4D2SA

Human ttk in complex with a dyrk1b inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
281
structure length
249
Chain Sequence
AANECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIATVNYMPPEAIKDMSPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Discovery and Optimization of a Novel Series of Dyrk1B Kinase Inhibitors to Explore a Mek Resistance Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 249
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d2sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d2sA01
2OXXA 3O51A 1NA7A 4MVFA 5CY3A 3FXWA 5D11A 4ASZA 2XK3A 2OFUA 1URWA 1MRYA 4BZDA 4CV9A 5K0XA 5LVPA 3RK5A 3FL4A 3RCDA 3Q60A 3RM7A 3PJ3A 3UZPA 2R3IA 1APME 2YA9A 2C3IB 2FGIA 3CIKA 3OMVA 4PNIA 5DH3A 3AGLA 3TCPA 4I22A 3EQFA 2Y4PA 2XKEA 3VUIA 3ZC6A 1H1WA 5IH4A 4FSWA 4XH6A 3E3BX 3F7ZA 3FJQE 4JDKA 3P7BA 1UNGA 2J0MB 4IZAA 2CDZA 3D5XA 3S4QA 5HBEA 2PSQA 3PY3A 4R3PA 1BI7A 5FTOA 4QMOA 4WSYA 1IAHA 3F69A 3VAPA 2JKKA 4X2KA 1OI9A 3SQQA 4D0WA 2OJGA 4L01A 3FMJA 3IK3A 4L6QA 4RX7A 4L3JA 5BVWA 4WG3A 3EQBA 3OFMA 1KE6A 3V8WA 2HYYA 3RAKA 2C6LA 4IZ5A 5DRBA 3DY7A 3D5WA 4GJ2A 2YIWA 1OL1A 2RFSA 5EM8A 2XIXA 1DM2A 2UZLA 4UX9A 2C47A 3SG8A 4UN0C 2R3JA 3NUYA 4F09A 4GEOA 4IC7A 5EK7A 4CQEA 3VS6A 2Z7QA 4EL9A 3BGPA 4TL0A 4BDFA 2UW3A 2QOCA 4RLKA 5F95A 5ACKA 5CAQA 3CTQA 5HIBA 5GIPE 1WAKA 2EXMA 4DINA 3BYUA 4FR4A 3GCSA 4J7BA 3TIZA 4F7LA 4XV2A 4C4GA 3PFQA 3BEAA 4FI1A 5LCKA 2YISA 5IQCA 2YM6A 4EH9A 3QQKA 5HLWA 3SVVA 3KB7A 4TWPA 3AD4A 4TYIA 4X3FA 4NKAA 3DFAA 3HVCA 2O64A 3RKBA 2I0EA 2VV9A 4PL4A 5JFVA 3DV3A 1NW1A 2R2PA 3C51A 3OW4A 4G1WA 3FKOA 4XNEA 5AP5A 4EONA 2C0OA 5HVKA 2XKFA 3N9XA 5IEXA 5E1SA 2V22A 3V6RA 4EKKA 1OIUA 3I1AA 5BNJA 2RFNA 2PUIA 3HKOA 5LMKC 2VTJA 1VYWA 4BHNA 5M4IA 4NM7A 4AU8A 2BIYA 4QYYA 4UB7A 1TQIA 4AWIA 4BRXA 5BUJA 4TT7A 5IUGA 3TIYA 5B2LA 4GFOA 4ENXA 4F4PA 5H8BA 2YCFA 3KMUA 4AX8A 5DYJA 2X6EA 4QMTA 5C01A 2WD1A 4UMTA 3TZMA 5CQWA 4EC8A 3PSBA 3Q6UA 3WE4A 4DLJA 5A46A 3NIEA 3R30A 1JKTA 3EOCA 3UQGA 3V5JA 3FPQA 4G3CA 4DLIA 3KY2A 5LMAA 4O7YA 3VNTA 4TNDA 5AV1A 2CKOA 5EG3A 5BUEA 4O0WA 1ZYCA 4B6LA 5ANIA 4BKJA 4M69B 4MD7E 2IPXA 1U5QA 3BLQA 1Q99A 4HZRA 4Q5HA 3PRIA 1S9JA 1WBWA 3LXLA 4MBJA 3VUKA 5C8NA 5DG5A 1XBBA 4WT6A 4AA0A 2PE2A 2C6IA 3C0HA 4FSQA 2BPMA 4IH8A 4RZWA 5EYMA 1GIHA 5M55A 4C35A 1WFCA 5IZFA 3TUCA 3EQCA 4GFMA 4K0YA 3JUHA 2BDFA 4I5CA 3EYGA 2VGOA 2ZOQA 4FIFA 4BDEA 1ZLTA 5DR2A 2VWWA 4EOMA 2QO7A 4YBKA 5A9UA 3HEGA 2QCSA 4O0TA 4ZSEA 3WZDA 4AGWA 4BVUA 1VYZA 5DEYA 4BDIA 5IKWA 4I93A 3PVWA 1MUOA 4KSPA 5CWZA 3KFAA 3Q32A 3SV0A 3DK6A 4PDSA 4FE2A 5ANJA 2QOIA 5I9XA 1YWNA 3VIDA 2RG5A 3MV5A 3FMDA 4J71A 4I41A 4ZTHA 2JKMA 3SA0A 4QMXA 1H26A 4S34A 1UU8A 3WIKA 4U6RA 3TG1A 2HWPA 1QPEA 5J5SA 4PPBA 5HX8A 5BYYA 2PZ5A 2F7EE 3CD8A 4WNOA 2YJRA 2R9SA 1CSNA 2GS6A 3TM0A 4FGBA 1OUKA 4CT1A 3ERKA 2CMWA 4FKQA 4X0MA 3HLLA 3KF7A 3OEFX 4NK9A 1HCKA 5CEMA 5L2IA 3O23A 2JKQA 1F3MC 3MY5A 2CN8A 4FIEA 4XV9A 3FI4A 5AV2A 3AC2A 3UOKA 3VUMA 1J1BA 3MA3A 1R1WA 3DBFA 5J5TA 3QRIA 4P7EA 2Y4IB 3ELJA 3EL7A 5M57A 3OOMA 3LIJA 2BRMA 5LQFA 3OC1A 3PXRA 5EQEA 3ZDUA 4D4YA 4ID7A 2IW8A 4ZTSA 3KGAA 2YIQA 4R7IA 4IVAA 5L6OA 5HG9A 5HTBA 3G9NA 4DH7A 2C5VA 2ZDUA 3DKFA 4M14A 1ZWSA 3ORKA 3PUPA 4I6FA 4CMTA 4EH2A 3ZUVA 4RJ3A 1YOMA 2A4LA 3NWWA 3MB7A 5HO8A 2JDVA 4H3PA 5D41A 4E93A 5L6PA 3U9CA 3PZHA 2PZIA 4YLKA 2UZVA 2WAJA 2GHGA 4PF4A 4PQNA 4FF8A 4KA3A 3REPA 4C3RA 4F6SA 5FDPA 4ZTQA 4FKRA 4D2VA 2J0LA 3KEXA 2C5YA 3P86A 3D5VA 3VS2A 4RWIA 4C7TA 1B38A 1CKIA 3NIZA 4CYJA 1UNHA 3BBWA 2X39A 3BHHA 5IA0A 4TYHB 2VTTA 4DBNA 3D4QA 3GEQA 3QUDA 4O0VA 5GHVA 4W9XA 1SM2A 2XM8A 4UWBA 2WMVA 3P0MA 2C6MA 3TWJA 2J0KA 4LRKA 4NCTA 2UW8A 4QYGA 3OUNB 3DAEA 2C69A 3NX8A 4J1RA 4MNEA 3EQPA 4XOYA 4GIIA 2BTRA 3L8SA 2F7ZE 3F2NA 4XBUA 3UJGA 5A4CA 4ZS0A 2IVTA 1KUTA 3CJFA 4I24A 1FGKA 2XIYA 3PWDA 3DKOA 1SMHA 4JBQA 3RMFA 5DA3A 2R3QA 4FKGA 4FEWA 3MPTA 4O1OA 5D7VA 3G6GA 2J51A 2VX1A 4F1TA 3LCKA 3Q53A 3QKKA 3KK8A 4CFUA 4RIOA 4ZJJA 4ZAUA 5E91A 3LMHA 2X2MA 3PSDA 4YLJA 3LQ8A 3R7UA 5LOHA 4CV8A 4JR3A 3EFKA 4K8AA 3CTJA 2XF0A 3HAVA 2IZUA 4K9YA 3P5KA 2R3PA 5IQIA 4NFNA 5AV3A 3EMGA 3UO4A 4MF0A 4QYEA 4FC0A 1SVHA 3PXYA 3RGFA 4FVRA 1URCA 3ZTXA 1AD5A 4BCHA 2BKKA 5ACBC 3QKLA 4YJSA 2I0VA 1PXOA 3LE6A 4JBOA 1IR3A 5HCYA 1AQ1A 1JSVA 1KE5A 4DAWA 1UWHA 4CLJA 1PXLA 2YCQA 3HV4A 4LOOA 2ERKA 3O0GA 1LUFA 3SX9A 1JLUE 2XA4A 3FDNA 1FINA 3WF9A 3PA5A 4Q2AA 1W98A 5LJJA 3MFRA 4JQ7A 1GZKA 3C7QA 3OVVA 4AQCA 2GU8A 5KBQA 3N4UA 4AW0A 3LQ3A 2QO9A 3PA3A 3MN3A 3OTUA 3ACKA 5AUYA 4OTDA 3R2YA 2OKRA 4L7FA 2Y7JA 4M67A 4EOIA 3U54A 5TO8A 4AZTA 4BIEA 4Z55A 2QR8A 3Q96A 4TKSA 1ZMVA 4FUYA 5J79A 1RW8A 2C6TA 3DNEA 4YTHA 3OZ6A 3QC4A 5J7HA 4GG7A 5FP5A 4RIWB 4H3QA 4ZSLA 2W05A 4QTBA 4X7QA 3I7BA 3OY1A 4D58A 5CASA 3BYVA 1KE9A 3EN6A 3BZ3A 3M11A 3BKBA 3R1YA 2BAQA 1J7UA 4IM3A 1R0EA 4F9CA 3UG2A 5CANA 1QMZA 4LMNA 3P79A 4NTTA 5JRSA 3SG9A 4DE4A 4M12A 4X3FC 4EH4A 5K5XA 3PDTA 4DH5A 1PF8A 2PVHA 4NTSA 3HP5A 3ZSHA 2PVFA 3V5LA 2R4BA 3II5A 1TQMA 2IZTA 1PMEA 4FT9A 3UC3A 2BHEA 4U45A 1PYEA 1JSUA 4AW1A 1CM8A 1VZOA 2KULA 4W4YA 5FBNC 1V0PA 4LMUA 