1M7NA

Crystal structure of unactivated apo insulin-like growth factor-1 receptor kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
305
structure length
299
Chain Sequence
SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor I receptor
publication title Crystal structure of the Apo, unactivated insulin-like growth factor-1 receptor kinase. Implication for inhibitor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m7nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m7nA01
3DNDA 4M67A 3OXIA 3VS1A 3ATTA 2R3RA 4FV2A 5EG3A 1EH4A 1STCE 3DOGA 3KN6A 3QU0A 1OGUA 3ACKA 4PF4A 4QYYA 5EI2A 3RAIA 3VAPA 4AQCA 4BICA 3R8ZA 4D9UA 2Z7LA 4NIFA 5HBEA 5ANGA 4AT4A 3H3CA 4CT2A 1WBNA 4UXLA 4JOAA 4F0GA 3UVQA 2G01A 2RKUA 4FIEA 2R3LA 3B8QA 3JY0A 4IACA 2X6DA 3WIKA 1IEPA 4EJNA 2XK3A 3TCPA 1H08A 3AD5A 3QTUA 5BVWA 4MHAA 5DR6A 1ZYJA 3DZQA 3GCUA 2CKOA 1ND4A 4FSZA 1YWRA 3ZONA 3EH9A 1ZMUA 4YBJA 2PHKA 3E88A 3FLYA 4KINA 5EYDA 4CFVA 5FEDA 3O17A 3ORTA 2X9EA 4NYEA 4FT5A 2DYLA 4AACA 5BVEA 4IX4A 4U0IA 3DFAA 4YJRA 5IH4A 4G1WA 2XCHA 3Q4TA 3U51A 2FB8A 4FEUA 1F5QA 3OTUA 2OW3A 3RNYA 4AZFA 4HYIA 2FA2A 5F94A 4JRVA 3N9XA 3VBYA 5IMEA 3A7GA 5CU6A 5KMJA 5IH5A 5HVKA 5ICPA 3ALOA 5J1VA 2BZIB 5CNOA 2CKPA 4FV4A 4NT4A 3PXYA 4YJOA 3FZSA 3A7IA 4XG9A 3P0MA 5LXMA 3PIXA 4FTCA 4CCUA 4XP2A 4ACCA 3PSBA 4LOPA 3CJGA 5T68A 1LR4A 4GFMA 4GK2A 4L3JA 4MWIA 4OBOA 4R6VA 3TG1A 1PXJA 1JKLA 4NUSA 4E5BA 4UYAA 4DT9A 3MSSA 5A14A 3OS3A 5HLPA 4FEVA 1YDSE 4GEOA 4JX3A 4EH8A 3RAHA 4CZUA 2Y4PA 4FG9A 4CKIA 4M15A 4PRJA 2ERZE 4HYUA 2JD5A 4CTCA 5BUIA 4DF3A 4NTTA 1OL5A 5ANKA 4YLJA 4EQUA 3F2RA 3LMHA 4FUYA 1MRYA 2QR7A 2CGVA 4TYHB 2WMQA 5L8JA 3UC4A 3ODYX 2UW7A 3ODZX 4YC6A 2YAKA 4W4YA 3ACJA 5IDNA 3TNPC 4MAOA 5CT7A 5HICA 3QX2A 3EFKA 3NUUA 3HMPA 3QHRA 3QRIA 3DGKA 4ONAA 4F6UA 5JFWA 3ANQA 4QPAA 2A0CX 4GIHA 4IAFA 3NGAA 3LFNA 3KXZA 2I0HA 4EK5A 3E87A 1PMEA 4NSTA 3VULA 2WFYA 3FLSA 2XKFA 4E4MA 4QMNA 5AUWA 1Q8WA 4UMUA 3M11A 2IVSA 4QO9A 4XP3A 4J96A 2I7QA 3F6XA 1U5QA 3HV3A 3TUCA 2FH9A 4YMJA 3BKBA 3VBTA 4O0UA 1Q5KA 2Y4IC 4YSMA 3RZBA 3V04A 3S1HA 4O21A 1JSTA 5KMLA 4D2PA 3R8UA 4FOCA 1PRYA 2JGZA 3ZSGA 1REJA 2YITA 3KN5A 3BLQA 4IVAA 2YCRA 4FODA 4AXAA 2OLCA 4FT3A 3TV6A 3SXFA 1ZMVA 1DI8A 4RIWB 2GCDA 2FSTX 2XNOA 2XJ1A 3COMA 4JAIA 3ZZWA 4E6CA 2W1EA 2XBAA 3NUXA 4G5PA 3ZRKA 4U41A 1OBGA 2W1ZA 4FV0A 5IQEA 4D5HA 2RFEA 3TNQB 3PVUA 2BDFA 2R64A 4O6EA 3ZO1A 4FYNA 3AGMA 3Q4CA 4EHGA 2G1TA 3FE3A 3NUNA 4V01A 5C8NA 2JDSA 2XNNA 1BKXA 4NW5A 3ZC6A 4BTKA 2QOHA 4MNFA 1MQ4A 3Q5ZA 4ZS4A 3QZGA 4BY9E 5HORA 2W5AA 2HZNA 4WD5A 3V5JA 4DGLC 3E64A 5JFXA 5AP0A 1R39A 2Y4IB 3DBEA 4GG7A 5L6WL 2XCKA 3VUIA 3ZRLA 2GS6A 4M14A 4N6YA 5DRBA 4ASZA 1W83A 2AC3A 3P78A 4EQMA 5CZIA 4LYNA 2W96B 3KRRA 3MW1A 4TNDA 3TZ7A 3PPZA 3P7AA 4FKRA 5KE0A 3F3VA 4AA5A 3DK7A 3FQHA 4YHFA 5AAFA 1MRUA 5IISA 4QPSA 5E8ZA 5HQ0A 4D4YA 1ZXEA 3LFSA 1Q4LA 4HYHA 4RRVA 1H1SA 4Y8DA 4MD9E 2Y6OA 3C4ZA 3PA3A 5CSVA 4D0XA 4BHZA 4AF3A 5CU2A 3PY1A 2C6IA 2JIIA 5EDQA 3ATSA 4HYSA 3DY7A 5D7VA 5CAVA 1UWJA 4BCOA 3VS4A 