXKA 4LOPA 5HVJA 2CNQA 3RPOA 4ANSA 1W83A 1CM8A 3K2LA 4D1ZA 2YM3A 3L1SA 3V5LA 4CFWA 3ZEPA 3CP9A 5CEQA 1LP4A 3ORMA 3IDCA 3NCGA 4E20A 1OI9A 3NEWA 5CU0A 3C0IA 4D2TA 2OJ9A 4F64A 3CQEA 1SNUA 5AR5A 2OIBA 3QQJA 3R7GA 3LFFA 4V0GA 1Z57A 4YC8A 4CKIA 2C6DA 4W4VA 5AWMA 3VC4A 3KRXA 4LG4A 1WVWA 3TNHA 3ZCLA 3ZEWA 3O23A 2X7FA 3QA0A 4ZSEA 5DR2A 1R0PA 4TTHB 3FI3A 1F0QA 2B0QA 2JIIA 5AR2A 2UZEA 2VTTA 2UV2A 3ORXA 3P7AA 4ITHA 3WIGA 3ZTXA 4C8BA 4F70A 2XANA 3U9CA 4IZAA 4BHZA 1GNGA 5A4TA 4FUYA 4IVAA 3MYGA 5CAPA 3H10A 3O7LB 4QMMA 2X7GA 3M42A 3MV5A 5C1QB 4FT7A 5D7AA 3NSZA 3GU6A 3QZFA 4ZTHA 1NVSA 3F5XA 4QYEA 2XNNA 4D0WA 1M14A 4L68A 4IJPA 3HV6A 3DJ6A 4FC0A 1UWHA 3TV6A 3DDPA 2GNJA 4QPSA 1UWJA 3EKNA 1BMKA 2VWVA 3IW8A 1H01A 4E6AA 1YQJA 1GJOA 4G6OA 4OTHA 4V0GB 1OIRA 5AP5A 4DH7A 3DK6A 3ORLA 3LMGA 3Q9WA 3OT3A 3QKLA 3HV3A 2VTJA 2UW0A 3MVJA 3MA3A 4BBFA 2UZWE 3D7ZA 3I6WA 3AC2A 4QPAA 3PSCA 3ROYA 3I0QA 4TYEA 2BZJA 4DGMA 2JDTA 4FGRA 3UYTA 1CSNA 5L2WA 5GINE 1OL6A 5ETFA 4DTBA 3N4UA 1ND4A 2C0OA 2ERKA 5FXSA 4XV2A 5JZJA 3L9NA 3OROA 3BHVA 4PPCA 3NFGB 4KNBA 3R1QA 5DT0A 3RK5A 2JD5A 2GHMA 3E87A 4RC2A 3AC8A 4UMRA 3TNIA 5HG8A 3PLAE 4E7WA 2C5NA 4A9TA 3G90X 4FE2A 1G8KA 1Y57A 3LQ5A 4XV1A 3CY2A 2IVTA 5HBHA 3UOKA 3O8TA 2C47A 3KY2A 5AR7A 4IB1A 2VX0A 4C0TA 2PVNA 4KINA 4KIQA 2WNTA 3UVPA 3AD4A 1PXJA 3AC1A 5EYMA 2VRXA 4IC7A 3C4ZA 3RKBA 2WMAA 1SNXA 4G3CA 3JR1A 1ZMVA 3SQQA 4NKAA 2R3NA 3TJCA 4IAFA 2A19B 3PA5A 1STCE 3JVRA 3PPJA 2Z7QA 2UW3A 3QQLA 3UGCA 4BDHA 4JOAA 5EQEA 2W4KA 5DN3A 3C4FA 3EOCA 1A9UA 5IUIA 5FGKA 1YDSE 3ULZA 4UBAA 5CSPA 4PTGA 3QZHA 2WHBA 3V3VA 2CKQA 4O7ZA 4G3EA 3PXKA 3GFEA 3NYXA 5HG7A 5ANOA 4HCVA 5BYLA 