1M7NA

Crystal structure of unactivated apo insulin-like growth factor-1 receptor kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
305
structure length
299
Chain Sequence
SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor I receptor
publication title Crystal structure of the Apo, unactivated insulin-like growth factor-1 receptor kinase. Implication for inhibitor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m7nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m7nA01
3NUUA 3NUSA 3GBZA 5CVFA 4WBBB 3AC4A 4ALUA 2YZLA 2HZIA 1OBDA 3FQEA 2A0CX 3W10A 2WMWA 5IQDA 2ITXA 3UIBA 1WAKA 4BF2A 5DOSA 5LWMA 2XIYA 3CD3A 3PPZA 1XO2B 3OW3A 5JMSA 4RIYB 4AS0A 3CJGA 4YJVA 5I9ZA 1WBNA 3OTUA 4G3GA 4NK9A 2ITUA 4TN6A 3FYJX 4Q5EA 4XG2A 1JOWB 5AP1A 4DH1A 4CFMA 4EHZA 4UX9A 1R78A 3DV3A 3EN9A 2QONA 1RQQA 2W05A 1H1PA 2I6LA 2XEYA 3C7QA 3LHJA 4RWLA 4X0MA 4PNKA 1OIUA 3QUDA 4IXPA 2WEVA 4QRCA 1J1BA 4ITHA 5KBRA 2C5YA 4E8AA 5TKDA 4C4GA 4BWPA 1BI8A 3F7ZA 3LM5A 4ACHA 5JN2A 3C4EA 4RWIA 4QP7A 4WNKA 3BYSA 3Q53A 2PVYA 3P86A 2G01A 2RSVA 4I5CA 2IO6A 4RJ6A 4ANLA 5FTOA 4G34A 3GQIA 3FLZA 2J0JA 4RVMA 2WTKC 2R3KA 4FF8A 3JY0A 3EH9A 3SX9A 2VO3A 3R1QA 4U3YA 4ASEA 4D4SA 1YDTE 2YCQA 4I22A 2VTJA 1NXKA 4GVJA 4KNBA 2E9UA 5CNOA 5TT7A 4CNHA 2GSFA 4LUEA 5L8KA 3C0HA 2EVAA 1R0EA 1IA9A 2HIWA 3BYUA 3IW7A 4NIFB 4KUJA 2YM3A 3FL4A 2R7IA 3S95A 2IW8A 4ANNA 2X81A 3BGZA 3BHUA 4XOYA 5L6WL 4M14A 5CANA 4YO4A 1PJKA 1YKRA 3DOGA 3RPYA 1XH8A 3DKGA 1OPJA 4TYIA 5CZHA 3A61A 2ZV2A 3JYAA 4D2TA 4U79A 3AGMA 2YLEA 3KU2A 2NNWB 2UW3A 4RVTA 5CSWA 5CAPA 2GS2A 4LL5A 4GU9A 1YDRE 3EHAA 3QZIA 4GSBA 5FM2A 3ZUVA 2PUIA 3O17A 4JDHA 4RX5A 3KRJA 3PE2A 3I60A 5E8ZA 2C3JA 3VBTA 5LWNA 2C5XA 4G16A 4PP9A 2YWVA 4G17A 4BDCA 5ACKA 3VBXA 2G9XA 4JAIA 2QOIA 3IDCA 5EYKA 5I9YA 3DLZA 3R9HA 4JG7A 3NGAA 5G6VA 1DS5A 1FMKA 1GAGA 3P7AA 4U7ZA 3UZPA 5KMMA 5KKRC 4PMSA 1SYKA 3S4QA 5AIKA 4IIRA 3R7IA 4CCUA 3KRXA 4ITJA 1PW2A 3VAPA 5BVNA 5D11A 2ZV8A 1YHWA 1XH6A 4ACMA 2Z7QA 4IW0A 3LQ5A 4CZUA 4D9TA 3BLRA 2GHMA 2WMRA 4GIHA 2WGJA 4DTBA 2OGVA 2AYPA 3BI6A 4RX7A 3MDYA 5GHVA 2IVVA 1KUTA 1Y8GA 3IDPA 5DLSA 4CEGA 2X7OA 4EKKA 4UY9A 1LPUA 4QNYA 2C6TA 3CXWA 4FYNA 4EH2A 2JIIA 4IAIA 4LUDA 2BPMA 4F1OA 3F3WA 3KFAA 3DKCA 5JFVA 5B2LA 2C6LA 3CKXA 5KCVA 1W84A 4N6YA 3K5VA 3UIMA 1UNHA 4D1XA 4BWKA 5FQDC 1FGIA 3I5NA 4FKTA 5KZ0A 5E4HA 4V0GA 2BROA 3QYZA 4PDSA 1PMUA 3BKBA 3OEFX 3PWYA 1ZYDA 3UP7A 4AE9A 2GNGA 3F6XA 5CSXA 2JITA 4BIDA 4NU1A 3S3IA 1OIYA 5GZ9A 3OP5A 2CNQA 4FT3A 4LOQA 3VS4A 3SXSA 4GEOA 3I0OA 4JIKA 5IA5A 4EHGA 5IDPA 1G3NA 1WBSA 2PWLA 4XG6A 5CZIA 5JZJA 4RWKA 2WD1A 4QMMA 4MXZA 3UBDA 3D9VA 4YJTA 3ZO1A 5AP4A 3PVBA 3RKBA 2CKOA 3F61A 3BHYA 5GNKA 3DY7A 5EYCA 1OL1A 4RJ7A 4DGOA 4YSJA 4QMUA 5AR8A 4JT3A 3LLTA 3DTCA 5HTBA 2PVJA 1UKHA 5BVOA 3ZSIA 1JSVA 2UZUE 4KIKB 4QP3A 2QOLA 4UMQA 1GNGA 4FKGA 4E7WA 5HCXA 5HESA 4UMRA 3FDNA 4BTKA 3RK9A 2A1AB 4AP7A 3F82A 2XCKA 4XRLA 3D7ZA 4M84A 2PVLA 3OWLA 4WT6A 5A54A 5KUPA 4FOBA 3RK5A 4EONA 1JLUE 2QO2A 3WF5A 5A4EA 5DYJA 1FQ1B 4F9AA 3BE2A 4MKCA 4QMNA 3VW6A 3MH1A 5KHXA 3KEXA 4JBVA 3OCTA 4C59A 1Q8UA 2QOBA 3AT3A 3PIZA 3CD8A 4BYIA 1NT2A 3FXWA 5GJFA 2JKKA 1VR2A 4DGNA 2WQMA 4IM0A 4C33A 4CGAA 3H0ZA 4EH4A 1URCA 3BX5A 4ID7A 2PYWA 5ANEA 4DHFA 2PUUA 2ZAZA 3MFSA 4EOPA 2XBJA 2B9IA 4B8MA 1Y57A 5KX8A 2CNVA 3EIDA 4YBKA 5FXRA 5KMLA 1OPKA 3P08A 4X2KA 5LVLA 3RNIA 5M4UA 2NP8A 2FSMX 4EJ7A 3GFEA 3GFWA 5ACBC 5FUTA 3OVVA 4FTOA 3ZZEA 3AXWA 1RW8A 3LFNA 5FXSA 2WTVA 5L2WA 5EDPA 2OSCA 2QVSE 3AC5A 2VWBA 4PY1A 1YOLA 1BL6A 3R7VA 3MB7A 5HBEA 3EJ1A 4FKUA 3UNZA 3L9PA 3PXFA 1QPEA 4C4HA 2B7AA 3IO7A 5CYIA 4E73A 1Q4LA 4EOKA 4OBPA 3KULB 4J98A 4AF3A 2I0YA 5M44A 3JXWA 3CTHA 2Z7SA 4F9BA 3ZS5A 1R39A 5AV2A 3QL8A 4DINA 3OT3A 4FV3A 3Q9XA 5CSPA 3R21A 2GCDA 1MRUA 4DH8A 3RWQA 4PP7A 1FVTA 4RZVA 2QCSA 2C0IA 3EN7A 2HZNA 4H39A 1W7HA 4USDA 1Q62A 3UTOA 2W17A 3KVXA 3GB2A 3QQJA 4WIHA 2VRXA 5CF6A 3F2RA 1H28A 4JLCA 3IW6A 1L3RE 3RJCA 2CCIA 2BUJA 1JKKA 2JDVA 3DNEA 3WARA 5A3XA 4YTIA 4QPAA 4E3CA 1OGUA 2BZHB 3GCPA 1V0BA 5E8YA 1GIHA 4FK3A 5CQUA 3ZOSA 4H05A 3HL7A 3MW1A 5F20A 3VW8A 1H0VA 3UIXA 2PMLX 3D5VA 4ACDA 5JGBA 5L6PA 4BGQA 2GNHA 5HO8A 1QPJA 1MRYA 3WILA 4BGHA 4KABA 4UMUA 4I0SA 4TWCA 4ZSGA 5KNJA 3WZUA 3Q6UA 3Q5ZA 4AUAA 2OJIA 4BCNA 4O84A 4DG0E 5M57A 2W06A 1PRYA 2BZKB 5D9HA 2QO9A 3HX4A 5KE0A 2XIRA 5JGDA 5GJDA 3NCGA 1CSNA 3HAMA 4GUEA 4EH6A 4J8NA 4Q5HA 3DQWA 4E5BA 3QTUA 2F7XE 1SNXA 4PMTA 3MFRA 4DT9A 3FY0A 3VF8A 4AZVA 4AA5A 3JUHA 5CU2A 3CIKA 4L7FA 5HG9A 3KXGA 1S9JA 3QRUA 4C3FA 1S9IA 5CENA 3FMDA 3HP2A 4RZWA 4TYEA 2VWWA 3QX2A 4QP9A 3F2NA 3HP5A 1B38A 4UYNA 4EH9A 4R77A 1KE7A 3Q4CA 4AW0A 4X3JA 3QUEA 3CGFA 5EHOA 3ZLWA 5K0KA 5B2MA 3PY1A 4FKRA 3CE3A 1TQMA 5FGKA 4BDEA 2PVMA 5BVEA 5L2QA 1OMWA 4X3FB 5AJQA 3COIA 3IDBA 4CKRA 2OG8A 5HCYA 4IMYA 2CNUA 5AA8A 5CEMA 1IEPA 1OIQA 3SAYA 1ZY4A 4X3FC 3E93A 2UZTA 3T3VA 2ITWA 2V5QA 3NNXA 4E5WA 2EUFB 3P23A 4IJ9A 5JH6A 1L8TA 4PNIA 5CS6A 4RVKA 3O8TA 5CEIA 5CASA 3HAVA 3OD6X 2VO0A 3HMMA 3R04A 3LFCA 4ZZMA 4D2VA 3VJNA 4Q2AA 4YC8A 3LJ2A 4NW6A 4UWBA 2PVFA 1V1KA 3PXQA 4MK0A 3KXXA 2B9HA 2Z60A 