4WG5A 5DNRA 5EOLA 5F95A 2ITOA 3BYSA 4LOOA 5D1JA 3QL8A 4QPMA 5M55A 1OKZA 2UV2A 4ZTRA 1JOWB 3LVPA 4RVKA 4FSQA 4WUNA 4AWIA 3CPCA 5E8WA 3EMGA 3QUPA 4MF0A 4R78A 4RMZA 4AZTA 5EI6A 1J7LA 4HGTA 3R30A 5C4KA 5FLFA 4CMOA 4JBPA 4IX5A 2V5QA 3D7TA 3EHAA 5AIRA 2VTAA 3D4QA 3WZUA 3R22A 5BVDA 4C4HA 5ANIA 2UZEA 3OD6X 5JFVA 2IPXA 1Q3DA 3ZXTA 1W84A 4ZTMA 4QMWA 4PTCA 2C6TA 2YZAA 3QUDA 4QMLA 3U9NA 5CEPA 4F08A 4D4SA 3R9HA 4RJ7A 4IJPA 3O8UA 2VWUA 2PVJA 3CGOA 2FSOX 3FQSA 3U9CA 2OWBA 3PXKA 2CGXA 3R63A 3PVBA 3IKAA 4LL5A 1WBWA 4G16A 3ZMMA 3EL8A 4IC8A 3DB6A 4OTWA 4F9WA 4U45A 4A4LA 4AZWA 3GEQA 5AA9A 3A60A 3VHKA 5CI7A 2BIKB 4DC2A 4O82A 5KCVA 4FIHA 4QP4A 2BHHA 3R7OA 2YIQA 5DT3A 5JSMA 1SYKA 2ZV2A 3VS5A 3ORXA 4AFEA 4C37A 4H36A 4FZDB 2HAKA 3BYVA 3FPMA 5IPJA 2F7XE 1GZOA 4MEDA 4ACDA 3KKVA 3GXLA 4B0GA 5I5ZA 4PDPA 4LV5A 3UP2A 3MN3A 2Z8CA 4LL0A 4HVIA 2OO8X 3SXSA 3I81A 1U59A 5KZ0A 4NTSA 4YJUA 3AD6A 4RBLA 4CZYB 3H30A 5FM2A 3EN7A 2EB2A 4A4XA 4AAAA 4C4IA 5EW8A 1Q8UA 4ZXTA 4RQKA 3BHYA 4Y73A 3DK6A 4YURA 5CXZA 2YCSA 2QOCA 5E9EA 1UU7A 2CSNA 2VO3A 5CEIA 4O7TA 4ALWA 2R3PA 3RHXA 3QRTA 2OJJA 4CFUA 3GC0A 3RM6A 1V0BA 3QQLA 2W99B 2WZJA 4E4NA 5LVPA 3KVXA 4GKHA 4FK6A 4A9RA 2JFMA 3MH2A 1V1KA 3DBCA 2A1AB 2GHGA 4EZ3A 3W55A 2PULA 5K5NA 4UWBA 3PP0A 3KREA 4WNMA 3KULA 2YIXA 1OI9A 4FKUA 2V22A 4DEBA 4MCVA 2SRCA 4W9WA 2X2MA 4AGCA 4HVGA 1YHVA 1W82A 3NDMA 4KWPA 5GZ8A 1XH4A 2JFLA 3BU3A 4XP0A 3SRVA 4YGAA 3PJ1A 4FKOA 4F7JA 5JEBA 4BZDA 4GKIA 1PY5A 3PTGA 5EDPA 1OPLA 2BUJA 2YJSA 4WNOA 2HYYA 4IAIA 2ITWA 2QOFA 3MVMA 3HDNA 1UNHA 2HCKA 3KK9A 2PK9A 5A4CA 2OJFE 2UZBA 3TNWA 3ZDIA 4AX8A 1Q8YA 5KMOA 4GUBA 1KV2A 1YKRA 2ZYBA 2J50A 4CVAA 2OG8A 3FI3A 1BX6A 4BCKA 3Q4ZA 4L6QA 2OFVA 5CVFA 2VTSA 3L9PA 1REKA 1Q8ZA 4BKZA 4C36A 4D9TA 4RWLA 2C47A 4Q5HA 2WU6A 4C8BA 4L68A 4K2RA 3FUPA 4WRSA 3PG3A 5CENA 3C4EA 4F9YA 2R5TA 3RWPA 5E91A 3BU5A 2OBJA 3KY2A 4XV9A 2C3KA 3PJ8A 4G6NA 3NW7A 5AM7A 5AX9A 2O5KA 4K6ZA 4FSNA 4AN2A 3VUTA 4KS7A 3R9OA 1OPKA 5A6NA 1SNXA 4M66A 2BRBA 2WMSA 3QHWA 4M0YA 4M0ZA 3A7HA 3P5KA 2CNVA 2QR8A 2WMBA 5AV4A 2W1GA 4PDOA 4BL1A 3FZ1A 3JS2A 4RG0A 4EH6A 2W1HA 4RVLA 4X6RA 5TR6A 2HIWA 5IMXA 2VO6A 5FDPA 2ZMCA 3LXNA 2ITNA 2ERKA 4HPTE 5LMKC 3HMOA 1OKWA 5M4IA 3EQBA 3OY3A 3ORKA 4CRSA 4JBOA 2KULA 4JT3A 5K3YA 3V01A 3OHTA 5G6VA 3GB2A 1KSWA 2UW6A 3QKMA 1Q24A 3VUMA 3ULZA 3QF9A 2J9MA 2DUVA 5FP6A 4DCAA 3HNGA 3ORMA 5E8YA 4DTAA 5AP5A 1VYZA 2PE1A 2V55A 2XIYA 3HMMA 3MB7A 3VW8A 2V7OA 5CU0A 4DT8A 3EJ1A 2QG5A 4C3RA 5D10A 2YJRA 2C6LA 2ZB0A 4IWDA 3HA6A 3IW4A 2P2IA 5AX3A 4C57A 4B7TA 1UNLA 5FP5A 1OBDA 3RPYA 5A3XA 3FZPA 4PY1A 2YM7A 4ANSA 3UNKA 3H0ZA 2XIZA 1JLUE 2C6MA 5GJDA 3RK7A 1NY3A 1JQHA 3TXOA 4CKRA 4EK3A 3I0QA 2XNMA 2BRHA 4RGJA 1E1XA 1H27A 3ANRA 2A19B 4USFA 5AR3A 4UBAA 4BDAA 3COIA 2UZTA 1O6KA 3WF8A 4AGDA 3TM0A 3F69A 2YERA 1UNGA 2R3KA 3DTWA 4JLCA 1DM2A 1P14A 3IONA 1PYXA 4UY9A 4ENYA 5DEWA 4F63A 5M51A 3LCKA 4APPA 4PMPA 1QPCA 4C4FA 2YIYA 2QONA 1NVQA 1Y8YA 2XEYA 1PXMA 2J0KA 2WPAA 3R00A 4ID7A 3MI9A 4XX9A 4PNKA 5CALA 1VZOA 5BMMA 2OZAA 4EQCA 4ALVA 2YEXA 