5JFWA 2IZSA 3HP2A 2BAJA 4FSUA 5AP6A 4PP7A 2ITVA 4BI2A 2BIYA 1PKGA 1IAJA 1JSVA 5FTQA 4XLIA 3L9PA 4QYHA 1IASA 4IZ7A 1PRYA 3HX4A 3KGAA 1GIHA 4X2KA 5AAGA 1H1QA 3Q9XA 5LVMA 3TN8A 1JQHA 5ANDA 3FZPA 4IX3A 3SAYA 1JKKA 5EYDA 3GCPA 3CD8A 2OH0E 5BMMA 4CEGA 3TXOA 3I4BA 3OXIA 2QLUA 4HGSA 3MB6A 2J7TA 2QOLA 4IX6A 3HECA 4DEEA 2ZOQA 5BYYA 2XUUA 4L9IA 4HOKA 5T68A 4FOBA 2WMUA 4FKJA 4PNIA 1QPDA 4OT5A 3ZLYA 5AR3A 4G5JA 2IW9A 3ZUUA 4MNEA 3D4QA 3DCVA 2Z8CA 4WO5A 5D1JA 2JFLA 4AW5A 3IGGA 4CTCA 5F94A 4AGWA 2W17A 4Y8DA 3FLZA 1UKHA 4CNHA 4ZZOA 1J3HA 1V1KA 2OIDA 3MFRA 2DUVA 3C4WA 3LAUA 3Q4UA 3R8UA 3W55A 3PPKA 3QRTA 3NUSA 5FBOA 2WFYA 3D14A 3NWWA 4O0WA 4FG7A 3TDVA 2WAJA 3QZIA 3W0QA 3IK3A 5AX9A 4FODA 1ST0A 1OL7A 4BGHA 3KN5A 3QYWA 4U43A 1DM2A 1UKIA 5M08A 4N70A 3NNUA 5E90A 3VRZA 3HDNA 2C6IA 3LFBA 5EM7A 1Q3DA 2H6DA 4ANNA 4E6CA 4FV3A 3LFSA 2Y4PA 4C2VA 3QQGA 5L8LA 4MUQA 2R3MA 2VWBA 2YJRA 3P7BA 4FT9A 4H58A 5K5NA 2O5KA 4YC3A 3DJ7A 4FZ6A 4MD8E 4CG9A 1DAWA 4W4WA 4Y95A 4ZLYA 3FV8A 4QO9A 1GY3A 2XNOA 3ZONA 5AJQA 5AM6A 2VTRA 1KSWA 2UW6A 2UZDA 4NCTC 4XLVA 5K0KA 1OKZA 4MNEB 4QMQA 3LIJA 2BIKB 5E1SA 4FIFA 2VTOA 4P5QA 2C5YA 1XJDA 4GS6A 4RGJA 4QMTA 4FV9A 4FT0A 4KAOA 4E3CA 3LKMA 2ZDUA 3LFCA 3LCSA 3R7OA 1TZDA 4ZSJA 5EW3A 3Q5ZA 4R7HA 2PPQA 5E8VA 3FZTA 3CIKA 3KREA 2GTNA 4GT3A 4PDPA 4TRLA 1KOAA 2YM7A 4CT2A 5GIPE 5LVNA 4RBLA 3HUCA 2HAKA 4BGGA 4CKJA 4AWIA 4QP4A 3KRLA 2CKPA 1GOLA 3AMAA 4L3JA 3UP2A 3DAJA 3PXFA 3RHXA 2UZNA 1MP8A 4WBBB 5BYZA 4L53A 3NR9A 3QUDA 4J97A 4FICA 3PZEA 3ZRKA 3R1SA 3WILA 1ZYJA 3R1NA 4JVGA 2YISA 4BDIA 3NUNA 2XNPA 3F88A 2HZ4A 1Q4LA 4YJRA 3C13A 4JBQA 3T3VA 4O91A 2F49A 3CQWA 5EH0A 2O63A 2VAGA 