2ZB1A 4U43A 3LCTA 3FI3A 3CS9A 3G90X 4ZSLA 3TG1A 4IZ5A 2WMXA 3HV4A 4WNOA 3F5GA 3RMFA 4QMPA 4GG7A 4BIEA 4FVPA 2WTIA 2VTTA 3EQIA 3DBDA 5AM6A 5FG8A 4CCBA 2GQRA 2X2MA 4E1ZA 3LXLA 3R6XA 5EQEA 3O23A 4FSMA 4JNWA 2YACA 4IACA 1PXPA 4MWHA 4RA5A 4ZZOA 5IA1A 3UPZA 3D15A 5CEPA 4TKSA 4C62A 2QC6A 3D83A 3HGKA 4FTMA 1QCFA 4A9RA 2V7OA 4D4VA 4FGRA 4KKHA 5EDQA 4P90A 3R9OA 3VWAA 3UQCA 3PJCA 4FICA 3S0OA 4FZAB 4TYHA 4HYHA 3W2PA 3DJ7A 4ANQA 4Y8DA 5AA9A 1TQPA 5DVRA 4V04A 3DAKA 3BU5A 3WOWA 2GNLA 5AV0A 4HGTA 3R9RA 5E1EA 2HWOA 3QYWA 2WMSA 4KBCA 4CFUA 2C47A 3UVPA 1YXUA 5DWRA 3PZEA 3LCKA 4EYMA 3NUNA 2YN8A 4EH7A 3D7TA 4FIIA 5AP6A 3QTXA 4LRKA 3C4CA 4YBJA 2IW9A 3ZRLA 3C1XA 5JKGA 2ZM1A 3DNDA 3BE9A 3GNIB 3MYGA 3PFQA 4I6QA 4PTGA 3QXOA 4ZTQA 5HTCA 4XMOA 4ZSAA 3ZM9A 2J4ZA 5KHWA 1LUFA 2BIYA 2BKKA 4XV1A 2OJGA 3AD6A 3W8QA 3WIGA 2W1DA 3K3JA 4FUXA 4Z55A 2QOHA 1WBWA 4PTCA 1YI6A 3G0FA 3F5XA 3OG7A 3DK3A 4FTLA 4HZSA 4FEUA 2WMQA 1DI8A 1XWSA 1JAMA 3V51A 4BKYA 3WZEA 3UOJA 5CEKA 5EW3A 3TI1A 2PY3A 4FKPA 3F2AA 4R1YA 5I9XA 4HNIA 5HZNA 5L8JA 2W4OA 5L2IA 2VD5A 3QQGA 1H8FA 4X6RA 5M06A 3NNVA 2Z8CA 4AWIA 4QMYA 3UOHA 5HIEA 4USFA 4UWCA 1RDQE 4HGEA 5AR5A 3KY2A 2WMBA 1F0QA 3KVWA 2XNGA 5H9BA 2WEIA 3KN5A 3EYGA 5CF5A 2ITQA 2WTJA 4ENYA 1O6KA 4NFMA 4HNFA 2XVDA 4MTAA 1BI7A 2ETRA 3DZQA 2E9VA 3TCPA 2W1EA 3ZEWA 2C0OA 4NUSA 4CMUA 5K4IA 4KBAA 4E20A 3FMMA 3W16A 3RCJA 3UZTA 4C02A 4Z9LA 1MP8A 3R1SA 3EQRA 3OTVA 3TWJA 3G2FA 4R7BA 4ACCA 4K77A 4K11A 3U87A 4G5PA 4BKJA 3IGGA 3QTRA 1PMVA 4FVQA 3AGLA 4FKWA 1J7IA 4L43A 2UVYA 4MXCA 5JQ5A 3U6IA 1NY3A 3UZRA 3MPMA 4HVIA 4XG9A 2R0IA 4GL9A 4FL1A 4LFIA 3E3BX 4O2PA 3QBNA 5ANGA 3W33A 4BCQA 5JSMA 3PYYA 2YJSA 3Q3BA 5IEYA 4MBLA 5LJJA 2NO3A 1GZOA 2ZDTA 4C7TA 2VN9A 3AMBA 3WIKA 5LVNA 2XZSA 3OW4A 3GVUA 2EXEA 3C4WA 4V0GB 2CKQA 3G15A 4DEIA 1OUYA 4FX3A 4QTCA 4U5JA 5FEEA 3TV4A 1XH7A 5H8BA 3VBYA 4J99A 4NH1A 4YNOA 5HOAA 5DH3A 3OWKA 4DEEA 3KXHA 1P5EA 3ZC5A 3LCDA 3BHHA 3NNUA 5LOHA 3UYSA 3A8XA 5LMKC 3PA4A 2JKQA 5EI6A 5IA0A 2PZPA 2Y4IB 3LW0A 1ZYSA 4WSQA 5HICA 3PY3A 4E6CA 4FKSA 3UOKA 1XKKA 4P2KA 4OTRA 4DGMA 3ODYX 5E7RA 3RPOA 4C58A 5JT2A 2Y4IC 5DEWA 4FOCA 2W5HA 4IAKA 3ACJA 3O96A 3WZKA 3OOMA 5FEQA 3C4FA 4O7ZA 4U8ZA 4HPUE 5DGZA 5F4NA 2YZAA 3VBVA 4C0TA 5DBXA 3HUBA 1OZ1A 3FQSA 2A19B 4FZDB 2EU9A 4FKQA 2HXQA 5H2UA 3U9NA 4PX6A 2UZWE 2YABA 4XBRA 4K8AA 3ZDIA 2B4SB 4RMZA 3V5PA 4E4LA 3KULA 3VS0A 3R7UA 3LXNA 5EG3A 3MSSA 4ERWA 3OEZA 5EM5A 4GRBA 5TE0A 1ZZLA 3ROCA 3GI3A 1IASA 2PL0A 3POZA 3R2BA 3U4UA 5CF4A 4PRJA 3D2KA 2F49A 4BDHA 3TKHA 2OIDA 4P5ZA 4QQCA 5I3OA 4GUBA 5HGIA 2HW7A 1VYWA 2OW3A 4IAAA 3KRLA 4BDAA 3ORLA 5C8MA 4O91A 4OTQA 4QMSA 2C6KA 2YDIA 2HZ4A 2B0QA 3I79A 4EC8A 3FE3A 2VU3A 4O7YA 3L8SA 3WZJA 5FBOA 1FINA 4AU8A 5LVPA 2IZSA 5AIRA 5KZIA 5HIDA 3EQHA 3PSCA 2UZDA 2XBAA 3TUBA 2R3FA 3FMLA 4FT9A 4IAFA 4I4EA 3VUKA 4R3CA 2R3GA 3ORNA 5M4FA 2FYSA 5KO1A 4J71A 3ORIA 4XBUA 3L9MA 3II5A 2C6IA 4XP0A 2P33A 3O2MA 4DCEA 2QKWB 3O0GA 4FTQA 4G6NA 3UODA 2UZBA 4CZTA 5HORA 5IMEA 4JR7A 3L8PA 3ORKA 4F63A 1KE6A 2F4JA 1OI9A 2XB7A 3GCSA 3MPAA 3BU6A 4GT3A 4KBKA 1ZWSA 2B52A 3RVGA 3LOKA 4QMZA 5E8TA 3U54A 2YJRA 4FTAA 4O0TA 4EK8A 3GP0A 1OB3A 3WF6A 4IVBA 3O8UA 4NEUA 3I6UA 3ZFXA 3OF0A 5IQAA 3SGCA 2YM4A 4PL5A 1X8BA 3P9JA 4BICA 4FZ7A 4HGLA 3BRBA 4MF1A 4Z16A 4RLKA 3NUXA 1XBAA 2RL5A 3R8ZA 4TXCA 1UNLA 4K18A 5HE2A 3W18A 4F64A 2UUEA 1GOLA 3Q5IA 4Y95A 3UP2A 2V0DA 3GC7A 4K2RA 2O2UA 1ATPE 4FODA 4OTDA 2IVUA 4G9RA 2O64A 1FVVA 4QP1A 3ZCLA 4D2RA 5IH6A 3VS3A 4RPVA 4W9XA 3CSVA 3R7OA 3GXLA 4AZWA 3R8LA 2DS1A 4OLIA 3PP1A 3MVJA 4MF0A 2X8EA 2EXCX 2YDKA 3NX8A 4ONAA 4DFZE 4ENXA 1CKJA 2BRHA 1H1QA 2IZTA 3FZSA 4JX7A 4L01A 4O0XA 4I0RA 3SD0A 3TV7A 5BX0A 5IA4A 2ONLA 4RLLA 1H00A 3DT1A 2YIWA 4ANMA 4EZ7A 4ZY5A 5EHYA 2QHNA 4RQVA 4U42A 4RIWA 5CI7A 2R3MA 4C38A 1HCLA 2BFYA 4U40A 3NW6A 3P4KA 4WRGA 5AUWA 3SKCA 3V6RA 4AA4A 4ZZNA 4Z7GA 1Q5KA 2YDJA 3HRBA 3UG1A 4GJ2A 2ITYA 2NPQA 2XNNA 1O6YA 2BHHA 4OTWA 5IA2A 4FNZA 5BMMA 3EMGA 3HA8A 1PYXA 3VS6A 3MY5A 3ZFMA 2BAJA 4I21A 3AC1A 1T46A 4IX6A 5KBQA 3A62A 3SVVA 3DXPA 4QMXA 2PPQA 5EH0A 1AQ1A 2E2BA 3FLNC 1UWJA 2YCFA 4O7SA 3PPKA 3FZRA 1O9UA 4WG5A 2ETKA 1Q41A 4UZHA 4JJRA 4X2NA 5A4QA 5HLPA 3R63A 2C5OA 2PVNA 4QMTA 2OXXA 5HNBA 5M08A 2XM9A 4HVDA 3ORPA 4O83A 1ZZ2A 4XG8A 1GIJA 2HK5A 4ZJVA 4IDVA 4E5AX 5AP5A 3IPHA 4HYUA 4QNAA 4YR8A 3FI2A 1Q3WA 4IWDA 5A6OA 5BUEA 3AC2A 2C6DA 4FTCA 4LL0A 4B6LA 5B2KA 4FIFA 3RI1A 4EK4A 1KOAA 4WA9A 3A2CA 2OJJA 4IB0A 3E62A 4WBOA 2X8DA 4AOTA 2IZUA 2X4ZA 3UC4A 4IAZA 3VO3A 1M7QA 1JWHA 2CKEA 3KRWA 3NNWA 4C37A 4DA5A 5AAEA 5HNIX 4U97A 3R73A 4FT0A 2O5KA 3ETAA 4E93A 5IH5A 1GIIA 3TT0A 5F9EA 2W4KA 5AP0A 3QRIA 3ZO3A 4L53A 3HV7A 2G1TA 4UMPA 1DI9A 5CU6A 4FV9A 5J1WA 3OC1A 3FMEA 4I23A 5DFPA 4DTKA 4EHVA 3K3IA 3BGQA 4XV2A 4KD1A 1Q61A 4RVLA 5BUJA 3RAIA 2RIOA 2Y6OA 3QTWA 2GPHA 4Y83A 1IR3A 5BVFA 3LKMA 4IC7A 4GKHA 3PWDA 3MTLA 3VHEA 3P7CA 3O7LB 3ZDUA 2RFDA 3DS6A 4S30A 5IEVA 1M52A 2BHEA 5CLPA 3NIZA 4IB1A 3FI8A 4JAJA 3GCUA 4YZ9A 4ALVA 4QQ5A 2VZ6A 4TYHB 2EB2A 5IQFA 4MWIA 4UWYA 5B7VA 2VWXA 5LARA 4CKJA 4FVRA 2QOQA 3GUBA 3ORTA 2GTNA 3PA5A 3R8PA 4EH3A 