1M7NA

Crystal structure of unactivated apo insulin-like growth factor-1 receptor kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
305
structure length
299
Chain Sequence
SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Apo, unactivated insulin-like growth factor-1 receptor kinase. Implication for inhibitor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Insulin-like growth factor I receptor
total genus 90
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m7nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m7nA01
2C6EA 4TWNA 4IH8A 5FTOA 3BRBA 4C2WA 2FSMX 1R3CA 3OWJA 3NUSA 1JSTA 4D1XA 3ZM4A 3C7QA 5ICPA 3F2RA 3H0ZA 5H9BA 1YQJA 4EH4A 4FNXA 2W17A 2W4JA 3POZA 3BWJA 3NCGA 3QZFA 5FLFA 4YBKA 3ORMA 2BCJA 2E9VA 3HMMA 2XM9A 4AGCA 3WARA 3MTFA 4FE2A 3W16A 4D1ZA 4M0ZA 3PG1A 5D7VA 5J95A 2JC6A 5B2MA 2J90A 2IVUA 3AMBA 4GSBA 1XBBA 2QG7A 4F1TA 4O7ZA 3ZTXA 5BVFA 5L2IA 2EB3A 4FTOA 5DEYA 3S2PA 4Z3VA 5I9VA 4YJQA 3AOXA 3QX4A 2OXXA 4IACA 2QQ7A 3NUYA 5CEMA 4LQMA 4TYJA 3O96A 2J0MB 5L8KA 4I4FA 1Y6AA 3MPAA 2ITTA 4I23A 4W4WA 3RWQA 2W96B 4M84A 1QPEA 1UWJA 4GRBA 3KB7A 4O6EA 5HNIX 3WIGA 3KREA 5BVKA 4EH3A 1CDKA 4KIKA 3V8WA 2PZYA 4G5PA 3V3VA 4RJ7A 5E8UA 2W9FB 3FSFA 3O50A 2BUJA 5FQDC 4RLKA 4ALUA 1H1QA 4X3FB 4UV0A 1OBGA 3LOKA 3U6JA 4I5MA 4XG9A 3D4QA 2VWBA 4XH6A 4UYAA 4FSMA 3SHEA 4U7ZA 4ZY4A 5L8LA 4IWQA 3AD6A 4IAFA 4BDCA 2WEVA 2HZ4A 3H3CA 3I7BA 3GBZA 3Q3BA 4O0VA 2YCRA 4U44A 3EN7A 1A06A 3IKAA 1QL6A 2VWYA 3ANRA 3NS9A 5CEOA 4PPCA 4KRCA 4M69A 5KKRC 4FV7A 3R7YA 3OG7A 3GC0A 3HDNA 1GIIA 3CPBA 3HP2A 5HBEA 5TOZA 5E4HA 2VO3A 2YWVA 2O65A 3CQUA 1MRVA 4ZEGA 1Z9XA 3FQSA 5IA5A 1VYZA 2QURA 2PVYA 2VTHA 4YNEA 4K33A 3TUCA 5HVYA 4M7IA 5JMSA 2PY3A 3OOGA 5HORA 2UW4A 3RALA 1URWA 2HAKA 4LV5A 4XBRA 1H28A 4FZ6A 3CTJA 4J71A 4NU1A 4CT1A 3UGCA 2ZVAA 4QMYA 1BX6A 4UYNA 3PXFA 3UMXA 4C3RA 4BCMA 5M51A 4E4LA 3E64A 2GQGA 3IDCA 1OUYA 3QQHA 3VW6A 4DFBA 4S32A 2HW7A 2P33A 3ZBFA 2BHEA 4HGSA 4OT5A 4A07A 5IA0A 2F7XE 4EOOA 4ANLA 3F82A 4TYHB 4MD8E 4FTRA 4CLJA 3QTQA 3E7OA 1P4FA 2H34A 3OP5A 2ETKA 4A4LA 4ZTQA 2FGIA 2Z8CA 3LJ0A 2PPQA 1ZZLA 2F49A 2ETRA 5H8BA 4AA4A 4AN2A 2GNJA 4ZSEA 3VF8A 4C02A 1XJDA 2IG7A 2OIQA 2YM3A 4I6HA 4IWOA 2QOQA 1L8TA 2WEIA 1E9HA 3Q5ZA 1Q4LA 2I6LA 3CQEA 4IANA 3QTXA 2EB2A 3W10A 4IVBA 5E8SA 1CMKE 5DNRA 1OKYA 5CXHA 4O0YA 2QOFA 4LRMA 5C4KA 3PTGA 3COIA 3KVWA 5EQEA 4RC3A 5DGZA 3LCDA 2JKKA 4JDIA 4W4YA 3O8UA 3AC2A 2JFMA 4L68A 5HVJA 3LJ1A 2VUWA 3ZEWA 1IRKA 3ZH8A 2IJMA 3UO4A 4IX6A 4PNKA 1YI3A 5CLPA 3ODYX 4FC0A 3LHJA 3R9NA 3F61A 2UUEA 3EFKA 3TEIA 2P0CA 4EWHA 2E9UA 4IB0A 2CKQA 1ZY5A 2BIKB 3P4KA 5IDPA 4DF3A 4YHFA 4E6QA 4U0IA 1URCA 2FB8A 3OBJA 4YC6A 4Y85A 2R3GA 5GJFA 1GAGA 2X9EA 3ATSA 3VRZA 4Z7GA 2GFSA 3BELA 2BZKB 2C3KA 2JITA 3Q53A 2UZUE 3QBNA 5JFWA 4MWIA 1S9IA 2VO6A 4XG4A 1YXTA 1H0WA 2YACA 3NSZA 4Z9LA 5EOLA 3PDTA 4CVAA 1GOLA 2QHMA 1UKIA 4RA5A 4B8MA 3HYHA 5T68A 2R0IA 4BN1A 3G15A 1UA2A 2YIQA 3FKNA 4IJ9A 5AR8A 3R1QA 2Z02A 2IWIA 3RCJA 3BGZA 3DDPA 2SRCA 3D2IA 4G31A 2FA2A 3G6GA 5E91A 1PXIA 3E8CA 5EM5A 5DRDA 2J50A 2W1DA 4C3FA 4XP2A 4QNYA 2PZRA 4RRVA 1XH9A 4O0RA 4PDYA 3KFAA 4X3FA 2ZOQA 4DG0E 3O2MA 5EH0A 2VWXA 2C4GA 2CLXA 3E8NA 4FIGA 5AV2A 4IXPA 2ZAZA 5C9CA 5BVDA 2ERKA 4JG6A 2WKMA 4BHZA 1Z57A 2YEXA 1ZYDA 3F5GA 4FYOA 3F2NA 3R83A 1WVWA 5IZFA 4IAYA 4MD9E 3IGGA 5C01A 5CS6A 4PMMA 2YJRA 5BMMA 4Y5QA 2CJMA 3IO7A 4DBXA 3Q4TA 3TG1A 1ZMUA 4IX4A 3BLRA 4WT6A 3PJ8A 2XJ2A 3RTPA 1PXOA 3Q2MA 4BRXA 3FEGA 4DT8A 3CR0A 5E7RA 1YOLA 3HRCA 3ORNA 4WNMA 5AP3A 4RIWB 3A62A 3SA0A 3QGWA 4HPUE 3LXNA 1OIRA 3V5LA 2P55A 3F3UA 3VHKA 2C6TA 4YHTA 3FLZA 4XG2A 2QODA 5C1QB 2CKEA 2VTPA 3CCNA 4CQGA 3E87A 2ZV7A 4QMOA 2H9VA 2WXVA 2ONLC 4UZHA 5HICA 4AZFA 4BCIA 3CBLA 3D15A 4B6LA 4D28A 2A4LA 3OS3A 2QI8A 5AEPA 4LMNA 1LR4A 1V0PA 5AR5A 2C1BA 3MWUA 3TZ8A 2X0GA 4IEBA 2WMTA 1J7LA 3NVKI 5HCZA 4USFA 4NUSA 1BL6A 4DLJA 3UG1A 3F5UA 3H9FA 4MBIA 4NFNA 5AV0A 4EKKA 1AD5A 1FGIA 4LGDA 1ND4A 1WBWA 3ZOSA 4DEGA 3QC9A 4IWDA 3MA6A 3TZMA 4OBOA 5EDRA 2PULA 5EQYA 1OKWA 1P4OA 4S34A 3NCZA 4U41A 3I81A 4GVJA 3BPRA 4TYHA 2EXEA 3T3VA 3ZRLA 4U6RA 4AOTA 3KK9A 4N57A 1JSUA 4CT2A 3WF8A 5EYKA 4U42A 4PRJA 4AX8A 3E7VA 1G5SA 4EOKA 4IIRA 3BBWA 4WG5A 4QMUA 5GJDA 3ALNA 4BCJA 3GQIA 3SLSA 3W1FA 4ALWA 3KXMA 4JQEA 5LMAA 4QMQA 4QO9A 4DA5A 1LEWA 3IOPA 3DJ7A 4C34A 3AGMA 4GV1A 5HBHA 3UIMA 2O5KA 3MDYA 3LJ2A 4U3ZA 2REIA 2XKFA 5HE3A 4DLIA 1OGUA 1ZARA 4HZSA 4Q5EA 4X2GA 4APPA 2JIVA 4FKQA 2XH5A 4IAAA 3PPKA 2GQSA 4XX9A 1PRYA 1KE6A 1I44A 3EQBA 5E8XA 5LMKA 4R3RA 4M15A 1TVOA 4DT9A 5FUTA 2QKRA 4HYIA 2VTNA 3LCSA 3NUXA 1YXXA 3OEZA 2BVAA 3V8TA 4HYSA 2W4KA 5FXSA 3DTWA 4G3DA 4TNDA 3LAUA 5K5NA 3WYYA 2JD5A 4YC3A 3ZO4A 3CTHA 4C2VA 3RPYA 1OBDA 4C57A 4EZ5A 4I21A 1E1VA 4IB3A 2NRYA 3ZSHA 3UPZA 3JY9A 4A9RA 3LM0A 4LRJA 4Y46A 5AV4A 2QNJA 2EU9A 3ALOA 3R63A 2YJSA 4YZMA 1APME 1X8BA 3S3IA 5F4NA 5BQ0A 4CMUA 5HO7A 4JG7A 1WBTA 4ANQA 3UOHA 5DT0A 5LVOA 1T45A 2GHLA 4LG4A 3ZDUA 4EYJA 5HO6A 2EXMA 4GYIA 5LJJA 2B9HA 2PUPA 4QTAA 3LM5A 2VZ6A 4KSQA 4YPSA 2XRUA 3GVUA 3NNXA 3FHIA 4JBPA 5DN3A 2CNVA 4DTAA 4CCUA 5EHLA 1KSWA 1WVXA 2JDVA 5A6NA 