5T3QA 4EJNA 5M55A 3R7VA 3PVBA 2YERA 3O7LD 3QHRA 4YJOA 2C6TA 2BAKA 5D12A 3R9DA 5L8KA 2PMOX 2YHVA 3EHAA 4BFMA 3NCZA 2W1HA 1FOTA 4ZAUA 2JDSA 3O2MA 4EZ5A 3KN6A 1WAKA 4AG8A 5HTIA 3ALNA 5LCKA 2HENA 2UW4A 4YGAA 2DWBA 2PU8A 3NNXA 1WMKA 4FV6A 3NGAA 4YLLA 5K3YA 2RFSA 4ALUA 3O8PA 1ATPE 4O2ZA 4RIYA 3VS7A 5BVDA 5LMBA 4RC3A 5H8BA 4FKLA 5JT2A 3W0SA 3VWAA 4IAIA 3II5A 2R7BA 3MW1A 5DNRA 4X2JA 4F0GA 2G2IA 4BICA 4F4PA 3GC0A 5JFVA 4FT5A 4L00A 1REKA 4DA5A 2I7QA 3PXZA 2WMVA 3DA6A 5F4NA 3W33A 2GPHA 4F09A 3H0YA 3KMMA 1OIYA 4RJ8A 4HZRA 3LPBA 3N51A 4JRVA 2B55A 5AUWA 4DHIB 4H1JA 4ACMA 2ITQA 1HOWA 2X8IA 5CANA 2GFSA 4X3JA 5IA0A 1JKSA 3TEIA 3QC9A 4GT4A 4OW8A 4U97A 1YOLA 3IGOA 2RIOA 4UZDA 1KV1A 2GHLA 4E6DA 2JGZA 3QALE 5E91A 2PZYA 1OITA 4MXAA 4CT1A 4NCTA 1Y6BA 2I0VA 5J87A 2XRWA 4JL9A 4F63A 5DMZA 2B53A 3KA0A 4M3QA 2JBPA 5GJGA 2XIYA 3IOPA 3ACKA 4JJRA 4UEUA 4U7ZA 3L8VA 5T6KA 1OIUA 4FG8A 4XP2A 4RIYB 3VBXA 5FWKK 5CF4A 5JK3A 5KMLA 4F7LA 3OY3A 3S4QA 4ACDA 1G3NA 4IWDA 3PFYA 2CN5A 4GG5A 5H2UA 5F20A 1KV2A 2VTLA 4YZCA 3AGLA 3DLZA 4QNYA 4C37A 2YDKA 2V0DA 3FZSA 1KE8A 1YDTE 4K1BA 4XHKB 4AXDA 3UIUA 5ETIA 3FAAA 3FQSA 5E9EA 2P3GX 3A7GA 1OBDA 4UX9A 1UVRA 2EB3A 3BEGA 4I6LA 3VS3A 4XOYA 4RZWA 2I40A 4HYSA 3KK9A 4H3PA 2WU7A 2OXDA 4X2FA 3AGMA 1U4DA 5AADA 2C5OA 2GS7A 2W1EA 3EZVA 5C4LA 4NEUA 2XEYA 3H0ZA 3IKAA 4JIKA 3ML1A 4U5JA 3F2AA 4C4FA 4EOLA 2J2IB 3LE6A 3A61A 3LXLA 1OZ1A 4F99A 3KCFA 4CGAA 4G3FA 1L3RE 4O27B 3IW4A 4EKKA 4FTQA 5CVHA 3GCSA 3BBTB 1KE6A 3GENA 3GI3A 4PDYA 4CSVA 4XCUA 2PTKA 2VO0A 3UYSA 1J7IA 1WBTA 2WPAA 3PVUA 3KXZA 3FXXA 4TYIA 2XK8A 4L3PA 3ZYAA 3DKGA 2UVYA 1WBPA 3NW5A 4C57A 4YHJA 1FVVA 5J8IA 5EHLA 4ERKA 