5AMNA 2FA2A 3KK9A 3QUPA 4CRLA 3DBEA 1I44A 4IVDA 4IAYA 3MY0A 5CI6A 5EOBA 2QQ7A 3D7TB 3F88A 4J1RA 2QOKA 5C4KA 1YXSA 1QL6A 4M66A 5IPJA 4GS6A 3G51A 3DKOA 3CQEA 1TVOA 5AUXA 4ZP5A 3F5PA 1P2AA 4OTPA 3ZM4A 4PV0A 4BL1A 4IQ6A 4D0WA 2I0VA 4IWOA 1FVRA 1H1RA 3R9DA 4LV8A 4D0XA 4FYOA 3PSBA 3GU7A 4ZTRA 2WTCA 2C69A 3GGFA 5JQ8A 5L2TA 4FV5A 5E90A 2VTRA 1FBNA 2YIYA 4G3EA 3SW4A 4I5MA 4D1SA 4RFZA 2GNJA 2FGIA 3DXQA 5CTPA 5CALA 3EQPA 3A4PA 3KF4A 3VJOA 4M69A 4TWOA 1R0PA 1Q8ZA 4MEDA 4MYGA 4OBQA 4L3LA 4YPDA 4HOKA 4YGAA 3ZZWA 1KV1A 1J3HA 4JBQA 4LRJA 3VBWA 4DFBA 3MJ1A 5HHWA 4LOOA 4ASDA 3W2RA 5LVMA 3EFKA 4FSNA 5K4JA 1YVJA 3Q2JA 4CQGA 3HRFA 3R2YA 4PDPA 2HZ0A 3DBFA 5DRBA 1Z57A 3WBLA 2I7QA 2F2UA 3PXYA 4BDDA 5CQWA 2OBJA 3GC9A 5J5SA 4ORKA 4FIGA 3MB6A 3PG1A 3R22A 3EYHA 3QGYA 1UWHA 1SNUA 1UVRA 2ZM3A 4S33A 4TWPA 4LYNA 1ZOGA 4ZMEA 4GFMA 4G5JA 2C3LA 4MBJA 4ASZA 2G2FA 2OJ9A 1OIRA 3MPTA 5HBHA 4R78A 2OLCA 4D9UA 4RJ4A 3A4OX 2IW6A 2JC6A 3TIZA 1U5RA 2BTRA 4UALA 4XCUA 3WI6A 1NVSA 5A4LA 2VNYA 1TKIA 3PXKA 4RBLA 5D7VA 4NWMA 1YOMA 3H30A 4U41A 4EOJA 1F3MC 1B6CB 3F3VA 2BILB 3OXTA 2OKRA 4O21A 2YM8A 4FI1A 3I6WA 1OKYA 3G5DA 4ZLOA 3FMJA 3Q4ZA 3KMWA 3DK6A 4BBMA 4EH5A 4QMOA 1QPCA 4BCFA 4FGBA 3OBJA 2PE1A 1W8CA 4FT7A 5CT0A 3VRYA 4ACGA 4YJUA 4AOJA 4EKLA 3N4UA 3D94A 4QTBA 3SHEA 5CEQA 3WF8A 4AN3A 3OY1A 3ZRKA 1RJBA 3T3UA 3HNGA 3NW7A 2O3PA 3ENMA 3MWUA 1YW2A 3NR9A 4IH8A 2Z2WA 5IDNA 3DKFA 1K2PA 1PKGA 2JKOA 4U0IA 4A9TA 3T8OA 3IQ7A 4D28A 5I5ZA 4U9AA 4O7VA 3ZBXA 3U9CA 1ZARA 5LCJA 3TZ9A 2JIUA 5J9YA 2XKEA 4Y5HA 3OUKA 4L68A 3RAHA 4O1OA 3NWWA 4YHJA 3TTIA 3CKWA 4BFMA 3PPJA 5HU9A 3OWJA 3B2TA 4UN0C 2V22A 2X0GA 3KL8A 4XRJA 4AAAA 1I09A 5M07A 2YERA 4YNEA 4F9CA 3HMOA 5AX9A 2OF4A 2I0EA 4NW5A 3NYXA 2PE0A 4NM3A 4BDJA 3LMHA 3O71A 2V7AA 2BDWA 4IZAA 3PJ8A 3AG9A 5AP2A 2Q83A 3ZXZA 5FP5A 2JFMA 3ULZA 4GT5A 2PK9A 5DT4A 5ICPA 4ZY6A 2O8YA 4CYIA 2OXYA 4D2PA 1BX6A 2WQOA 2C1AA 2ZJWA 1JKTA 3PZHA 4E4NA 3KMMA 4D4RA 3KC3A 2C3KA 3CBLA 5LMBA 3QTIA 5CWZA 5IU2A 3EL7A 4FKJA 2UW9A 4F6SA 3KF7A 4DE4A 3AD4A 5HD7A 1SZMA 2WPAA 1CM8A 1Q8WA 2W96B 3SG9A 4CFFA 4CVAA 4LRMA 4EL9A 4ZLYA 4AXAA 5CEOA 4E4MA 2OF2A 2YCRA 1FPUA 2R5TA 3LFEA 3ITZA 4MX9A 4E6DA 2WQBA 2Z7RA 5DG5A 5H8GA 4Z7HA 4CG9A 5K5NA 1ZLTA 3FZPA 4XH6A 4Y46A 3OMVA 4AG8A 2CHLA 4O7RA 2VNWA 3W1FA 1ZY5A 5GIOE 3OS3A 1MQ4A 3D4QA 1ZYLA 5I3RA 4DAWA 4M12A 4JI9A 4OTFA 3F9NA 4H1MA 3ELJA 1H1WA 3PSDA 2HENA 5HX8A 2WB8A 5B0XA 4MNEA 2Y8OA 3RALA 3TEIA 3FC2A 4W4YA 3LFFA 3THBA 1UU8A 4FSTA 4R3RA 3LM0A 3FSKA 4EZ5A 3EFJA 2X6EA 2F9GA 3DGKA 4RA4A 4A07A 4U80A 3OHTA 3R00A 4LI5A 3MFUA 3FY2A 3LCOA 5DR6A 4DT8A 2XYNA 5HG7A 1WVXA 3DAEA 5KMKA 4ZLZA 5KMJA 5GINE 4FSZA 4QO9A 3FKNA 2C6MA 3PIXA 4MXOA 4BIBA 5DRDA 4F6WA 2WIHA 2VTHA 4R6VA 4O6EA 2B55A 1PXOA 3Q6WA 3E92A 4U6RA 3Q9ZA 2VTSA 3A99A 4YJSA 1G8SA 3ORZA 4GK2A 2BMCA 4JOAA 4YC3A 2P2IA 5AV1A 3H9OA 4ZIMA 4NTSA 4DC2A 4KINA 2GFCA 4IWQA 3BBWA 2H6DA 2QODA 2C68A 1AGWA 2ZVAA 4GCJA 4QTAA 1OL7A 4AZSA 2DUVA 1WBPA 4AFEA 3LFSA 4MVFA 3OROA 5ITAA 3NYNA 3GC8A 2JD5A 2YAKA 2YM6A 2JDTA 4ZTLA 3SG8A 3A7JA 2OXDA 3BYOA 1ZMVA 5AAGA 5EM6A 4JXFA 5IA3A 3UJGA 3E7OA 5CSHA 3UG2A 4E6QA 3F69A 3L1SA 2C6OA 4J95A 2X9EA 5J5TA 2ZOQA 4PF4A 4ARKA 2KULA 3ENHA 4IHPA 4LM5A 4C2WA 5JEBA 3R8VA 2ZDUA 2XA4A 1H0WA 2BFXA 2W1HA 3QLGA 4F1TA 2HXLA 4TW9A 1CTPE 4RIWB 3RGFA 4HYIA 4O0RA 4FE2A 4O86A 2QOCA 1DAWA 3FMHA 5AP7A 3IKAA 4M8TA 3Q9WA 1MQBA 2SRCA 3W2OA 2XIKA 1LP4A 4RSSA 2BIKB 2RFNA 3MN3A 4YSMA 1WVWA 3KCKA 1PXIA 2WTDA 3UO4A 4G3CA 4FG8A 4L7SA 4JQEA 3V3VA 1UU9A 4O0SA 4R5SA 4RGJA 1J91A 2QKRA 2PMNX 2QOFA 2UZLA 3QWJA 4I4FA 4LGHA 4XLVA 5AUUA 4GIIA 3WYXA 4YTCA 2ERKA 1JPAA 2W5BA 3KGAA 5EHLA 4ZOGA 4ZEGA 3GOPA 4BI1A 3RBWA 3QZHA 4FEQA 4YZCA 4AN9A 1VZOA 3NYOA 5CXZA 2W7XA 3EQGA 2PMOX 4C4JA 3ORMA 4F7JA 3AMYA 4F9YA 1R1WA 1W83A 1SVHA 2YM5A 4GMYA 3TNIA 5A9UA 5IZFA 4O7TA 1CKIA 2I1MA 4I6FA 3QCXA 3AMAA 3VULA 3EN5A 2VTIA 3O7LD 4FSQA 3FHRA 4QMWA 3TZ7A 5IMXA 2UZEA 1W0XC 4P7EA 3G0EA 3EKKA 3FMKA 4YLJA 4DCAA 4HCVA 3T9IA 3FWQA 4J97A 4MHAA 4D58A 3UYTA 4QPSA 3PVWA 4MCVA 4B4LA 4FBXA 2Y9QA 4BHZA 3R1NA 3RHXA 3TNWA 5TR6A 4GJ3A 5HE1A 4I1ZA 2X9FA 5CNNA 2WELA 3DK7A 3PRIA 4IVCA 4EK6A 3LMGA 4BI0A 4IM3A 5HNGA 3OZ6A 2VTQA 3BYMA 3FI4A 3FMNA 3I5ZA 3OT8A 4FV1A 4LG4A 4ZTHA 5DMZA 4MQ2A 5DR2A 4K33A 4LGGA 1QMZA 1R3CA 5ETAA 2X7FA 2CGUA 2OK1A 3GU8A 4GG5A 5CF8A 4O0WA 4Y5QA 4FNWA 3RTPA 3E63A 2ITZA 5J79A 1BLXA 2R4BA 3UO6A 4CMOA 1H27A 1KWPA 3FLQA 3SLSA 4BZNA 4DEHA 5A14A 5HLNA 3DZOA 3TNHA 2WXVA 5IQGA 2XKDA 4H3QA 3G9LX 3B8RA 5EQYA 4BTMA 1H08A 1UNGA 5FP6A 4AN2A 3PLAE 4W4VA 4FIJA 4DEAA 4W9WA 5A6NA 3RNYA 4W8EA 5T6KA 4CV8A 3QTQA 3A7IA 4GT4A 4BCIA 3QHRA 4MQ1A 4R7HA 5IQCA 2CSNA 5CAQA 4YP8A 3EN6A 4QYFA 3UQGA 2FSLX 3M2WA 2UW8A 1H01A 2O0UA 3FPQA 4K0YA 5EM8A 4TL0A 1ZXEA 3VN9A 2RF9A 5ETCA 4O7WA 3REPA 4WRSA 4G9CA 3FAAA 3ZH8A 3TUCA 5CU3A 5ANIA 3SXRA 4V01A 5HQ0A 3HLLA 4QP6A 2XH5A 3VF9A 2WMVA 3PIYA 3VC4A 3PRFA 3VBQA 1OVEA 4QP8A 3MA6A 2XK4A 3V5JA 4M13A 5EDRA 2ZB0A 4XNEA 3MS9A 3EZRA 3KQ7A 2QOOA 5L4QA 1OITA 1KSWA 4LMUA 1JQHA 5C26A 3WZDA 2QNJA 5JK3A 3U55A 3NIEA 4YO6A 3WF7A 2XEZA 3CCNA 2XNPA 