2PVKA 4K11A 3DKOA 3S0OA 4NT4A 3FZRA 1WBOA 3ZFMA 5HKMA 2PVNA 4DE4A 4A9UA 3OCSA 2F9GA 2BTSA 2OU7A 3M42A 4C4HA 2CMWA 5JGBA 3BCEA 4GUEA 1KV1A 3W2CA 4MXXA 3K5UA 3D83A 1OIUA 2GNLA 3R6XA 3I5NA 3VBTA 4NJ3A 2WMXA 3OMVA 4FV9A 4PPAA 3HMIA 5E8WA 4E1ZA 2FSLX 1U5RA 5CWZA 5M4FA 1H07A 4NM7A 4RFMA 3SW4A 4UB7A 2OZAB 4G2FA 1MP8A 3DK7A 4WBOA 1A48A 1KUTA 4TWOA 3PLAE 3DCVA 2C0IA 4JRNA 2ETMA 3RZBA 3SDJA 1UNHA 5L6OA 3EKKA 3QUPA 4FTAA 3QTIA 1PW2A 2GU8A 1G3NA 3VO3A 3CY2A 1FVTA 3HUBA 3CGOA 3QD4A 4I0SA 4ACCA 1Y91A 2PE2A 3UQCA 2OKRA 5K0XA 4ZJVA 3UP7A 1L3RE 4G3GA 3DTCA 3VNTA 3ZONA 4W4VA 4KKHA 2CDZA 4G3CA 1H1WA 4I6QA 3R8VA 5IUIA 3MA3A 2BDWA 5HIEA 1UVRA 3RJCA 2W1ZA 1WBNA 2PVLA 3BQCA 3WZUA 5IU2A 4QTEA 2R0UA 2VTSA 3QTUA 4FOBA 4RJ4A 2YCSA 3F3WA 3FV8A 3QD2B 3RNIA 4IB5A 3BGQA 4Q9SA 5EM8A 1FVVA 3RM6A 3PRFA 4L00A 4PL3A 1G8AA 4GUBA 5HD4A 3A7IA 3QA8A 4AAAA 1I09A 3HAVA 4RVKA 1UU7A 1PXJA 2JAMA 3W2SA 2QLQA 3VUMA 3CEKA 4TXCA 2UZNA 3FKLA 3RINA 5CENA 4EH7A 2WZJA 2I0EA 4M66A 2RSVA 3AXWA 4AU8A 4QP9A 1Q5KA 1J7IA 3I0QA 5A4LA 2ITUA 4OGRA 4EOPA 4FVRA 2W1GA 2IZTA 4EK5A 4JVGA 2VAGA 3FLWA 3PJ2A 4HNFA 4N0SA 4O2PA 4X2NA 4W8DA 3OCBA 4V05A 2XNNA 5KMKA 2JBOA 4NIFB 4TRLA 1UKHA 4ASEA 3KK8A 4CTCA 3CD8A 3G0EA 3MH1A 4O86A 5M4CA 4FK6A 2VNWA 4FTUA 2UV2A 4R7HA 5CF5A 4YLKA 5J7BA 3WF7A 3REPA 3DOGA 4QYFA 5JFSA 4ZS4A 2UZBA 4AUAA 4C4FA 3FUPA 1XKKA 1PMEA 4YLJA 4F7LA 2H8HA 4MXAA 4GFOA 5A4CA 1UU8A 3I7CA 1OB3A 4G6NA 3U4UA 4IADA 5I5ZA 1OPLA 1Q8YA 4FIJA 2C5YA 3BZ3A 3F5XA 3IGOA 4R7BA 3C4XA 4YZ9A 3F3ZA 2EUFB 3KU2A 3LVPA 2VTIA 5KMLA 4AA0A 4Z16A 5HLWA 1H25A 4FKVA 1H08A 4TWPA 4EBVA 5CEIA 1OL2A 4YBJA 4XS2A 5H2UA 5H8EA 4BR3A 4TYEA 3IW4A 2PWLA 5FTQA 3KRWA 1U54B 4DG2E 2JAVA 3NX8A 3ATTA 2GPHA 5JEBA 5T6KA 3C51A 3B8RA 5L4QA 4TKSA 4QOXA 4HGEA 3EZRA 1W0XC 3QQUA 4P2KA 4IFCA 4LI5A 1M52A 2VX0A 3E63A 3NW7A 3Q32A 4KNBA 3WBLA 4QQTA 4EOQA 3KEXA 2JGZA 2C69A 4JAJA 3CC6A 3TXOA 4A06A 2OJJA 4XV3A 4CLIA 4ITJA 3PJ1A 4AE9A 4XYFA 3MFUA 5E8VA 3NYNA 2XNOA 1CSNA 3S00A 4K9YA 4BCPA 2YCFA 3TV4A 2IVSA 4TY1A 3Q60A 3QYZA 3G6HA 2RFNA 2KTYA 4LGGA 5K5XA 2WU6A 1FQ1B 3EKNA 4O27B 4ITHA 5HE1A 3VBXA 4QMVA 4CZTA 3B2WA 5HZNA 3ZSGA 5GZAA 2V0DA 3OY1A 3PVUA 4I3ZA 3WZJA 5HG7A 2UVXA 4PL4A 3TNIA 3QQFA 4NM0A 3B8QA 3GC7A 3BU3A 2KULA 5LCKA 4EZ3A 1KE7A 2OI4X 3OXZA 3PXQA 3W18A 5F20A 3P1AA 1ZOHA 2CCIA 3QLGA 3TN8A 4CFUA 4EK8A 2YIYA 4E4MA 3FXWA 3CJFA 1M14A 4L42A 4O7TA 4I6BA 4MK0A 4P5QA 4O82A 3OC1A 4GFGA 3DY7A 4RX8A 2FH9A 2UW7A 1CTPE 1SVGA 2WTCA 1M17A 4FNZA 5A3XA 1MUOA 2BKZA 3HP5A 2CGWA 3PA5A 3I79A 3QU0A 3UZTA 3EQIA 1SNUA 3L9LA 1UU9A 3C4WA 3BIZA 4JBVA 4QP4A 1JKTA 1K2PA 3DJ5A 4LL0A 4UXLA 4OBPA 2HZNA 4JR3A 3SQQA 2GFCA 3D5WA 5CI6A 4ANBA 4JAIA 3IECA 3QLFA 4JDHA 3V5WA 3R9OA 4RT7A 4HCVA 4FIFA 5HIDA 1OUKA 4AOJA 2HY81 3QRUA 3QTRA 4QP3A 4FKGA 4O0UA 4EC9A 5GIPE 2XM8A 3R7UA 4D58A 5BYZA 4WKQA 5L2TA 5JZNA 4D9UA 3IOKA 3ULZA 3TCPA 3ODZX 4Q9ZA 5EM6A 2YIWA 2FVDA 4CQEA 1YXVA 4EZ7A 1ZZ2A 3U9NA 5CI7A 3E3BX 3IW8A 4MX9A 4JQ7A 2F7ZE 4EQMA 1KWPA 4I5HA 1NY3A 1P14A 3FL4A 3KN6A 4FSWA 5HIBA 4BCNA 1FGKA 1CKJA 1U46A 4H1JA 4IHPA 2H96A 3EQFA 3O7LD 3A4PA 2XMYA 4QNAA 3ZXZA 2R3IA 4AGWA 5CVGA 4AZVA 2C3LA 4F99A 3JXWA 4RA4A 4MF1A 3R73A 3TNQB 4XLIA 5F9EA 5AUVA 2IZSA 4FSQA 3FZPA 2XA4A 4EK4A 4N4SA 5J5SA 3QD3A 4G1WA 4UMTA 3R2BA 5KCVA 5EYCA 4EORA 4WHZA 4PTEA 3DA6A 4K77A 3VUGA 4R7IA 5JN2A 4YP8A 5D11A 4J8NA 5IEYA 2F2CB 1V0OA 1TQMA 4EYMA 4WUNA 5A4QA 2VTLA 4FKTA 4O7RA 4BDHA 2WOTA 4C58A 4AZWA 2QOBA 3ORTA 4K8AA 4L46A 5FEDA 4IX5A 1O9UA 4P4CA 4BWPA 5AM7A 1PKGA 3A4OX 4GKHA 4JBQA 2WELA 1SNXA 3R28A 4BY9E 4MTAA 5IEXA 2GMXA 4AP7A 3VN9A 4FV1A 5IH5A 2DQ7X 3HECA 4FV2A 4NEUA 4E7WA 3BEGA 3GU6A 3IW5A 4HGLA 3GU5A 4JDJA 4FVPA 4KINA 4OTQA 4L43A 5EDQA 4BWXA 1KOAA 3ETAA 4L01A 4XMOA 2CGUA 5EHOA 1WCCA 4NWMA 3CJGA 1TKIA 3DT1A 1GNGA 4MBJA 4WD5A 5CALA 4C37A 2WHBA 2ACXA 2XK3A 3LQ8A 3WYXA 1Q8TA 5LMKC 1YDTE 2UZWE 2I0HA 4L52A 5F95A 3TWJA 4IVAA 1ZYSA 3HV5A 2NRUA 4M68A 4D2TA 4KKGA 3RK5A 4NH1A 3PE2A 3LMHA 4B8LA 3G51A 3V8SA 2B52A 1ZRZA 2OO8X 3RWPA 3ZLYA 1O6YA 3HUCA 2G2HA 1OIYA 3VUIA 2XF0A 3HVCA 3KULB 3PE1A 3UNZA 3PA3A 3QA0A 4J7BA 5CT7A 2X1NA 4FNWA 5AFVA 5EQPA 3RI1A 4S2ZA 4O1PA 1GZOA 3ZUUA 2J51A 3F7WA 3TL8A 2IW6A 4ZSGA 3HMPA 2GCDA 3FPQA 1NW1A 2GS6A 2VWUA 4EH2A 3DPKA 2HWOA 2BZJA 4AZTA 5CVFA 4R77A 4KIKB 3GCUA 4KS7A 3QRIA 5IQIA 2ITPA 4FSYA 4HNIA 4GU9A 2VNYA 4ACDA 3HKOA 4RMZA 4FGRA 3A99A 3EQGA 2I0YA 2X2MA 4FL3A 3FAAA 2BAJA 2IN6A 2QONA 4OTHA 4QPAA 4AACA 5I4NA 4UWYA 3LMIA 3DV3A 1ZYLA 2BR1A 4KBKA 3ORIA 4FV6A 3DZOA 4DGNA 3ZMMA 3GFEA 1H24A 1PXKA 4G16A 2C5NA 3G0FA 4I5CA 4YO4A 2Z7SA 5FG8A 3DJ6A 3MIYA 3MY5A 3QUEA 3FC2A 4RJ5A 3R7GA 4MYGA 4XJ0A 4YTHA 2XJ1A 3W55A 4AT4A 1RW8A 3COHA 4F65A 5M56A 1LP4A 2UW3A 3EQHA 1H1PA 4XHKB 5LCJA 4NW5A 4QTBA 4DFXE 2Y6MA 5EW3A 2OF2A 2FO0A 3GCVA 4BTKA 5IUHA 3BYOA 5J8IA 3ENMA 2GNGA 2RFEA 4AA5A 4DBNA 3A7JA 3WOWA 2RGPA 2WD1A 3QCQA 3ZLXA 3DKCA 3C1XA 2XEZA 3RZFA 3W2QA 4BCOA 2BRHA 2O8YA 3HMNA 5ETAA 4BC6A 4D2WA 4D5KA 2HXLA 3F88A 4O38A 5I9ZA 3HMOA 4CFMA 3PXZA 3OW3A 1WBSA 4ALVA 1QCFA 1AQ1A 3ZRKA 4IC8A 5IISA 4O96A 4JRVA 4M13A 5BYYA 4R3CA 3T3UA 