4HPUE 4O22A 2V7OA 2PZPA 3FLWA 1W82A 3A60A 3AC4A 4EOPA 2HY81 4U3ZA 1YXTA 3R63A 5AX9A 2HCKA 4ARKA 4EHZA 4JDIA 3R7VA 2CNVA 4PDYA 4I20A 2YN8A 4YZNA 1H4LA 4NL0A 4U80A 3PXZA 2X7OA 3SW7A 3DXQA 3H30A 3A4OX 4FNYA 4FV9A 4M3QA 4MQ2A 4CKIA 3PLAE 4RQKA 1UKHA 2YWPA 4FTLA 4BDBA 4CMUA 1Q8TA 1WVYA 4JJRA 4JIKA 4WUAA 5AAGA 4H1MA 5AM7A 3LCTA 2ITTA 1H24A 1YOJA 3FLQA 2BZJA 2A1AB 2X9FA 2Z7SA 3QU0A 2WMWA 3UZRA 3ZM9A 4TRLA 4MWIA 3QD3A 2W99B 3G9LX 3KXZA 4IX4A 1UKIA 4KINA 4KS8A 4FGRA 5KMLA 4L44A 5B7VA 3ALNA 3QGYA 3ZLWA 3OCTA 1UU3A 3F5PA 3FMHA 3ZEPA 3SRVB 4D5HA 2CGWA 5H8EA 3PJ2A 4YZDA 4TPTA 4KD1A 4XRJA 3VS4A 3M1SA 4S30A 3VS3A 3EN9A 4O96A 3BEGA 5JZJA 3LFFA 4NKSA 5EKNA 3H0YA 4DA5A 5H9BA 2IVSA 3G33A 3Q4UA 4FVQA 5J1VA 2WTKC 4BDGA 2YDKA 3CQEA 2RFEA 3GU5A 3MH3A 3A7JA 3MY0A 3QQLA 4IB3A 4O38A 4YR8A 5KMNA 5IDNA 2QONA 3ODZX 3FSFA 1ZY4A 1H27A 3MVMA 2WU6A 1JPAA 2XNMA 4EBWA 1OKYA 4FV7A 3WARA 5BQ0A 4LOPA 1E9HA 4LRJA 1OMWA 4XG4A 5ANKA 3O7LD 3OCBA 3TEIA 2WXVA 1W7HA 5ANGA 4BHZA 4O91A 4AFEA 4QMWA 2EVAA 1LPUA 1R78A 3CE3A 4FZDB 4GYIA 4HCUA 2C5NA 4BC6A 4BY9E 5C03A 5ETFA 5HVYA 1XQZA 2CGUA 4QNYA 4ZOGA 5FQDC 3O7LB 5LXMA 3ATTA 4F63A 1BKXA 3Q52A 4K1BA 4NZWB 2C1AA 1FMOE 3R21A 5DRDA 4C34A 5BUIA 2XEYA 4G31A 4WBOA 5BYZA 2JKOA 4EK3A 4ALUA 4HVGA 3D7ZA 5LVLA 3EJ1A 3GC9A 2XNEA 4GVJA 3V5WA 3WBLA 2J9MA 1XBAA 5EH0A 2UUEA 1LP4A 5GZ8A 1FMKA 3MBLA 2J50A 4C37A 4DGMA 3FWQA 3DQWA 4UXLA 3VW8A 2FO0A 5JGAA 4F6UA 1BI8A 4AACA 2F2UA 3NUAA 2EUFB 2QKRA 2ERZE 2XB7A 2W1CA 3PIYA 4KRDA 5G1XA 3ZC5A 4CTCA 2PK9A 2ESMA 4XV3A 5A4EA 5E8ZA 5FD2A 2BUJA 3NCGA 3BRBA 4A9RA 3W55A 3DB8A 3S00A 4FSZA 2ZV2A 3BV2A 3C9WA 4PRJA 2OGVA 3PPJA 3GCQA 4B0GA 1M17A 4EOJA 4OGRA 1V0BA 2UZOA 2XBJA 4EH8A 2GHMA 3FQSA 3IKAA 3ZO2A 5IPJA 2EXEA 4IB0A 3U8WA 5KHWA 3VC4A 2Q0NA 3D14A 5HKMA 5AUUA 1YHVA 3CCNA 4QPAA 2W1HA 5DMZA 2DS1A 4ERKA 2VX0A 5J9ZA 3OD6X 4IWOA 4CFVA 2W5HA 2CSNA 3SXSA 3ZXTA 4BYJA 5ANDA 5JKGA 3HUCA 3A99A 4YNEA 3OXZA 2A27A 2VD5A 3VS1A 5JSMA 4QQCA 4W4WA 2VN9A 2VTAA 3RPVA 4Z7GA 4Y73A 5KMMA 2UVZA 5CI7A 4IVDA 4NJ3A 3R7OA 3GQLA 1Q8UA 3UGCA 4FNZA 4BTFA 1MRUA 2BAKA 4FSTA 3NNUA 2QI8A 5L2SA 3NW7A 4IADA 4IM0A 3W2CA 4EK6A 4HJOA 4Y85A 4FKWA 4HYSA 4HYUA 5HESA 5CAUA 5DHJA 2VWVA 2YABA 4PMMA 3RVGA 1YXVA 2UVYA 4I6QA 4USEA 3A7FA 4D2TA 2OF4A 4Y95A 4EOQA 5BPYA 3TT0A 4RJ7A 4LYNA 3EFWA 4YLLA 3POOA 4ZY6A 4BI0A 4KNBA 3R1QA 4FKTA 2OLCA 1V0OA 5ETAA 4RIYA 4DH8A 4I5PA 4EQCA 3FC2A 4CT2A 3LMIA 5EI6A 1IASA 4M13A 4EH3A 3QZFA 4KIKA 4OTQA 2JAVA 1WBVA 5HO6A 4I94A 4F9WA 1ATPE 4JQEA 5HORA 2DYLA 3P7AA 4FKLA 2ZMCA 3GC0A 4BTKA 1UNLA 3FZOA 3U51A 3V8TA 4C59A 5JH6A 5GIOE 2XNNA 2ZJWA 2ZV9A 4X6QC 2FSTX 4FKPA 4NEUA 5DOSA 4ZLOA 4L42A 1MQ4A 5I9UA 2Q83A 4YP8A 3BU5A 4YZMA 4DGOA 2WMSA 4APPA 4C58A 1WVWA 3W2SA 3DS6A 3Q2MA 3KULA 3OBJA 2B54A 1GIJA 2JITA 1KE7A 2H34A 2P2HA 2XZSA 2P4IA 2VTOA 3PIXA 4F0IA 4EUTA 4UMPA 2C5XA 2YZLA 3M2WA 2YIRA 4XJ0A 5JFXA 3LFEA 5DNRA 4AG8A 4DT8A 2H6DA 2BILB 2ZV7A 4HOKA 3RP9A 4C36A 4FTUA 2ITQA 5L6WL 3DBCA 5DT3A 4JAIA 4XCUA 3S95A 3P78A 3P08A 5FDXA 2W4OA 3QRKA 5JRQA 3HV6A 5TOZA 4G5PA 2C6KA 3VRZA 3HRCA 3UC4A 2GHLA 4CNHA 4PNKA 2WIHA 2Z8CA 2X4FA 4FTOA 4TY1A 3VUTA 4A4XA 3QAME 2Y6MA 4YHJA 2XUUA 5HX6A 4OAVB 2UW9A 2BTSA 2UZWE 5HCZA 4ZIMA 3DXNA 4GW8A 4FVPA 4E4MA 5KUPA 4R7BA 4IVCA 2VTLA 3T8OA 3OT8A 4APCA 3JPVA 4MXAA 3GC7A 1Q8YA 4I5HA 2BKZA 3ZMMA 3C5UA 4ZS4A 2BZKB 5E8XA 2HZ4A 2GTNA 3E7VA 4FTNA 5HBHA 1A48A 2B9FA 3LKMA 2Z7RA 3GU4A 4MQ1A 4EUUA 1KOAA 1BYGA 4O2ZA 3FMEA 5AAEA 1NVSA 4OTPA 5HGIA 1Q24A 1YDSE 2WMXA 3FHRA 3LFAA 3LPBA 2YM4A 2QOHA 3ORPA 1M2RA 4FX3A 3TV6A 1H00A 4FOBA 3UQFA 3BWFA 2P0CA 4AZFA 5GJFA 3PTGA 3WYYA 4B8MA 5C4KA 4I4FA 3AMAA 2CKEA 5CLPA 5HVJA 5IQFA 4K33A 2ITYA 3CR0A 3N4TA 3LM0A 4C4FA 4FIJA 1F0QA 3V51A 3UP2A 4DTBA 5DT4A 5E8TA 4C4IA 4FTIA 4GS6A 4R77A 3HMNA 4MX9A 2WOUA 2UVXA 3NAXA 4D2SA 1IEPA 4EEVA 5K5NA 5CT7A 4DFUA 3PYYA 4QQJA 4YJTA 3L9MA 3HMOA 5CNOA 5AR4A 3WE8A 2OBJA 3E64A 4OBPA 4AZSA 2F2CB 1XR1A 3KKVA 4LGDA 4K77A 3C4XA 3DK3A 2W06A 2PUPA 4CZUA 3SXRA 5AUXA 3W2PA 3D94A 4CRLA 5BMSA 5IF1A 2J7TA 4FT3A 3W2QA 3R7IA 4NH1A 5AWMA 4BGQA 4ZXTA 2EWAA 2BFXA 5FG8A 2GSFA 3OBGA 3ORXA 4PP7A 1DI9A 4WRGA 4EQUA 4MKCA 3ZFXA 2R64A 1KWPA 4D1SA 2VWYA 5EM5A 2BVAA 3R7YA 5CF8A 3NNXA 4C4EA 4LGHA 3R7GA 4FL2A 4FTMA 4OBQA 2ITXA 5GZ9A 4FZAB 4D2PA 2VZ6A 3EFLA 4G6NA 2VGPA 4QTDA 3TJCA 4ASDA 4FK6A 4ANQA 3LFQA 2V55A 3ROCA 1YW2A 4QMZA 3GFWA 4DCEA 2X4ZA 5DBXA 4E5AX 2VO3A 3IGOA 3EZRA 3BYSA 4H1JA 5M06A 4J53A 5F4NA 4RWKA 2ITNA 5AAFA 4CFNA 3U55A 2PYWA 4FEQA 2XNGA 4IAKA 4D55A 3RHXA 4Y83A 3BGZA 4FODA 3FZPA 4QMSA 1OVEA 2YFXA 4YJRA 3O96A 2JDOA 4G9RA 5EW8A 3Q6WA 4BCKA 4ZJVA 5M08A 5CEQA 4RA5A 3H3CA 4FICA 4TXCA 4IXPA 2WTJA 3WF5A 5TE0A 2R0UA 2XK8A 4GFGA 4QMUA 1M7QA 2E9VA 2WELA 1PXPA 3DLZA 2C3KA 3IQ7A 5DI1A 5FXSA 3ZZEA 4F9BA 2JD5A 4ZTNA 2C68A 4XLVA 4L52A 4OR5A 1U5RA 2XRUA 1UU7A 3QQUA 5M4CA 3WZEA 3F82A 3TZ9A 2O63A 5FWKK 5BVEA 4OTRA 4U7ZA 4XS2A 2JLDA 4WSQA 5J1WA 1JAMA 5EHLA 4DBXA 2CCIA 5C9CA 3UOLA 1XH5A 3R6XA 4GU9A 3ZHPC 5CU0A 3AD5A 4RWJA 5BVNA 4JR7A 1GJOA 1JOWB 4WKQA 3A8XA 2VUWA 5JN2A 4ZMFA 4BGGA 2YDJA 3OCSA 3WILA 1QCFA 4M69A 