4CFXA 5E8SA 3NVKI 4M69B 5HIBA 4WG3A 4C61A 2FSTX 4BCHA 4CT2A 5J7BA 2VO7A 1PHKA 3FV8A 2OFUA 3KXMA 5EI8A 2C5NA 3HRCA 4DEGA 4KRDA 3LQ8A 3P5KA 2UZVA 3EOCA 5M4CA 4BCPA 4XJ0A 4QTEA 5FD2A 5C8NA 1M2PA 2OICA 3BHTA 3AOXA 3PA3A 4FKOA 5HE3A 2QD9A 4YJQA 2IN6A 4JBOA 5FM3A 4JDIA 4WKQA 3AC3A 3HEGA 2H8HA 3QKKA 4UMTA 5ETFA 5D7AA 1U46A 4ZJJA 2ERZE 3HDMA 2B53A 3DFAA 2W9ZB 3N4VA 4DG3E 5I4NA 2Z7LA 3DBCA 4W8DA 1RE8A 1OL5A 2W4JA 3PVGA 3D5UA 3E8EA 3R71A 1ZMWA 4BRXA 2YM7A 2VAGA 4H1JA 5HO7A 2R3JA 4ALWA 3F66A 4QYGA 3NW5A 4DFNA 5J8IA 4I24A 4IM2A 4DFXE 2A4LA 2QG5A 5DT3A 1BUHA 4A4XA 4F4PA 5CAVA 4FKVA 2R3HA 2DYLA 2OZOA 4XG7A 1Q99A 3ZSGA 3K54A 2ITVA 3POOA 3IS5A 4XV3A 2YIXA 2YCSA 1XR1A 4N6ZA 2VTMA 4O6LA 4L6QA 2R0UA 4Y85A 3L8VA 3EFLA 2ACXA 1JKLA 3PUPA 4C3PA 2XNBA 4APPA 4D1ZA 4B99A 4B7TA 2EXMA 3EQDA 2R7BA 2VGOA 5BVKA 4W4WA 4I5PA 1UA2A 3F3UA 3VRZA 4DFLA 3CEKA 2R2PA 4FT5A 4DBNA 2QU5A 1Z9XA 4RX8A 3PJ3A 2P0CA 3HYHA 3NUYA 4DEBA 3OCGA 4JRVA 4IFGA 4JRNA 2GFSA 2X2LA 3QALE 1IAJA 1H24A 2PU8A 3CQWA 3IGOA 5E91A 2W5AA 3NSZA 3F3TA 2CPKE 4FTTA 4QP4A 3VUDA 4Y73A 2W1ZA 2O65A 3G6GA 5EYDA 2CGWA 3MH3A 4J52A 2BCJA 4XEYA 1GZ8A 2BALA 3M42A 4M97A 4O0YA 3WE8A 3ATSA 4YMJA 5BPYA 4JL9A 2BDFA 3GCVA 2YA9A 2RFEA 4PL4A 4UBAA 3U6HA 3Q2MA 4NM0A 3RZFA 1OM1A 2OZAA 4AZFA 2ITOA 3R30A 3BHVA 3W32A 2PMIA 1JSUA 2VWVA 4G31A 3IOKA 3R01A 5AR3A 2J6MA 2BZJA 3DCVA 3GU4A 2ZV9A 3DJ6A 5C01A 5AP3A 4J7BA 5HBJA 3N4TA 3COMA 4WO5A 4MD9E 3RCDA 4M15A 4M68A 3AD5A 3VIDA 4HZRA 4HVHA 4RX9A 2J51A 2DWBA 3UC3A 5C1QB 4RC3A 3W2CA 2VWYA 3KB7A 4EOSA 4YZMA 3D2IA 4AW1A 2XNOA 3LE6A 4TZRA 2VTOA 1STCE 3B2WA 4LOPA 3KKVA 4L45A 1BYGA 1E1VA 3NAYA 2C1BA 1NVQA 3IW5A 4NSTA 2XYUA 4FMQA 4O7LA 2XS0A 3UGCA 4DFYA 1Q24A 2NRYA 1A48A 2WAJA 4BB4A 4C4IA 5HKMA 4F7LA 1XBCA 4EOOA 2C6EA 4IX5A 4FV7A 2WMUA 3VHKA 4DLIA 4EH8A 5T68A 4DGGA 3NS9A 4D2WA 1YOJA 3KCFA 5D10A 5BVDA 4BCMA 1GY3A 2BKZA 2CGXA 4JDKA 4EWQA 4MNEB 5HVKA 5I9VA 1V0OA 4DEDA 4DG2E 3GU5A 2YLFA 3MGYA 4BCOA 4WSYA 1Y6BA 2BRMA 3FSFA 4WD5A 5AAFA 2R3RA 1SMHA 5DPVA 3UNKA 4F7SA 4RT7A 3ROYA 1SM2A 4U45A 4CFVA 2JKMA 2REIA 5AFVA 1AD5A 5CVGA 1PYEA 1QPDA 5HVJA 1GJOA 1YQJA 4BDIA 2VX3A 4BTJA 5E92A 3CC6A 5L6OA 4FC0A 3CY2A 4KRCA 5M51A 2Z02A 2R3IA 3N9XA 3D14A 3QRJA 5DN3A 5AUYA 4O0VA 5BYZA 3ZEPA 2DQ7X 4LQMA 3NMUF 2VX0A 5K5XA 3TKUA 1YXXA 1BL7A 3UMXA 4CXAA 4WUNA 2XRUA 4B9DA 4F99A 1MUOA 2R3PA 5H8EA 3FEGA 2CCHA 4PWNA 3PTGA 4LGDA 5AV4A 4FV0A 4EUUA 2PVHA 4JQ7A 2WNTA 5JRQA 2XF0A 4UZDA 3PXRA 1WFCA 3KMUA 3Q96A 4KIOA 2F57A 3SDJA 1P4FA 3I0QA 4KB8A 4FV4A 5ANKA 4F08A 1KE5A 4P4CA 1DAYA 2XP2A 4IC8A 2B9JA 3RZBA 4CRSA 5DHJA 2XMYA 5M4IA 4YU2A 3VUIA 4ZXTA 3QRTA 4MD7E 4F0GA 3Q32A 4C4EA 3QZFA 4L67A 3SW7A 4APCA 1OKWA 2AC5A 3MBLA 3QTSA 3OBGA 4J96A 4AA0A 3ZMMA 4I94A 4AT4A 3R7GA 2WHBA 4MD8E 4UYAA 3QQHA 2G2IA 3A7FA 5G1XA 4F0IA 3LJ1A 3S00A 3QD3A 5EYMA 5FXQA 4AT3A 4O2ZA 5DT0A 4QYYA 2VTAA 4EQUA 3IK3A 1YHVA 5EW9A 3SXFA 4QT1A 4YLLA 4L42A 5TO8A 5IUGA 2JAVA 3ZYAA 2A2AA 1PY5A 4L52A 3R1YA 5IISA 4GFOA 3EB0A 3EQFA 4EC9A 4MAOA 2B1PA 4OGRA 5IQHA 3H10A 3P7BA 2FVDA 2J0LA 5E8WA 3ZRMA 1F5QA 2WTKB 4RWJA 4GVAA 4GW8A 4IZ7A 2AC3A 1A06A 5BYLA 3KN6A 2IZRA 4GV1A 3DFCB 3OFMA 5LVOA 5I9UA 4WUAA 3SC1A 4CSVA 2W1GA 5J87A 1ZRZA 5AR7A 3ZBFA 2RFSA 4AGCA 3E87A 3JY9A 4DFUA 4XUFA 3ZLXA 4TYGA 1HOWA 2W99B 1UKIA 3HV3A 4YJRA 3RPRA 4X2GA 3TNQB 4QQTA 4C35A 3CPBA 4EJNA 4G2FA 3B8QA 1WBVA 2ITPA 5BNJA 2HY81 4AOIA 3NZ0A 4A4OA 1U59A 4TT7A 4RJ8A 1G5SA 3L9LA 3O8PA 5C03A 4R7IA 3Q60A 4N70A 2OH0E 1PF8A 4KKGA 4DH3A 3G9NA 5L8LA 4S32A 4EHEA 3FLWA 3DBQA 4R3PA 4D4YA 3QCQA 3V5QA 4F0FA 3MESA 3H0YA 2P4IA 4G6OA 2YIRA 5F94A 2ITTA 4YHFA 1XH4A 4BI2A 1OKVA 3V8SA 3AT4A 4AGDA 3VQUA 1E9HA 4UXLA 5LXMA 3V01A 4I20A 5EOLA 3FJQE 2YEXA 3A60A 3SQQA 3MTFA 1K9AA 1CKPA 4HVGA 3C5IA 4S31A 3U8WA 4EZ3A 2UV2A 5HG5A 5A46A 2B9FA 2FUMA 2CN8A 1E1XA 1UU3A 2QR8A 3FLSA 4K6ZA 4UXQA 5E8XA 3RPSA 3VNTA 4I0TA 4BN1A 5HD4A 3FC1X 2XK8A 4NJDA 4HPTE 3JS2A 5KKRB 4Q9SA 5D41A 5GIPE 2VWUA 1M2QA 3ANQA 4QYHA 4AZEA 2C5VA 4LV5A 4OTGA 4BCKA 2QLQA 3TKIA 4F7NA 4QQJA 3RAWA 1XJDA 2XNMA 1J1CA 4BHNA 1Z5MA 4NCTA 4AE6A 4CV9A 1OPLA 3EFWA 3ZHPC 2CGVA 2WU6A 1K3AA 2AUHA 2OH4A 4PTEA 4RJ5A 2BRGA 5JZNA 3T9TA 2ZV7A 2JDOA 3ANRA 3EKNA 3EN4A 3H4JA 2UZOA 3SV0A 2JFLA 4DH7A 2PUNA 5L3AA 1ND4A 3Q4TA 3VVHA 3UPXA 5DIAA 4D2SA 1ZMUA 3O51A 3QCYA 4I6BA 3HA6A 3NVMB 1NW1A 1JBPE 1O6LA 3DQXA 5K9IA 5EKNA 2ITNA 3KA0A 4DN5A 3AC8A 3UMWA 3L9NA 4GYGA 3RM6A 3TZ8A 3RINA 2X2KA 4KA3A 1KV2A 3R7EA 3LLAA 3CTJA 4FKLA 3V8WA 3VUTA 2C0TA 2UW0A 3CGOA 4HJOA 2YISA 1APME 1Q3DA 2I0HA 1YHSA 3QHWA 3HVCA 4NTTA 4A9YA 5AADA 5LMKA 3HUCA 3HV5A 5AV3A 1OUKA 3NLBA 5JRSA 4IBMA 4R8QA 5HVYA 3BPRA 3DLSA 4IVAA 5HG8A 2BRNA 4KS8A 5K3YA 1VEBA 3VS2A 4I93A 4GKIA 4RIXA 4FK6A 3UE4A 3I7BA 2R3NA 2RKUA 2ZM4A 3GEQA 2J50A 3K5UA 4UB7A 4F6UA 2X4FA 3V04A 4ZY4A 3ATTA 4YURA 3BLHA 3IG7A 3OXZA 3F7WA 3DTWA 1HCKA 3MA3A 5JFWA 3VS1A 5BMSA 4RFMA 4Z3VA 1YWNA 2H96A 3BYVA 1Y8YA 4MBIA 3QZGA 4JQ8A 4OT5A 4U44A 3ZUUA 2G2HA 3NPCA 3BEGA 2R9SA 3GQLA 4FSYA 4FIHA 3TM0A 2XK7A 4CG8A 2WZJA 4QTDA 4E26A 4ZSEA 1XH5A 5J9LA 2VO6A 2WIPA 2UVXA 4IX4A 4QYEA 4YJOA 4YJPA 