5K4IA 4YR8A 3EFLA 4FKPA 3V01A 3FC1X 5CU4A 3P5KA 4ITIA 5E92A 5ETIA 2QKWB 2CKOA 2C6MA 2EVAA 4BDBA 3NUAA 1PXNA 2J9MA 3GFWA 4AF3A 4CFFA 1Z5MA 4TNBA 2ZB1A 5IQDA 3BWFA 5HCXA 3UO6A 1YI4A 3BBTB 4BKJA 5IA3A 4Y95A 3V6SA 3KXXA 4BDFA 3DK6A 2OXYA 5EW8A 3V6RA 4C3PA 5K4JA 3SVVA 1WFCA 4BZDA 4F9AA 3GT8A 5JQ8A 4IM0A 4DEIA 4DH1A 3PZHA 4I4EA 5CEQA 3HA6A 2XKCA 3P78A 4FI1A 3BLQA 3L9PA 4NTTA 2JDTA 4CG8A 1S9JA 1G8SA 3LFDA 4EOSA 3WE4A 3UBDA 5GIOE 3HEGA 2CPKE 1PKDA 2UZTA 5CTPA 3UC4A 1PHKA 3GUBA 2OK1A 3NWWA 3K3IA 3KF7A 4JX7A 3UMWA 3VHEA 4A7CA 4F08A 5IA2A 2ESMA 3PJ3A 4RJ6A 4ZLYA 3JUHA 2WAJA 4R6VA 1YXSA 2UVZA 3A61A 2W1FA 2QVSE 4II5A 4RVTA 4TT7A 2OJIA 4USDA 2PL0A 5KUPA 4DEAA 4EJ7A 5EYMA 4A9YA 4JBOA 1YOJA 2JKMA 5IG1A 3CKXA 3SXRA 2OJGA 3N4UA 3IDBA 3LMGA 4BBFA 4KRDA 4D4RA 5B0XA 1GIJA 2CNQA 3M1SA 4HW7A 4I93A 1IEPA 3A7GA 3N4VA 2VGPA 3O0GA 3FI3A 2QO7A 4AWIA 4GEOA 2R3OA 2ZV2A 5D41A 4BDAA 3O8TA 4PMPA 5M57A 2IVVA 3AT4A 4MWHA 3EFJA 5IEVA 1UU3A 3SAYA 2PUIA 2YERA 5IQFA 5IQBA 4XBUA 4PDPA 5CSWA 3NVMB 4CMOA 4DAWA 3ULIA 1PY5A 4LUEA 3JPVA 1ZY4A 2R3LA 4E4XA 4F4PA 2C0OA 1WAKA 2FUMA 4GJ2A 3OXTA 3L8XA 4E6AA 3NUUA 1Q8WA 4FKUA 3I60A 3MSSA 4B7TA 4RZWA 4ORKA 2HZIA 2PVHA 5K9IA 3QWJA 3EQPA 4ZXTA 3NEWA 3PY3A 2OSCA 2XNMA 3PLSA 4D0WA 5AR7A 3PVBA 3V5QA 4BZOA 1GZNA 3UC3A 4PP7A 2HY0A 3HRFA 3TKUA 1BLXA 1A9UA 3MW1A 4QP1A 4TZRA 3KCFA 1PXMA 4LOQA 5HG9A 1BI7A 3AMYA 3EQDA 2YZLA 3AC5A 4JT3A 3NUNA 5HQ0A 4ZTNA 5CZIA 4X2FA 3UNJA 4ASZA 5B2LA 5H8GA 4ANNA 1H4LA 1XQZA 3OT8A 4I41A 2QOCA 5AR2A 4EHGA 4YNOA 5ANIA 2ZM4A 3ERKA 3WF5A 5J9ZA 3OCTA 3S1HA 3P7BA 4GFMA 3GEQA 5FRIA 3TZ7A 1EH4A 3U51A 4E73A 4PDSA 2C47A 4DH3A 4EL9A 3UNKA 2YN8A 3D94A 4O0SA 2Z7LA 3EJ1A 2BZIB 2WOUA 4KABA 2R3HA 3FMKA 1SVEA 3VS2A 3AT2A 2VTAA 4TL0A 2OWBA 4FG7A 4USEA 5KMMA 5CAPA 3MVLA 4BTFA 5L3AA 3E88A 3NNWA 4FKWA 4LL5A 4BGQA 4CGAA 4HZRA 4V01A 5JRSA 1JVPP 3EL7A 4BICA 4UY9A 3LZBA 2QR8A 4L44A 4RVMA 3HAMA 3HL7A 5FGKA 3TKHA 3H9OA 4ZP5A 3RNYA 4FTIA 2GSFA 1DI9A 4E6CA 2VO0A 4QMLA 3VJNA 5CU0A 4BZNA 4IM3A 3GU8A 3MTLA 4FMQA 4MXOA 4B9DA 3KF4A 3QUDA 4UXQA 3ZFYA 5CVHA 3HV3A 4ERWA 5JSMA 3FMMA 5KHXA 4RGJA 4CNHA 5L6WL 5A54A 4OTIA 3WIKA 3UZRA 4XRLA 2DWBA 1ZMWA 3QCXA 2YM6A 2V5QA 3EN9A 4FV5A 2BRNA 5EI6A 2GHGA 5HO8A 2G2IA 2HWPA 3TNWA 3E93A 2Y0AA 2VX3A 3E5AA 4MNFA 1IAJA 3ZUVA 2PUNA 3NRMA 4O83A 5KBQA 2HZ0A 3OHTA 4NFMA 3BHUA 5F1ZA 4DGLC 3JVRA 2Q83A 4AG8A 3PSBA 2ZDTA 3GC8A 3Q04A 4KAOA 4YZBA 1XHAA 4O0WA 1IR3A 5EKOA 4CV8A 2VTJA 3GCPA 2V22A 3PG3A 4FUYA 4BGGA 4FIEA 2RG6A 4RIYA 4RX7A 4H58A 4CYIA 1Q97A 1XWSA 2WQOA 3VQHA 5JGAA 4YZCA 5CY3A 3RPRA 3ZBXA 2QU6A 3E8EA 5L2WA 3RAKA 1JBPE 2OLCA 2XB7A 3R7IA 3DFCB 4HJOA 5DFPA 3FHRA 1V0BA 2Z7QA 2ZYBA 2QU5A 3AD5A 3R8ZA 4C4EA 4F1MA 3TACA 3LLTA 3GU4A 1ZOGA 2W05A 4IB1A 1Y8YA 2XIZA 4GVAA 1KOBA 1P2AA 5TO8A 4GL9A 1V1KA 1OKVA 5CU2A 1PYXA 3F2AA 2HK5A 2WIPA 3DNEA 3EIDA 3R0TA 5E1EA 3SV0A 3WF9A 2XNBA 4JNWA 4BIDA 1ZYCA 2WO6A 2YM4A 2E9OA 5KNJA 5M55A 1T46A 2R3MA 3G5DA 4BB4A 3HV6A 5L8JA 3GCQA 3AGLA 4WG3A 5DH3A 2F57A 2G15A 3IONA 3PVWA 4PQNA 3FLQA 4RIOA 4YGAA 4ZJIA 4E5WA 5ANJA 2UW0A 4AN3A 3MYGA 3MB7A 3NNVA 4EKLA 3U55A 1LEZA 5ITAA 3TUDA 2PVMA 3IG7A 3IS5A 4NKSA 5AX9A 3LFNA 2QR7A 2VWIA 3R00A 4DEHA 3AMAA 3TTIA 1Q41A 4QRCA 4YSJA 2YM8A 3QX2A 3UDBA 5KBRA 1RQQA 2G2FA 2XS0A 3BYSA 4D5HA 4YUQA 5IPJA 5KKRB 2PTKA 4ENXA 3OUNB 1REKA 4U3YA 4IJPA 4L45A 2XIKA 3DBCA 1NVRA 3DAEA 3RK9A 3TJDA 4FT3A 5B2KA 4EHEA 3SGCA 3HZTA 2GS2A 3IW7A 2HW6A 1PJKA 1CM8A 3BU6A 4RVLA 5JT2A 3H30A 2WU7A 2X6EA 4FKJA 3UVPA 3WZEA 4JS8A 4F0IA 3VJOA 2IZRA 1YWVA 3ENHA 2XIXA 3EMGA 4NW6A 4FTTA 4CZYB 5C26A 4GU6A 4DFLA 4YJRA 2F2UA 5KHWA 5AP2A 4OTDA 3KXNA 4GT4A 2C30A 4BBEA 2PU8A 4BF2A 3UIXA 4KD1A 3ID6C 5AA8A 4WOVA 2OG8A 4NYEA 3JY0A 4D4VA 2UZVA 2VTRA 4X2KA 5GZ9A 4OTFA 4AGDA 4ENYA 3GB2A 2C5VA 3Q4CA 4F70A 1GIHA 3IK3A 2QOIA 1OI9A 2X39A 1W8CA 3PXYA 5IH6A 5FWKK 5LMBA 5GJGA 1NA7A 5D9HA 3KKVA 2X8IA 5HHWA 3TT0A 2O3PA 3O23A 3RAWA 4FR4A 4BCFA 4DFZE 4EOMA 3EZVA 3JVSA 5FDPA 4IZ5A 4BDJA 3COKA 3DLZA 3D7TA 4EOJA 4ZTMA 1NXKA 4FG8A 1XR1A 2VTQA 3NZ0A 1XH5A 4JL9A 4MHAA 3R7OA 2NPQA 3ELJA 4NIFA 4ZTLA 3WF6A 1ZWSA 2W5AA 3AD4A 3OWLA 3PIXA 4FTLA 4L7SA 3O17A 4GH2A 4JOAA 3DAKA 5CU6A 2JKOA 3OY3A 4AGUA 1NT2A 4ZMFA 4BTJA 4HCUA 2VN9A 1JKLA 5A4TA 3MY1A 4GYGA 5HE0A 4MQ2A 1XH8A 5DT4A 4BBMA 5ANOA 3A7FA 3OZ6A 3L1SA 5IKWA 3EN4A 2ZM3A 5C8KA 3RP9A 1ZYJA 2Y6OA 2J6MA 3MV5A 2CGVA 2QOOA 3EH9A 5AP7A 4UMPA 1ZXEA 4ZTHA 3VC4A 5CAUA 3TDWA 4DINA 4QP6A 5A14A 4R1YA 4J95A 5FXRA 5BMSA 4FZAB 1Q3WA 3MS9A 2O63A 4FEUA 5LWMA 4W9XA 5AA9A 4D2RA 5I3RA 4O7WA 1BUHA 2FSOX 5LARA 4YJNA 4APCA 4DGMA 3GC9A 4GJ3A 1GJOA 4DFNA 3K2LA 5TE0A 3KY2A 4BYIA 4E5BA 3BE9A 2XNPA 1JKSA 3GOPA 5DEWA 3QALE 3QRTA 3F9NA 4FICA 4LOOA 2QO2A 4ID7A 2AUHA 5DR9A 3R8UA 3IPHA 3RK7A 3RM7A 3ORXA 4L53A 3W2PA 3CD3A 4EH8A 3QZGA 3C4CA 3LFSA 4EQUA 2GTNA 2UZOA 3NAYA 5TF9A 4RFZA 4ASDA 4UN0C 4CV9A 2CKPA 2CNUA 2W99B 3R30A 4UALA 4QMZA 4Z7HA 2JLDA 4C61A 4FG9A 1W98A 4F64A 4MH7A 3QRKA 3UYSA 4BYJA 3FI2A 4RC2A 4C62A 3G9LX 5E8ZA 3OCGA 3TZ9A 2BRMA 3DFAA 3QQGA 5C27A 3Q9WA 3ZYAA 3DKFA 4IAIA 3TTJA 2Z60A 3PY0A 4FBXA 3W33A 1KE5A 3EYHA 