4G3DA 1Z5MA 1BMKA 4JVGA 4MXXA 4QP6A 3MY1A 1RDQE 5I3OA 4FZAB 3UTOA 2UZUE 5KNJA 3EL7A 5HX6A 2C30A 5LCKA 3OG7A 4OT5A 1P2AA 2FO0A 2E9OA 4FF8A 4IWQA 4OBQA 2HELA 3LCTA 2YACA 1AQ1A 4ZS0A 3SC1A 2WB8A 3KA0A 4FL3A 4OTPA 4QRCA 3DK3A 3LFFA 1IAHA 2QO2A 5FEEA 5AUUA 5HZNA 1TVOA 3VC4A 4GJ3A 5HCYA 4KIOA 4LRKA 4P2KA 2W1FA 2OK1A 2F2CB 1K3AA 1OITA 3A99A 1YOJA 3KQ7A 4YP8A 3FYJX 3ZSIA 4R77A 3EN5A 5AAGA 2G15A 3CKWA 4MYGA 3VBXA 4L45A 3HECA 2B7AA 4O38A 1Q3WA 4QQ5A 5HESA 3ZLSA 3FI4A 1SM2A 3LZBA 2X2LA 4W9XA 4MQ2A 4RX5A 2QI8A 4R7BA 3FLWA 2Y0AA 4TY1A 1Q99A 3NUYA 2VNWA 3FKOA 3OY1A 3PPKA 4K8AA 4UZDA 3CEKA 4FIJA 3VUHA 2ITYA 4QMXA 3AQVA 2YISA 2JLDA 3DNEA 3M2WA 4L46A 4RIOA 4XG6A 4XS2A 3DBDA 1Q62A 4OAUC 4JR7A 4U6RA 4BDFA 5D12A 3I6WA 3N51A 4GIIA 3WZJA 2X8IA 4FSYA 3A7FA 4X3FC 4O86A 3IOPA 3K5UA 4ZZMA 3SLSA 2C6OA 4R5YA 2CGUA 4BCFA 4DH3A 3U87A 1JSUA 4DYMA 1M7QA 3EQDA 4CQGA 4NWMA 3W2CA 2G2HA 5CAQA 4X6QC 3PJ3A 4O2ZA 1YI3A 5CTPA 1K2PA 2C6DA 3WF9A 2J5FA 1NW1A 4P5QA 4FVRA 4TTHB 2WNTA 2VTNA 4QMYA 1GJOA 2A2AA 4WT6A 2VGPA 4DH1A 1R0PA 1YQJA 4RIXB 4NH1A 4RLLA 5EK7A 5LARA 5CI6A 1LUFA 1PKDA 4I5CA 4J7BA 1A9UA 5ITAA 2ITXA 4S34A 5EFQA 5CEOA 1FMKA 5HLNA 2YM4A 2OJGA 4BDIA 4FT0A 3TEIA 4JX7A 5J79A 4JDJA 3HYHA 2VX1A 2J4ZA 3I5ZA 5CVHA 4C3FA 2YDIA 2XIRA 2JDTA 4X3FB 2NPQA 3C5IA 3DBQA 5CSWA 4AP7A 3OXZA 3BLRA 4UEUA 4BIDA 4CNHA 4D2TA 2XVDA 4G3FA 4NCTA 3MYGA 3COHA 3V5WA 3RINA 3QRJA 5KO1A 4W8DA 3HMIA 4IE9A 5HBJA 1V0OA 3RPOA 3WYYA 4Z9LA 4R3CA 4ACMA 4B8MA 2X4ZA 4DG2E 5EHLA 1WVXA 4PPBA 2BALA 4Y85A 3E3PA 4K18A 1YVJA 4K11A 4BWKA 4EBVA 4QMVA 1VR2A 2VWYA 3WYXA 4CRLA 3UG1A 2QC6A 3G2FA 4FG8A 4PL4A 5J8IA 5B2KA 3R9RA 3MTLA 5DE2A 4K0YA 4OT6A 1FINA 4Q9SA 5C01A 4FZ7A 4E8AA 3AG9A 4YJTA 3GVUA 4FV9A 3OCSA 3RBWA 2JKQA 4OTFA 5A4EA 5BYLA 2I6LA 4X2KA 2JIUA 4RWIA 5AM6A 1XO2B 4ACGA 3UG2A 3DQXA 3KL8A 2VTOA 4PDSA 3ZSHA 2PUPA 1T46A 4FV8A 4BYIA 1YXXA 4IWOA 1UA2A 3FY0A 3MFSA 2QOOA 3S0OA 2ONLA 2JBOA 4JQ7A 2VTHA 3R2YA 3RK5A 2HOGA 2XIXA 2W1DA 3LJ1A 5JGBA 3A4PA 1X8BA 2B0QA 4Y83A 3MBLA 4ZP5A 3QRKA 3TJDA 3I7CA 2OZAB 4YJVA 1P4FA 4DFNA 4KBKA 4E1ZA 5AADA 1PKGA 2WTWA 4J95A 5AR7A 2X8EA 3V51A 4TT7A 4A07A 4U8ZA 4UMPA 4LMUA 4PDYA 5FTGA 4AOTA 4M68A 4GCJA 1DS5A 4OTHA 3D0EA 4F70A 3BE2A 4NM5A 3WZDA 4N70A 2GNFA 4NK9A 2ZV9A 2JDRA 3KFAA 3PXZA 2J51A 2BKZA 3LM0A 4APCA 4EOMA 3D14A 4TYHA 5HCZA 3N4UA 1QMZA 3DPKA 5AP1A 4IVDA 4IMYA 3BGQA 2QNJA 1JKTA 2VU3A 4I93A 2IZSA 3F3WA 5M09A 5EKOA 4BBMA 4CFMA 5BVNA 4MD7E 4WUAA 5AV1A 5LMAA 3ZTXA 3GFWA 2VWIA 5F4NA 5L2IA 2VTQA 4BYJA 3Q6WA 3LJ2A 4YC3A 4Z7HA 1YXUA 2JDOA 3RTPA 4F9CA 4Q2AA 4O96A 3PRFA 5HIDA 5DA3A 2XZSA 2QOIA 3UVRA 2O3PA 4JDKA 4RA5A 5M53A 4GH2A 3FHRA 4C4GA 2Y7JA 3PZEA 2BAQA 2UZVA 4LOQA 4ZJJA 3W16A 2PVHA 4FV3A 5CU3A 3WARA 2VTRA 2PPQA 3FC2A 4DTKA 4Z3VA 4FE2A 4FKLA 4B8LA 1NVRA 4EH3A 4O0XA 2XP2A 3TWJA 4PV0A 2XB7A 3BLHA 3ZU7A 2CKEA 2E9PA 2H8HA 4TYIA 4O7SA 4GL9A 1WBVA 2PY3A 4IZAA 4MNEA 4RIWA 4BWXA 3WI6A 4NCTC 1JBPE 3KCKA 3H4JA 4BCNA 3V5QA 5GIPE 5LVLA 5DYJA 5CT0A 5IQAA 4BI1A 3EFLA 4IBMA 4N4SA 1FGKA 3NYNA 3HV5A 