5FBNC 5CAUA 4TNBA 2HOGA 4AW5A 5TF9A 5DE2A 5A4CA 2BTSA 4I6HA 4BDKA 5E9EA 3QD2B 3W2SA 3S2PA 3P1AA 2WFYA 4AX8A 4CQEA 4YPSA 1J7LA 2IWIA 5FTGA 4AGUA 3ZSHA 3CPCA 4D55A 4C2VA 5FDXA 3LMIA 2OIQA 2GS7A 4F65A 5A4TA 4JS8A 1U54A 4RC2A 4CKIA 4OTHA 4EORA 4HVSA 4EWHA 3E8NA 4EOIA 2JBPA 3C9WA 1YI3A 3VUHA 3Q52A 4Y72A 4YZDA 5EQPA 5H3QA 4DBXA 1CMKE 4ZSJA 3KREA 3QD4A 3FXZA 3OOGA 3S1HA 2UVZA 4W4XA 4H3PA 4FTUA 3QQUA 3LZBA 3TACA 4FEXA 4EBVA 3VQHA 4IANA 2Q0NA 3DDQA 4A4LA 3K2LA 3PVUA 5IH4A 3RK7A 3E8DA 4HCUA 3DU8A 5FTQA 5LQFA 3PXZA 5E8UA 4BCJA 1BMKA 2PSQA 4ANSA 4QD6A 3ACKA 3LXPA 5JFSA 4XG3A 4BZDA 4OBOA 2PULA 2V55A 4KSPA 5FEDA 5LCKA 2X6DA 3ALNA 3UNJA 2W9FB 4ANOA 2J0IA 2OU7A 4RG0A 5I0BA 3QF9A 3ZO4A 3FYKX 3FZOA 3MFTA 2OWBA 3I4BA 4C57A 1V0PA 3FXXA 1WBOA 1TQIA 3KXNA 4S2ZA 5CU4A 4IB5A 3W55A 3GU6A 3ZUTA 2OZAB 5EM7A 3QA0A 2PZ5A 5DA3A 4EEVA 2J7TA 1WCCA 1UU7A 1JSTA 2F7EE 3NCZA 2BVAA 2VWZA 2XNEA 3KRRA 2J9MA 2X7GA 3QWKA 4PQNA 3VUMA 5IEXA 5IF1A 4P5QA 2VWIA 4PDYA 4AGWA 4ITIA 1H25A 1JKSA 2NRUA 3QFVA 4FKIA 4NFNA 4YZNA 1W98A 4K1BA 4ZJIA 3AQVA 2JEDA 3Q04A 4XP2A 2JIVA 4DYMA 3F5UA 3A7GA 3W2QA 4I3ZA 2XK6A 4EK3A 4GYIA 3BU3A 4FL3A 2OJFE 3NYVA 3C0IA 3NEWA 2YITA 3LFAA 3SRVA 4EOMA 2ESMA 3JVSA 4TRLA 5EW8A 1Q8TA 4PPBA 4A7CA 4BYJA 2OO8X 3CR0A 1WVYA 4OAVB 1PXLA 4XG4A 4R5YA 2PZRA 5FRIA 3ZXTA 4CYJA 5C9CA 5M56A 5AM7A 3QQKA 5IUIA 5DNRA 4DLJA 4CD0A 2QR7A 2WQEA 2YIQA 3DAJA 2VTNA 2G15A 3UO5A 4NYEA 4O82A 5IKWA 2UW5A 5EI2A 3I1AA 4YHTA 3TNPC 3HMIA 4O7NA 3QX4A 4RJ3A 4WNPA 3H9RA 3R7YA 5K0XA 3EWHA 3DDPA 4L8MA 3TN8A 3IOPA 4I41A 1YDSE 5IG1A 3RM7A 3MIAA 4TY1A 1IAHA 5M09A 2XJ1A 2LGCA 2XIZA 2GHLA 4L9IA 2H34A 4YLKA 4G6LA 4XS2A 2CJMA 4R1VA 4BC6A 4KAOA 3C13A 2HW6A 4AFJA 2XUUA 4J8MA 2RG5A 1PXKA 2XKFA 3RP9A 1IG1A 4GK4A 1PMNA 3WYYA 3AT2A 4RIYA 4ZS0A 4CTCA 2KTYA 3MVMA 3CTQA 3LFQA 1G8AA 2GMXA 2ONLC 3CLYA 3C50A 3MIYA 5AR2A 2QLUA 2C30A 3TUDA 4MNFA 5TOZA 3ALOA 2EB3A 2FB8A 4II5A 4BCGA 4KSQA 3FQHA 4CZYB 3RAKA 3M1SA 3V5TA 2GNFA 2WMAA 2W0JA 4EQCA 3CQUA 3VS5A 4FUYA 4O22A 2PZYA 3COHA 4E4XA 3G33A 1A9UA 4OUCA 4PUZA 4BBEA 3LCSA 2BAQA 3LVPA 3FZTA 3VS7A 4EBWA 2BR1A 2RGPA 3BELA 3ZLSA 4PPAA 4USEA 2HELA 4V05A 3JR1A 2UW7A 3OCBA 3C4XA 3QXPA 5FLFA 2WKMA 5T3QA 4TWNA 3WF9A 2CDZA 3MJ2A 3QTZA 3BQRA 3HMNA 1LEZA 4B8LA 3QC9A 4G3DA 3F3ZA 4OAUC 4AACA 4FZ6A 4FZFB 4NJ3A 3HECA 4O27B 5EK7A 5J95A 4NIFA 5D12A 4FG9A 4QOXA 5HTIA 4KIPA 3TJDA 2B54A 3HKOA 2C3IB 2Y4PA 3EQCA 3BBTB 3QU0A 2P55A 4NT4A 3TJCA 3QQLA 5J7HA 5CVHA 3TXOA 3NAXA 1LR4A 5C4LA 4F70A 3PY0A 4NZWB 5HO6A 3PJ1A 3ODZX 3QC4A 4WOVA 3MH0A 5D1JA 4ERKA 2Y0AA 2YWPA 2CN5A 2X39A 5AUZA 3LFDA 5AWMA 4GH2A 2UW4A 4XP3A 4UV0A 5JFXA 4O96A 5E8VA 2CLQA 3ERKA 4FNXA 4MH7A 3SOAA 4ANBA 3JVRA 4N57A 2Y7JA 3C51A 2I40A 4IEBA 5ETIA 3V6SA 4JX3A 5HU3A 3FL5A 5C8KA 3IW8A 2J0KA 4BY9E 3I7CA 3ZTXA 1OECA 3SA0A 3H9FA 3GENA 2V62A 4A06A 4M0ZA 4OT6A 2UW6A 3TIYA 4HGSA 3PE1A 2HY0A 5F95A 4DGLC 1M7NA 4KS7A 3N51A 2X1NA 4FV8A 2GNIA 1ZYJA 4AQCA 4WHZA 1ZOEA 2UZNA 3OUNB 4J53A 4NM5A 2HWPA 4KWPA 2W1IA 3HDNA 2WTWA 3COKA 5HE0A 3TZMA 3PP0A 4ZMFA 3LJ0A 1VJYA 3PJ2A 4MXXA 4ZS4A 1M2RA 2QO7A 3FPMA 2WQNA 3GCQA 3M11A 4X6QC 1XHAA 2ETMA 3LFBA 4RQKA 1BKXA 1M17A 5DEYA 4NKAA 3DXNA 3GT8A 1T45A 1ERKA 3JPVA 2PZIA 3E88A 4IADA 1XBBA 1MRVA 2BZIB 4BGGA 2BAKA 4QMVA 3BCEA 1VYZA 3H3CA 3MVHA 4FTJA 4WNMA 2F2CB 3OWPA 5E1SA 4OTIA 4A9SA 4EUTA 3BEAA 3U4WA 4FTKA 1WBTA 2XJ2A 2CLXA 1SVEA 2QURA 2XK9A 4EQMA 5IUHA 4H36A 1ZYCA 4CMTA 5HLWA 4TYJA 3C4ZA 1H26A 4OR5A 5DI1A 3VUGA 4EYJA 2ZMDA 3R8MA 4XV9A 4BVUA 1Y6AA 1JVPP 3UDBA 2ZMCA 4TNDA 2JAMA 3A7HA 3FUPA 4ZTNA 3U51A 3BV3A 3UIUA 4N4SA 3R9NA 2W1CA 5HEZA 2PVRA 3CY3A 3W8LA 4C4FA 3LAUA 3FKOA 4CFWA 5AEPA 1FOTA 2IPXA 1W82A 3SOCA 3ULIA 2JGZA 2GDOA 5CX9A 3Q4UA 4BDBA 3BGPA 1DM2A 3P79A 1Q8YA 1IA8A 2FSOX 3QA8A 2IVTA 3FBVA 1P14A 5ANDA 1B39A 3I81A 5CXHA 3D0EA 5ANJA 5EKOA 4AW2A 4RRVA 3MH2A 5L2SA 4FTNA 2R64A 2J0MB 2PTKA 2OFVA 4NCTC 3MV5A 5AUTA 4C8BA 3QCSA 2PHKA 4KIKA 3LPBA 3O50A 2ZYBA 2FH9A 4U81A 5M53A 3LXKA 1XH9A 1YRPA 2HYYA 2R3QA 4IE9A 5HX6A 1FGKA 4FL2A 4L3PA 4L44A 1PMEA 5FWKK 3E7VA 4QMQA 5KMIA 3ZC6A 2JLDA 2GHGA 2WMTA 2XM8A 4JG8A 4ZTMA 3DPKA 3ORXA 2X8IA 2CKPA 3HMPA 2R3LA 4N0SA 4G3FA 1Y91A 4HCTA 4BZOA 5CAOA 2A27A 4D5HA 2Q0BA 2QHMA 5CU0A 2E9PA 3BV2A 4FA2A 4GFGA 2HCKA 3HV6A 4C3RA 2EWAA 3TDVA 2W1FA 5AR4A 3IW4A 3NDMA 3P0MA 5LMAA 5AUVA 3QLFA 4O1PA 4DTAA 4RIXB 3OY3A 5KMOA 4EK5A 2XJ0A 2Y6MA 1U5QA 4JBPA 3RPVA 1IRKA 3ZU7A 5GZ8A 2GS6A 4KIQA 2XIXA 4ZTSA 5J9ZA 4L46A 4PL3A 3PG3A 4NM7A 3ZLYA 4DF3A 2YFXA 3OXIA 3UOLA 4CLIA 2O63A 5EFQA 1ZOHA 4EOQA 4JIAA 3FHIA 4LMNA 4XHKB 2JDSA 5DR9A 1P4OA 2GQGA 2XCHA 4PMMA 4XX9A 2BDJA 3R0TA 4H3BA 4M7IA 1JNKA 1M14A 2LAVA 3TTJA 3UQFA 2P3GX 4H58A 4B0GA 4UEUA 2GU8A 4FEVA 4YZBA 5HI2A 3QQFA 3QAME 3U6JA 5HCZA 4CFNA 4GU6A 4O38A 3NRMA 1REJA 3OCSA 5C27A 3BZ3A 2WO6A 4JDJA 1YWRA 1OL6A 1YWVA 1J7UA 1EH4A 1GZKA 1GZNA 3DB8A 3LIJA 2H9VA 4XOZA 4AT5A 4DH5A 2F7ZE 4FSWA 3BWFA 3NUPA 1SVGA 1YI4A 1KE9A 1U54B 4I5HA 4BBFA 2VGPA 3GC0A 4FSUA 3A8WA 2VUWA 4XLIA 4ZK5A 1U4DA 2VTPA 1KOBA 4YTHA 5CT7A 2GTMA 1KE8A 5CSVA 2GQSA 4FIEA 3CJFA 3DJ5A 4FG7A 4O0UA 4G1WA 