2ONLA 1M2PA 3ZC5A 1PF8A 2J2IB 3VBVA 2A2AA 3VS0A 4R78A 5ACKA 2JIUA 4NM5A 4L8MA 3TNHA 5BUJA 3D5VA 4JLCA 4LFIA 4NCTC 3D2KA 1M2QA 2X4ZA 4H3BA 3MJ2A 2JFLA 4NM3A 1JQHA 3HX4A 4MXZA 5I3OA 4YJVA 4FV8A 4U5JA 2W1CA 2YHVA 2WNTA 2CSNA 4J99A 4BCQA 2XK8A 2C68A 3QHWA 3VS1A 4BIBA 3C5UA 2WMWA 2WQNA 2R3FA 2XVDA 4XOYA 5DA3A 3T9TA 3SRVB 3ZHPC 5AAEA 5HTBA 5JH6A 4O22A 2ITZA 2ZMCA 1REJA 3FQEA 3OTUA 4LMUA 4P90A 4C4IA 2IVTA 3C5IA 4BDDA 2X8EA 1VR2A 4O0XA 4EH6A 2YAAA 3MGYA 5IA4A 4KA3A 3EFWA 5JQ5A 2QC6A 2X2LA 4LOPA 4GK2A 4YTIA 3RAHA 3V5JA 3EWHA 5EOBA 4FYNA 2R2PA 4YZNA 3ACJA 2V7AA 1VYWA 2YFXA 2ITYA 3PPJA 3PXKA 3QFVA 3P86A 4U40A 4X6RA 2X9FA 3R7EA 3UZPA 3ZO1A 4K6ZA 5H3QA 3LQ3A 2G01A 3QL8A 4AW2A 4CFVA 4EH9A 2V55A 3MJ1A 3Q6WA 3K3JA 2XIYA 1DM2A 2BKKA 1OKZA 2AC5A 2CCHA 3UVRA 2ITXA 4O84A 3ACKA 4OLIA 4ZY5A 4NL0A 1PXLA 4BI2A 3FZTA 2YM7A 3U6HA 4I20A 2VO7A 3NYXA 3QXOA 1MQ4A 3F3TA 3TIYA 3NDMA 3ZM9A 3FLNC 2OJFE 5C8NA 4ACGA 1PYEA 2Y8OA 1OL1A 5CF4A 4OT6A 3SOAA 3TKIA 4XV1A 2R7IA 4KS8A 5A9UA 4WSYA 3KVXA 5TKDA 2W7XA 5DR6A 5AV3A 3D9VA 2PYWA 3MIAA 3FMHA 3QKMA 3UYTA 2JEDA 4XV2A 1FPUA 2XK6A 1MRUA 3I6UA 2ZM1A 2CHLA 2WTKC 3II5A 4FEXA 4FZDB 2C6KA 3KRRA 5BVEA 4NJDA 4A9SA 5M07A 4N6ZA 1RJBA 4FGBA 4RJ3A 3UJGA 4DC2A 4GMYA 4QPSA 4G9RA 2WMRA 4PP9A 2PMNX 1VJYA 3FI8A 1HCKA 4FT0A 3FQHA 3OEFX 4RIXA 5DMZA 5CASA 3TM0A 1XH4A 3POOA 3VS5A 2J0IA 5CNNA 4DITA 3QTWA 4XP0A 3DXQA 1YHSA 4BDIA 1RE8A 5CSPA 5AMNA 1IA9A 1NVQA 4FTJA 4DTKA 3GENA 4L3JA 3LXLA 4F09A 4YU2A 3KMWA 4ZTSA 3HNGA 3C0GA 3SXSA 3GP0A 2QD9A 4D2VA 4ZJJA 4AFEA 4Y8DA 1YW2A 3U87A 4DN5A 4DH8A 4EOLA 4I5PA 1QMZA 4TYGA 4AW1A 1PMVA 5HGIA 3BHHA 5HG5A 3CIKA 4QP7A 4LYNA 4TWCA 2FYSA 3BHTA 4YZDA 3DBFA 1WBPA 3QXPA 4X7QA 3C4FA 4Y73A 4AZSA 2ZV9A 3HRBA 4I94A 4JIKA 4JXFA 2RKUA 4GIIA 5AUXA 2LAVA 4F9BA 2PMLX 1OIQA 4R5SA 3R8PA 4HVDA 3DQXA 4ACMA 3FMDA 3PXRA 2PZIA 2BRBA 4FTQA 4M0YA 3N9XA 4FUXA 1XH6A 3COMA 3LXPA 3CGFA 4PUZA 3OWKA 3LCTA 4GG7A 4X2JA 3R8LA 3RHKA 2A0CX 3CP9A 2BIYA 4FNYA 3T9IA 1BYGA 3UOKA 3O51A 2HOGA 4AE6A 4OAUC 4HGTA 3VIDA 4U79A 3EB0A 3GI3A 3U6IA 1OECA 5BVWA 4S33A 2ITNA 3QZIA 4OTRA 4F9CA 1J3HA 3EN6A 5D12A 5HU9A 3TUBA 3TIZA 4I24A 1J1BA 4DGOA 5CXZA 4RPVA 5CX9A 5D10A 4FX3A 2CN5A 4ZIMA 1PMUA 2R3KA 3QTZA 1YWRA 3QYWA 3R1NA 4MBLA 3R9DA 3C50A 4AFJA 3LE6A 5L2SA 2Z2WA 4RJ8A 2B9FA 3G90X 3MH2A 5FEEA 2OH0E 1YRPA 2UW8A 2WQBA 3NUPA 2R5TA 4JDKA 4GS6A 2WMAA 4FKLA 3VF9A 3VUHA 4DEDA 4XEYA 4W8EA 2OZAA 2RIOA 2Z7RA 3ANQA 3DBEA 4O0TA 5AR4A 5GNKA 4BCGA 4DH7A 5M53A 2W9ZB 4TTHB 5C8MA 2X7FA 3W8QA 4WA9A 1ATPE 4NK9A 5GHVA 4EOIA 4F0GA 4OBQA 5EFQA 5BPYA 2B9IA 3GCSA 3MY0A 4AT5A 5ETCA 1MQBA 4X0MA 3UO5A 1U4DA 3V5PA 4YC8A 4GK3A 4O7LA 4H36A 3HV7A 4FTCA 3HLLA 3TI1A 5KX8A 5AR3A 4KKEA 3BHVA 3FDNA 1IG1A 4OR5A 3JYAA 5BVOA 3TDVA 4PPBA 2V62A 4O7YA 5M4IA 3W8LA 2IW9A 3U9CA 2BILB 2NP8A 4JJRA 5DYJA 2VTOA 4F6SA 4F1OA 4UWBA 3H9RA 2BTRA 2E2BA 3GNIB 3NGAA 3BKBA 2BFXA 3EHAA 3UPXA 4C4JA 3Q2JA 2Y9QA 1FBNA 1TQPA 3GQLA 1JLUE 4R1VA 2OW3A 3E92A 3UODA 4RWKA 2YITA 2XK7A 3LFEA 3MPMA 4ZS0A 2F4JA 3P79A 4RWJA 3MH0A 5DLSA 3GU7A 4ZSJA 4WBBB 3ZO3A 1HCLA 5HE2A 2B1PA 1ZLTA 4BI1A 5GZ8A 2QG5A 4A9TA 1OL7A 4RSSA 3UQGA 4WNKA 1R1WA 4FV0A 1IAHA 2P3GX 5DPVA 2PK9A 5DRBA 2ITWA 3KA0A 4H3PA 4Y83A 3VW8A 4F7SA 2GDOA 1ZMVA 2R3RA 4QMPA 2BZHB 4MEDA 5C03A 4GKIA 1OITA 4IZYA 4MKCA 3DDQA 3ZRMA 3GOKA 5CZHA 5ACBC 4CXAA 4RIXB 4FSUA 4MXCA 4WIHA 3MI9A 1KE9A 4G3EA 3HA8A 2ERZE 3QWKA 3FMEA 5M4UA 3VULA 5IF1A 5BUIA 3KCKA 3R1SA 5EI2A 5E9EA 4KBAA 3PFQA 3DKGA 4K1BA 5AUZA 2GHMA 4CMTA 4ZZMA 5LXMA 2YABA 1UNLA 1YKRA 3QZHA 5EDPA 3UOJA 3FL5A 4XNEA 4Y5HA 3ZU7A 3ROCA 3DU8A 2BMCA 4UZDA 2OXDA 4FZ7A 2J5FA 5I9UA 2B0QA 1OPKA 1J7UA 3BX5A 3AC1A 2WMSA 4B0GA 3PRIA 2XBAA 3NPCA 4IQ6A 5CNOA 5EHYA 4HCTA 4J97A 5FBNC 3L9NA 5BVNA 4YJPA 4OUCA 3DGKA 3VAPA 3KN5A 4B4LA 1WVYA 4JI9A 1JAMA 3BI6A 2BFYA 3DBDA 5J9LA 3C9WA 2X7OA 3CE3A 5AUUA 4WRSA 3OVVA 4J98A 2C5OA 3C4ZA 3LFAA 3BQRA 4AXAA 1U5QA 3KGAA 4Q2AA 4QP2A 5HOAA 5EKNA 5IA1A 1H27A 1YOMA 1Y57A 3ORKA 3QKKA 4FIIA 4D55A 2HCKA 4ZZNA 4ANOA 2BAQA 2HELA 4TYIA 5LVLA 3AG9A 2RFSA 2ZV8A 5CQWA 4YSMA 3VS7A 4X3FC 5DT3A 5M08A 2OH4A 3LCKA 3P9JA 4FKRA 4FZFB 5KO1A 3MVJA 5ANKA 4I1ZA 5CF6A 2XKEA 4DG3E 2Y7JA 4FIHA 1F5QA 3PY1A 1PXPA 4KBCA 2RG5A 2R64A 5DOSA 5IQAA 3VUTA 3QAME 4E5AX 2VWWA 1Q99A 1GZKA 2P4IA 2C0TA 2WQMA 4HPTE 2XP2A 4FL1A 4ZSLA 5FEQA 5HI2A 4UMRA 4ZLOA 5CEKA 4EWQA 4HVSA 3DNDA 4GT3A 5CAVA 1OZ1A 3BV2A 3NYVA 4NZWB 1JWHA 3R9RA 3FLYA 3NW6A 1KV2A 2XKDA 4BTMA 2HIWA 3CY3A 3V04A 4DEEA 5K3YA 3OXIA 4Q5HA 5JGDA 4DTBA 4FSRA 2VD5A 4CFXA 5CANA 5TR6A 4KSPA 4ARKA 2GQRA 3V5TA 1YDSE 5IDNA 4AQCA 5J87A 4DHFA 1IA8A 4WUAA 3ZS5A 3A8WA 4O7NA 5E90A 2AYPA 5BNJA 1E1XA 5E1SA 4BIEA 3Q5IA 4AS0A 2YA9A 4KIPA 3F5PA 4KUJA 2F7EE 1K9AA 2XNEA 3PUPA 1GZ8A 5CQUA 3UG2A 4Z55A 2BPMA 2VWVA 2XK4A 4AW5A 1XBAA 4EONA 1RDQE 2UZDA 2UZEA 3UP2A 4V0GA 3FXXA 1BMKA 5JK3A 3FJQE 4M69B 5HCYA 3SKCA 3NMUF 4P5ZA 2DUVA 3NIEA 4RX9A 3CQWA 4HVHA 3C0IA 3FI4A 3LFQA 4D4SA 2WGJA 3ZXTA 5AADA 5IH4A 1TQIA 3MN3A 4RG0A 4LGHA 2I0VA 3Q9ZA 5AAGA 4IAKA 3N51A 3VS4A 4YMJA 3D7ZA 4GK4A 4ASXA 5J1WA 1AGWA 5F94A 2B55A 1JSVA 4FSTA 3OT3A 