4Y5HA 4ANMA 3C1XA 2YWPA 3MDYA 3R7GA 4QYHA 3EWHA 4LUEA 3LCSA 4PMSA 3TUBA 1J7UA 3TL8A 4EK6A 3M1SA 5LVMA 4BB4A 4M7IA 2J90A 4MVFA 1J1BA 2Y8OA 3C9WA 3P08A 4QMUA 3FXWA 5CF5A 4FK3A 2Z02A 4RFYA 3JYAA 1H1RA 4UXQA 5AJQA 3BPRA 3S95A 5HIEA 5I9UA 4C58A 3NNVA 3NVMB 3OT3A 3BYUA 4BDEA 2F7EE 3LCOA 3TI1A 4EKKA 3JR1A 4AZVA 2ETRA 3MJ2A 5T3QA 1BL7A 2YHVA 3GC8A 3VWAA 3OROA 4J99A 5LOHA 2QG7A 1LEWA 4MXYA 4NW6A 2BTRA 3C7QA 2ONLC 4HNFA 4I24A 1TQPA 4O0TA 4D4RA 4O0VA 3OOGA 5EM8A 4WOVA 5AFVA 4DH7A 1R1WA 3QXOA 2BZHB 4QP1A 3VS0A 4FT9A 3K3IA 1RJBA 3LMGA 4HGLA 1XBAA 2OF2A 3QCYA 4IM0A 4WO5A 4CEGA 2IZTA 1A48A 3ZUUA 4FKIA 4HVDA 3BWJA 3U4WA 3GQLA 4ALUA 4BGQA 4L52A 4OLIA 5EH0A 4EHEA 1QPJA 3LFQA 1ZY5A 4RJ3A 2R3JA 1DAYA 1SVHA 2GS7A 4I22A 4G9RA 5JZNA 1RQQA 4ZY4A 3NIEA 1ZYLA 4X2FA 5AUZA 4EH9A 5KMMA 5IQBA 4FKPA 3TTIA 4RVTA 2VX3A 1Y6AA 3MB6A 1GIJA 1FGIA 3AC4A 4GT5A 4DEHA 3HX4A 3R01A 1R3CA 3CE3A 1W8CA 3F5XA 1Y8GA 4J8MA 1GAGA 4GK3A 4IB3A 3LQ8A 3MH3A 3UZTA 1FBNA 3UYTA 3QD0A 1E1VA 2JKOA 4JQ8A 2X6EA 5J87A 4E26A 2XYUA 4C2WA 4RX7A 2O64A 2VWVA 2Z7SA 3QGWA 1PW2A 1H28A 4XBUA 3S3IA 4O1OA 2JKMA 3GU6A 3A4OX 5L8KA 4ARKA 3FJQE 5H3QA 4QP3A 3MVHA 4MXCA 5E90A 3QRUA 3DJ5A 3P86A 3KEXA 4BKYA 4AOIA 4OTDA 4MBIA 5AUVA 5A54A 1V0PA 1QCFA 3BIZA 3QGYA 2HW6A 1WVWA 3KB7A 4KKEA 3VVHA 2JC6A 4XG3A 4D2WA 4NM3A 3NRMA 3VJOA 2WQNA 1SZMA 4PPCA 3PVWA 5I9WA 2XH5A 3QD3A 4C02A 4CT1A 1OB3A 2PMOX 4GU9A 5JN2A 2CMWA 2YFXA 3NPCA 3HV7A 4I20A 3FXZA 3POZA 2XUUA 2IZUA 1S9JA 4S30A 1IA9A 5AV2A 4F6SA 2VAGA 3AT2A 4KKGA 3FMHA 3R1NA 4NM0A 2PSQA 5F1ZA 3QCSA 3ZHPC 4O7ZA 3QUEA 3R8PA 5M08A 5L2QA 5LMBA 5DT0A 1Z57A 4M84A 3A62A 5AEPA 1OL7A 3C4XA 4KSPA 5JMSA 1OMWA 2OIDA 5C4LA 4I3ZA 3LJ0A 4K77A 4RC4A 5B0XA 4M12A 2C68A 4WNKA 2WMWA 4YZ9A 4D2VA 5AA8A 1H26A 5BUJA 3IOKA 4FL2A 3HV4A 4O6LA 4QTBA 4QYEA 5J7HA 3TDVA 5IA5A 5IF1A 3S2PA 4YTFA 4MNEB 5IEVA 1M17A 4KUJA 3CQEA 1G8AA 4K33A 5ANEA 5M44A 4YJQA 4XV1A 2PVKA 4DCEA 3FYKX 4DLIA 5FUTA 3C4WA 5L6PA 3ERKA 1KE7A 3C0HA 2B9HA 1OECA 3UZRA 2GDOA 1G5SA 3RHKA 4GW8A 2ZVAA 3T9TA 1S9IA 4I94A 4AT5A 4O7LA 4ANQA 5TE0A 3CXWA 4RFMA 4C3PA 5KHWA 4XJ0A 4YC8A 2GQRA 3Q2JA 3NAYA 3DU8A 2ZM1A 4E20A 3MPAA 3GI3A 2CLQA 2GTNA 3OC1A 2ZAZA 4RX9A 4DEDA 3Q5IA 4BBEA 5HO7A 3CTQA 5JRSA 3QLGA 2HZ0A 1M2PA 4JG7A 3C4FA 5E1SA 4PL3A 4WA9A 5HD4A 2YM3A 1VYWA 2YAAA 3MTFA 4HJOA 4L44A 3SDJA 4AW0A 5IQDA 2BIYA 4Y72A 4CMUA 3PYYA 1R78A 2BZJA 4UV0A 4FTOA 2UW9A 3JUHA 1YW2A 2QLQA 1GZNA 5HG5A 2YIRA 3E5AA 4LMNA 4EOOA 2OZOA 4IB1A 4TXCA 5BYYA 2UW3A 3QTWA 4WBOA 3KF4A 3UO6A 2W9FB 3H0YA 3JXWA 4DAWA 2NNWB 3COKA 5EHOA 4RIYA 1JKKA 1M2RA 1YI6A 4JIAA 5KMKA 4ZEGA 1MRVA 4DH5A 3HEGA 4U7ZA 3AD4A 4IM3A 3Q2MA 5AR8A 4OTGA 2R3GA 3BYMA 1IAJA 2E2BA 3DA6A 3U8WA 3V8WA 5HX8A 2W5BA 3QD4A 1CKIA 4KA3A 2OU7A 4L3PA 4C35A 4NU1A 5DH3A 1GZ8A 3EKKA 4JG8A 2R3OA 3GU8A 3MS9A 2C0IA 3U6IA 3HP5A 4ZJVA 5M06A 3VN9A 5CASA 4DH8A 2X7FA 4DEAA 4F65A 4FKQA 2HZIA 4JAJA 5IUGA 4UB7A 5EQYA 1OL2A 3E92A 2CNUA 3NUPA 4I1ZA 3LKMA 1U46A 1U54B 2C0TA 5ETFA 2BRMA 1BYGA 2WELA 1OIRA 2REIA 3HUCA 4JNWA 3ZC5A 4QTEA 