3E5AA 3R28A 3RWPA 2PE2A 3QKMA 4IZYA 3C0GA 4CT1A 4MXAA 2WOUA 2IG7A 1YXTA 2FO0A 1H07A 2IJMA 5BYYA 2QI8A 4QPMA 4YC6A 2XK3A 4JR3A 4S34A 3FZ1A 3E64A 3BLQA 4K9YA 4XYFA 3ZFYA 4F09A 1H4LA 2OI4X 3FLYA 3DA6A 4QP2A 4M0YA 2P2HA 2XRWA 2E9NA 1OL2A 3P78A 3V5WA 4X21A 1Q97A 4OW8A 4BDFA 2YHVA 2OIBA 5BQ0A 4FV6A 1FMOE 3Q9YA 4Q9ZA 1PXMA 4X2JA 4C34A 3V5LA 3ZO2A 4BWXA 4FR4A 3R8UA 3WE4A 4FNYA 1LEWA 3TDWA 4IX3A 3GOKA 1OBGA 1YXVA 4RC4A 5KMNA 5I9WA 4PMPA 5M55A 3R02A 5CY3A 5J1VA 4JVGA 3UVRA 1OKZA 4JG6A 1NA7A 3IECA 3MVLA 3BIZA 4IWPA 4HW7A 5FDPA 4MXYA 4WG4A 4NL0A 1WZYA 3ET7A 4L3JA 4TPTA 4A9UA 4CTBA 5AX3A 3BWJA 1WMKA 4M67A 1PXJA 3HZTA 2JDRA 2VV9A 4YUQA 4RIOA 1URWA 2J2IB 4IB3A 5GJGA 4X7QA 2C4GA 2JBOA 3KXZA 3D5WA 1H1SA 2BRBA 2VTLA 3MI9A 1PXNA 3TL8A 3KK8A 3FKLA 2J90A 3QD0A 3UVQA 5BUIA 4NKSA 3MY1A 2PUPA 5BVWA 2R3OA 3LQ3A 4YJNA 4O81A 4RFYA 2RG6A 4U3ZA 1CDKA 2J5FA 4X3FA 3TV6A 4PPCA 2XKCA 4KKEA 4BR3A 1XQZA 1ZAOA 4FSRA 2QG7A 5IQEA 2QU6A 3SRVB 4BTFA 2WU7A 3ID6C 2IVSA 3PLSA 4F9WA 3D5XA 4EI4A 4CLJA 2J5EA 2HAKA 3EL8A 3ZONA 3R83A 4E6AA 3QGWA 3QKLA 4BDGA 3IONA 3BQCA 2WOTA 4ZAUA 4FEWA 3C5UA 3EZVA 4FTIA 3RHKA 3EQBA 1UV5A 4ASXA 4AZTA 5JGAA 4QMLA 4C36A 4X2FA 4IJPA 4M3QA 5GZAA 3QRKA 3L8XA 1REKA 4L00A 1NVRA 5IQIA 3NUAA 4FV2A 1PKDA 4HYSA 4YTFA 4PDOA 5F1ZA 5IQBA 4F1MA 3E3PA 4D5KA 3G6HA 5ANOA 4IFCA 4IDTA 3V8TA 4DITA 4EOLA 2E9OA 4BKZA 2YAAA 4FTRA 3DB6A 2PVKA 4GK3A 2CMWA 4I92A 3CP9A 4TTHB 3PDTA 2VX1A 3E8CA
chains in the Genus database with same CATH superfamily
3NUUA 3NUSA 3GBZA 5CVFA 4WBBB 3AC4A 4ALUA 2YZLA 2HZIA 1OBDA 3FQEA 2A0CX 3W10A 2WMWA 5IQDA 2ITXA 3UIBA 1WAKA 4BF2A 5DOSA 5LWMA 2XIYA 3CD3A 3PPZA 1XO2B 3OW3A 5JMSA 4RIYB 4AS0A 3CJGA 4YJVA 5I9ZA 1WBNA 3OTUA 4G3GA 4NK9A 2ITUA 4TN6A 3FYJX 4Q5EA 4XG2A 1JOWB 5AP1A 4DH1A 4CFMA 4EHZA 4UX9A 1R78A 3DV3A 3EN9A 2QONA 1RQQA 2W05A 1H1PA 2I6LA 2XEYA 3C7QA 3LHJA 4RWLA 4X0MA 4PNKA 1OIUA 3QUDA 4IXPA 2WEVA 4QRCA 1J1BA 4ITHA 5KBRA 2C5YA 4E8AA 5TKDA 4C4GA 4BWPA 1BI8A 3F7ZA 3LM5A 4ACHA 5JN2A 3C4EA 4RWIA 4QP7A 4WNKA 3BYSA 3Q53A 2PVYA 3P86A 2G01A 2RSVA 4I5CA 2IO6A 4RJ6A 4ANLA 5FTOA 4G34A 3GQIA 3FLZA 2J0JA 4RVMA 2WTKC 2R3KA 4FF8A 3JY0A 3EH9A 3SX9A 2VO3A 3R1QA 4U3YA 4ASEA 4D4SA 1YDTE 2YCQA 4I22A 2VTJA 1NXKA 4GVJA 4KNBA 2E9UA 5CNOA 5TT7A 4CNHA 2GSFA 4LUEA 5L8KA 3C0HA 2EVAA 1R0EA 1IA9A 2HIWA 3BYUA 3IW7A 4NIFB 4KUJA 2YM3A 3FL4A 2R7IA 3S95A 2IW8A 4ANNA 2X81A 3BGZA 3BHUA 4XOYA 5L6WL 4M14A 5CANA 4YO4A 1PJKA 1YKRA 3W0MA 3DOGA 3RPYA 1XH8A 3DKGA 1OPJA 4TYIA 5CZHA 3A61A 2ZV2A 3JYAA 4D2TA 4U79A 3AGMA 2YLEA 3KU2A 2NNWB 2UW3A 4RVTA 5CSWA 5CAPA 2GS2A 4LL5A 4GU9A 1YDRE 3EHAA 3QZIA 4GSBA 5FM2A 3ZUVA 2PUIA 3O17A 4JDHA 4RX5A 3KRJA 3PE2A 3I60A 5E8ZA 2C3JA 3VBTA 5LWNA 2C5XA 4G16A 4PP9A 2YWVA 4G17A 4BDCA 5ACKA 3VBXA 2G9XA 4JAIA 2QOIA 3IDCA 5EYKA 5I9YA 1TFFA 3DLZA 3R9HA 4JG7A 3NGAA 5G6VA 1DS5A 1FMKA 1GAGA 3P7AA 4U7ZA 3UZPA 5KMMA 5KKRC 4PMSA 1SYKA 3S4QA 5AIKA 4IIRA 3R7IA 4CCUA 3KRXA 4ITJA 1PW2A 3VAPA 5BVNA 5D11A 2ZV8A 1YHWA 1XH6A 4ACMA 3TMOA 2Z7QA 4IW0A 3LQ5A 4CZUA 4D9TA 3BLRA 2GHMA 2WMRA 4GIHA 2WGJA 4DTBA 2OGVA 2AYPA 3BI6A 4RX7A 3MDYA 5GHVA 2IVVA 1KUTA 1Y8GA 3IDPA 5DLSA 4CEGA 2X7OA 4EKKA 4UY9A 1LPUA 4QNYA 2C6TA 3CXWA 4FYNA 4EH2A 2JIIA 4IAIA 4LUDA 2BPMA 4F1OA 3F3WA 3KFAA 3DKCA 5JFVA 5B2LA 2C6LA 3CKXA 5KCVA 1W84A 4N6YA 3K5VA 3UIMA 1UNHA 4D1XA 4BWKA 5FQDC 1FGIA 3I5NA 4FKTA 5KZ0A 5E4HA 4V0GA 2BROA 3QYZA 4PDSA 1PMUA 3BKBA 3OEFX 3PWYA 1ZYDA 3UP7A 4AE9A 2GNGA 3F6XA 5CSXA 2JITA 4BIDA 4NU1A 3S3IA 1OIYA 5GZ9A 3OP5A 2CNQA 4FT3A 4LOQA 3VS4A 3SXSA 4GEOA 3I0OA 4JIKA 5IA5A 4EHGA 5IDPA 1G3NA 1WBSA 2PWLA 4XG6A 5CZIA 5JZJA 4RWKA 2WD1A 4QMMA 4MXZA 3UBDA 3D9VA 4YJTA 3ZO1A 5AP4A 3PVBA 3RKBA 2CKOA 3F61A 3BHYA 5GNKA 3DY7A 5EYCA 1OL1A 4RJ7A 4DGOA 4YSJA 4QMUA 5AR8A 4JT3A 3LLTA 3DTCA 5HTBA 2PVJA 1UKHA 5BVOA 3ZSIA 1JSVA 2UZUE 4KIKB 4QP3A 2QOLA 4UMQA 1GNGA 4FKGA 4E7WA 5HCXA 5HESA 4AXEA 4UMRA 3FDNA 4BTKA 3RK9A 2A1AB 4AP7A 3F82A 2XCKA 4XRLA 3D7ZA 4M84A 2PVLA 3OWLA 4WT6A 5A54A 5KUPA 4FOBA 3RK5A 4EONA 1JLUE 2QO2A 3WF5A 5A4EA 5DYJA 1FQ1B 4F9AA 3BE2A 4MKCA 4QMNA 3VW6A 3MH1A 5KHXA 3KEXA 4JBVA 3OCTA 4C59A 1Q8UA 2QOBA 3AT3A 3PIZA 3CD8A 4BYIA 1NT2A 3FXWA 5GJFA 2JKKA 1VR2A 4DGNA 2WQMA 4IM0A 4C33A 4CGAA 3H0ZA 4EH4A 1URCA 3BX5A 4ID7A 2PYWA 5ANEA 2ZFYA 4DHFA 2PUUA 2ZAZA 3MFSA 4EOPA 2XBJA 2B9IA 4B8MA 1Y57A 5KX8A 2CNVA 3EIDA 4YBKA 5FXRA 5KMLA 1OPKA 3P08A 4X2KA 5LVLA 3RNIA 5M4UA 2NP8A 2FSMX 4EJ7A 3GFEA 3GFWA 5ACBC 5FUTA 3OVVA 4FTOA 3ZZEA 3AXWA 1RW8A 3LFNA 5FXSA 2WTVA 5L2WA 5EDPA 2OSCA 2QVSE 4FRFA 3AC5A 2VWBA 4PY1A 1YOLA 1BL6A 3R7VA 3MB7A 5HBEA 3EJ1A 4FKUA 3UNZA 3L9PA 3PXFA 1QPEA 4C4HA 2B7AA 3IO7A 5CYIA 4E73A 1Q4LA 4EOKA 4OBPA 3KULB 4J98A 4AF3A 2I0YA 5M44A 3JXWA 3CTHA 2Z7SA 4F9BA 3ZS5A 1R39A 5AV2A 3QL8A 4DINA 3OT3A 4FV3A 3Q9XA 5CSPA 3R21A 2GCDA 1MRUA 2X0OA 4DH8A 3RWQA 4PP7A 1FVTA 4RZVA 2QCSA 2C0IA 4DHIB 3EN7A 2HZNA 4H39A 4LDTA 1W7HA 4USDA 1Q62A 3UTOA 2W17A 3KVXA 3GB2A 3QQJA 4WIHA 2VRXA 5CF6A 3F2RA 1H28A 4JLCA 3IW6A 1L3RE 3RJCA 2CCIA 2BUJA 1JKKA 2JDVA 3DNEA 3WARA 5A3XA 4YTIA 4QPAA 4E3CA 1OGUA 2BZHB 3GCPA 1V0BA 5E8YA 