3F7ZA 2ITOA 4IM2A 4U8ZA 2UVYA 4IE9A 4PMTA 1OL5A 3P08A 5HEZA 4C59A 5KMIA 3CKWA 3E62A 4TPTA 3FE3A 1H26A 3VS3A 4AT3A 4DH5A 4KIQA 5AUYA 3BE2A 4JX3A 2O0UA 3EN5A 2X7GA 1DS5A 2IPXA 5D7AA 2BDFA 4OW8A 4E26A 4B99A 4RQKA 2B4SB 1W7HA 2XCHA 4PNIA 4QT1A 4F6UA 5DHJA 2PHKA 3L8PA 4BKYA 2E9PA 4O1OA 3VBYA 1MRYA 4QMTA 1JKKA 3WZDA 2WTJA 3LFBA 5IQGA 3ET7A 5AP0A 1JPAA 2J7TA 2ZMDA 1FINA 3NIZA 1FMOE 3RAIA 4AZEA 3N4TA 2WTKB 3PVGA 1XBCA 4ZLZA 2C5XA 2OZOA 2R7BA 5EI8A 3P0MA 4WRGA 4XOZA 3ZZEA 1XH7A 4R3PA 5L2QA 3UTOA 3KRXA 4E6DA 4CSVA 5FTGA 4P7EA 1BL7A 4RIYB 5IQEA 2WTDA 3RPVA 4F9WA 4LV8A 2GNIA 3EYGA 3QRJA 3ZLWA 3MVHA 4K18A 3PP1A 4M67A 4ONAA 4ERKA 4PTCA 4ANSA 3SG8A 4RLLA 3ORLA 1F3MC 5CU3A 1YHVA 5HX8A 4OTPA 4O91A 4J53A 4XG8A 1UV5A 5LVPA 3TV6A 3PWDA 4JG8A 2P2HA 3DS6A 4IAZA 2UW9A 1U54A 4E4NA 2WMVA 3ZLSA 3BU5A 5FP5A 3KULA 4XG7A 2W5HA 5HNGA 2JDOA 2QLUA 4M12A 4F6WA 4FTNA 5JRQA 3PJCA 1H1RA 3PIYA 4FTKA 4G34A 4DFYA 4ZY6A 1H00A 3G2FA 2I7QA 3O71A 2XIRA 3AC8A 3QF9A 2OJ9A 3AC4A 2W5BA 2XYUA 3PSDA 2JDSA 3VBWA 3G9NA 4FOCA 1SYKA 4CFNA 3UIBA 2RL5A 3LW0A 4XCUA 3FMJA 5FM2A 4U9AA 3ZFXA 2BROA 4IVDA 2GTMA 3Q9XA 2LGCA 3OD6X 4U97A 4BHNA 2NNWB 1B38A 3EL8A 4QMWA 3KL8A 1Q8UA 2B9JA 3OWPA 4XG3A 2OIDA 4BGHA 4FKSA 4HVGA 1FVRA 1YWNA 3FY2A 3OUKA 3PA4A 3SG9A 4XV9A 2OGVA 4C8BA 2R3NA 2C6LA 1DAWA 4MAOA 4MCVA 2QO9A 5FBOA 4RC4A 3RMFA 2ITVA 3QQJA 4QQCA 4YHJA 5FXQA 2O2UA 4C38A 4HOKA 4WSQA 5CEPA 4YJOA 1DI8A 1R0EA 2G9XA 4I0TA 2BDJA 2A19B 5HVKA 3EQRA 4GG5A 5AP6A 4IZAA 5J7HA 3T8OA 5FDXA 1YVJA 4ZK5A 5J9YA 3EOCA 3HDMA 3S95A 3K5VA 2VWZA 2BHHA 3KMMA 3LFFA 3H4JA 4AOIA 2OFVA 3MFRA 4CD0A 4IDVA 4QMMA 3DLSA 3R7VA 4BWKA 1Y8GA 1ZOEA 1UWHA 3I4BA 5CYIA 3ZEPA 3C13A 3A8XA 4ANMA 1SVHA 4IWPA 2QOLA 2WTVA 4EEVA 1CKPA 2HXQA 4V0GB 3VBQA 4G6LA 4RIWA 2W1IA 3TV7A 4QTCA 4K0YA 4QMSA 2R4BA 3Q6UA 4WNPA 1J91A 1K3AA 2VGOA 4V04A 4R5YA 5HD7A 4QYHA 4EBWA 4EHVA 2C3JA 5AUTA 5BX0A 3DBQA 2EWAA 3FPMA 2W1HA 3OF0A 2WMBA 3D0EA 3HV4A 3QQLA 4FODA 4FEQA 2UW6A 4CZUA 2PVFA 1ZAOA 3R2YA 1H1SA 4K2RA 2WB8A 4XLVA 4NKAA 3D5XA 2PZ5A 3JS2A 1WZYA 3ORZA 3U8WA 2W06A 3NAXA 4CRSA 3H0YA 1H01A 3S4QA 1QPCA 1DAYA 1VEBA 5B7VA 3E8DA 1KE8A 3MB6A 2WMQA 2C3IB 4W9WA 5T3QA 4MNEA 5I9WA 1OL6A 3R01A 1CKIA 4O21A 3B2TA 5BYLA 3KXHA 4F0FA 5HBJA 5I9YA 3P23A 3ROYA 3VVHA 3ZO2A 2W1EA 3ZCLA 4G17A 3R02A 3AC3A 2IW8A 3JR1A 5KZIA 5FP6A 2EXCX 2G1TA 4PMSA 3ZZWA 2X4FA 4C0TA 4EC8A 2J0KA 2OICA 2ZJWA 4X21A 4QPMA 2Y4PA 3UVQA 3VS6A 3AQVA 3P7CA 4F7NA 4I0RA 3I1AA 4BI0A 2WPAA 3F66A 4DYMA 4WNOA 3QD0A 1R78A 2I1MA 4QYGA 4J52A 4XRJA 2WTIA 4QD6A 2PE1A 3C0HA 4CKRA 3L8SA 2OBJA 2BAKA 3KXZA 5EK7A 4ZZOA 4MF0A 4ZSAA 4S30A 3M2WA 4BL1A 3SXFA 4G6OA 4FVQA 4FK3A 5IQCA 5ANDA 2W4OA 2YCQA 4QQ5A 2DS1A 2Q0BA 4U45A 2XNGA 3W2OA 3A60A 3DB8A 4M3QA 3DXPA 3CTQA 4C7TA 3WILA 3SOCA 2XJ0A 3ITZA 1OPJA 5HLPA 5L6PA 4H3QA 2YISA 2YLFA 4U81A 5HG8A 3UOLA 5A6OA 4RBLA 4R8QA 4OAVB 2FSTX 1Y6BA 4J8MA 3BGPA 2X8DA 4QP8A 3Q4UA 4FT5A 5DWRA 4KB8A 3BYVA 5AUWA 2QOHA 5DI1A 3DAJA 3V51A 1PMNA 3FZ1A 4U43A 3TNPC 1F0QA 3FSKA 2WFYA 3QTSA 3FZSA 4FSZA 2NO3A 1IASA 3KQ7A 5JFVA 3PPZA 3H10A 5J1VA 5HTCA 2CLQA 2PSQA 4FT9A 1OM1A 2YDJA 1UNGA 5JKGA 1YI6A 5KE0A 1ERKA 3KRLA 4JQ8A 5M44A 4YJUA 2VTMA 4MD7E 4DFUA 2XK9A 2OF4A 1P5EA 1Q61A 3D14A 2BRGA 3E3PA 4CYJA 4NCTA 5CSHA 5HTIA 5ANGA 3BLHA 5A46A 4FT7A 2X2KA 5K0KA 5HLNA 2R9SA 2XEYA 3QCYA 3R22A 4QQJA 2YIXA 2YLEA 3C4EA 3FYKX 3ZUTA 3UQFA 1JOWB 2YZAA 4YURA 3BYUA 5DVRA 3W32A 4UMUA 4A4XA 4I6FA 3M11A 2VV9A 4L7FA 3FLSA 4YO6A 3FXZA 3SRVA 4EH5A 4QMNA 1GY3A 4AN9A 4O7SA 2A1AB 4JR7A 2H6DA 3MFSA 4BKZA 5AV1A 3NLBA 4OTGA 3CPCA 4A4OA 3MVMA 4WG4A 4PX6A 4EJNA 2XCKA 2IO6A 2ZB0A 3LKMA 4XG6A 1R0PA 3SW7A 3OROA 3ZDIA 4Y72A 4LRKA 3UIUA 4CEGA 4CKIA 2JBPA 3P7AA 4G3FA 4BCKA 4RX5A 4F63A 5JZJA 4GW8A 2GNFA 3DXNA 4CKJA 5BUEA 1QPDA 3GGFA 1LUFA 2YDKA 3NYOA 5EM7A 4O6LA 4ZAUA 2J4ZA 2VRXA 3F6XA 3ZC6A 5LOHA 4GCJA 5AJQA 2R3JA 5CSXA 4IBMA 4XUFA 5G6VA 4PY1A 2E9NA 3FMNA 5AIRA 1FOTA 3R9HA 4C33A 1R39A 5IMEA 2R3PA 4FKIA 4H05A 2VTTA 3I5ZA 4CCBA 1YDRE 3WE8A 1W82A 5HU3A 4C35A 4LM5A 3K54A 4NTSA 5E8TA 4IDTA 4UBAA 2YIRA 3NNUA 2C6IA 4BDGA 1STCE 4D9TA 3TJCA 4EUTA 1OMWA 3GXLA 4X3JA 5HESA 2IZUA 4KIOA 2PZPA 3DK3A 4AW0A 2YWPA 3CLYA 3KC3A 4EK3A 1U59A 4EQCA 2ITQA 5JFXA 4RZVA 5ANEA 3G33A 4C36A 2CGXA 4H39A 2P2IA 4MNEB 5DIAA 3SX9A 3LFCA 3CSVA 1O6KA 2YAKA 1O6LA 4EI4A 2XZSA 4IVCA 1B6CB 4FKOA 5KMOA 2J5EA 3KXGA 3THBA 4L6QA 5CAQA 4QYYA 4X6QC 2GS7A 2QCSA 2CN8A 2V7OA 4S31A 3RPSA 2I40A 2X81A 1H8FA 1XO2B 4IX3A 5DE2A 3BEAA 4FTMA 4CG9A 3R1YA 5CSVA 3R8MA 4MXYA 2VU3A 4UX9A 5FD2A 3DQWA 5AWMA 2PMOX 3CXWA 2VX1A 4ACHA 3RKBA 3QHRA 5IUGA 2B53A 1JNKA 4U80A 4UEUA 1WMKA 2AC3A 1SM2A 3D5UA 3UE4A 2BALA 3O8PA 4UWCA 3RCDA 4EUUA 4FV3A 3Q96A 1M7QA 1J1CA 4FSNA 3PWYA 4TN6A 2XUUA 4ZTRA 1FMKA 3IW6A 5I0BA 5AX3A 2RFDA 3A2CA 3LXKA 3FY0A 4G9CA 5AM6A 3FWQA 3DZQA 5CF8A 5LVNA 2A27A 4ZOGA 3BHYA 1Q3DA 5DG5A 5CAOA 4E3CA 4PV0A 5LQFA 1B39A 2ZDUA 3IDPA 4D1SA 3PYYA 4O81A 4KWPA 5KMJA 4MVFA 3RBWA 4IFGA 4YTFA 3R04A 5J79A 3VUDA 1M2RA 1BI8A 1YXUA 3AT3A 4HYUA 4FEVA 3LPBA 3WI6A 3QGYA 5KZ0A 1Q62A 2YM5A 2HYYA 2QOKA 4YTCA 4XP3A 3L8VA 4IW0A 5C4LA 