1YWVA 1G8SA 4AN3A 4D1SA 2X39A 5B2MA 4YZNA 4DTBA 2WMXA 3EFJA 4JI9A 3SV0A 3RAWA 3QBNA 4DEIA 4YO4A 3IG7A 5L2WA 2PZYA 2HW7A 1ZOHA 1OPJA 5H8GA 1CM8A 3MESA 1YDRE 3QXPA 5AUXA 1FOTA 3EN6A 5C8MA 3EZVA 5C9CA 3UODA 3REPA 4FEWA 2XK7A 4FC0A 4D1ZA 1PMUA 4XBRA 3N4TA 1F0QA 3CBLA 4ZSJA 4YNOA 4FL1A 1KV1A 3CTJA 4KD1A 4O7VA 5H8EA 2QOQA 2ITUA 2DWBA 2J0JA 2WTKC 4FTLA 3QCXA 2WMAA 3MIAA 5A4QA 4U80A 2W0JA 5BMSA 1P5EA 4O0RA 1F3MC 5HNIX 3C50A 3UNZA 3DXQA 2YLEA 3BHUA 1W7HA 5E8TA 3W10A 5LMKA 4DGOA 3KU2A 4H58A 3AXWA 3KXHA 2VV9A 3UIMA 3C5UA 3ENHA 4BDDA 3K3JA 2H6DA 2J5EA 3G9LX 5BYZA 5BX0A 3WF7A 2RSVA 3HRFA 4U43A 2R3NA 1JNKA 4GT3A 2WIPA 4A06A 3ZZEA 4I92A 3WBLA 2C1BA 4G9CA 5JT2A 2F2UA 3MPTA 2PZIA 3DDPA 5CAUA 3UPZA 3SA0A 4DBXA 3OW4A 4EI4A 2X9FA 2QHMA 3CQUA 4U9AA 3OEFX 2QHNA 3L9NA 4R5SA 5LWMA 3H9RA 4FVQA 3KVWA 3RI1A 1Q41A 5HU9A 2WTKB 2CKQA 3OWLA 3BQCA 3HL7A 4ENXA 3FY2A 4GMYA 1M14A 2VWZA 2WTDA 4UMTA 3UJGA 2UZWE 3LM5A 3R7IA 3DLZA 2X4FA 4JDHA 1Y91A 4IIRA 4ASXA 3QTRA 5CSPA 3O2MA 3NVKI 4ASDA 3UOLA 3D5UA 3Q96A 3Q9XA 5CX9A 3GENA 4TL0A 4O27B 4UMRA 4PTGA 3R1YA 4G34A 2WXVA 4CZTA 4BI2A 3GGFA 2B54A 3RVGA 4K1BA 5C1QB 2OICA 2I40A 4LUDA 3BI6A 2EXEA 3OCGA 3UYSA 1H07A 5KBRA 5LJJA 4WHZA 3UOJA 5LVOA 2QLUA 3LFCA 5J9LA 3G6GA 2PVNA 3LCDA 5M4UA 3ZS5A 3F7ZA 3TIYA 3OWPA 4RVMA 3TV7A 1JWHA 3UDBA 2CHLA 2UVYA 4KABA 1CKJA 4QMOA 4EOSA 2HWPA 1BI8A 4QMSA 4CSVA 2VWBA 4R7HA 3HAVA 3MGYA 3UVPA 1PYEA 4AU8A 2Y6MA 2P33A 1WFCA 2BR1A 4ZZOA 3PY0A 2CDZA 3EYHA 3IGOA 3DJ6A 4B6LA 4BFMA 4I5HA 3EYGA 4ZLYA 3W2PA 3PE1A 1UU9A 2VO7A 3QALE 2JIVA 4JG6A 4JBVA 4ZJIA 3QQGA 3MY0A 1H00A 1NVSA 1QPDA 3ITZA 5I4NA 4EC8A 3RAKA 4ZMEA 3QQFA 1B39A 2GU8A 4OTQA 2CGWA 4RIYB 3F5PA 4YZBA 1E9HA 4XRJA 5EKNA 3FSKA 2QKWB 2ITPA 3V3VA 5CAPA 4XNEA 4N57A 2ZOQA 3R9NA 3GFEA 1YXSA 3AT3A 5K0KA 4GRBA 3OT8A 4H3BA 4EOPA 3AMYA 4RIXA 5FRIA 4FV6A 4N6ZA 3SD0A 5E8VA 1M2QA 5IA1A 1H1QA 1Q97A 2I0EA 4UX9A 1O6LA 3CGFA 4XG7A 2QODA 4XG4A 2UVXA 5ETCA 3BX5A 3LIJA 3TJCA 5GNKA 2C69A 2JDVA 3D5VA 5DFPA 3ULIA 1H0WA 2BCJA 5E1EA 3ZLWA 3TKUA 3GU4A 4X3FA 2EU9A 3LFDA 3IW5A 2GNJA 4IZYA 5HO6A 1ZYCA 3PXFA 4PX6A 3L8SA 3IS5A 1KE5A 4RFZA 1XH6A 3VUGA 3DQWA 3T8OA 2ZJWA 3TZMA 4YLKA 3DB8A 2GS2A 4DINA 2C5XA 4OGRA 5F9EA 4E5WA 1J91A 4IM2A 5AMNA 3LMIA 1SVEA 3OUNB 2IVVA 2VWXA 3Q32A 3UOKA 3K2LA 5IA0A 1L8TA 4ANBA 3HKOA 4E6DA 4Z7GA 3TACA 4S2ZA 5HI2A 3BZ3A 2XKEA 3GOKA 3OCBA 4GU6A 4U5JA 3UMXA 3ZO2A 3PDTA 4DHFA 1ZMWA 4BCGA 2BAJA 3F5GA 5ETIA 4F1MA 5B7VA 5M4FA 2O8YA 5IDPA 1JVPP 2VZ6A 5FBNC 4FI1A 3FL4A 3RKBA 5AWMA 2F4JA 2FSMX 1XBCA 4BCPA 5FTQA 5CWZA 4BTFA 3POOA 4RLKA 3FMLA 3ORZA 5HO8A 3L8XA 3NYOA 3NLBA 4LG4A 4ZSEA 3CY2A 4H3QA 1VEBA 2QU6A 2R7IA 4D2SA 4IAKA 4PL5A 2O63A 1Q8TA 4NZWB 4RC2A 2WQBA 4GVAA 5C8KA 5JZJA 3FMDA 2F9GA 5BPYA 5TT7A 2G2FA 2P0CA 4O7RA 5A4TA 1W0XC 3GT8A 2EB3A 4I0TA 5GZ9A 3ZBFA 2WEVA 5DIAA 4IEBA 2AYPA 1CKPA 2PMLX 2QD9A 3MH1A 4DBNA 5L4QA 3VRZA 4I23A 2VNYA 2XBJA 4BDKA 2NO3A 2R4BA 3U6HA 2VTLA 3NNXA 4IAZA 4AT3A 2ETMA 4BIEA 2R3FA 2WAJA 2PZPA 4BF2A 3NAXA 2WQOA 3Q3BA 3B2TA 2R0IA 4IZ7A 4V04A 2C6EA 