3GCVA 4F9AA 4JNWA 3RWPA 5EW9A 3C13A 1HOWA 2QHMA 2OIBA 3GC8A 3EFJA 3SD0A 3BV3A 4JVGA 4AUAA 1S9IA 3CY2A 5EDPA 4YUQA 2C0TA 4PWNA 3NUSA 2WMUA 4FNWA 3UIUA 2P2IA 3VUDA 3H4JA 4DG3E 5BVOA 4YJQA 3H9OA 3UMWA 2BAJA 2PVRA 3FZRA 3QXOA 3RPOA 3CQWA 2WMTA 4X3JA 4CSVA 5E1EA 3EQIA 3DPKA 3KA0A 4Y46A 3HV3A 3BGQA 5E90A 2XNOA 3D15A 3MFSA 3E62A 3FQEA 4M8TA 2WQEA 4Y5QA 3OWLA 4MAOA 2XEZA 3TL8A 4DGNA 4ZZOA 2PZYA 4AGDA 3TZ7A 4YC3A 4E1ZA 4IE9A 5JQ5A 4HCVA 5CVGA 4EOSA 5TF9A 3CGFA 4IDTA 3SOAA 1VR2A 4F6WA 4C57A 3UO5A 3F88A 4AT3A 4E5WA 4I23A 5AJQA 4HCTA 2CGVA 4PTCA 4O81A 3RI1A 2ZB1A 4Y72A 4EK4A 3MY1A 4ZTMA 4ZZMA 3MYGA 3VQHA 1Y8GA 2BROA 3QZGA 3PJ1A 4HPTE 5I0BA 4UZHA 4DTAA 4G5JA 1Q3WA 2QOLA 4JS8A 5CZHA 4AF3A 2PVNA 2OZAA 3QLFA 3V5PA 3PLSA 5AMNA 2A0CX 3POZA 2BRGA 4F1OA 4CZYB 3NVMB 3H0ZA 2X9EA 3QRTA 5F1ZA 3UQCA 4X21A 3IDPA 1T45A 4QMPA 4X3FB 4AW5A 1Q5KA 3FAAA 2QOBA 2HOGA 5AIKA 4C33A 1ZRZA 4G34A 3G51A 2V62A 2V0DA 1QPCA 3MTFA 2QURA 5DT0A 5FP6A 2B55A 4CZTA 4ACDA 1YXXA 4QNAA 5DGZA 3RPYA 4FUXA 2ZYBA 5ITAA 2QHNA 3R8MA 5CEIA 1UVRA 3TNIA 3BCEA 3OY3A 3HV7A 5HE2A 5JFWA 2P33A 4ZLZA 4PDOA 3L1SA 1SVEA 2F57A 2B1PA 3CY3A 3IONA 2IWIA 4D28A 5DWRA 1H07A 2W1FA 1YI3A 2JGZA 2FH9A 4NFMA 1M14A 1SNXA 2CGXA 4XG9A 1A9UA 4DH1A 1ERKA 3QGWA 4YZCA 3ITZA 4L3PA 2QVSE 3UVQA 1STCE 3WZJA 5F9EA 5JEBA 4IAYA 2X7GA 4ZMEA 4HYHA 4TYHA 1XKKA 4I6HA 3KCFA 3DXPA 3E8EA 4O6LA 2ITUA 2BZHB 4LGGA 4MH7A 4D4SA 2UZDA 3FI8A 4RBLA 3VF8A 4JT3A 1R39A 3F61A 4BFMA 2VTIA 3DTWA 3PZEA 2UW5A 5CX9A 4MXZA 4BBFA 4AE6A 3ZO3A 5AADA 2E9PA 5KE0A 4LOQA 2J4ZA 4FKIA 4ZY4A 4B99A 4O7VA 4FOCA 4BWPA 3Q4TA 5EOLA 4GVAA 3D7TB 3HA6A 2HZNA 4FBXA 3ZFMA 2PVMA 3WI6A 3RK7A 4GT4A 3NVKI 3NMUF 2WQBA 3GNIB 4CVAA 3TV7A 2YERA 3GQIA 2OXDA 1YHWA 3LAUA 3ACJA 4QPMA 4TW9A 3WF7A 2X6DA 2PVKA 3AT4A 1H01A 4IW0A 4U0IA 3EWHA 4BF2A 4FSYA 4AN2A 1CKPA 5H2UA 4FTQA 3QHWA 3EL8A 2WTKB 3CPCA 4HGEA 2CCHA 3PY0A 4GK2A 4WBBB 3AQVA 3V5QA 4FT5A 3HX4A 4IHPA 3R04A 1KE8A 5ETCA 4RX5A 4BGHA 3TKUA 1M2PA 4CFFA 4IZ7A 2ZB0A 2NPQA 4ONAA 5JQ8A 3AC1A 4AN9A 4NSTA 3N4VA 3GENA 4KABA 5HLNA 3TACA 2UZTA 5ANEA 3GU7A 4BB4A 3TJDA 4O7TA 2Z02A 4WNPA 1J3HA 4J8NA 3QTZA 4LV8A 5L2TA 3UOJA 3V6SA 2W1DA 1SVGA 3BELA 2PVLA 3MS9A 4EORA 4NW5A 4OUCA 5C27A 1K9AA 3Q04A 2BFYA 1ZXEA 3OP5A 1BX6A 3UG1A 4R1VA 5I4NA 3EQGA 2OG8A 2XIRA 5D9HA 5HHWA 4KSQA 4WO5A 4BL1A 4QMMA 1SYKA 5K4IA 1PRYA 3E8NA 4ZTLA 2HIWA 2FA2A 3SXFA 3WYXA 3PJCA 2CNQA 3NLBA 2WHBA 4YMJA 3QUPA 4WOVA 4DTKA 3OF0A 2YCSA 4JX7A 4TYJA 2W1IA 3O8UA 4CFWA 4Z3VA 4RVLA 3QD4A 4QMVA 4XP0A 2OIQA 4WRSA 5L3AA 5K9IA 1RJBA 2ETMA 4ZY5A 1J7IA 4D2WA 4EI4A 5FEQA 2ZV8A 1KOBA 5BVDA 2UZUE 3NW5A 4DC2A 3CP9A 4BI1A 4RPVA 5CEKA 2GNIA 4BCGA 4N0SA 4BCPA 3ZDIA 4HYIA 4YO6A 2VX3A 4RFZA 3QUEA 4DG0E 3KMMA 4TWCA 3S3IA 4I0RA 4L67A 4XEYA 4FA2A 5CEOA 5AUZA 3RCJA 5I5ZA 2VU3A 2W7XA 3GU8A 3R9RA 5K4JA 3PP1A 4EZ5A 2AC5A 5DLSA 1U54A 4WIHA 3HL7A 2IN6A 3PG1A 5DE2A 5B2KA 3PSCA 4BYIA 4C4HA 4F99A 4FZFB 4IAIA 3MVHA 4RJ8A 2CPKE 4UXQA 4U5JA 5CF6A 4O82A 1ZOGA 3ORZA 5E8SA 4BCIA 4L46A 3VUHA 3UPXA 4DEEA 4BDKA 2WMAA 3DZQA 3R2BA 4OTWA 3GOPA 1OECA 1Y91A 2UZEA 2R3MA 4FL3A 3MESA 2X1NA 4YZBA 4O7LA 3BLHA 3O2MA 3TXOA 4MXOA 5A4QA 3UZTA 1FVVA 5HQ0A 1KSWA 4PL5A 4FYNA 2GQGA 3VRYA 3AD6A 3QZIA 2OJJA 3W2OA 5EQPA 4MNEB 4G3FA 1P4FA 2RSVA 3VHEA 3BE9A 5E7RA 3VF9A 1P2AA 4XG2A 4O0XA 5C8MA 4II5A 3DJ6A 4QMLA 3RNYA 4ANOA 4YSJA 2CHLA 4BZNA 2XIKA 3QZHA 4UMQA 3ALOA 4AZVA 2QLUA 3OS3A 2RF9A 3MA6A 4PTEA 4HGLA 3V5TA 5EKOA 4CLIA 2PMLX 5KMIA 4BTMA 1L8TA 1U59A 3GGFA 2PL0A 2P55A 2GQRA 3FY2A 3ANQA 2HAKA 4QQTA 2FSOX 1R3CA 5FTQA 4YU2A 3VUGA 5J9LA 3SRVA 2CKQA 3ANRA 5AEPA 3ORNA 4IWQA 3W2RA 2G2HA 3CD3A 2UV2A 3QX4A 1JKLA 1H08A 4IJ9A 4ITIA 2JBPA 4HGTA 4YPDA 5C4LA 2ITZA 2WTVA 4O1PA 2WMQA 3R1NA 5IA5A 5M56A 4OAUC 5EQYA 2J2IB 1W0XC 2NP8A 4XMOA 2R3NA 3DK7A 2GS7A 3LJ1A 2PTKA 3SDJA 3SHEA 3NPCA 4YC6A 4C02A 4YHFA 2XRWA 3E8CA 4MXXA 3D2KA 4DEGA 1YHSA 2VTSA 2W0JA 3QTXA 3QA0A 4X6RA 3O71A 4RIXB 4GYGA 1IA9A 1YXSA 1OL2A 4R3CA 4ACHA 2ZM3A 4FYOA 2QU5A 4MD8E 2R3HA 2J5EA 4G6LA 3ZRLA 3A7GA 4FV5A 3BPRA 1OIQA 4BWXA 4EOOA 4BCMA 4Y5HA 4IVBA 4TYGA 4FTAA 4FK3A 3ZH8A 5IEVA 1YWRA 2O8YA 1Q8ZA 4DN5A 3DB6A 5IH5A 1QL6A 5KX8A 3DFCB 4NM5A 2F9GA 1B6CB 3NRMA 3Q4ZA 3H9FA 1JQHA 1UA2A 3IW8A 3QWKA 2ETKA 5D7AA 3OT3A 4GKHA 3OROA 5D10A 1XH9A 2J0JA 5CSVA 3ENHA 3D83A 4L68A 4CGAA 5KHXA 2QODA 4QRCA 2R5TA 4E5BA 3CKWA 3EH9A 4M7IA 4R6VA 4M84A 4UZDA 3RPSA 5HD7A 4I1ZA 2O3PA 5H3QA 3V01A 5BX0A 1XWSA 2DUVA 2GDOA 3IECA 3PXQA 1Q41A 3F5UA 1GY3A 4U40A 4DEBA 3FI3A 4RX9A 4I4EA 4EHGA 1ND4A 4UEUA 2X0GA 5C1QB 5IUHA 3LLAA 3HA8A 1VEBA 5HD4A 1G8SA 2G15A 4ENYA 2FYSA 2WQOA 1O6KA 3RK9A 3CTHA 4CFXA 2Y9QA 2YLFA 2E9OA 2OWBA 3SKCA 4N6YA 4ACGA 4EWHA 3FUPA 3I6WA 3LHJA 4CKJA 3MPMA 3VBTA 2RFDA 5IQAA 3GI3A 5HU3A 2NNWB 5KO1A 5KMJA 3TDWA 3E88A 4KWPA 2C5OA 3AC3A 4S33A 1OKWA 4O84A 1DAYA 5IEYA 4F65A 4HNFA 3WOWA 3ZS5A 3HNGA 4EH5A 4IBMA 3R83A 5FUTA 4LL0A 4PPAA 5IUIA 4J98A 3I0OA 3E93A 4GUEA 5I3RA 1KV2A 4NU1A 2YM7A 5JFSA 3ORTA 5L4QA 4L00A 1IG1A 2JIVA 3VVHA 4R1YA 4Z9LA 2HELA 4BCOA 4HVIA 4P5ZA 5M51A 4FKSA 5HCXA 1GOLA 4BZOA 4O86A 3CGOA 1RQQA 5IQDA 5E92A 