1GIHA 4FK3A 5CQUA 3ZOSA 4H05A 3HL7A 3MW1A 5F20A 3VW8A 1H0VA 3UIXA 2PMLX 3D5VA 4ACDA 5JGBA 5L6PA 4BGQA 2GNHA 5HO8A 1QPJA 1MRYA 3WILA 4BGHA 4KABA 4UMUA 4I0SA 4TWCA 4ZSGA 5KNJA 3WZUA 3Q6UA 3Q5ZA 4AUAA 2OJIA 4BCNA 4O84A 4DG0E 5M57A 2W06A 1PRYA 2BZKB 5D9HA 2QO9A 3HX4A 5KE0A 2XIRA 5JGDA 5GJDA 3NCGA 1CSNA 3HAMA 4GUEA 4EH6A 4J8NA 4Q5HA 3DQWA 4E5BA 3QTUA 2F7XE 1SNXA 4PMTA 3MFRA 4DT9A 3FY0A 3VF8A 4AZVA 4AA5A 3JUHA 5CU2A 3CIKA 4L7FA 5HG9A 3KXGA 1S9JA 3QRUA 4C3FA 1S9IA 5CENA 3FMDA 3HP2A 4RZWA 4TYEA 2VWWA 3QX2A 4QP9A 3F2NA 3KIOC 3HP5A 1B38A 4UYNA 4EH9A 4R77A 1KE7A 3Q4CA 4AW0A 4X3JA 3QUEA 3CGFA 5EHOA 3ZLWA 5K0KA 5B2MA 4QDVA 3PY1A 4FKRA 3CE3A 1TQMA 5FGKA 4BDEA 2PVMA 5BVEA 5L2QA 1OMWA 4X3FB 5AJQA 3COIA 3IDBA 4CKRA 2OG8A 5HCYA 4IMYA 2CNUA 5AA8A 5CEMA 1IEPA 1OIQA 3SAYA 1ZY4A 4X3FC 3E93A 2UZTA 3T3VA 2ITWA 2V5QA 3NNXA 4E5WA 2EUFB 3P23A 4IJ9A 5JH6A 1L8TA 4PNIA 5CS6A 4RVKA 3O8TA 5CEIA 5CASA 3HAVA 3OD6X 2VO0A 3HMMA 3R04A 3LFCA 4ZZMA 4D2VA 3VJNA 4O4BB 4Q2AA 3LJ2A 4NW6A 4UWBA 4YC8A 2PVFA 1V1KA 3PXQA 4MK0A 3KXXA 2B9HA 2Z60A 2ZB1A 4U43A 3LCTA 3FI3A 3CS9A 3G90X 4ZSLA 3TG1A 4IZ5A 2WMXA 3HV4A 4WNOA 3F5GA 3RMFA 4QMPA 4GG7A 4BIEA 4FVPA 2WTIA 2VTTA 3EQIA 3DBDA 5AM6A 5FG8A 4CCBA 2GQRA 2X2MA 4E1ZA 3LXLA 3R6XA 5EQEA 3O23A 4FSMA 4JNWA 2YACA 4IACA 1PXPA 4MWHA 4RA5A 4ZZOA 5IA1A 3UPZA 3D15A 5CEPA 4TKSA 4C62A 2QC6A 3D83A 3HGKA 4FTMA 1QCFA 4A9RA 2V7OA 4D4VA 4FGRA 4KKHA 5EDQA 4P90A 3R9OA 3VWAA 3UQCA 3PJCA 4FICA 3S0OA 4FZAB 4TYHA 4HYHA 3W2PA 3DJ7A 4ANQA 4Y8DA 5AA9A 1TQPA 5DVRA 4V04A 3DAKA 3BU5A 3WOWA 2GNLA 5AV0A 4HGTA 3R9RA 5E1EA 2HWOA 3QYWA 2WMSA 4KBCA 4CFUA 2C47A 3UVPA 1YXUA 5DWRA 3PZEA 3LCKA 4EYMA 3NUNA 2YN8A 4EH7A 3D7TA 4FIIA 5AP6A 3QTXA 4LRKA 3C4CA 4YBJA 2IW9A 3ZRLA 3C1XA 5JKGA 2ZM1A 3DNDA 3BE9A 3GNIB 3MYGA 3PFQA 4I6QA 4PTGA 3QXOA 4ZTQA 5HTCA 4XMOA 4ZSAA 3ZM9A 2J4ZA 5KHWA 1LUFA 2BIYA 2BKKA 4XV1A 2OJGA 3AD6A 3W8QA 3WIGA 2W1DA 3K3JA 4FUXA 4Z55A 2QOHA 1WBWA 4PTCA 1YI6A 3G0FA 3F5XA 3OG7A 3DK3A 4FTLA 4HZSA 4FEUA 2WMQA 1DI8A 1XWSA 1JAMA 3V51A 4BKYA 3WZEA 3UOJA 5CEKA 5EW3A 1G8KA 3TI1A 2PY3A 4FKPA 3F2AA 4R1YA 5I9XA 4HNIA 5HZNA 5L8JA 2W4OA 5L2IA 2VD5A 3QQGA 1H8FA 4X6RA 5M06A 3NNVA 2Z8CA 4AWIA 4QMYA 3UOHA 5HIEA 4USFA 4UWCA 1RDQE 4HGEA 5AR5A 3KY2A 2WMBA 1F0QA 3KVWA 2XNGA 5H9BA 2WEIA 1W2CA 3EYGA 3KN5A 5CF5A 2ITQA 2WTJA 4ENYA 1O6KA 4NFMA 4HNFA 2XVDA 4MTAA 1BI7A 2ETRA 3DZQA 2E9VA 3TCPA 2W1EA 3ZEWA 1XMMA 2C0OA 4NUSA 4CMUA 5K4IA 4KBAA 4E20A 3FMMA 3W16A 3RCJA 3UZTA 4C02A 4Z9LA 1MP8A 3R1SA 3EQRA 3OTVA 3TWJA 3G2FA 4R7BA 4ACCA 4K77A 4K11A 3U87A 4G5PA 4BKJA 3IGGA 3QTRA 1PMVA 4FVQA 3AGLA 4FKWA 1J7IA 4L43A 2UVYA 4MXCA 5JQ5A 3U6IA 1NY3A 3UZRA 3MPMA 4HVIA 4XG9A 2R0IA 4GL9A 4FL1A 4LFIA 3E3BX 4O2PA 3QBNA 5ANGA 3W33A 4BCQA 5JSMA 3PYYA 2YJSA 3Q3BA 5IEYA 4MBLA 5LJJA 2NO3A 1GZOA 2ZDTA 4C7TA 2VN9A 3AMBA 3WIKA 5LVNA 2XZSA 3OW4A 3GVUA 2EXEA 3C4WA 4V0GB 2CKQA 3G15A 4DEIA 1OUYA 4FX3A 4QTCA 4U5JA 5FEEA 3TV4A 3UDZA 1XH7A 5H8BA 3VBYA 4J99A 4NH1A 4YNOA 5HOAA 5DH3A 3OWKA 4DEEA 3KXHA 1P5EA 3NFFB 3ZC5A 3LCDA 4QEBA 3BHHA 3NNUA 5LOHA 3UYSA 3A8XA 5LMKC 3PA4A 2JKQA 5EI6A 5IA0A 2PZPA 2Y4IB 3LW0A 1ZYSA 4WSQA 5HICA 3PY3A 4E6CA 4FKSA 3UOKA 1XKKA 4P2KA 4OTRA 4DGMA 3ODYX 5E7RA 3RPOA 4C58A 5JT2A 2Y4IC 5DEWA 3P5JC 4FOCA 2W5HA 4IAKA 3ACJA 3O96A 3WZKA 3OOMA 5FEQA 3C4FA 4O7ZA 4U8ZA 4HPUE 5DGZA 5F4NA 2YZAA 3VBVA 4C0TA 5DBXA 3HUBA 1OZ1A 3FQSA 2A19B 4FZDB 2EU9A 4FKQA 2HXQA 5H2UA 3U9NA 4PX6A 2UZWE 2YABA 4XBRA 4K8AA 3ZDIA 2B4SB 4RMZA 3V5PA 4E4LA 3KULA 3VS0A 3PFYA 3R7UA 3LXNA 5EG3A 3MSSA 2AEGA 4ERWA 3OEZA 5EM5A 4GRBA 5TE0A 1XMLA 1ZZLA 3ROCA 3GI3A 1IASA 2PL0A 3POZA 3R2BA 3U4UA 5CF4A 4PRJA 4FJVA 3D2KA 2F49A 4BDHA 3TKHA 2OIDA 4P5ZA 4QQCA 5I3OA 4GUBA 5HGIA 2HW7A 1VYWA 2OW3A 4IAAA 3KRLA 4BDAA 3ORLA 5C8MA 4O91A 4OTQA 4QMSA 2C6KA 2YDIA 2HZ4A 2B0QA 3I79A 4EC8A 3FE3A 2VU3A 4O7YA 3L8SA 3WZJA 5FBOA 1FINA 4AU8A 5LVPA 2IZSA 5AIRA 5KZIA 5HIDA 3EQHA 3PSCA 2UZDA 2XBAA 3TUBA 2R3FA 3FMLA 4FT9A 4IAFA 4I4EA 3VUKA 4R3CA 2R3GA 3ORNA 5M4FA 2FYSA 5KO1A 4J71A 3ORIA 4XBUA 3L9MA 3II5A 2C6IA 4XP0A 2P33A 3O2MA 3BLAA 4DCEA 2QKWB 3O0GA 4FTQA 4G6NA 3UODA 2UZBA 4CZTA 5HORA 5IMEA 4JR7A 3L8PA 3ORKA 4F63A 1KE6A 2F4JA 1OI9A 2XB7A 3GCSA 3MPAA 3BU6A 4GT3A 4KBKA 1ZWSA 1OGYA 2B52A 3RVGA 3LOKA 4QMZA 5E8TA 3U54A 2YJRA 4FTAA 4O0TA 4EK8A 3GP0A 1OB3A 3WF6A 4IVBA 3O8UA 4NEUA 3I6UA 3ZFXA 3OF0A 5IQAA 3SGCA 2YM4A 4PL5A 1X8BA 3P9JA 4BICA 4FZ7A 4HGLA 3BRBA 4MF1A 4Z16A 4RLKA 3NUXA 1XBAA 2RL5A 3R8ZA 4TXCA 1UNLA 4K18A 5HE2A 3W18A 4F64A 2UUEA 1GOLA 3Q5IA 4Y95A 3UP2A 2V0DA 3GC7A 4K2RA 2O2UA 1ATPE 4FODA 4OTDA 2IVUA 4G9RA 2O64A 1FVVA 4QP1A 3ZCLA 4D2RA 5IH6A 3VS3A 4RPVA 4W9XA 1W2DA 3R7OA 3CSVA 3GXLA 4AZWA 3R8LA 2DS1A 4OLIA 4F78A 3PP1A 3MVJA 4MF0A 2X8EA 2EXCX 2YDKA 3NX8A 4ONAA 4DFZE 4ENXA 1CKJA 2BRHA 1H1QA 2IZTA 3FZSA 4JX7A 4L01A 4O0XA 4I0RA 3SD0A 3TV7A 5BX0A 5IA4A 2ONLA 4RLLA 1H00A 3DT1A 2YIWA 4ANMA 4EZ7A 4ZY5A 5EHYA 2QHNA 4RQVA 4U42A 4RIWA 5CI7A 2R3MA 4C38A 1HCLA 2BFYA 4U40A 3NW6A 3P4KA 4WRGA 5AUWA 3SKCA 3V6RA 4AA4A 4ZZNA 4BJJA 4Z7GA 1Q5KA 2YDJA 3HRBA 3UG1A 4GJ2A 2ITYA 2NPQA 2XNNA 1O6YA 