2R3QA 3ZSIA 3HGKA 4EK6A 4W4XA 3I0OA 3FKOA 3MFTA 5D1JA 2PMIA 3KRJA 4IZ7A 3QC4A 4DCEA 4LUDA 2C6DA 2C6OA 2J0LA 3PIZA 3Q52A 4N6YA 3RPOA 3MESA 1YHWA 4D2PA 2YDIA 4DEBA 2DYLA 4BVUA 4L3LA 3IQ7A 4PWNA 2OFUA 4GIHA 4L9IA 4PDOA 5LVMA 2JIIA 4E93A 3BV3A 5J5TA 5AP1A 5LWNA 1WBVA 1W84A 4GT5A 4DCAA 4O7VA 4G5JA 4IMYA 3FYJX 2HENA 3VQUA 5KMNA 3LQ5A 5AP5A 4YLLA 5CT0A 3KMUA 2WQEA 4J1RA 1SMHA 3FZOA 4PF4A 4E8AA 2Q0NA 3QCSA 2UW5A 2J0JA 2WMUA 4O2ZA 4H1MA 4D0XA 4UMQA 5M06A 5E8YA 1QPJA 3MPTA 4M14A 2RF9A 3OW4A 3OOMA 1Q8ZA 5FM3A 4CFWA 4FEWA 3F69A 2X6DA 3MBLA 4I92A 2WIHA 4M8TA 3MH3A 3ORPA 4HYHA 4PL5A 1SZMA 2C1AA 3R71A 2XRWA 4D4YA 4FF8A 4FL2A 4CTBA 2WTWA 2B54A 1HOWA 5GINE 1Q24A 3OTVA 4DGGA 2JDRA 3Q4ZA 5G1XA 2PVJA 2UZLA 5EG3A 5DR2A 3A7HA 3SC1A 4FV4A 1BKXA 3I6WA 4EHZA 2XYNA 4BFMA 4BDEA 2OIBA 3DB6A 3FBVA 5TT7A 3VRYA 1OVEA 5ETFA 4HVIA 5IMXA 4PTGA 5A4EA 1W83A 4JIAA 3LIJA 4TW9A 1VZOA 1M7NA 1H0VA 3U4WA 4C4GA 3D7TB 1NVSA 3QQKA 4E20A 3VWAA 3U54A 5EW9A 5I9XA 4D2SA 2W0JA 4IC7A 5AIKA 4RWLA 4N70A 4MQ1A 3W2RA 3L9MA 3OBGA 5DBXA 3NR9A 4OTWA 3Q9YA 5IQHA 5HNBA 3O7LB 3CS9A 4I22A 4L3PA 4YPDA 3RGFA 4RFYA 4FA2A 3LLAA 2PE0A 3NW5A 2PUUA 4QTDA 5AAFA 3OFMA 3BYMA 3QKLA 3FMLA 3RHXA 5AP4A 4J96A 3R21A 2Y4IB 4CRLA 3LCOA 2B7AA 3RVGA 4NSTA 2PVRA 3F3VA 2JKQA 3VUKA 3WZKA 3SD0A 3PP0A 4BCHA 4L67A 2QHNA 4M97A 4WO5A 1LPUA 4RQVA 2GNHA 4QYEA 2O64A 3EQCA 3PSCA 4YJSA 5HX6A 4F9YA 4RWIA 4F7JA 5M09A 2XBJA 5EYDA 4YJTA 4BDKA 2Y4IC 4QMXA 3PZEA 4ZMEA
chains in the Genus database with same CATH superfamily
2C6EA 4TWNA 4IH8A 5FTOA 3BRBA 4C2WA 2FSMX 1R3CA 3OWJA 3NUSA 1JSTA 4D1XA 3ZM4A 3C7QA 5ICPA 3F2RA 3H0ZA 5H9BA 1YQJA 4EH4A 4FNXA 2W17A 2W4JA 3POZA 3BWJA 3NCGA 3QZFA 5FLFA 4YBKA 3ORMA 2BCJA 2E9VA 3HMMA 2XM9A 4AGCA 3WARA 3MTFA 4FE2A 3W16A 4D1ZA 4M0ZA 3PG1A 5D7VA 5J95A 2JC6A 5B2MA 2J90A 2IVUA 4F78A 3AMBA 4GSBA 1XBBA 2QG7A 4F1TA 4O7ZA 3ZTXA 5BVFA 5L2IA 2EB3A 4FTOA 5DEYA 3S2PA 4Z3VA 5I9VA 4YJQA 4LDTA 3AOXA 3QX4A 2OXXA 4IACA 2QQ7A 3NUYA 5CEMA 4LQMA 4TYJA 3O96A 2IF8A 2J0MB 5L8KA 4I4FA 1Y6AA 3MPAA 2ITTA 4I23A 4W4WA 3RWQA 2W96B 4M84A 1QPEA 1UWJA 4GRBA 3KB7A 4O6EA 5HNIX 3WIGA 3KREA 5BVKA 4EH3A 1CDKA 4KIKA 3V8WA 2PZYA 4G5PA 3V3VA 4RJ7A 5E8UA 2W9FB 3FSFA 3O50A 2BUJA 5FQDC 4RLKA 4ALUA 1H1QA 4X3FB 4UV0A 1OBGA 3LOKA 3U6JA 4I5MA 4XG9A 3D4QA 2VWBA 4O4BB 4XH6A 4UYAA 4FSMA 3SHEA 4U7ZA 3UDTA 4ZY4A 5L8LA 4IWQA 3AD6A 4IAFA 4BDCA 2WEVA 2HZ4A 3H3CA 3I7BA 3GBZA 3Q3BA 4O0VA 2YCRA 4U44A 3EN7A 1A06A 3IKAA 1QL6A 2VWYA 3ANRA 3NS9A 5CEOA 4PPCA 4KRCA 4M69A 5KKRC 4FV7A 3R7YA 3OG7A 3GC0A 3HDNA 1GIIA 3CPBA 3HP2A 5HBEA 5TOZA 5E4HA 2VO3A 2YWVA 2O65A 3CQUA 1MRVA 4ZEGA 1Z9XA 3FQSA 5IA5A 1VYZA 2QURA 2PVYA 2VTHA 4YNEA 4K33A 3TUCA 5HVYA 4M7IA 5JMSA 2PY3A 3OOGA 5HORA 2UW4A 3RALA 1URWA 2HAKA 4LV5A 4XBRA 1H28A 4FZ6A 3CTJA 4J71A 4NU1A 4CT1A 3UGCA 2ZVAA 4QMYA 1BX6A 4UYNA 3PXFA 3UMXA 4C3RA 4BCMA 5M51A 4E4LA 3E64A 2GQGA 3IDCA 1OUYA 3QQHA 3VW6A 4DFBA 4S32A 1ST0A 2HW7A 2P33A 3ZBFA 2BHEA 4HGSA 4OT5A 4A07A 5IA0A 2F7XE 4EOOA 4ANLA 3F82A 4TYHB 4MD8E 4FTRA 4CLJA 3QTQA 3E7OA 1P4FA 2H34A 3OP5A 2ETKA 4A4LA 4ZTQA 2FGIA 2Z8CA 3LJ0A 2PPQA 1ZZLA 2F49A 2ETRA 5H8BA 4AA4A 4AN2A 2GNJA 4ZSEA 3VF8A 4C02A 4QEBA 1XJDA 2IG7A 2OIQA 2YM3A 4I6HA 4IWOA 2QOQA 1L8TA 2WEIA 1E9HA 3Q5ZA 1Q4LA 2I6LA 3CQEA 4IANA 3QTXA 2EB2A 3W10A 4IVBA 5E8SA 1CMKE 5DNRA 1OKYA 5CXHA 4O0YA 2QOFA 4LRMA 5C4KA 3PTGA 3COIA 3KVWA 5EQEA 4RC3A 5DGZA 3LCDA 4DHZA 2JKKA 4JDIA 4W4YA 3O8UA 3AC2A 2JFMA 4L68A 5HVJA 3LJ1A 2VUWA 3ZEWA 1IRKA 3ZH8A 2IJMA 3UO4A 4IX6A 4PNKA 4AXCA 1YI3A 5CLPA 3ODYX 4FC0A 3LHJA 3R9NA 3F61A 2UUEA 3EFKA 3TEIA 2P0CA 4EWHA 2E9UA 4IB0A 2CKQA 1ZY5A 2BIKB 3P4KA 5IDPA 4DF3A 4YHFA 4E6QA 4U0IA 1URCA 2FB8A 3OBJA 4YC6A 4Y85A 2R3GA 5GJFA 1GAGA 2X9EA 3ATSA 3VRZA 4Z7GA 2GFSA 3BELA 2BZKB 2C3KA 2JITA 3Q53A 2UZUE 3QBNA 5JFWA 4MWIA 1S9IA 2VO6A 4XG4A 1YXTA 1H0WA 2YACA 3NSZA 4Z9LA 5EOLA 3PDTA 4CVAA 1GOLA 2QHMA 1UKIA 4RA5A 4B8MA 3HYHA 5T68A 2R0IA 4BN1A 3G15A 1UA2A 2YIQA 3FKNA 4IJ9A 5AR8A 3R1QA 2Z02A 2IWIA 3RCJA 3BGZA 3DDPA 2SRCA 3D2IA 4G31A 2FA2A 3G6GA 5E91A 1PXIA 3E8CA 5EM5A 5DRDA 2J50A 2W1DA 4C3FA 4XP2A 4QNYA 2PZRA 4RRVA 1XH9A 4O0RA 4PDYA 3KFAA 4X3FA 2ZOQA 4DG0E 3O2MA 5EH0A 2VWXA 2C4GA 2CLXA 3E8NA 4FIGA 5AV2A 4IXPA 2ZAZA 5C9CA 5BVDA 2ERKA 4AAYA 4JG6A 2WKMA 4BHZA 1Z57A 2YEXA 3W0MA 1ZYDA 3F5GA 4FYOA 3F2NA 3R83A 1WVWA 5IZFA 4IAYA 4MD9E 3IGGA 5C01A 5CS6A 4PMMA 2YJRA 5BMMA 4Y5QA 2CJMA 3IO7A 4DBXA 3Q4TA 3TG1A 1ZMUA 4IX4A 3BLRA 4WT6A 3PJ8A 2XJ2A 3RTPA 1PXOA 3Q2MA 4BRXA 3FEGA 4DT8A 3CR0A 5E7RA 1YOLA 3HRCA 3ORNA 4WNMA 5AP3A 4RIWB 3A62A 3SA0A 3QGWA 4HPUE 3LXNA 1OIRA 3V5LA 2P55A 3F3UA 3VHKA 2C6TA 4YHTA 3FLZA 4XG2A 2QODA 5C1QB 2CKEA 2VTPA 3CCNA 4CQGA 3E87A 2ZV7A 4QMOA 2H9VA 2WXVA 2ONLC 4UZHA 5HICA 4AZFA 4BCIA 3CBLA 3D15A 4B6LA 4D28A 2A4LA 3OS3A 2QI8A 5AEPA 4LMNA 1LR4A 1V0PA 5AR5A 2C1BA 3MWUA 3TZ8A 2X0GA 4IEBA 2WMTA 1J7LA 3NVKI 5HCZA 4USFA 4NUSA 1BL6A 4DLJA 3UG1A 3F5UA 3H9FA 4MBIA 4NFNA 5AV0A 4EKKA 1AD5A 1FGIA 4LGDA 1ND4A 1WBWA 3ZOSA 4DEGA 3QC9A 4IWDA 3MA6A 3TZMA 4OBOA 5EDRA 2PULA 5EQYA 1OKWA 1P4OA 4S34A 3NCZA 4U41A 3I81A 4GVJA 3BPRA 