1BL7A 4USDA 4GG5A 4CG9A 4A9YA 2AUHA 2C30A 1DAWA 1NXKA 2IW6A 4J95A 4FV6A 2B7AA 2J0IA 4KAOA 2HW7A 5FM3A 2LAVA 3G90X 4ANNA 3FZSA 5FXRA 1FBNA 5G6VA 5IQEA 3R7EA 3T9TA 4O2PA 1PXJA 4QOXA 1UU9A 2A19B 1OGUA 3QWJA 4FTRA 3MH2A 2GFCA 1FPUA 2ZM1A 3VJOA 5HIEA 3HRFA 4BDDA 1JKSA 1ZOHA 4G2FA 3T3UA 4ZLYA 3RAIA 5BYLA 4OW8A 5M4UA 4QP7A 1JVPP 3NW6A 1ZMUA 1NY3A 4ITHA 4BR3A 2EXCX 3UDBA 2PE1A 4QP4A 2E2BA 3HMPA 4RGJA 4F0GA 3UPZA 3DT1A 4UMRA 4O7ZA 4NCTC 4RVKA 4QD6A 2VTNA 2QG5A 4LFIA 5IISA 4FV1A 3S1HA 4JLCA 1J91A 3ZM4A 5IQGA 5CT0A 5B0XA 4YJVA 5AV0A 3RAHA 4KIOA 4N70A 4PPCA 5FBOA 3W16A 3C1XA 3QQHA 4V01A 2WMBA 4ERWA 4H3BA 4OTIA 4F70A 2VAGA 4RFMA 3C5IA 1JNKA 3F2RA 2F4JA 3SC1A 3FBVA 3UNZA 4O21A 4DFNA 3IW4A 1E1VA 5I9ZA 4M66A 3TUDA 2OK1A 1FGIA 2WFYA 1ZAOA 2X8DA 2Y6OA 4FZ7A 3L8VA 4XG7A 5IA1A 3NCZA 4PMPA 4O27B 4EYJA 2C6EA 4L9IA 3ET7A 3ZSIA 4XOZA 2WNTA 4FMQA 1ZYJA 5AP3A 2I6LA 5K3YA 3RZFA 4KUJA 2RG6A 3VHKA 4MWHA 4HW7A 3I4BA 4ZTRA 3R8VA 3KQ7A 4J96A 3VS5A 2UZNA 1GNGA 1W8CA 4QT1A 3O17A 2YIXA 3U6HA 5AP2A 5DIAA 4KIQA 4ANBA 3TUBA 4EJNA 3NNVA 4IIRA 2PUUA 4QP8A 3E87A 2CNUA 4NM0A 3GU6A 5LMKA 4G16A 2XP2A 3P1AA 3C4EA 4YJNA 4C62A 5E8VA 4OBOA 5HNBA 4RC3A 4MYGA 5J87A 4AZEA 4L7SA 3AT3A 3OXTA 5A54A 4A7CA 5CI6A 3QKMA 3KRXA 3F3VA 3ROYA 2VWIA 4Q9ZA 2V7AA 4I5MA 4C3FA 2ZDTA 4OT5A 2OXYA 2R3OA 5BVFA 2PY3A 1T46A 3QHRA 5AP0A 5AV4A 2VO6A 3UVPA 4U97A 1YQJA 1XH4A 1EH4A 5M09A 2ITWA 1YOLA 3ZYAA 4IWPA 3G5DA 1CMKE 2WPAA 5K0KA 1QPDA 2QKWB 3FI2A 4ZSJA 4ORKA 2VTPA 2H8HA 4DGGA 3FMKA 4J52A 4RJ5A 3PXFA 4EQMA 4YJUA 2BDWA 5HE1A 3E63A 4CCBA 2XS0A 2WTIA 2RGPA 1ZARA 1OITA 2BHHA 3QCSA 3G15A 3NAYA 3MTLA 4KBKA 1UV5A 3FMMA 4YHTA 2GCDA 5CXHA 3AG9A 1OUYA 4WHZA 3CS9A 4DEAA 3SOCA 2YDIA 3MSSA 1NVQA 5IA2A 4LI5A 2C6OA 2C0IA 4K6ZA 5FM2A 3S2PA 3MIYA 3QALE 1G8AA 5IQHA 2W1EA 3GP0A 5DFPA 2R3GA 2W96B 4NJDA 3TN8A 4E4XA 3KXGA 4GU6A 4IZYA 4I3ZA 3QYWA 3BQCA 4N4SA 3VULA 4BDAA 2GQSA 2PE0A 1MRVA 3LZBA 2Z60A 4JBPA 1YKRA 3MJ1A 3U6IA 2XMYA 4MK0A 4KIKB 3H9RA 3PA4A 4DT9A 1PKDA 3O8PA 3G0FA 3PPKA 4D2RA 4I6BA 4NIFA 2WTDA 4MBIA 5AA9A 4GT5A 3DLSA 3NUPA 5FLFA 5L8JA 4P2KA 1YDTE 3A2CA 3HZTA 2WEIA 3K3JA 4EKLA 3Q9YA 2B9IA 1Y6BA 2ITOA 5C26A 3TV4A 1H28A 3EN4A 4ACMA 3ZRMA 2G2IA 3TNQB 1OL7A 5B2MA 2GNFA 2I40A 4BWKA 5M07A 3EQRA 3OWKA 4EWQA 2WIPA 2XBAA 3R9HA 3LLTA 2O0UA 2JAMA 1DI8A 5KZIA 4KIPA 3KREA 4QYHA 5I3OA 5BVKA 4NM3A 5EDRA 3LOKA 3GBZA 5CTPA 4R5SA 4HVDA 1Z57A 3NDMA 3TNWA 5AR5A 3Q9ZA 4ACCA 5GINE 3R8PA 4KBAA 4YGAA 5JGDA 2GNHA 2ONLA 2OJFE 2VWZA 1M7NA 4QP2A 5LVOA 4EH6A 3DCVA 4AT5A 3UIBA 4BKYA 3EKNA 4PX6A 3MVLA 3UIXA 3OTVA 3Q5IA 5KMKA 1P4OA 4UWYA 3IW6A 3W33A 5L8KA 5FGKA 3GB2A 3ZBFA 3MH1A 5DR6A 4CEGA 3R22A 3IPHA 3C4FA 3I5NA 3AC5A 1ZZLA 1CKJA 3QQFA 4AFJA 2JDSA 5J9YA 3BHVA 5A14A 4GKIA 4IANA 3PVGA 2I0HA 4AE9A 5L8LA 4GJ3A 3NYNA 3L8PA 4YZ9A 2UW7A 1REKA 5AP7A 4K2RA 4L8MA 1BLXA 3I60A 4MF1A 5HEZA 1OIRA 2YCRA 4LG4A 2E9UA 4M15A 3ULIA 2QR7A 4A4LA 3ZZWA 3HGKA 4GL9A 4F7SA 3FSKA 4BDCA 4DFYA 1A06A 5M44A 3JY9A 3ZCLA 3AMBA 3NUNA 4FNXA 4EH7A 1OBDA 3DKGA 5CU4A 5AA8A 3IOKA 1SNUA 4FT7A 2PZRA 3UNKA 4U9AA 3CLYA 2G9XA 4Z16A 4UWCA 5LWMA 1CTPE 4JRVA 3HDMA 4Q5EA 5T6KA 3JYAA 4YTIA 5D12A 2Y8OA 2O5KA 4BDHA 3C0IA 4YSMA 5CAOA 4QP3A 4W4VA 4R8QA 5CU2A 4OT6A 4C4JA 2WTWA 1PMVA 2WU7A 3GUBA 5A4TA 4AGUA 3TDVA 1FOTA 3R9NA 1IAJA 3QTIA 5A6OA 4U41A 1YRPA 3RWQA 3R8UA 5AM6A 3H10A 4O6EA 1NVRA 3L9NA 5HO7A 4IB5A 4RZVA 1REJA 4IX6A 2JIIA 5E8YA 3FXXA 2I0YA 4CD0A 4BCQA 5HOAA 2XM9A 4G3DA 3G6HA 2XCKA 1IA8A 5A3XA 4JAJA 3QCQA 2W17A 5AR8A 1VJYA 4EZ7A 4FV3A 2VTMA 5FRIA 2QOFA 4J8MA 4V0GB 4MD9E 3DOGA 1JSTA 4FKVA 4ITJA 4RG0A 4D4VA 5HTIA 4BBMA 3W8QA 1I09A 4FSMA 2JFLA 5DEWA 3AMYA 3A8WA 3UODA 1LEWA 5IU2A 1ZZ2A 5CSHA 2YLEA 4QTAA 2QOOA 1PJKA 4Y8DA 5ICPA 1H0VA 5TR6A 1GZ8A 4K18A 2XK6A 3MGYA 3C4ZA 2YEXA 5I9WA 4DCAA 2IZRA 4BKZA 1M2QA 5AR2A 3HECA 4QTCA 3QTRA 3UYTA 2XVDA 1OL5A 3LFNA 3KRLA 3IG7A 4XX9A 3UYSA 3IDBA 1ZYLA 2GPHA 2B9JA 2G2FA 2JDRA 3LJ0A 4WUNA 2VTHA 3W10A 1GZNA 3GXLA 3KCKA 4HVSA 3ODYX 5CU3A 5ETIA 3L8XA 2O2UA 2WZJA 3IGGA 4CQGA 2Q0BA 3MJ2A 3U6JA 4NYEA 2EB3A 3QF9A 4H58A 3T3VA 4A06A 3NUXA 2W1GA 3OOGA 2B9HA 1Q62A 4RSSA 2KTYA 1O6LA 4E6CA 3OUKA 1CDKA 3FLSA 4LQMA 5HE0A 4MCVA 4JX3A 3KXXA 3LCSA 3SGCA 3BIZA 1G5SA 3DQXA 4XP2A 4AA4A 1H1QA 2REIA 1GAGA 4EK8A 2F49A 3ZU7A 3RTPA 4YPSA 1KV1A 1L3RE 3RNIA 5KCVA 3CPBA 2HW6A 3LFDA 5CENA 3DZOA 4C38A 5CAPA 4FTJA 4FG9A 4A9UA 3V3VA 3V8SA 3C4CA 5H8GA 2X7FA 4BICA 4V04A 3U87A 4BBEA 3CEKA 3FE3A 3M42A 4DEDA 4E4LA 3A62A 3TKIA 1RDQE 1XJDA 3MPAA 4P5QA 5HLPA 4A9SA 1Y57A 3DGKA 1TVOA 2WB8A 2EB2A 3NGAA 4CRSA 4N6ZA 5EHOA 2X8EA 2BRNA 5HE3A 4O7WA 2OZOA 5FEDA 2EU9A 2BCJA 4ZJIA 4DITA 2VNYA 4A07A 4BDJA 5JT2A 5CAVA 3DBQA 2C6DA 4D1ZA 3D5UA 3Q9XA 2VTQA 4G17A 4FIHA 4XG6A 5FEEA 4FKJA 3D0EA 5AR3A 4BCNA 4BIDA 1WMKA 2B0QA 3TZ8A 3FKNA 4PV0A 3OG7A 4ALVA 4YC8A 2ACXA 3OEZA 3QTSA 4C8BA 4PP9A 2FSMX 2XK9A 4CTBA 3D7TA 4BN1A 3HV5A 3CBLA 4CG8A 1OPLA 3QXPA 4D9UA 5DPVA 3VO3A 4XP3A 2PMNX 4C2VA 3BWJA 2JC6A 5EW3A 4O83A 4IAZA 2DWBA 2YZAA 2GNJA 4TYEA 5C8KA 5HG5A 4PDPA 3DAJA 4YTCA 4G6OA 2YAKA 4HNIA 3EYHA 5CF4A 4PMTA 3D9VA 3UP7A 3ORIA 3VS0A 5IMXA 