3V5PA 3BEAA 2WIHA 4A9UA 3E8DA 5HOAA 4DITA 5E92A 3U55A 3QWJA 2EWAA 5CVGA 3R83A 4K9YA 4QMZA 1OL1A 4TRLA 4BDJA 5IA4A 3TDWA 2R2PA 2JEDA 3F9NA 2WOTA 3L1SA 4ANOA 1XQZA 3E8NA 4KB8A 4O2PA 4J71A 1ZLTA 4OUCA 5HTCA 2C5YA 4DFYA 4YHJA 4QNAA 4ACHA 5F20A 2XA4A 3Q53A 2VGOA 3R04A 5DG5A 2ETKA 5DBXA 1J3HA 3Q60A 4E5AX 3IW8A 4USEA 2IVTA 3MV5A 4S32A 4XRLA 3QKKA 4KRCA 4F1OA 5GZAA 1IA8A 4CD0A 4IWPA 5J7BA 3PG1A 3IQ7A 4FV7A 3MVLA 3RALA 4NFMA 4AA0A 3O0GA 3PIYA 3W2QA 3WF6A 3UQFA 3UGCA 4YJSA 4CCBA 3DBFA 4U3ZA 2ZM3A 4OTRA 4ZTLA 4CV9A 4DG0E 5BVFA 3EQGA 4BC6A 4W4WA 4R3RA 2BDJA 2E9UA 3FLNC 3PY3A 2WMTA 5T6KA 3SHEA 3KMMA 5DN3A 3BU6A 4GUEA 3RP9A 4MQ1A 4EWHA 5M07A 1PMVA 4L42A 4FUXA 5DI1A 4MD8E 1TQIA 4D2RA 3P9JA 3LW0A 4FG7A 4J8NA 3VUDA 5HE0A 3ROYA 4EHZA 4ZSAA 5JQ8A 5L3AA 2HENA 3D7ZA 4I4EA 1L3RE 3QYWA 4JJRA 3LFAA 4LGHA 4YSJA 2XYNA 4FNWA 4QNYA 3ZH8A 3DKOA 3GBZA 4DGNA 3I60A 3NWWA 4EUTA 4RPVA 3BRBA 3PPJA 4CGAA 4ZIMA 2OSCA 3KXNA 4A9TA 4DA5A 3DKCA 3EB0A 2XMYA 4QTAA 3PXQA 5KMNA 5TF9A 4IAAA 2G9XA 1H24A 1ERKA 4RJ6A 3OOMA 4CLIA 4LI5A 4TPTA 4F9AA 5IA3A 4EUUA 3IGGA 4LM5A 3QC4A 1H25A 5HG9A 1P4OA 3PE2A 3R28A 2WQMA 4FYOA 4PP7A 3QTIA 4ZSGA 1KWPA 4QP8A 4QOXA 4D58A 5I9YA 3NX8A 1U4DA 4YBKA 4TWPA 2UZOA 3PUPA 5IEYA 3R71A 1M52A 1YRPA 2GSFA 3TZ8A 4MXOA 1UKHA 2EVAA 1PXKA 3TKIA 4EYMA 1OVEA 4S31A 4FIGA 5L6OA 1KUTA 4ZLOA 3HRBA 3UOHA 5L2TA 3ZRMA 2XK4A 3NS9A 4HGSA 3ID6C 1H1WA 1XH7A 2PUNA 3FMNA 2WKMA 3QWKA 3DXPA 2WTVA 4F7LA 4FICA 4U40A 2QOBA 1RW8A 1WBTA 5HIBA 2BAKA 4AE9A 4LV8A 1IR3A 1JAMA 2HY0A 3VO3A 5I9ZA 4FKSA 3IDPA 2ZV7A 4DLJA 1JSVA 3Q4UA 4E4XA 2PVLA 2R9SA 2XNPA 4LRJA 5BVKA 1QL6A 5HKMA 3UC3A 3G0FA 3L8PA 5FG8A 3RCDA 4NKSA 5DT4A 1YHWA 1Q61A 5CYIA 2P55A 5M57A 3E7VA 3ZFMA 3OUKA 4P7EA 5AR2A 4HGEA 3NYXA 4USDA 4PMMA 1CDKA 3M42A 3OTVA 3QZFA 1URWA 4TNBA 3FWQA 3R1SA 3Q04A 4FNXA 3E63A 3GCPA 5TOZA 2OJIA 4QTDA 2AC5A 1BL6A 3ORNA 4C34A 2UW4A 2FSLX 2C6KA 2QOLA 3EN4A 2BRNA 4JBQA 2EUFB 4PP9A 4Y95A 1ZOGA 3MVJA 1UWHA 3SQQA 3VQUA 4IX3A 4BDCA 3DJ7A 3IDCA 3Q9WA 3H9FA 3VIDA 3QTQA 5CSHA 3ZFYA 5HNGA 3TV4A 5A4LA 5IUHA 3SKCA 4RWKA 1UV5A 4V0GA 4TN6A 3ENMA 4AW5A 4CYIA 4MBLA 3FZRA 3ORIA 3FMMA 3PWYA 3TNHA 3C51A 4FSRA 3D15A 1XHAA 4BBFA 4ITIA 4Y46A 3F88A 3I4BA 4X7QA 3EQIA 3RJCA 4EEVA 1APME 3I1AA 4ZAUA 3B8RA 3FPQA 2IG7A 3G90X 5IG1A 1HCLA 4HW7A 4BCMA 5IZFA 5BUEA 1YDTE 4F0FA 1HOWA 2HWOA 2UW8A 4RZVA 1OIUA 4CTBA 4XV3A 2Z60A 4FTAA 3IK3A 4IXPA 4L3LA 4WG3A 3CCNA 3O50A 5DR9A 1YOMA 3G51A 4AW1A 2P2HA 3D5XA 3HLLA 3UE4A 5CQWA 2VTMA 4P5ZA 3TTJA 3PIZA 5JKGA 4M69B 4NKAA 2CCIA 1YI4A 2G2IA 2YABA 5H8BA 5KKRC 2PYWA 3SX9A 2OI4X 1VJYA 3D5WA 3MFRA 4L01A 4MWHA 4CMTA 1CMKE 3U6JA 4BWPA 3OWKA 4FA2A 2XEZA 3F66A 4H39A 3E7OA 1H1PA 1XH9A 4C0TA 4O1PA 5DMZA 1PXOA 4IJ9A 1TKIA 4NM7A 4IX6A 4FV1A 3UPXA 3WE8A 4FEQA 3P7BA 1OUKA 5EYKA 4AOJA 3ZUTA 3AC1A 3FMJA 1MQBA 2PVMA 5ACBC 5EHYA 5E8UA 3EN9A 2OFUA 4PUZA 3RMFA 3QTXA 4QT1A 2QO9A 2V62A 3OEZA 3W8LA 5CANA 4O7YA 4G2FA 3VHEA 4D5KA 2B55A 4QP9A 4I6HA 4TYEA 5JGAA 4ZZNA 5ACKA 4GK4A 4NL0A 4FKTA 2Q0BA 5CSXA 3NEWA 4ZTSA 4EKLA 