2LGCA 4ZY4A 3V5WA 3OEFX 3QD0A 2QONA 2HZIA 2J6MA 4MAOA 4I22A 4OTPA 2XNEA 4PQNA 3VUGA 3DGKA 4FEXA 2X9EA 1W2DA 5CF5A 5IQFA 3UMWA 4EH2A 5HIDA 4KSQA 2W99B 5KBRA 5IPJA 3R30A 4W9XA 3VF8A 4IB5A 2XM9A 3HRFA 2VNYA 2BZKB 3ELJA 4QYYA 3FMNA 2BKZA 4BF2A 3SW7A 3TACA 3UZRA 3EN7A 2P33A 2CKOA 5ICPA 4N0SA 4RFZA 4BTJA 4EI4A 3KRWA 5JH6A 3PJ1A 1A48A 2O65A 4UZHA 3SXSA 4I5CA 3D0EA 4GL9A 4TWPA 1REJA 4ASZA 3COMA 5IU2A 2BFXA 2UW7A 4BDGA 5HX6A 3Q9ZA 4DEIA 4U3ZA 1SMHA 4TNDA 5FP6A 2ITPA 2YIYA 1I09A 4J7BA 5LVPA 2BCJA 4E6QA 3UNKA 4RQVA 4LRKA 1VR2A 4IVBA 5IQHA 1XH5A 4BCNA 5M4UA 3IQ7A 2C4GA 1JSTA 1BYGA 4QP2A 2Y4IB 5HCYA 3R04A 4ENXA 4DEAA 1R3CA 3AD6A 1M52A 4O0YA 4PWNA 4IWOA 5EM8A 4AA4A 5AIKA 2GU8A 4S32A 3LFNA 3A7FA 3BV2A 1PYEA 3EQGA 4KKEA 4X3FA 3GFWA 3W16A 4IACA 4RX9A 4ZLZA 3RZBA 3QQFA 5EKNA 1WBNA 3OG7A 1W2FA 3D5UA 3PE2A 1ZYLA 5DH3A 2E9OA 4F1TA 5K9IA 2GTMA 3MIAA 1Q97A 3NYOA 1X8BA 3ENHA 5C8KA 3BPRA 1JVPP 1XO2B 2HIWA 3OT8A 2W1GA 4XOZA 5AM7A 5AAEA 3GC9A 2PVRA 3FDNA 5HCXA 1S9IA 4XS2A 5ITAA 4XG6A 2WTKC 5CT7A 3SVVA 4FKGA 2ITNA 2WQNA 3HDMA 5FXQA 2X0QA 3LCTA 3UPZA 2PZ5A 3ZUTA 1Q62A 3C5UA 3E8EA 4QTBA 5EOBA 4O4FA 1URCA 3ZDIA 3R71A 4U42A 4AOTA 2RFDA 2C1AA 3NNVA 4GUBA 4OT6A 4UYNA 5DRBA 4A4OA 2ACXA 4E26A 2YEXA 2J4ZA 2J0JA 3WOWA 3CLYA 3R00A 2YM6A 5B2LA 1XQZA 4LV7A 4ZZMA 1U59A 5IUHA 4X3FB 3MVHA 5CU6A 2XIRA 3I0OA 1XMLA 3DJ5A 4P90A 2G1TA 2WTJA 3UOLA 4DGNA 4FSQA 4FV7A 1HCKA 4HVIA 5D9HA 3F3TA 4G5PA 3PA4A 3R7IA 4Q5EA 3MA6A 2X6EA 2BTRA 2R9SA 3HA8A 4JAIA 4CFUA 4ZSAA 1RDQE 4RWLA 3ZXZA 3AT3A 2W9FB 3QC4A 4YSMA 4O22A 3DAKA 4DHZA 3MI9A 1PYXA 2X2MA 1G8AA 5HU9A 2I1MA 3CGFA 4ANMA 4YJNA 4LV5A 4RVTA 3GP0A 4DFNA 5A9UA 