2BHHA 4OTWA 5IA2A 4FNZA 4DDGA 5BMMA 3EMGA 3HA8A 1PYXA 3VS6A 3MY5A 3ZFMA 2BAJA 4I21A 3AC1A 1T46A 4IX6A 5KBQA 3A62A 3SVVA 3DXPA 4QMXA 2PPQA 5EH0A 1AQ1A 2E2BA 3FLNC 1UWJA 2YCFA 4O7SA 3PPKA 3FZRA 1O9UA 4WG5A 2ETKA 1Q41A 4UZHA 4JJRA 4X2NA 5A4QA 5HLPA 3R63A 2C5OA 2PVNA 4QMTA 2OXXA 5HNBA 5M08A 2XM9A 4HVDA 3ORPA 4O83A 1ZZ2A 4XG8A 1GIJA 2HK5A 4ZJVA 4IDVA 4E5AX 5AP5A 3IPHA 4HYUA 4QNAA 4YR8A 3FI2A 1Q3WA 4IWDA 5A6OA 5BUEA 3AC2A 2C6DA 4FTCA 4LL0A 4B6LA 5B2KA 4FIFA 3RI1A 4EK4A 1KOAA 4WA9A 3A2CA 2OJJA 4IB0A 3E62A 4WBOA 2X8DA 4AOTA 2IZUA 2X4ZA 3UC4A 4IAZA 3VO3A 1M7QA 1JWHA 2CKEA 3KRWA 3NNWA 4C37A 4DA5A 5AAEA 5HNIX 4U97A 3R73A 4FT0A 2O5KA 3ETAA 4E93A 5IH5A 1GIIA 3TT0A 5F9EA 2W4KA 5AP0A 3QRIA 3ZO3A 4L53A 3HV7A 2G1TA 4UMPA 1DI9A 5CU6A 4FV9A 5J1WA 3OC1A 3FMEA 4I23A 5DFPA 4DTKA 4EHVA 3K3IA 3BGQA 4XV2A 4KD1A 1Q61A 4RVLA 5BUJA 3RAIA 2RIOA 2Y6OA 3QTWA 2GPHA 4Y83A 1IR3A 5BVFA 3LKMA 4IC7A 4GKHA 3PWDA 3MTLA 3VHEA 3P7CA 3O7LB 3ZDUA 2RFDA 3DS6A 4S30A 5IEVA 1M52A 2BHEA 5CLPA 3NIZA 4IB1A 3FI8A 4JAJA 3GCUA 4YZ9A 4ALVA 4QQ5A 2VZ6A 4TYHB 2EB2A 5IQFA 4MWIA 4UWYA 5B7VA 2VWXA 5LARA 4CKJA 4FVRA 2QOQA 3GUBA 3ORTA 2GTNA 3PA5A 3R8PA 4EH3A 5AMNA 2FA2A 3KK9A 3QUPA 4CRLA 3DBEA 1I44A 4IVDA 4IAYA 3MY0A 5CI6A 5EOBA 2QQ7A 3D7TB 3F88A 4J1RA 2QOKA 5C4KA 1YXSA 1QL6A 4M66A 5IPJA 4GS6A 3G51A 3DKOA 3CQEA 1TVOA 5AUXA 4ZP5A 3F5PA 1P2AA 4OTPA 3ZM4A 4PV0A 4BL1A 4IQ6A 4D0WA 2I0VA 4IWOA 1FVRA 1H1RA 3R9DA 4LV8A 4D0XA 4FYOA 3PSBA 3GU7A 4ZTRA 2WTCA 2C69A 3GGFA 5JQ8A 5L2TA 4FV5A 5E90A 2VTRA 1FBNA 2YIYA 4G3EA 3SW4A 4I5MA 4D1SA 4RFZA 2GNJA 2FGIA 3DXQA 5CTPA 5CALA 3EQPA 3A4PA 3KF4A 4AXCA 3VJOA 4M69A 4TWOA 1R0PA 1Q8ZA 4MEDA 4MYGA 4OBQA 4L3LA 4YPDA 4HOKA 4YGAA 3ZZWA 1KV1A 1J3HA 4JBQA 4LRJA 3VBWA 4DFBA 3MJ1A 5HHWA 4LOOA 4ASDA 3W2RA 5LVMA 3EFKA 4FSNA 5K4JA 1YVJA 3Q2JA 4CQGA 3HRFA 3R2YA 4PDPA 2HZ0A 3DBFA 5DRBA 1Z57A 3WBLA 2I7QA 2F2UA 3PXYA 4BDDA 5CQWA 2OBJA 3W0RA 3GC9A 5J5SA 4ORKA 4FIGA 3MB6A 3PG1A 3R22A 3EYHA 3QGYA 1UWHA 1SNUA 1UVRA 2ZM3A 4S33A 4TWPA 4LYNA 1ZOGA 4ZMEA 4GFMA 4G5JA 2C3LA 4MBJA 4ASZA 2G2FA 2OJ9A 1OIRA 3MPTA 5HBHA 4R78A 2OLCA 4D9UA 4RJ4A 3A4OX 2IW6A 2JC6A 3TIZA 1U5RA 2BTRA 4UALA 4XCUA 3WI6A 1NVSA 5A4LA 2VNYA 1TKIA 3PXKA 4RBLA 5D7VA 4NWMA 1YOMA 3H30A 4U41A 4EOJA 1F3MC 1B6CB 3F3VA 2BILB 3OXTA 2OKRA 4O21A 2YM8A 4FI1A 3I6WA 1OKYA 3G5DA 4ZLOA 3FMJA 3Q4ZA 3KMWA 3DK6A 4BBMA 4EH5A 4QMOA 1QPCA 4BCFA 4FGBA 3OBJA 2PE1A 1W8CA 4FT7A 5CT0A 3VRYA 4ACGA 4YJUA 4AOJA 4EKLA 3N4UA 4AAYA 3D94A 4QTBA 3SHEA 5CEQA 3WF8A 4AN3A 3OY1A 3ZRKA 1RJBA 3T3UA 3HNGA 3NW7A 2O3PA 3ENMA 3MWUA 1YW2A 3NR9A 4IH8A 2Z2WA 5IDNA 3DKFA 1K2PA 1PKGA 2JKOA 4U0IA 4A9TA 3T8OA 3IQ7A 4D28A 5I5ZA 4U9AA 4O7VA 3ZBXA 3U9CA 1ZARA 5LCJA 3TZ9A 2JIUA 5J9YA 2XKEA 4Y5HA 3OUKA 4L68A 3RAHA 4O1OA 3NWWA 4YHJA 3TTIA 3CKWA 4BFMA 3PPJA 5HU9A 3OWJA 3B2TA 4UN0C 2V22A 2X0GA 3KL8A 4XRJA 4AAAA 1I09A 5M07A 2YERA 4YNEA 4F9CA 3HMOA 5AX9A 2OF4A 2I0EA 4NW5A 3NYXA 2PE0A 4NM3A 4BDJA 3AKLA 3O71A 2V7AA 3LMHA 2BDWA 4IZAA 3PJ8A 3AG9A 4O4DA 5AP2A 2Q83A 3ZXZA 5FP5A 2JFMA 3ULZA 4GT5A 2PK9A 5DT4A 5ICPA 4ZY6A 2O8YA 4CYIA 2OXYA 4D2PA 1BX6A 2WQOA 2C1AA 2ZJWA 1JKTA 3PZHA 4E4NA 3KMMA 4D4RA 3KC3A 2C3KA 3CBLA 5LMBA 3QTIA 5CWZA 5IU2A 3EL7A 4FKJA 2UW9A 4F6SA 3BL9A 3KF7A 4DE4A 3AD4A 5HD7A 1SZMA 2WPAA 1CM8A 1Q8WA 2W96B 3SG9A 4CFFA 4CVAA 4LRMA 4EL9A 4ZLYA 4AXAA 5CEOA 4E4MA 2OF2A 2YCRA 1FPUA 2R5TA 3LFEA 3ITZA 4MX9A 4E6DA 2WQBA 2Z7RA 5DG5A 5H8GA 4Z7HA 3W0NA 4CG9A 5K5NA 1ZLTA 3FZPA 4XH6A 4Y46A 3OMVA 4AG8A 2CHLA 4O7RA 2VNWA 3W1FA 1ZY5A 5GIOE 3OS3A 1MQ4A 3D4QA 1ZYLA 5I3RA 4DAWA 4M12A 4JI9A 4OTFA 3F9NA 4H1MA 3ELJA 1H1WA 3PSDA 2HENA 5HX8A 2WB8A 5B0XA 4MNEA 2Y8OA 3RALA 3TEIA 3FC2A 4W4YA 3LFFA 3THBA 1UU8A 4FSTA 4R3RA 3LM0A 3FSKA 4EZ5A 3EFJA 2X6EA 2F9GA 3DGKA 4RA4A 4A07A 4U80A 1VLRA 3OHTA 3R00A 4LI5A 3MFUA 3FY2A 3LCOA 5DR6A 4DT8A 2XYNA 5HG7A 1WVXA 3DAEA 5KMKA 4ZLZA 5KMJA 5GINE 4FSZA 4QO9A 3FKNA 2C6MA 3PIXA 4MXOA 4BIBA 5DRDA 4F6WA 2WIHA 2VTHA 4R6VA 4O6EA 2B55A 1PXOA 3Q6WA 3E92A 4JMQA 4U6RA 3Q9ZA 2VTSA 3A99A 4YJSA 1G8SA 3ORZA 4GK2A 2BMCA 4JOAA 4YC3A 2P2IA 5AV1A 3H9OA 4ZIMA 4NTSA 4DC2A 4KINA 2GFCA 4IWQA 3BBWA 2H6DA 2QODA 2C68A 1AGWA 2ZVAA 4GCJA 4QTAA 1OL7A 4AZSA 2DUVA 1WBPA 4AFEA 3LFSA 4MVFA 3OROA 5ITAA 3NYNA 3GC8A 2JD5A 2NYAA 2YAKA 2YM6A 2JDTA 4ZTLA 4MUQA 4LV7A 3SG8A 3A7JA 2OXDA 3BYOA 1ZMVA 5AAGA 5EM6A 4JXFA 5IA3A 3UJGA 3E7OA 5CSHA 3UG2A 4E6QA 3F69A 3L1SA 2C6OA 4J95A 2X9EA 5J5TA 2ZOQA 4PF4A 4ARKA 2KULA 3ENHA 4IHPA 4LM5A 4C2WA 5JEBA 3R8VA 2ZDUA 2XA4A 1H0WA 2BFXA 2W1HA 3QLGA 4F1TA 2HXLA 4TW9A 1CTPE 4RIWB 3RGFA 4HYIA 4O0RA 4FE2A 4O86A 2QOCA 1DAWA 4BJJB 3FMHA 5AP7A 3IKAA 4M8TA 3Q9WA 1MQBA 2SRCA 3W2OA 2XIKA 1LP4A 4RSSA 2BIKB 2RFNA 3MN3A 4YSMA 1WVWA 3KCKA 1PXIA 2WTDA 3UO4A 4G3CA 4FG8A 4L7SA 4JQEA 3V3VA 1UU9A 4O0SA 4R5SA 4RGJA 1J91A 2QKRA 2PMNX 2QOFA 2UZLA 3QWJA 4I4FA 4LGHA 4XLVA 5AUUA 4GIIA 3WYXA 4YTCA 2ERKA 1JPAA 2W5BA 3KGAA 3BL7A 5EHLA 4ZOGA 4ZEGA 3GOPA 4BI1A 2X0PA 3RBWA 3QZHA 4FEQA 4YZCA 4AN9A 1VZOA 3NYOA 5CXZA 2W7XA 3EQGA 2PMOX 4C4JA 3ORMA 4F7JA 3AMYA 4F9YA 1R1WA 1W83A 1SVHA 2YM5A 4GMYA 3TNIA 5A9UA