5IQHA 3CP9A 2GPHA 2X7GA 5IU2A 5KKRB 1KE9A 2J7TA 4NEUA 2VTIA 3E8CA 3LFEA 3VRYA 2BPMA 3BWFA 3VNTA 2WTJA 4XG2A 5AP3A 2FVDA 4F9BA 3LQ3A 2PE2A 5IQCA 2DS1A 4U44A 4XOZA 1NT2A 3UMWA 1OKVA 3BELA 4FKVA 5FM3A 1PXNA 3QZIA 4D0WA 4EH7A 4FKGA 4L9IA 3MA6A 5FWKK 3OWJA 5E8XA 4HCUA 5HGIA 3BGPA 2XK9A 3T9IA 3SAYA 4EOLA 2E9NA 2PZRA 4H3PA 2WD1A 2IVUA 1KE6A 4JQEA 4X2GA 3TNIA 2HK5A 3P7CA 2R7BA 4XCUA 4BZNA 3GUBA 5IKWA 4PNIA 3F3TA 4MX9A 4EBWA 4GFGA 4X0MA 1U54A 3QQKA 1QPEA 2YN8A 5FEQA 4EONA 2WEIA 3QYZA 3CLYA 3LXKA 4II5A 4A7CA 1XH5A 3VJNA 4YO6A 5DRDA 4U97A 3TN8A 3D9VA 3C13A 3OW3A 4BCIA 4QQTA 2FUMA 4GS6A 5DVRA 2OXXA 3RCJA 2GNLA 2ITVA 4FZ6A 2CLXA 2I1MA 4I5MA 5HG8A 2X0GA 4AG8A 4FSTA 1T45A 4YJPA 3AC8A 4IANA 2GFSA 4L8MA 4FTJA 4JL9A 4AS0A 2WTIA 2HY81 3BHTA 5FBOA 4F7NA 3HVCA 1FMOE 2QCSA 4P4CA 4EZ7A 4FKWA 3VBVA 4D55A 5D9HA 1I09A 3LXPA 2WGJA 3KK8A 5A9UA 5KMIA 5M56A 3O51A 4PWNA 3A61A 1YXTA 2PTKA 2BZKB 3I0OA 1OUYA 5IA2A 3HGKA 2XKCA 5CEKA 4IDVA 2WU7A 2WQEA 1BUHA 2LGCA 2ZDTA 3AC5A 2OF4A 3G5DA 3MIYA 4IW0A 3UZPA 5HD7A 3S4QA 3V8SA 4J98A 2OIQA 4HVSA 5C03A 2P3GX 4RT7A 2WO6A 3NUSA 4V0GB 3P79A 4FSUA 4KRDA 5HE2A 1XR1A 4S33A 3ZDUA 3AMBA 3BYOA 5E7RA 4UWCA 2F57A 2EXCX 4I21A 4KBAA 4X2JA 4XLVA 4XMOA 5H9BA 4YTIA 2V0DA 5J9ZA 4MXAA 2BROA 4I4FA 3LFBA 3EQFA 2EXMA 5GINE 4FTKA 4YTCA 1URCA 3UP7A 4O83A 5HNBA 2ZDUA 3AMAA 1LEZA 5AUTA 5JRQA 2ACXA 3P4KA 2RFSA 2NRUA 3FC1X 4F6WA 4AZSA 4FTMA 4RWJA 4OTIA 4X21A 4I5PA 4U3YA 1KE8A 3FZTA 4LRMA 4FTQA 4XG8A 4YLLA 3R8VA 4EOQA 4O7NA 4P90A 5DWRA 2H9VA 3NR9A 2B9JA 2OGVA 1WVYA 4FOBA 4O22A 5ANOA 4UWYA 4D4VA 3O96A 4F4PA 3ZYAA 4RJ5A 4U81A 3QFVA 2PMIA 5CU4A 5EYMA 2PU8A 1HCKA 5IEXA 2XIKA 4F1TA 5LQFA 3AOXA 3NYVA 5I9XA 4ITJA 3PA5A 5D41A 4TZRA 4BGGA 4IB0A 3HP2A 2GHMA 4WKQA 2OJ9A 2PZ5A 3DTCA 4I6BA 3UBDA 4I0SA 3UQCA 1MP8A 3CR0A 3W18A 5HLWA 2QURA 4JS8A 3NCGA 4ZY5A 4O7WA 2IW6A 4U79A 2O65A 3HRCA 3QA0A 5CNNA 3BV2A 4Q5EA 3O7LD 3EZRA 1B38A 3SOCA 4QQJA 3PZHA 4DFUA 2ZMDA 3RPSA 2XRWA 2UW5A 1M7NA 3E3BX 4YPSA 2I0YA 3P23A 5HCXA 4ZSLA 3HV6A 3RM7A 2XK6A 4EK4A 1OIYA 2RGPA 3IECA 4A9YA 3WF5A 2J0MB 4CFNA 3R21A 4OAVB 2VN9A 5FGKA 4IQ6A 4JIKA 3FL5A 3W2RA 1J1CA 4QMQA 3V5TA 3BV3A 3WIGA 4F7SA 5G1XA 4NIFB 1YXVA 1H4LA 4G3CA 5JK3A 5FXSA 4ZY6A 3MFTA 4RQVA 4G6OA 2UVZA 4Y5QA 2W4JA 2GTMA 5IUIA 2OH0E 4ORKA 4IAYA 4YU2A 1UVRA 3ETAA 3RNIA 4JDIA 2ITQA 2GNGA 4IZ5A 5CF8A 2IWIA 3NIZA 4HZSA 4UMQA 5K9IA 5HVJA 1H8FA 2QU5A 3ZFXA 2Q83A 3FI8A 4G17A 2BFYA 5HBHA 3SXRA 4ASEA 3A7JA 3OF0A 5HTBA 4M13A 4CFFA 4C2VA 2OKRA 3GP0A 4YPDA 2HXLA 5E4HA 2GNHA 5AIKA 3ROCA 3KXMA 3D94A 4R3PA 5LWNA 1J7IA 3C4CA 3KGAA 4FTNA 5ETAA 4E7WA 2HZ4A 4L7FA 2PWLA 3R02A 1XH8A 3OCTA 4YZMA 1KOBA 4ANLA 4DGGA 2GFCA 5K4IA 3MPMA 4E73A 3KXGA 5EOBA 1Y57A 2X7OA 4FTIA 2O0UA 4FIFA 3R8MA 4EL9A 2XJ2A 3IO7A 3GCVA 2W9ZB 2YDKA 2GQSA 2JITA 4C33A 2CJMA 3FBVA 1O9UA 3NNWA 5DLSA 3QD2B 4QP7A 2WHBA 4FGBA 2WOUA 3CD8A 3MWUA 3R73A 3HZTA 2RFNA 2BFXA 2VRXA 3DT1A 4AN9A 2IW9A 3PA4A 4BGHA 1GY3A 3JY9A 5AUYA 3R7VA 4EORA 2UZDA 2C5VA 3R7UA 5HE3A 5HVYA 5KUPA 4B99A 5L8LA 5HU3A 3MY5A 