3THBA 3PIZA 1OBGA 4I0SA 2H9VA 4IWDA 1H1SA 4P4CA 5JZNA 2PMOX 4XLIA 5EYCA 3NYXA 2OIDA 3DBDA 2OI4X 2JFMA 4LRMA 4O7RA 4RJ4A 3NS9A 2UW0A 1NT2A 3COHA 4X2FA 4YTFA 3E5AA 3U9NA 2OSCA 3KN6A 5F20A 1F5QA 2YACA 4E6QA 4FV8A 2AYPA 2QLQA 3FZ1A 5KZ0A 5GNKA 2BR1A 3TKHA 1PYXA 1JKKA 1PXIA 4I0TA 4UALA 2OZAB 4JDJA 5CVHA 3DNDA 2X2LA 3EHAA 4FKOA 1H0WA 3FYKX 3OHTA 4EZ3A 2HK5A 1Z5MA 3MIAA 4TWOA 4RLLA 3R02A 2YWVA 4IAFA 2UW6A 4IDVA 3UIMA 3ZBXA 4AOJA 2ZAZA 4AP7A 3Q4CA 4W8DA 4X2JA 4UMUA 1K3AA 3I5ZA 3N51A 3R00A 3LMGA 3CKXA 4HGSA 1V1KA 1JBPE 3OWPA 4PL3A 3MH0A 2ONLC 3L9PA 1Q8WA 5ANOA 2OU7A 2NO3A 3EKKA 3SAYA 3VS7A 3ZUTA 3HUBA 3K2LA 4E20A 5IQBA 2R0IA 4M0YA 4IFCA 4HVHA 1WBTA 3KVWA 5IG1A 3COIA 3BX5A 4FSUA 4F7NA 2YAAA 4LUEA 5IA3A 2R3FA 3NNWA 3GCPA 5E4HA 4JOAA 5LCJA 4D0XA 2J6MA 3MVJA 2GFSA 1YI4A 4FEUA 4FIGA 2QU6A 3W8LA 2R3LA 4M0ZA 4F7JA 1LEZA 3FPMA 5CEPA 4R7HA 4KKEA 3E92A 5AP1A 1BUHA 4ZEGA 1J1CA 4XG3A 3VW6A 4R5YA 2CLXA 3EIDA 4UYAA 2XKDA 2W5AA 2V5QA 3RPRA 3GT8A 1OIYA 3PE2A 2C3LA 1OL6A 2OJ9A 3KC3A 2HENA 2OW3A 4RIWA 3D2IA 3PVBA 3ZLYA 1M52A 3HAMA 3MDYA 1FVRA 3F7WA 4RC4A 4CCUA 3MB6A 4C0TA 3GOKA 2ITPA 2VRXA 1YDRE 2XJ0A 4D1XA 5JMSA 1P5EA 4RVTA 4ASXA 2QC6A 4PUZA 4EYMA 3LQ5A 3LFSA 3R8LA 3PG3A 3NYOA 4XG8A 1YXUA 1K2PA 1PXNA 3UMXA 3KK9A 2QOKA 2XCHA 3W18A 4EHVA 1TQPA 1E1XA 5CU6A 5EYKA 1WBNA 1OPJA 3QYZA 5IMEA 2PPQA 3OWJA 4UV0A 4E73A 4F0FA 2WTCA 3AOXA 4DFXE 3L9LA 3RZBA 3DAKA 1BL6A 3P7CA 4QTEA 2B4SB 2QOQA 4GK4A 4WNMA 4U3YA 4FEVA 3FLZA 4JQ8A 5AIRA 5HBJA 5HG7A 5HG8A 3BHTA 4YBJA 4HZSA 4A9TA 1GZOA 2W1ZA 4AS0A 1IRKA 4JDHA 2UW4A 3F5GA 5CQUA 3LM5A 2YITA 4Z7HA 5EHYA 4IB1A 1RE8A 4MHAA 2BRHA 1H25A 3EQHA 4QPSA 2IO6A 4WNKA 4XBRA 4RMZA 2XYNA 2WGJA 4IJPA 4M97A 5CALA 3MW1A 4RIXA 3HYHA 2QNJA 1XO2B 3LXPA 3NYVA 3CJGA 3FQHA 2IVUA 1XH6A 3EQDA 4OLIA 4QQ5A 1W84A 3CXWA 4KS7A 2CKPA 2R7BA 3P9JA 3K5VA 3FY0A 4JI9A 4DG2E 4F1MA 3GVUA 3FKLA 3QX2A 4IACA 4D4RA 3FXZA 3BLRA 3HMMA 4U81A 4QMNA 3HMIA 5KKRB 2AC3A 5CVFA 3R0TA 1H8FA 4U42A 4JRNA 5AUWA 3RALA 4C3PA 3COMA 3F3ZA 3ZEWA 1FQ1B 3LW0A 2JIUA 3I6UA 3E7OA 1OM1A 4DFLA 5J7BA 2HY0A 3PP0A 4L43A 3QFVA 4S31A 5E8WA 4WG4A 2BRBA 4GK3A 5J8IA 5BMMA 4XYFA 3SW4A 1PXKA 2FUMA 1U54B 4IX5A 3ZOSA 1ZOEA 4AZWA 3ZSGA 4OTFA 5FTGA 2E9NA 2VNWA 3A7IA 1UWJA 2CN5A 5AR7A 3ORLA 4E6AA 5CXZA 2X81A 4G9CA 4B7TA 4AN3A 2IVVA 2OH4A 4O0RA 4TWNA 2YIYA 4EBVA 3QRJA 2C1BA 4IQ6A 2XJ2A 4RC2A 4FSRA 1JWHA 4GMYA 5HNIX 3WZKA 4JG6A 3DU8A 4QP9A 3QTQA 1Q3DA 4L3LA 3F66A 3FHIA 4ANSA 4AW2A 3A61A 3I7CA 3UVRA 2X2KA 3R1SA 4OTGA 3QD2B 3KRJA 2Y4IC 2WOTA 3W32A 3KRWA 3PXKA 1H1RA 3C50A 3CQUA 3F3TA 4E8AA 3I79A 3R9DA 2OH0E 4O0YA 2G01A 3B2TA 3RM6A 2OFVA 3BI6A 3B2WA 4E3CA 3AGMA 3WF6A 4ZP5A 4PY1A 1WBSA 4W4XA 4YO4A 4U79A 4MEDA 3ULZA 3F3UA 4N57A 1OZ1A 1PHKA 4PMSA 5F94A 5HTCA 2HZ0A 2F7XE 5IDPA 3QBNA 3IOPA 2OO8X 1H1PA 5E9EA 4JL9A 4DEIA 3BU6A 3HDNA 5L2WA 3MFUA 2I1MA 4ZSGA 3BYMA 1HCLA 3FYJX 3LFBA 4IMYA 4WD5A 4AGCA 3GCUA 4X2NA 5LVMA 3AT2A 4J97A 2UZBA 4FG7A 4LV5A 4RA4A 1DS5A 4PTGA 4I21A 4BCJA 4V05A 3FLYA 5EYDA 5D1JA 2XK4A 2VO7A 4E4NA 1WZYA 2I7QA 2QG7A 5HNGA 4EOKA 4E7WA 5EI8A 3OCGA 3MI9A 3TTIA 3QTWA 4MXCA 4YURA 3CSVA 3R28A 4Q9SA 2BDJA 2ZMDA 3UE4A 4FT0A 4DFZE 4KBCA 2Z7LA 4G3GA 4YJOA 3ZFYA 5EFQA 3FMLA 3DKCA 2RIOA 5AUVA 2W4KA 3FLNC 4GT3A 3NUUA 3Q5ZA 3TI1A 4QP6A 4F64A 3ZUUA 4FIIA 4RJ6A 3A7HA 4GH2A 3R9OA 4RT7A 4NT4A 4CMOA 2HZIA 4BI2A 3BQRA 3SLSA 4E6DA 2IJMA 3TNHA 4DF3A 4LL5A 1PY5A 4USFA 4MNFA 3EB0A 3KRRA 4GRBA 3IW5A 4FG8A 3TTJA 2JDTA 4GIHA 3DJ7A 5HICA 4CYIA 2JBOA 4F9YA 2RKUA 2P3GX 2VWXA 2R7IA 3OW3A 3ID6C 3GFEA 5GJDA 4XRLA 3VBVA 3QCXA 3R01A 4O0SA 2GNGA 4FEXA 3ORMA 4O0UA 4WA9A 2BMCA 2J5FA 3BHYA 3JVSA 4FV0A 2VWUA 3JVRA 3VBYA 5M4FA 3VBWA 2BIKB 3BU3A 3AXWA 2YM3A 2GTMA 3FL5A 2Y0AA 4TN6A 2W9ZB 3B8QA 3DDPA 3W1FA 4DFBA 1U46A 2YJSA 3COKA 3KXNA 4L45A 5DN3A 3R8ZA 4BIBA 5CS6A 2WQNA 5T3QA 3AC8A 2PWLA 2J90A 2H96A 4XHKB 3NZ0A 2VTRA 3DJ5A 1MQBA 4FTCA 3DTCA 1AGWA 1R0PA 2Z2WA 3QTUA 4JXFA 2NRYA 5CNNA 2ZM4A 3FEGA 3BYOA 4FTTA 4TZRA 5LVNA 4RVMA 2W9FB 2LGCA 1W83A 4RX8A 5EM6A 2OF2A 5M53A 4WG5A 2PULA 3RHKA 4H39A 4JG7A 2ITVA 2X8IA 4UBAA 3DA6A 3QD0A 3U4WA 3WF8A 5AP4A 2XJ1A 5KKRC 4EK5A 1Q61A 2C3JA 4U43A 3EZVA 3OXIA 4TTHB 3WIGA 1PW2A 2JEDA 3DDQA 4FTKA 3V04A 3Q3BA 3VQUA 5AUTA 3LVPA 1PKGA 4EC9A 4RRVA 4C61A 4W8EA 3LCDA 3R71A 3JR1A 3QA8A 1Z9XA 5J95A 1I44A 2DQ7X 1GIIA 1WCCA 2BALA 4FKUA 3K5UA 3BHUA 4KRCA 4QYFA 4IX3A 1Y6AA 3C4WA 3F5XA 3UTOA 3K54A 5EOBA 5LARA 5HIDA 3Q2JA 4AT4A 4ZSAA 3G2FA 4MBLA 3E8DA 3F2AA 1XH7A 3G0EA 4D5KA 4D9TA 4R78A 4JBVA 3WZUA 3NSZA 3VJNA 1XBCA 3Q9WA 2HWOA 1ZY5A 3MWUA 4AOIA 2QQ7A 4QP1A 5IA4A 5AX3A 3T9IA 2OICA 4IEBA 2XNPA 4EOLA 3P4KA 4DGLC 4DYMA 3KN5A 4NW6A 3VN9A 4EHEA 3QC9A 3FMNA 3IS5A 5EDQA 3A4PA 3FC1X 4KB8A 3KXHA 4MXYA 5LWNA 2QO2A 3ZO1A 3F3WA 3O50A 4E26A 5HU9A 3CC6A 4UYNA 4RWLA 1PMUA 4B9DA 1X8BA 3PY1A 3VBQA 5LMBA 2HXLA 4O7NA 4GV1A 5KNJA 3LJ2A 3U4UA 2YHVA 4QO9A 3PRFA 1WBOA 4GSBA 5EM7A 3ENMA 1Y8YA 3HRBA 3KMWA 1O9UA 2PVYA 1MP8A 5L2QA 4O7SA 1OB3A 3QCYA 4OTHA 4S2ZA 2WQMA 5IH6A 5T68A 3LFCA 4BCFA 2XIZA 2YM5A 4GUBA 2YM8A 2A2AA 2WO6A 2BZIB 4UY9A 4CKRA 4F08A 1G3NA 3DBEA 3LCOA 