4TYHA 2EXEA 3T3VA 3ZRLA 4U6RA 4AOTA 3KK9A 4N57A 1JSUA 4CT2A 3WF8A 5EYKA 4U42A 4PRJA 4AX8A 3E7VA 1G5SA 4EOKA 4IIRA 3BBWA 4WG5A 4QMUA 5GJDA 3ALNA 4BCJA 3GQIA 3SLSA 3W1FA 4ALWA 3KXMA 4JQEA 5LMAA 4QMQA 4QO9A 4DA5A 1LEWA 3IOPA 3DJ7A 4C34A 3AGMA 4GV1A 5HBHA 3UIMA 2O5KA 3MDYA 3LJ2A 4U3ZA 2REIA 2XKFA 5HE3A 4DLIA 1OGUA 1ZARA 4HZSA 4Q5EA 4X2GA 4APPA 2JIVA 4FKQA 2XH5A 4IAAA 3PPKA 2GQSA 4XX9A 1PRYA 1KE6A 1I44A 3EQBA 5E8XA 5LMKA 4R3RA 4M15A 1TVOA 4DT9A 5FUTA 2QKRA 4HYIA 2VTNA 3LCSA 3NUXA 1YXXA 3OEZA 2AEGA 2BVAA 3V8TA 4HYSA 2W4KA 5FXSA 3DTWA 4G3DA 4TNDA 3LAUA 5K5NA 3WYYA 2JD5A 4YC3A 2X0OA 3ZO4A 3CTHA 4C2VA 3RPYA 1OBDA 4C57A 4EZ5A 4I21A 1E1VA 4IB3A 2NRYA 3ZSHA 3UPZA 4O4EA 3JY9A 4A9RA 3LM0A 4LRJA 4Y46A 5AV4A 2QNJA 2EU9A 3ALOA 3R63A 2YJSA 4YZMA 1APME 1X8BA 3S3IA 5F4NA 5BQ0A 4CMUA 5HO7A 4JG7A 1WBTA 4ANQA 3UOHA 5DT0A 5LVOA 1T45A 2GHLA 4LG4A 3ZDUA 4EYJA 5HO6A 2EXMA 4GYIA 5LJJA 2B9HA 1G8JA 2PUPA 4QTAA 3LM5A 2VZ6A 4KSQA 4YPSA 2XRUA 3GVUA 3NNXA 3FHIA 4JBPA 5DN3A 2CNVA 2X0QA 4DTAA 4CCUA 5EHLA 1KSWA 1WVXA 2JDVA 5A6NA 2PVKA 4K11A 3DKOA 3S0OA 4DHJA 4NT4A 3FZRA 1WBOA 3ZFMA 5HKMA 2PVNA 4DE4A 4A9UA 3OCSA 2F9GA 2BTSA 2OU7A 3M42A 4C4HA 2CMWA 5JGBA 3BCEA 4GUEA 1KV1A 3W2CA 4MXXA 3K5UA 3D83A 2XANA 1OIUA 2GNLA 3R6XA 3I5NA 3VBTA 3BLAA 4NJ3A 2WMXA 3OMVA 4FV9A 4PPAA 3HMIA 5E8WA 4E1ZA 2FSLX 1U5RA 5CWZA 5M4FA 1H07A 4NM7A 4RFMA 3SW4A 4UB7A 2OZAB 4G2FA 1MP8A 3DK7A 4WBOA 1A48A 1KUTA 4TWOA 3PLAE 3DCVA 2C0IA 4JRNA 2ETMA 3RZBA 3SDJA 1UNHA 5L6OA 3EKKA 3QUPA 4FTAA 3QTIA 1PW2A 2GU8A 1G3NA 3VO3A 3CY2A 1FVTA 3HUBA 3CGOA 3QD4A 4I0SA 4ACCA 1Y91A 2PE2A 3UQCA 2OKRA 5K0XA 4ZJVA 3UP7A 1L3RE 4G3GA 3DTCA 3VNTA 3ZONA 4W4VA 4KKHA 2CDZA 4G3CA 1H1WA 4I6QA 3R8VA 5IUIA 3MA3A 2BDWA 5HIEA 1UVRA 3RJCA 2W1ZA 1WBNA 2PVLA 3BQCA 3WZUA 5IU2A 4QTEA 2R0UA 2VTSA 3QTUA 4FOBA 4RJ4A 2YCSA 3F3WA 3FV8A 3BL9A 3QD2B 3RNIA 4IB5A 3BGQA 4Q9SA 5EM8A 1FVVA 3RM6A 3PRFA 4L00A 4PL3A 1G8AA 4GUBA 5HD4A 3A7IA 3QA8A 4AAAA 1I09A 3HAVA 4RVKA 1UU7A 1PXJA 2JAMA 3W2SA 2QLQA 3VUMA 3CEKA 4TXCA 2UZNA 3FKLA 3RINA 5CENA 4EH7A 2WZJA 2I0EA 4M66A 2RSVA 3AXWA 4AU8A 4QP9A 1Q5KA 1J7IA 3I0QA 5A4LA 2ITUA 4OGRA 4EOPA 4FVRA 2W1GA 3AKJA 2IZTA 4EK5A 4JVGA 2VAGA 3FLWA 3PJ2A 4HNFA 4N0SA 4O2PA 4X2NA 4W8DA 3OCBA 4V05A 2XNNA 5KMKA 2JBOA 4NIFB 4TRLA 1UKHA 4ASEA 3KK8A 4CTCA 3CD8A 3G0EA 3MH1A 4O86A 5M4CA 4FK6A 4AXDA 2VNWA 4FTUA 2UV2A 4R7HA 5CF5A 4YLKA 5J7BA 3WF7A 3REPA 3DOGA 4QYFA 5JFSA 4ZS4A 2UZBA 4AUAA 4C4FA 3FUPA 1XKKA 1PMEA 4YLJA 4F7LA 2H8HA 4MXAA 4GFOA 5A4CA 1UU8A 3I7CA 1OB3A 4G6NA 3U4UA 4IADA 5I5ZA 1OPLA 1Q8YA 4FIJA 2C5YA 3BZ3A 3F5XA 3IGOA 4R7BA 3C4XA 4YZ9A 3F3ZA 2EUFB 3KU2A 3LVPA 2VTIA 5KMLA 4AA0A 4Z16A 5HLWA 1H25A 4FKVA 1H08A 4TWPA 4EBVA 5CEIA 1OL2A 4YBJA 4XS2A 5H2UA 5H8EA 4BR3A 4TYEA 3IW4A 2PWLA 5FTQA 4FRFA 3KRWA 1U54B 4DG2E 2JAVA 3NX8A 3ATTA 2GPHA 5JEBA 5T6KA 3C51A 3B8RA 5L4QA 4TKSA 4QOXA 4HGEA 3EZRA 1W0XC 3QQUA 4P2KA 4IFCA 4LI5A 1M52A 2VX0A 3E63A 3NW7A 3Q32A 4KNBA 3WBLA 4QQTA 4EOQA 3KEXA 2JGZA 2C69A 4JAJA 3CC6A 3TXOA 4A06A 2OJJA 4XV3A 4CLIA 4ITJA 3PJ1A 4AE9A 4XYFA 3MFUA 5E8VA 3NYNA 2XNOA 1CSNA 3S00A 4K9YA 4BCPA 2YCFA 3TV4A 2IVSA 4TY1A 3Q60A 3QYZA 3G6HA 2RFNA 2KTYA 4LGGA 5K5XA 2WU6A 1FQ1B 3EKNA 4O27B 4ITHA 5HE1A 3VBXA 4QMVA 4CZTA 3B2WA 5HZNA 3ZSGA 5GZAA 2V0DA 3OY1A 3PVUA 4I3ZA 3WZJA 5HG7A 2UVXA 4PL4A 3TNIA 3QQFA 4NM0A 3B8QA 3GC7A 3BU3A 2KULA 5LCKA 4EZ3A 1KE7A 2OI4X 3OXZA 3PXQA 3W18A 5F20A 3P1AA 1ZOHA 2CCIA 3QLGA 3TN8A 4CFUA 4EK8A 2YIYA 4E4MA 3FXWA 3CJFA 1M14A 4L42A 4O7TA 4I6BA 4MK0A 4P5QA 4O82A 3OC1A 4GFGA 3DY7A 4RX8A 2FH9A 2UW7A 1CTPE 1SVGA 2WTCA 1M17A 4FNZA 5A3XA 1MUOA 2BKZA 3HP5A 2CGWA 3PA5A 3I79A 3QU0A 3UZTA 3EQIA 1SNUA 3L9LA 1UU9A 3C4WA 3BIZA 4JBVA 4QP4A 1JKTA 1K2PA 3DJ5A 4LL0A 4UXLA 4OBPA 2HZNA 4JR3A 3SQQA 2GFCA 3D5WA 5CI6A 4ANBA 4JAIA 3IECA 3QLFA 4JDHA 3V5WA 3R9OA 4RT7A 4HCVA 4FIFA 5HIDA 1OUKA 4AOJA 2HY81 3QRUA 3QTRA 4QP3A 4FKGA 4O0UA 4EC9A 5GIPE 2XM8A 3R7UA 4D58A 5BYZA 4WKQA 5L2TA 5JZNA 4D9UA 3IOKA 3ULZA 3TCPA 3ODZX 4Q9ZA 5EM6A 2YIWA 2FVDA 4CQEA 1YXVA 4EZ7A 1ZZ2A 3U9NA 5CI7A 3E3BX 3IW8A 4MX9A 4JQ7A 2F7ZE 4EQMA 1KWPA 4I5HA 3W0SA 1NY3A 1P14A 3FL4A 3KN6A 4FSWA 5HIBA 4BCNA 1FGKA 1CKJA 1U46A 4H1JA 4IHPA 2H96A 3EQFA 3O7LD 3A4PA 2XMYA 4QNAA 3ZXZA 2R3IA 4AGWA 5CVGA 4AZVA 2C3LA 4F99A 3JXWA 4RA4A 4MF1A 3R73A 3TNQB 4XLIA 5F9EA 3TYKA 5AUVA 2IZSA 4FSQA 3FZPA 2XA4A 4EK4A 4N4SA 5J5SA 3QD3A 4G1WA 4UMTA 3R2BA 5KCVA 5EYCA 4EORA 4WHZA 4PTEA 3DA6A 4K77A 3VUGA 4R7IA 5JN2A 4YP8A 5D11A 4J8NA 5IEYA 2F2CB 1V0OA 1TQMA 4EYMA 4WUNA 2XAMA 5A4QA 2VTLA 1W2FA 4FKTA 4O7RA 4BDHA 2WOTA 4C58A 4AZWA 2QOBA 3BL7A 3ORTA 4K8AA 4L46A 5FEDA 4IX5A 1O9UA 4P4CA 4BWPA 5AM7A 1PKGA 3A4OX 4GKHA 4JBQA 2WELA 1SNXA 3R28A 4BY9E 4MTAA 5IEXA 2GMXA 4AP7A 3VN9A 4FV1A 5IH5A 2DQ7X 3HECA 4FV2A 4NEUA 4E7WA 3BEGA 3GU6A 3IW5A 4HGLA 3GU5A 4JDJA 4FVPA 4KINA 4OTQA 4L43A 5EDQA 4BWXA 1KOAA 3ETAA 4L01A 4XMOA 2CGUA 5EHOA 1WCCA 4NWMA 3CJGA 1TKIA 3DT1A 1GNGA 4MBJA 4WD5A 2A98A 5CALA 4C37A 2WHBA 2ACXA 2XK3A 3LQ8A 3WYXA 1Q8TA 5LMKC 1YDTE 2UZWE 3VONA 2I0HA 4L52A 5F95A 3TWJA 4IVAA 1ZYSA 3HV5A 2NRUA 4M68A 4D2TA 4KKGA 