2ZM4A 5I9XA 1IA9A 3A7HA 2R3HA 3C9WA 3EQHA 1DI8A 1H1SA 2H9VA 1E1VA 1PXIA 2XNGA 3R8MA 4EOJA 3QTSA 4FUXA 4HW7A 2FVDA 1W98A 3KVWA 4XX9A 5BVOA 2XK9A 2RG5A 4DEGA 3SHEA 2X0OA 3EN9A 1FMOE 3LW0A 1XBAA 4BDEA 4BWKA 4R1YA 4RIXA 4C34A 4BJJA 4Y46A 4CQEA 5CALA 4QMSA 4M66A 3OUKA 4NYEA 2Y0AA 2J5FA 2W7XA 2I0HA 2CHLA 4FR4A 3UOHA 4MQ2A 1PHKA 3Q6WA 4O84A 3NX8A 1YXVA 5KCVA 3VONA 3EL8A 3QXOA 3C5IA 3RCDA 3QA8A 4LV8A 2OXYA 4I93A 3IONA 5M4CA 4JDKA 1NA7A 2VWZA 3PY1A 2YITA 4G31A 2SRCA 4LQMA 5HLPA 5L2IA 1OL1A 2O64A 2XKFA 2ITOA 4A9YA 2R0UA 3SLSA 2PVHA 5EDRA 5HNBA 5HVKA 1ZYCA 2O2UA 2OFVA 3VHEA 2YWPA 4FV8A 2CNVA 2X4FA 3SC1A 1RE8A 4O7YA 1YVJA 4PMPA 5CSHA 2J9MA 4FTKA 3AT2A 3JY9A 3QUEA 2EXMA 4G3DA 4YLJA 4AZEA 4CFVA 4TL0A 3O8UA 4HNIA 2X2LA 3NDMA 4LRJA 4NWMA 3LXPA 3I7BA 1PY5A 4DGGA 4GFMA 2B7AA 3ORNA 4RIXB 1RJBA 5EW8A 5CEMA 1Z9XA 1J91A 2GMXA 3EYHA 4J95A 5LVLA 3QLGA 3RM7A 3R8LA 3ZOSA 4D2SA 4F9AA 5BUIA 2W1IA 4FTRA 3F7ZA 2C5XA 4XG3A 5AP7A 1FVRA 1YXUA 3ZO4A 4Z55A 2ITUA 1XWSA 5AIRA 4AXAA 2F7XE 3OCSA 3FHIA 2BR1A 2OZAA 3V8SA 3E88A 5A6OA 2CDZA 3IECA 3CJGA 4HGTA 5EOLA 2HYYA 4XV3A 1Q41A 5GJFA 3W2OA 3GC7A 4DAWA 1SVEA 5AUUA 1Q61A 4O0VA 4AW2A 4XMOA 3DK3A 2G2FA 2QVSE 2H34A 3C51A 3H3CA 4KBCA 4FTOA 5TOZA 4EK8A 1MRUA 2CSNA 5IDNA 5F9EA 5L2TA 3BLAA 1B6CB 4DH8A 3P79A 5LOHA 4OAUC 3ZXTA 2OO8X 1Q8UA 4BI1A 1LUFA 3P4KA 4JR7A 5K4IA 2QR8A 5IQDA 1W2CA 2UZVA 3C0GA 4YZNA 3TZMA 2NP8A 3Q96A 2WTKB 3QQHA 4II5A 4NFNA 3RTPA 4A4XA 4WG4A 4Q9SA 4WA9A 4JLCA 3NIEA 2F57A 4E93A 4FSRA 4O0TA 4C33A 4C2WA 4EH5A 4GVAA 5AA9A 3LM0A 3QAME 5KKRC 3RPVA 1KE5A 4JT3A 1IR3A 4I4FA 4NM3A 1SVHA 2WQBA 3RAHA 4EOQA 5CAVA 5AMNA 3EN5A 3W8LA 4UN0C 3FXZA 