4NUSA 2HXQA 1Q97A 2GS2A 3ZXZA 3FZTA 4ANMA 3BBTB 4IM2A 3RAWA 2XK7A 1P14A 3QQGA 4AA5A 4M68A 1OKVA 3BE2A 3HP2A 4RIYB 3RJCA 4A4OA 3ZO4A 1LR4A 2B53A 3NR9A 1YVJA 4AOTA 1TKIA 1YWVA 2R3RA 4DHFA 2WMRA 2SRCA 4GCJA 3ATSA 4DH3A 3MFTA 3F6XA 3IDCA 3PVUA 5KMOA 3K3IA 2PUNA 5A4LA 4YNOA 4ASEA 2CJMA 2WKMA 3R73A 4G3EA 4BTJA 4LUDA 4C2WA 1PXMA 3PPZA 2IZSA 3LXKA 5A6NA 5AFVA 1ZMWA 3EN7A 3ETAA 1ZYDA 3JS2A 3KVXA 3I81A 3KU2A 3PJ8A 2ETRA 3QL8A 4FL1A 4FSNA 3PE1A 5HI2A 4ANLA 5DVRA 3RBWA 2XKCA 3QLGA 4JIAA 3ZRKA 5JK3A 4EJ7A 2W4JA 3KL8A 4AAAA 3JXWA 4J99A 4YJPA 4FZ6A 3KULB 2R3KA 3I0QA 4FV2A 2IG7A 4H05A 3PWYA 2OJIA 1ZYSA 2XYUA 3JY0A 4IFGA 2FSLX 5E8UA 2PU8A 2XH5A 2W5BA 4R3RA 4U44A 2B52A 4MTAA 3UO6A 1U4DA 1XH8A 4ZK5A 4H36A 5CSXA 5CF5A 4X2GA 4AXAA 1OPKA 4LM5A 4DEHA 3P23A 4P90A 4KKHA 3UOHA 3FV8A 5CYIA 1WBPA 4QMYA 3TNPC 2CLQA 3EN5A 5TT7A 4XV1A 4K11A 2XNBA 4QMQA 2IW9A 5KBRA 2GNLA 5HZNA 1J7LA 3UBDA 5JGBA 3S0OA 3ZLXA 3F9NA 3VWAA 3RINA 4I92A 4FV4A 4IC8A 5FXQA 3QRUA 4B8LA 4B4LA 3LXNA 1QPJA 2FB8A 2PMIA 3IO7A 5AP6A 1WVXA 4ZZNA 2VWBA 5CSPA 1B39A 5GZAA 1YI6A 2VO0A 3VBXA 2QD9A 4KKGA 4CXAA 1OKZA 5I9VA 1BMKA 2RL5A 4IAAA 2FVDA 2O65A 2GMXA 3IW7A 4U8ZA 5DR9A 3NEWA 1SZMA 2ZVAA 2NRUA 2PVJA 3ZLSA 2PHKA 4NIFB 3O8TA 1O6YA 4CFMA 4XUFA 3ZONA 4RFYA 2G1TA 4S32A 5CZIA 4L53A 3C0GA 3KXMA 4TNBA 4JG8A 4W9WA 5I9YA 5CSWA 2C4GA 1FVTA 1PMNA 2WEVA 3KF4A 4RQVA 5GJGA 3B8RA 5TKDA 4V0GA 5EI2A 3QQJA 1XHAA 4NWMA 1Q4LA 4ALWA 3UNJA 3E3PA
chains in the Genus database with same CATH superfamily
2OXXA 3O51A 1NA7A 4MVFA 5CY3A 3FXWA 5D11A 4ASZA 2XK3A 2OFUA 1URWA 1MRYA 4BZDA 4CV9A 5K0XA 5LVPA 3RK5A 3BL7A 3FL4A 3RCDA 3Q60A 3RM7A 3PJ3A 3UZPA 2R3IA 1APME 2YA9A 2C3IB 2FGIA 3CIKA 3OMVA 4PNIA 5DH3A 3AGLA 3TCPA 4I22A 3EQFA 2Y4PA 2XKEA 3VUIA 3ZC6A 1H1WA 5IH4A 4FSWA 4XH6A 3E3BX 3F7ZA 3FJQE 4JDKA 3P7BA 1UNGA 2J0MB 4IZAA 2CDZA 3D5XA 3S4QA 5HBEA 2PSQA 3PY3A 4R3PA 1BI7A 5FTOA 4QMOA 4WSYA 1IAHA 3F69A 3VAPA 2JKKA 4X2KA 1OI9A 3SQQA 4D0WA 2OJGA 4L01A 3FMJA 3IK3A 4L6QA 4RX7A 4L3JA 5BVWA 4WG3A 3EQBA 1TZDA 3OFMA 1KE6A 3V8WA 2HYYA 3RAKA 2C6LA 4IZ5A 5DRBA 4O4FA 3DY7A 3D5WA 4GJ2A 2YIWA 1OL1A 2RFSA 5EM8A 4AXFA 2XIXA 1DM2A 2UZLA 4UX9A 2C47A 3SG8A 4UN0C 2R3JA 3NUYA 4F09A 4GEOA 4IC7A 5EK7A 4CQEA 3VS6A 2Z7QA 4EL9A 3BGPA 4TL0A 4BDFA 2UW3A 2QOCA 4RLKA 5F95A 5ACKA 5CAQA 3CTQA 5HIBA 5GIPE 3UDZA 1WAKA 2EXMA 4DINA 3BYUA 4FR4A 3GCSA 4J7BA 3TIZA 4F7LA 4XV2A 4C4GA 3PFQA 3BEAA 4FI1A 5LCKA 2YISA 5IQCA 2YM6A 4EH9A 3QQKA 5HLWA 3SVVA 3KB7A 4TWPA 3AD4A 4TYIA 4X3FA 4NKAA 3DFAA 3HVCA 2O64A 3RKBA 2I0EA 2VV9A 4PL4A 5JFVA 3DV3A 1NW1A 2R2PA 3C51A 3OW4A 4G1WA 3FKOA 4XNEA 5AP5A 4EONA 2C0OA 5HVKA 2XKFA 3N9XA 5IEXA 5E1SA 2V22A 3V6RA 4EKKA 1OIUA 3I1AA 5BNJA 2XARA 2RFNA 2PUIA 3HKOA 5LMKC 2VTJA 1VYWA 4BHNA 5M4IA 4NM7A 4AU8A 2BIYA 4QYYA 4UB7A 1TQIA 4AWIA 4BRXA 5BUJA 4TT7A 5IUGA 3TIYA 5B2LA 4GFOA 4ENXA 4F4PA 5H8BA 2YCFA 3KMUA 4AX8A 5DYJA 2X6EA 4QMTA 5C01A 2WD1A 4UMTA 3TZMA 5CQWA 4EC8A 3PSBA 3Q6UA 3WE4A 4DLJA 5A46A 3NIEA 3R30A 1JKTA 3EOCA 3UQGA 3V5JA 3FPQA 4G3CA 4DLIA 3KY2A 5LMAA 4O7YA 3VNTA 4TNDA 4DHJA 5AV1A 2CKOA 5EG3A 5BUEA 4O0WA 1ZYCA 4B6LA 5ANIA 4BKJA 4M69B 4MD7E 2IPXA 1U5QA 3BLQA 1Q99A 4HZRA 4Q5HA 3PRIA 1S9JA 1WBWA 3LXLA 4MBJA 3VUKA 5C8NA 5DG5A 1XBBA 4WT6A 4AA0A 2PE2A 2C6IA 3C0HA 4FSQA 2BPMA 4IH8A 4RZWA 5EYMA 1GIHA 5M55A 4C35A 1WFCA 5IZFA 3TUCA 3EQCA 4GFMA 4K0YA 3JUHA 2BDFA 4I5CA 3EYGA 2VGOA 2ZOQA 4FIFA 4BDEA 1ZLTA 5DR2A 2VWWA 4EOMA 2QO7A 4YBKA 5A9UA 3HEGA 2QCSA 4O0TA 4ZSEA 3WZDA 4AGWA 4BVUA 1VYZA 5DEYA 4BDIA 5IKWA 4I93A 3PVWA 1MUOA 4KSPA 5CWZA 3KFAA 3Q32A 3SV0A 3DK6A 4PDSA 4FE2A 5ANJA 2QOIA 5I9XA 1YWNA 3VIDA 2RG5A 3MV5A 3FMDA 4J71A 4I41A 4ZTHA 2JKMA 3SA0A 4QMXA 1H26A 4S34A 1UU8A 3WIKA 4U6RA 3TG1A 3BLAA 2HWPA 1QPEA 5J5SA 4PPBA 5HX8A 5BYYA 2PZ5A 2F7EE 3CD8A 4WNOA 2YJRA 2R9SA 1CSNA 2GS6A 3TM0A 4FGBA 1OUKA 4CT1A 3ERKA 2CMWA 4FKQA 4X0MA 3HLLA 3KF7A 3OEFX 4NK9A 1HCKA 5CEMA 5L2IA 3O23A 2JKQA 1F3MC 3MY5A 2CN8A 4FIEA 4XV9A 3FI4A 5AV2A 3AC2A 3UOKA 3VUMA 1J1BA 2AQXA 3MA3A 1R1WA 3DBFA 5J5TA 3QRIA 4BJJA 4P7EA 2Y4IB 3ELJA 3EL7A 5M57A 3OOMA 3LIJA 2BRMA 5LQFA 3OC1A 3PXRA 5EQEA 3ZDUA 4D4YA 4ID7A 2IW8A 4ZTSA 3KGAA 4LDTA 2YIQA 4R7IA 4IVAA 5L6OA 5HG9A 5HTBA 3G9NA 4DH7A 2C5VA 2ZDUA 3DKFA 4M14A 1ZWSA 3ORKA 3PUPA 4I6FA 4CMTA 4AQKA 4EH2A 3ZUVA 4RJ3A 1YOMA 2A4LA 3NWWA 3MB7A 5HO8A 2JDVA 4H3PA 5D41A 4E93A 5L6PA 3U9CA 3PZHA 2PZIA 4YLKA 2UZVA 2WAJA 2GHGA 4PF4A 4PQNA 4FF8A 4KA3A 3REPA 4C3RA 4F6SA 5FDPA 4ZTQA 4FKRA 4D2VA 4AXEA 2J0LA 3KEXA 2C5YA 3P86A 3D5VA 3VS2A 4RWIA 4C7TA 1B38A 1CKIA 3NIZA 4CYJA 1UNHA 3BBWA 2X39A 3BHHA 5IA0A 4TYHB 2VTTA 4DBNA 3D4QA 3GEQA 3QUDA 4O0VA 5GHVA 4W9XA 1SM2A 2XM8A 4UWBA 2WMVA 3P0MA 2C6MA 3TWJA 2J0KA 3UDSA 4LRKA 4NCTA 2UW8A 4QYGA 3OUNB 3DAEA 2C69A 3NX8A 4J1RA 4MNEA 3EQPA 4XOYA 4GIIA 2BTRA 3L8SA 2F7ZE 3F2NA 4XBUA 3UJGA 5A4CA 4ZS0A 2IVTA 1KUTA 3CJFA 4I24A 1FGKA 2XIYA 3PWDA 3DKOA 1SMHA 4JBQA 3RMFA 5DA3A 2R3QA 4FKGA 4FEWA 3MPTA 4O1OA 5D7VA 3G6GA 2J51A 2VX1A 4F1TA 3LCKA 3Q53A 3QKKA 3KK8A 4CFUA 4RIOA 4ZJJA 4ZAUA 5E91A 3LMHA 2X2MA 3PSDA 4YLJA 3LQ8A 3R7UA 5LOHA 4CV8A 4JR3A 3EFKA 4K8AA 