3RK5A 4NH1A 3PE2A 3LMHA 4B8LA 3G51A 3V8SA 2B52A 1ZRZA 2OO8X 3RWPA 3ZLYA 1O6YA 3HUCA 2G2HA 1OIYA 3VUIA 2XF0A 3HVCA 3KULB 3PE1A 3UNZA 3PA3A 3QA0A 4J7BA 5CT7A 2X1NA 4FNWA 5AFVA 5EQPA 3RI1A 4S2ZA 4O1PA 1GZOA 3ZUUA 2J51A 3F7WA 3TL8A 2IW6A 4BJJB 4ZSGA 3HMPA 2GCDA 3FPQA 1NW1A 2GS6A 2VWUA 4EH2A 3DPKA 2HWOA 2BZJA 4AZTA 5CVFA 4R77A 4KIKB 3GCUA 1OGYA 4KS7A 3QRIA 5IQIA 2ITPA 4FSYA 4HNIA 4GU9A 2VNYA 4ACDA 3HKOA 4RMZA 4FGRA 3A99A 3EQGA 2I0YA 2X2MA 4FL3A 3FAAA 2BAJA 2IN6A 2QONA 4OTHA 4QPAA 4AACA 5I4NA 4UWYA 3LMIA 3DV3A 1ZYLA 2BR1A 4KBKA 3ORIA 4FV6A 3DZOA 4DGNA 3ZMMA 3GFEA 1H24A 1PXKA 4G16A 2C5NA 3G0FA 4I5CA 4YO4A 2Z7SA 5FG8A 3DJ6A 3MIYA 3MY5A 3QUEA 3FC2A 4RJ5A 3R7GA 4MYGA 4XJ0A 4YTHA 2XJ1A 3W55A 4AT4A 1RW8A 3COHA 4F65A 5M56A 1LP4A 2UW3A 3EQHA 1H1PA 4XHKB 5LCJA 4NW5A 4QTBA 4DFXE 2Y6MA 5EW3A 2OF2A 2FO0A 3GCVA 4BTKA 5IUHA 3BYOA 5J8IA 3W0QA 3ENMA 2GNGA 2RFEA 4AA5A 4DBNA 3A7JA 3WOWA 2RGPA 2WD1A 3QCQA 3ZLXA 3DKCA 3C1XA 2XEZA 3RZFA 3W2QA 4BCOA 2BRHA 2O8YA 3HMNA 5ETAA 4BC6A 4D2WA 4D5KA 2HXLA 3F88A 4O38A 5I9ZA 3HMOA 4CFMA 3PXZA 3OW3A 1WBSA 4ALVA 1QCFA 1AQ1A 3ZRKA 4IC8A 5IISA 4O96A 4JRVA 4M13A 5BYYA 4R3CA 3T3UA 5K4IA 4YR8A 3EFLA 4FKPA 3V01A 3FC1X 1W2DA 5CU4A 3P5KA 4ITIA 5E92A 5ETIA 2QKWB 2XAOA 2CKOA 2C6MA 2EVAA 4BDBA 3NUAA 1PXNA 2J9MA 3GFWA 4AF3A 4CFFA 1Z5MA 4TNBA 2ZB1A 5IQDA 3BWFA 5HCXA 3UO6A 1YI4A 3BBTB 4BKJA 5IA3A 4Y95A 3V6SA 3KXXA 4BDFA 3DK6A 2OXYA 5EW8A 3V6RA 4C3PA 5K4JA 3SVVA 1WFCA 4BZDA 4F9AA 3GT8A 5JQ8A 4IM0A 4DEIA 4DH1A 3PZHA 4I4EA 5CEQA 3HA6A 2XKCA 3P78A 4FI1A 3BLQA 3L9PA 4NTTA 2JDTA 4CG8A 1S9JA 1G8SA 3LFDA 4EOSA 3WE4A 3UBDA 5GIOE 3HEGA 2CPKE 1PKDA 2UZTA 5CTPA 3UC4A 1PHKA 3GUBA 2OK1A 3NWWA 3K3IA 3KF7A 4JX7A 3UMWA 3VHEA 4A7CA 4F08A 5IA2A 2ESMA 3PJ3A 4RJ6A 4ZLYA 3JUHA 2WAJA 4R6VA 1YXSA 2UVZA 3A61A 2W1FA 2QVSE 4II5A 4RVTA 4TT7A 2OJIA 4USDA 2PL0A 5KUPA 4DEAA 3P5JC 5EYMA 4A9YA 4EJ7A 4JBOA 1YOJA 2JKMA 5IG1A 3CKXA 3SXRA 2OJGA 3N4UA 3IDBA 3LMGA 4BBFA 4KRDA 4D4RA 5B0XA 1GIJA 2CNQA 3M1SA 4HW7A 4I93A 1IEPA 3A7GA 3N4VA 2VGPA 3O0GA 3FI3A 2QO7A 4AWIA 4GEOA 2R3OA 2ZV2A 5D41A 4BDAA 3O8TA 4PMPA 5M57A 2IVVA 3AT4A 4MWHA 3EFJA 5IEVA 1UU3A 3SAYA 2PUIA 2YERA 5IQFA 5IQBA 4XBUA 4PDPA 5CSWA 3NVMB 4CMOA 4DAWA 3ULIA 1PY5A 4LUEA 3JPVA 1ZY4A 2R3LA 4E4XA 4F4PA 2C0OA 1WAKA 2FUMA 4GJ2A 3OXTA 3L8XA 4E6AA 3NUUA 1Q8WA 4FKUA 4BJJA 3I60A 3MSSA 4B7TA 4RZWA 3PFYA 4ORKA 2HZIA 2PVHA 5K9IA 3QWJA 3EQPA 4ZXTA 3NEWA 3PY3A 2IEWA 2OSCA 2XNMA 3PLSA 4D0WA 3AKLA 5AR7A 3PVBA 3V5QA 4BZOA 1GZNA 3UC3A 4PP7A 2HY0A 3HRFA 3TKUA 1BLXA 1A9UA 3MW1A 4QP1A 4TZRA 3KCFA 1PXMA 4LOQA 5HG9A 1BI7A 3AMYA 3EQDA 2YZLA 3AC5A 4JT3A 3NUNA 5HQ0A 4ZTNA 5CZIA 4X2FA 3UNJA 4ASZA 5B2LA 5H8GA 4ANNA 1H4LA 1XQZA 3OT8A 4I41A 2QOCA 5AR2A 4EHGA 4YNOA 5ANIA 2ZM4A 3ERKA 3WF5A 5J9ZA 3OCTA 3S1HA 3P7BA 4GFMA 3GEQA 5FRIA 3TZ7A 1EH4A 3U51A 4E73A 4PDSA 2C47A 4DH3A 4EL9A 3UNKA 2YN8A 3D94A 4O0SA 2Z7LA 3EJ1A 2BZIB 2WOUA 4KABA 2R3HA 3FMKA 1SVEA 3VS2A 3AT2A 2VTAA 4TL0A 2OWBA 4FG7A 4USEA 5KMMA 5CAPA 3MVLA 4BTFA 5L3AA 3E88A 3NNWA 4FKWA 4LL5A 4BGQA 4CGAA 4HZRA 4V01A 5JRSA 1JVPP 3EL7A 4BICA 4UY9A 3LZBA 2QR8A 4L44A 4RVMA 3HAMA 3HL7A 5FGKA 3TKHA 3H9OA 4ZP5A 3RNYA 4FTIA 2GSFA 1DI9A 4E6CA 2VO0A 4QMLA 3VJNA 5CU0A 4BZNA 4IM3A 3W0OA 3GU8A 3MTLA 4FMQA 4MXOA 4B9DA 3KF4A 3QUDA 4UXQA 3ZFYA 5CVHA 3HV3A 4ERWA 5JSMA 3FMMA 5KHXA 4RGJA 4CNHA 5L6WL 5A54A 4OTIA 3WIKA 3UZRA 4XRLA 2DWBA 1ZMWA 3QCXA 2YM6A 2V5QA 3EN9A 4FV5A 2BRNA 5EI6A 2GHGA 5HO8A 2G2IA 2HWPA 3TNWA 3E93A 2Y0AA 2VX3A 3E5AA 4MNFA 1IAJA 3ZUVA 2PUNA 3NRMA 4O83A 5KBQA 2HZ0A 3OHTA 4NFMA 3BHUA 5F1ZA 4DGLC 3JVRA 2Q83A 4AG8A 3PSBA 2ZDTA 3GC8A 3Q04A 4KAOA 4YZBA 1XHAA 4O0WA 1IR3A 5EKOA 4CV8A 2VTJA 3GCPA 2V22A 3PG3A 4FUYA 4BGGA 4FIEA 2RG6A 4RIYA 4RX7A 4H58A 4CYIA 1Q97A 1XWSA 2WQOA 3VQHA 5JGAA 4YZCA 3NFGB 5CY3A 3RPRA 3ZBXA 2QU6A 3E8EA 5L2WA 3RAKA 1JBPE 2OLCA 2XB7A 3R7IA 3DFCB 4HJOA 5DFPA 3FHRA 1V0BA 2Z7QA 2ZYBA 2QU5A 3AD5A 3R8ZA 4C4EA 4F1MA 3TACA 3LLTA 3GU4A 1ZOGA 2W05A 4IB1A 1Y8YA 2XIZA 4GVAA 1KOBA 1P2AA 5TO8A 4GL9A 1V1KA 1OKVA 5CU2A 1PYXA 3F2AA 2HK5A 2WIPA 3DNEA 3EIDA 3R0TA 5E1EA 3SV0A 3WF9A 2XNBA 4JNWA 4BIDA 1ZYCA 2WO6A 2YM4A 2E9OA 5KNJA 5M55A 1T46A 2R3MA 3G5DA 4BB4A 3HV6A 5L8JA 3GCQA 3AGLA 4WG3A 5DH3A 2F57A 2G15A 3IONA 3PVWA 4PQNA 3FLQA 4RIOA 4YGAA 4ZJIA 4E5WA 5ANJA 2UW0A 4AN3A 3MYGA 3MB7A 3NNVA 4EKLA 3U55A 1LEZA 5ITAA 3TUDA 2PVMA 3IG7A 4O4DA 3IS5A 4NKSA 5AX9A 3LFNA 2QR7A 2VWIA 3R00A 4DEHA 3AMAA 3TTIA 1Q41A 4QRCA 4YSJA 2YM8A 3QX2A 3UDBA 5KBRA 1RQQA 2G2FA 2XS0A 3BYSA 4D5HA 4YUQA 5IPJA 5KKRB 2PTKA 4ENXA 3OUNB 1REKA 4U3YA 4IJPA 4L45A 2XIKA 3DBCA 1NVRA 3DAEA 3RK9A 3TJDA 4FT3A 5B2KA 4EHEA 3SGCA 3HZTA 2GS2A 3IW7A 2HW6A 1PJKA 1CM8A 3BU6A 4RVLA 5JT2A 1ST4A 3H30A 2WU7A 2X6EA 4FKJA 3UVPA 3WZEA 4JS8A 4F0IA 3VJOA 2IZRA 1YWVA 3ENHA 2XIXA 3EMGA 4NW6A 4FTTA 4CZYB 5C26A 4GU6A 4DFLA 4YJRA 2F2UA 5KHWA 5AP2A 4OTDA 3KXNA 4GT4A 2C30A 4BBEA 2PU8A 4BF2A 3UIXA 4KD1A 3ID6C 5AA8A 4WOVA 2OG8A 4NYEA 3JY0A 4D4VA 2UZVA 2VTRA 4X2KA 5GZ9A 4OTFA 4AGDA 4ENYA 3GB2A 2C5VA 3Q4CA 4F70A 1GIHA 3IK3A 2QOIA 1OI9A 2X39A 1W8CA 3PXYA 5IH6A 5FWKK 5LMBA 5GJGA