2Y6OA 4ANOA 4CXAA 3F82A 4HPTE 4IWQA 1G8SA 2ZJWA 4CV9A 2VWWA 5M44A 2CGWA 5HHWA 4C4JA 2OZAB 3NZ0A 1FPUA 4QNAA 2GNHA 3I79A 5H8GA 1Y91A 5IQIA 4AU8A 1OL2A 3EKKA 4ZSGA 3LLTA 1MRYA 5CNOA 4LGGA 4R7IA 3BKBA 4M97A 3SGCA 4DINA 2G01A 4EOKA 3CXWA 4D2WA 4W4XA 4DH1A 2V5QA 2R3IA 4FVRA 5I9VA 3G51A 5BX0A 3MDYA 2VTSA 5FEDA 3P86A 4A9SA 5AP4A 3U6IA 2V7OA 5CWZA 5I9YA 3LVPA 2CLXA 3C4XA 4LGDA 5IH5A 3ZBXA 1YOMA 4KIOA 3CS9A 3R2YA 3NLBA 2UVZA 4BYIA 3W8QA 4USEA 5EHOA 4FF8A 3Q60A 2XYNA 5EK7A 1YXSA 2R3PA 3LOKA 2QOCA 4IDVA 3FYJX 3TI1A 3ZFXA 3NVMB 5IA4A 4LUDA 3VIDA 2QKRA 4JDIA 1WZYA 4RSSA 4GIIA 3BL7A 5I4NA 2NRYA 2DQ7X 4DLIA 4EH3A 4EK5A 2R7IA 3KXXA 4FSNA 4BL1A 3ODYX 3PRIA 2REIA 4YLKA 5HLWA 3DFAA 4QP1A 1H08A 3GVUA 4MXZA 1LPUA 4M0ZA 2QO9A 3F66A 3OZ6A 4B99A 5FXRA 4G3GA 1M2RA 1YXTA 3A7IA 2V7AA 3P1AA 1U5RA 4O6LA 5IA2A 2GS2A 1KUTA 3UBDA 1FGIA 2E2BA 5KX8A 4LUEA 3HAVA 2V62A 3CGOA 4RX8A 3NUXA 2QURA 4RJ5A 2PE1A 4GFOA 3EN6A 4HNFA 4XG7A 2PVMA 3KF4A 3UP7A 5BV3A 4FNYA 4CZUA 4I0SA 2R3OA 4ERWA 4CZYB 3R7EA 2W5AA 3EQRA 1UU8A 3TTJA 2WGJA 2CN8A 1XBBA 3MFTA 3EQFA 4X2GA 2PZIA 5E7RA 2QOFA 3F5GA 1K2PA 3KC3A 4Z7HA 3W0OA 2P55A 3Q4TA 4TW9A 3UPXA 4OR5A 3HL7A 4AFJA 4E4LA 3C50A 4QEBA 3GCQA 3DKFA 4AACA 3ATTA 4WIHA 5DA3A 4Q9ZA 5IA3A 2XKCA 2P0CA 3KK8A 3POOA 4AN9A 4I24A 5FUTA 2BRHA 3KL8A 4KBKA 2BRMA 3DB6A 2P2IA 5C26A 4O7WA 1PXOA 3B2WA 4BCFA 4K0YA 2OBJA 2WEIA 2Y9QA 4IM3A 4IDTA 3FI2A 3GQLA 3E7OA 4JX3A 4V04A 4DF3A 5CSWA 4QTDA 1Z5MA 2Q0BA 3MTFA 4GV1A 3VS2A 1H25A 1OMWA 3MH1A 5HNGA 4OBQA 4X6RA 4J8NA 2XIXA 3UNJA 2QU5A 3MTLA 4O7TA 3L8PA 3PE1A 3DDQA 2VU3A 2A98A 2F7ZE 4QPMA 3VO3A 4ITIA 2PYWA 3E63A 5CEOA 5F95A 1Q8TA 4EHEA 3WZKA