3CTJA 2XF0A 3HAVA 2IZUA 4K9YA 3P5KA 2R3PA 5IQIA 4NFNA 5AV3A 3EMGA 3UO4A 4MF0A 4QYEA 4FC0A 1SVHA 3PXYA 3RGFA 4FVRA 1URCA 3ZTXA 1AD5A 4BCHA 2BKKA 5ACBC 3QKLA 4YJSA 2I0VA 1PXOA 3LE6A 4JBOA 1IR3A 5HCYA 1AQ1A 1JSVA 1KE5A 4DAWA 1UWHA 4CLJA 1PXLA 2YCQA 3HV4A 4LOOA 2ERKA 3O0GA 1LUFA 3SX9A 1JLUE 2XA4A 3FDNA 1FINA 3WF9A 3PA5A 4Q2AA 1W98A 5LJJA 3MFRA 4JQ7A 1GZKA 3C7QA 3OVVA 4AQCA 2GU8A 5KBQA 3N4UA 4AW0A 3LQ3A 2QO9A 2XALA 3PA3A 3MN3A 3OTUA 3ACKA 5AUYA 4OTDA 3R2YA 2OKRA 4L7FA 2Y7JA 4M67A 4EOIA 3U54A 5TO8A 4AZTA 4BIEA 4Z55A 2QR8A 3Q96A 4TKSA 1ZMVA 4FUYA 5J79A 1RW8A 2C6TA 3DNEA 4YTHA 3OZ6A 3QC4A 5J7HA 4GG7A 5FP5A 4RIWB 4H3QA 4ZSLA 2W05A 4QTBA 4X7QA 3I7BA 3OY1A 4D58A 5CASA 3BYVA 1KE9A 3EN6A 3BZ3A 3M11A 3BKBA 3R1YA 2BAQA 1J7UA 4IM3A 1R0EA 4F9CA 3UG2A 5CANA 1QMZA 4LMNA 3P79A 4NTTA 5JRSA 3SG9A 4DE4A 4M12A 4X3FC 4EH4A 5K5XA 3PDTA 4DH5A 1PF8A 2PVHA 4NTSA 3HP5A 3ZSHA 2PVFA 3V5LA 2R4BA 3II5A 1TQMA 2IZTA 1PMEA 4FT9A 3UC3A 2BHEA 3TYKA 4U45A 1PYEA 2XANA 1JSUA 4AW1A 1CM8A 1VZOA 2KULA 4W4YA 5FBNC 1V0PA 4LMUA 4HPUE 4O22A 2V7OA 2PZPA 3FLWA 1W82A 3A60A 3AC4A 4EOPA 2HY81 4U3ZA 1YXTA 3R63A 5AX9A 2HCKA 4ARKA 4EHZA 4JDIA 3R7VA 2CNVA 4PDYA 4I20A 2YN8A 4YZNA 1H4LA 4NL0A 4U80A 3PXZA 2X7OA 3SW7A 3DXQA 3H30A 3A4OX 4FNYA 4FV9A 4M3QA 4MQ2A 4CKIA 3PLAE 4RQKA 1UKHA 2YWPA 4FTLA 4BDBA 4CMUA 1Q8TA 1WVYA 4JJRA 4JIKA 4WUAA 5AAGA 4H1MA 5AM7A 3LCTA 2ITTA 1H24A 1YOJA 3FLQA 2BZJA 2A1AB 2X9FA 2Z7SA 3QU0A 2WMWA 3UZRA 3ZM9A 4TRLA 4MWIA 3QD3A 2W99B 3G9LX 3KXZA 4IX4A 1UKIA 4KINA 4KS8A 4FGRA 5KMLA 4L44A 5B7VA 3ALNA 3QGYA 3ZLWA 3OCTA 1UU3A 3F5PA 3FMHA 3ZEPA 1W2CA 3SRVB 4D5HA 2CGWA 5H8EA 3PJ2A 4YZDA 4TPTA 4KD1A 4XRJA 3VS4A 3M1SA 4S30A 3VS3A 3EN9A 4O96A 3BEGA 5JZJA 3LFFA 4NKSA 5EKNA 3H0YA 4DA5A 5H9BA 2IVSA 3G33A 3Q4UA 4FVQA 5J1VA 2WTKC 4DDGA 4BDGA 4QEBA 2YDKA 3CQEA 2RFEA 3GU5A 3MH3A 3A7JA 3MY0A 3QQLA 4IB3A 4O38A 4YR8A 5KMNA 5IDNA 2QONA 3ODZX 1VLRA 3FSFA 1ZY4A 1H27A 3MVMA 2WU6A 1JPAA 2XNMA 4EBWA 1OKYA 4FV7A 3WARA 5BQ0A 4LOPA 1E9HA 4LRJA 3AKKA 1OMWA 4XG4A 5ANKA 3O7LD 3OCBA 3TEIA 2WXVA 1W7HA 5ANGA 4BHZA 4O91A 4AFEA 4QMWA 2EVAA 1LPUA 1R78A 3CE3A 4FZDB 4GYIA 4HCUA 2C5NA 4BC6A 4BY9E 5C03A 5ETFA 5HVYA 1XQZA 2CGUA 4QNYA 4ZOGA 5FQDC 3O7LB 5LXMA 2XAMA 4F63A 1BKXA 3Q52A 4K1BA 4NZWB 2C1AA 1FMOE 3R21A 5DRDA 4C34A 5BUIA 2XEYA 4G31A 4WBOA 5BYZA 2JKOA 4EK3A 4ALUA 4HVGA 3D7ZA 5LVLA 3EJ1A 3GC9A 2XNEA 4GVJA 3V5WA 3WBLA 2J9MA 1XBAA 5EH0A 2UUEA 1LP4A 5GZ8A 1FMKA 3MBLA 2J50A 4C37A 4DGMA 3FWQA 3DQWA 4UXLA 3VW8A 2FO0A 5JGAA 4F6UA 1BI8A 4AACA 2F2UA 3NUAA 2EUFB 2QKRA 2ERZE 2XB7A 2W1CA 3PIYA 4KRDA 5G1XA 3ZC5A 4CTCA 2PK9A 2ESMA 4XV3A 5A4EA 5E8ZA 5FD2A 2BUJA 3AKLA 3NCGA 3BRBA 4A9RA 3W55A 3DB8A 3S00A 4FSZA 2ZV2A 3BV2A 3C9WA 4PRJA 2OGVA 3PPJA 3GCQA 4B0GA 1M17A 4EOJA 4OGRA 1V0BA 2UZOA 2XBJA 4EH8A 2GHMA 3FQSA 3IKAA 3ZO2A 5IPJA 2EXEA 4IB0A 3U8WA 5KHWA 3VC4A 2Q0NA 3D14A 5HKMA 5AUUA 1YHVA 3CCNA 4QPAA 2W1HA 5DMZA 2DS1A 4ERKA 2VX0A 5J9ZA 3OD6X 4IWOA 4CFVA 2W5HA 2CSNA 3SXSA 3ZXTA 4BYJA 5ANDA 5JKGA 3HUCA 3A99A 4YNEA 3OXZA 2A27A 2VD5A 3VS1A 5JSMA 4QQCA 4W4WA 2VN9A 2VTAA 3RPVA 4Z7GA 4Y73A 5KMMA 2UVZA 5CI7A 4IVDA 4NJ3A 3R7OA 3GQLA 1Q8UA 3UGCA 4FNZA 4BTFA 2X0OA 1MRUA 2BAKA 4FSTA 3NNUA 2QI8A 5L2SA 3NW7A 4IADA 4IM0A 3W2CA 4EK6A 4HJOA 4Y85A 4FKWA 4HYSA 4HYUA 5HESA 5CAUA 5DHJA 2VWVA 2YABA 4PMMA 3RVGA 1YXVA 2UVYA 4I6QA 4USEA 3A7FA 4D2TA 2OF4A 4Y95A 4EOQA 5BPYA 3TT0A 4RJ7A 4LYNA 3EFWA 4YLLA 3POOA 4ZY6A 4BI0A 4KNBA 3R1QA 4FKTA 2OLCA 1V0OA 5ETAA 4RIYA 4DH8A 4I5PA 4EQCA 1W2FA 3FC2A 4CT2A 3LMIA 5EI6A 1IASA 4M13A 4EH3A 3QZFA 4KIKA 4OTQA 2JAVA 1WBVA 5HO6A 4I94A 4F9WA 1ATPE 4JQEA 5HORA 2DYLA 3P7AA 4FKLA 2ZMCA 3GC0A 4BTKA 1UNLA 4JMQA 3FZOA 3U51A 3V8TA 4C59A 5JH6A 5GIOE 2XNNA 2ZJWA 2ZV9A 4X6QC 2FSTX 4FKPA 4NEUA 5DOSA 4ZLOA 4L42A 1MQ4A 5I9UA 2Q83A 4YP8A 3BU5A 4YZMA 4DGOA 2WMSA 4APPA 4C58A 1WVWA 3W2SA 3DS6A 3Q2MA 3KULA 3OBJA 2B54A 1GIJA 2JITA 1KE7A 2H34A 2P2HA 2XZSA 2P4IA 2VTOA 3PIXA 4F0IA 4EUTA 4UMPA 2C5XA 2YZLA 3M2WA 2YIRA 4XJ0A 5JFXA 3LFEA 5DNRA 4AG8A 4DT8A 2H6DA 2BILB 2ZV7A 4HOKA 3RP9A 4C36A 4FTUA 2ITQA 5L6WL 3DBCA 5DT3A 4JAIA 4XCUA 3S95A 3P78A 3P08A 1G8JA 5FDXA 2W4OA 3QRKA 5JRQA 3HV6A 5TOZA 4G5PA 2C6KA 3VRZA 3HRCA 3UC4A 2GHLA 4CNHA 4PNKA 2WIHA 2Z8CA 2X4FA 4FTOA 4TY1A 3VUTA 4A4XA 3QAME 2Y6MA 4YHJA 2XUUA 5HX6A 4OAVB 2UW9A 2BTSA 2UZWE 5HCZA 4ZIMA 3DXNA 4GW8A 4FVPA 4E4MA 5KUPA 4R7BA 4IVCA 2VTLA 3T8OA 3OT8A 4APCA 3JPVA 4MXAA 3GC7A 1Q8YA 4I5HA 2BKZA 3ZMMA 3C5UA 4ZS4A 2BZKB 5E8XA 2HZ4A 2GTNA 3E7VA 4FTNA 5HBHA 1A48A 2B9FA 3LKMA 2Z7RA 3GU4A 4MQ1A 4EUUA 1KOAA 1BYGA 4O2ZA 3FMEA 5AAEA 1NVSA 4OTPA 5HGIA 1Q24A 1YDSE 2WMXA 3FHRA 3LFAA 3LPBA 2YM4A 2QOHA 3ORPA 1M2RA 4FX3A 3TV6A 1H00A 4FOBA 3UQFA 3BWFA 2P0CA 4AZFA 5GJFA 3PTGA 3WYYA 4B8MA 5C4KA 4I4FA 3AMAA 2CKEA 5CLPA 5HVJA 5IQFA 4K33A 2ITYA 3CR0A 3N4TA 3LM0A 4C4FA 4FIJA 1F0QA 3V51A 3UP2A 4DTBA 5DT4A 5E8TA 4C4IA 4FTIA 4GS6A 4R77A 3HMNA 4MX9A 2WOUA 2UVXA 3NAXA 4D2SA 1IEPA 4EEVA 5K5NA 5CT7A 4DFUA 3PYYA 4QQJA 4YJTA 3L9MA 3HMOA 5CNOA 5AR4A 3WE8A 2OBJA 3E64A 4OBPA 4AZSA 2ZFYA 2F2CB 1XR1A 3KKVA 4LGDA 4K77A 3C4XA 3DK3A 2W06A 2PUPA 4CZUA 3SXRA 5AUXA 3W2PA 3D94A 4CRLA 5BMSA 5IF1A 2J7TA 4FT3A 3W2QA 3R7IA 4NH1A 5AWMA 4BGQA 4ZXTA 2EWAA 2BFXA 5FG8A 2GSFA 3OBGA 3ORXA 4PP7A 1DI9A 4WRGA 4EQUA 4MKCA 3ZFXA 2R64A 1KWPA 4D1SA 2VWYA 5EM5A 2BVAA 3R7YA 5CF8A 3NNXA 4C4EA 4LGHA 3R7GA 4FL2A 4FTMA 4OBQA 2ITXA 5GZ9A 4FZAB 4D2PA 2VZ6A 3EFLA 4G6NA 2VGPA 4QTDA 3TJCA 4ASDA 4FK6A 4ANQA 3LFQA 2V55A 3ROCA 1YW2A 4QMZA 3GFWA 4DCEA 2X4ZA 5DBXA 4E5AX 2VO3A 3IGOA 3EZRA 3BYSA 4H1JA 5M06A 4J53A 5F4NA 4RWKA 2ITNA 5AAFA 1W2DA 4CFNA 3U55A 2PYWA 4FEQA 2XNGA 4IAKA 4D55A 3RHXA 4Y83A 3BGZA 4FODA 3FZPA 4QMSA 1OVEA 2YFXA 4YJRA 3O96A 2JDOA 4G9RA 5EW8A 3Q6WA 4BCKA 4ZJVA 5M08A 5CEQA 4RA5A 3H3CA 4FICA 4TXCA 4IXPA 2WTJA 3WF5A 5TE0A 2R0UA 2XK8A 4GFGA 4QMUA 1M7QA 2E9VA 2WELA 1PXPA 3DLZA 2C3KA 3IQ7A 5DI1A 5FXSA 3ZZEA 4F9BA 2JD5A 4ZTNA 2C68A 4XLVA 4L52A 4OR5A 1U5RA 2XRUA 1UU7A 3QQUA 5M4CA 3WZEA 3F82A 3TZ9A 2O63A 5FWKK 5BVEA 4OTRA 4U7ZA 4XS2A 2JLDA 4WSQA 5J1WA 1JAMA 5EHLA 4DBXA 2CCIA 5C9CA 3UOLA 1XH5A 3R6XA 4GU9A 3ZHPC 5CU0A 3AD5A 4RWJA 5BVNA 4JR7A 1GJOA 1JOWB 4WKQA 3A8XA 2VUWA 5JN2A 4O4CA 4ZMFA 4BGGA 2YDJA 3OCSA 3WILA 1QCFA 4M69A 3GCVA 4F9AA 4JNWA 3RWPA 5EW9A 3C13A 1HOWA 2QHMA 2OIBA 3GC8A 3EFJA 3SD0A 3BV3A 4JVGA 4AUAA 1S9IA 3CY2A 5EDPA 4YUQA 2C0TA 4PWNA 3NUSA 2WMUA 4FNWA 3UIUA 2P2IA 3VUDA 3H4JA 4DG3E 5BVOA 4YJQA 3H9OA 3UMWA 2BAJA 2PVRA 3FZRA 3QXOA 3RPOA 3CQWA 2WMTA 4X3JA 4CSVA 5E1EA 3EQIA 3DPKA 3KA0A 4Y46A 3HV3A 3PUFC 3BGQA 5E90A 2XNOA 3D15A 3MFSA 3E62A 3FQEA 4M8TA 2WQEA 4Y5QA 3OWLA 4MAOA 2XEZA 3TL8A 4DGNA 4ZZOA 2PZYA 4AGDA 3TZ7A 4YC3A 4E1ZA 4IE9A 5JQ5A 4HCVA 5CVGA 4EOSA 5TF9A 3CGFA 4IDTA 3SOAA 1VR2A 4F6WA 4C57A 3UO5A 3F88A 4AT3A 4E5WA 4I23A 5AJQA 4HCTA 2CGVA 4PTCA 4O81A 3RI1A 2ZB1A 4Y72A 4EK4A 3MY1A 4ZTMA 4ZZMA 3MYGA 3VQHA 1Y8GA 2BROA 3QZGA 3PJ1A 4HPTE 5I0BA 4UZHA 4DTAA 4G5JA 1Q3WA 2QOLA 4JS8A 5CZHA 4AF3A 3UDTA 2PVNA 2OZAA 3QLFA 3V5PA 3PLSA 5AMNA 2A0CX 3POZA 2BRGA 4F1OA 4CZYB 3NVMB 3H0ZA 2X9EA 3QRTA 5F1ZA 3UQCA 4X21A 3IDPA 1T45A 4QMPA 4X3FB 4AW5A 1Q5KA 3FAAA 2QOBA 2HOGA 5AIKA 4C33A 1ZRZA 4G34A 3G51A 2V62A 2V0DA 1QPCA 3MTFA 2QURA 5DT0A 5FP6A 2B55A 4CZTA 4ACDA 1YXXA 4QNAA 5DGZA 3RPYA 4FUXA 2ZYBA 5ITAA 2QHNA 3R8MA 5CEIA 1UVRA 3TNIA 3BCEA 3OY3A 3HV7A 5HE2A 5JFWA 2P33A 4ZLZA 4PDOA 3L1SA 1SVEA 2F57A 2B1PA 3CY3A 3IONA 2IWIA 4D28A 5DWRA 1H07A 2W1FA 1YI3A 2JGZA 2FH9A 4NFMA 1M14A 1SNXA 2CGXA 4XG9A 1A9UA 4DH1A 1ERKA 3QGWA 4YZCA 3ITZA 4L3PA 2QVSE 3UVQA 1STCE 3WZJA 5F9EA 5JEBA 4IAYA 2X7GA 4ZMEA 4HYHA 4TYHA 1XKKA 4I6HA 3KCFA 3DXPA 3E8EA 4O6LA 2ITUA 2BZHB 4LGGA 4MH7A 4D4SA 2UZDA 3FI8A 4RBLA 3VF8A 4JT3A 1R39A 3F61A 4BFMA 2VTIA 3DTWA 3PZEA 2UW5A 5CX9A 4MXZA 4BBFA 4AE6A 3ZO3A 5AADA 2E9PA 5KE0A 4LOQA 2J4ZA 4FKIA 4ZY4A 4B99A 4O7VA 4FOCA 4BWPA 3Q4TA 5EOLA 4GVAA 3D7TB 3HA6A 2HZNA 4FBXA 3ZFMA 2PVMA 3WI6A 3RK7A 4GT4A 1XMMA 3NMUF 3NVKI 2WQBA 3GNIB 4CVAA 3TV7A 2YERA 3GQIA 2OXDA 1YHWA 3LAUA 3ACJA 4QPMA 4TW9A 3WF7A 2X6DA 2PVKA 3AT4A 1H01A 4IW0A 4U0IA 3EWHA 4BF2A 4FSYA 4AN2A 1CKPA 5H2UA 4FTQA 3QHWA 3EL8A 2WTKB 3CPCA 4HGEA 2CCHA 3PY0A 4GK2A 4WBBB 3AQVA 3V5QA 4FT5A 3HX4A 4IHPA 3R04A 1KE8A 5ETCA 4RX5A 4BGHA 3TKUA 1M2PA 4CFFA 4IZ7A 2ZB0A 2NYAA 2NPQA 4ONAA 5JQ8A 3AC1A 4AN9A 4NSTA 3N4VA 3GENA 4KABA 5HLNA 3TACA 2UZTA 5ANEA 3GU7A 4BB4A 3TJDA 4O7TA 2Z02A 4WNPA 1J3HA 4J8NA 3QTZA 4LV8A 5L2TA 3UOJA 3V6SA 2W1DA 1SVGA 3BELA 2PVLA 3MS9A 4EORA 4NW5A 4OUCA 5C27A 1K9AA 3NFGB 3Q04A 2BFYA 1ZXEA 3OP5A 1BX6A 3UG1A 4R1VA 5I4NA 3EQGA 2OG8A 2XIRA 5D9HA 5HHWA 4KSQA 4WO5A 4BL1A 4QMMA 1SYKA 5K4IA 1PRYA 3E8NA 4ZTLA 2HIWA 2FA2A 3SXFA 3WYXA 3PJCA 2CNQA 3NLBA 2WHBA 4YMJA 4BJJB 3QUPA 4WOVA 4DTKA 2IEWA 3OF0A 2YCSA 4JX7A 4TYJA 2W1IA 3O8UA 4CFWA 4Z3VA 4RVLA 3QD4A 4QMVA 4XP0A 2OIQA 4WRSA 5L3AA 5K9IA 1RJBA 2ETMA 4ZY5A 1J7IA 4D2WA 4EI4A 5FEQA 2ZV8A 1KOBA 5BVDA 2UZUE 3NW5A 4DC2A 3CP9A 4BI1A 4RPVA 5CEKA 2GNIA 4BCGA 4N0SA 4BCPA 3ZDIA 4HYIA 4YO6A 2VX3A 4RFZA 3QUEA 4DG0E 3KMMA 4DHZA 3ATTA 4TWCA 3S3IA 4I0RA 4L67A 4XEYA 4FA2A 5CEOA 5AUZA 3RCJA 5I5ZA 2VU3A 2W7XA 3GU8A 3R9RA 5K4JA 3PP1A 4EZ5A 2AC5A 5DLSA 1U54A 4WIHA 3HL7A 2IN6A 3PG1A 5DE2A 5B2KA 3PSCA 4BYIA 4C4HA 4F99A 4FZFB 4IAIA 3MVHA 4RJ8A 2CPKE 4UXQA 4U5JA 5CF6A 4O82A 1ZOGA 3ORZA 5E8SA 4BCIA 4L46A 3VUHA 3UPXA 4DEEA 4BDKA 2WMAA 3DZQA 3R2BA 4OTWA 3GOPA 1OECA 1Y91A 2UZEA 2R3MA 4FL3A 3MESA 2X1NA 4YZBA 4O7LA 3BLHA 3O2MA 3TXOA 4MXOA 5A4QA 3UZTA 1FVVA 5HQ0A 1KSWA 4PL5A 4FYNA 2GQGA 3VRYA 3AD6A 3QZIA 2OJJA 3W2OA 5EQPA 4MNEB 4G3FA 1P4FA 2RSVA 3VHEA 3BE9A 5E7RA 3VF9A 1P2AA 4XG2A 4O0XA 5C8MA 4II5A 3DJ6A 4QMLA 3RNYA 4ANOA 4YSJA 3W0NA 2CHLA 4BZNA 2XIKA 3QZHA 4UMQA 3ALOA 4AZVA 2QLUA 3OS3A 2RF9A 3MA6A 4PTEA 4HGLA 3V5TA 5EKOA 4CLIA 2PMLX 5KMIA 4BTMA 1L8TA 1U59A 3GGFA 2PL0A 2P55A 2GQRA 3FY2A 3ANQA 2HAKA 4QQTA 2FSOX 1R3CA 5FTQA 4YU2A 3VUGA 5J9LA 3SRVA 2CKQA 3ANRA 5AEPA 3ORNA 4IWQA 3W2RA 2G2HA 3CD3A 2UV2A 3QX4A 1JKLA 1H08A 4IJ9A 4ITIA 2JBPA 4HGTA 4YPDA 5C4LA 2ITZA 2WTVA 4O1PA 2WMQA 3R1NA 5IA5A 5M56A 4OAUC 5EQYA 2J2IB 1W0XC 2NP8A 4XMOA 2R3NA 3DK7A 2GS7A 3LJ1A 2PTKA 3SDJA 3SHEA 3NPCA 4YC6A 4C02A 4YHFA 2XRWA 3E8CA 4MXXA 3D2KA 4DEGA 1YHSA 2VTSA 2W0JA