1YWNA 3UIBA 3FV8A 3W32A 4GV1A 2XJ0A 3A8XA 3HDMA 3CS9A 1H0VA 4G3GA 3DXNA 3FAAA 1YOLA 3LE6A 2YM8A 2Z7RA 1ZY4A 4WNPA 4MK0A 4YHTA 3U54A 2YWVA 2XK8A 4Z16A 3FKLA 4M3QA 3CIKA 3K5VA 3ZLXA 5K5XA 1XKKA 2BMCA 3OFMA 3KC3A 5C27A 1SVGA 4CFXA 2C5NA 4RA4A 4E6QA 3KRJA 5FD2A 1PMNA 4XHKB 3ZLYA 1XJDA 4IC7A 4RZWA 4UYNA 4J53A 5LCJA 1UKIA 3DKFA 4IHPA 1XWSA 3Q52A 4H1JA 2YM6A 3HMNA 4GJ2A 4IFGA 4LGDA 2XS0A 4IB5A 3EQPA 4U42A 5DEYA 3RPRA 3W2SA 3GC7A 4UN0C 1OIQA 3EFWA 3BGZA 4QMTA 1WZYA 5C26A 1R0EA 2QO7A 2C0OA 4AW2A 2WTCA 5J5TA 3D2IA 4CXAA 2VD5A 4GSBA 4DFXE 3ZXZA 3G9NA 4LQMA 1ZYDA 3CQWA 4XYFA 5CLPA 4DEEA 2YLFA 3DKGA 3GOPA 4CG9A 3EQHA 3EQRA 3QKLA 1ATPE 3SW7A 3AC2A 3RK9A 3C0GA 1B6CB 5J1WA 4JRNA 5CXHA 5AP4A 3MH0A 3QC9A 4R1YA 2CN8A 5BQ0A 2XM9A 4PPAA 4D1XA 4EC9A 3F3ZA 1LP4A 5CS6A 1IRKA 2WMVA 4AGWA 5IQIA 4BI0A 3CD3A 3FSFA 2C1AA 3BE9A 3B2WA 3ZO4A 4BCJA 3SOAA 5GJGA 4L53A 4EH2A 2ZM4A 4HNIA 4YZDA 5TO8A 5HEZA 3FZOA 4ZLZA 3PJCA 2OXDA 3BCEA 1I44A 3JPVA 3RZFA 3G0EA 2B53A 3CTHA 3R8LA 3SVVA 4QP2A 3OP5A 4J97A 4X2NA 3CY3A 5H2UA 3PJ2A 5AP7A 4FMQA 4EOIA 4QTCA 2CPKE 3TUDA 1CSNA 3VS6A 1BI7A 5EW9A 3VQHA 3WZEA 4BTJA 2W5HA 3F82A 5AV0A 3FEGA 1K9AA 4F09A 5K0XA 1SMHA 3QTZA 5DPVA 3OMVA 1WMKA 3A8WA 3UO5A 4KKHA 3W8QA 3TZ9A 3GCSA 4UZHA 4XEYA 4C62A 3BEGA 4OBPA 5GHVA 5CAOA 3PLSA 4BHNA 1AGWA 4CYJA 4ZTQA 3UO4A 4OR5A 3P1AA 2R0UA 2X81A 3LAUA 1DI9A 4G31A 2BHEA 4R1VA 4ZMFA 3W1FA 2PVYA 3EIDA 3OBGA 2FGIA 3ORPA 4FNYA 4R8QA 2JAVA 1WBOA 3BBWA 4FTTA 4G6LA 1WBPA 2J0LA 1FVRA 4MXZA 3NSZA 4N0SA 1ZARA 2B9FA 2JAMA 4ZTHA 4GYIA 3BHHA 3H9OA 3F7WA 4CV8A 5EQPA 1UU3A 4KIQA 2C3JA 3QQUA 3LOKA 3RWQA 4EOJA 3FHIA 2YM5A 4OW8A 4DN5A 2GNIA 2YCFA 3EKNA 4EH4A 2W1CA 3MJ1A 5KZIA 2NRYA 3GU7A 5HHWA 1IASA 4F0IA 4PTEA 5JH6A 3D7TB 1FVVA 3PSCA 3CJFA 4TYGA 5AR5A 4BCQA 4BN1A 2UW0A 2XKDA 4C7TA 2BRGA 4TKSA 5CY3A 5BVOA 5FXRA 3KXXA 5I3RA 2RL5A 3H10A 3WZKA 3DDQA 3DAEA 3VUKA 4O0WA 4RC3A 4BTMA 5IQFA 4AFJA 4HVHA 3S00A 3E93A 3NCZA 2W05A 4HPUE 2HXQA 5CEQA 4TW9A 5JFSA 3DFCB 4FTUA 4X3JA 3T3UA 2DQ7X 4AZEA 1ZAOA 2V7AA 3TIZA 1ZRZA 3ELJA 3O23A 4KIKA 5TKDA 5IH6A 4ERWA 2PVFA 2CN5A 2H34A 2OH4A 3PWDA 4RSSA 2IO6A 2VO0A 4EZ5A 2IN6A 4A4OA 1FVTA 4F99A 4AGUA 4TWCA 2Z7QA 3KMWA 4CLJA 4MF1A 3R2BA 5DOSA 5M4CA 1OKYA 1W98A 3F61A 1WAKA 4HOKA 2JKKA 1OL6A 3ZBXA 3NMUF 3D2KA 3FI2A 4E3CA 2ZB1A 4XUFA 4WSYA 2CNQA 1BLXA 3AC3A 1GOLA 2IJMA 3G15A 4WG4A 2GHLA 2X8DA 5CF4A 4Q9ZA 4XOYA 4FZFB 2P4IA 2C5OA 3ZUVA 4C61A 4EOKA 2R3HA 3QAME 4O91A 2XRUA 4B4LA 3ZM4A 2VX0A 2XNGA 3JVRA 2A27A 2RF9A 4DFBA 2X2KA 4MBJA 4GYGA 5FQDC 3JVSA 2C4GA 3DS6A 2I0VA 5FXQA 1PJKA 4YZCA 4C4JA 2BKKA 2R3QA 2BDWA 3SG8A 4V05A 4ZOGA 1WCCA 3L9MA 1GIHA 4KAOA 4W4XA 2YCQA 3F2NA 4H05A 4DGMA 4BKJA 4FT7A 3UIXA 4IVBA 4L7SA 3RGFA 5HG7A 4XV2A 3VBQA 1MUOA 5CF6A 1GIIA 3IPHA 5JGDA 2A4LA 4TWOA 4UALA 1ZOEA 3R7YA 4LFIA 4TYJA 3CSVA 3F5UA 2E9VA 3IW6A 4MTAA 1ZYSA 4FEXA 2Y9QA 5EW3A 2CCHA 4EWQA 2IZRA 3KULB 3OZ6A 4FR4A 3VF9A 4RJ8A 5D7AA 4QD6A 3VS3A 4NJDA 4CFWA 2VTJA 3FMEA 3HAMA 4NJ3A 4AE6A 5A6OA 2XM8A 4I0RA 4XH6A 3THBA 3VS7A 3QX4A 4HZRA 3R9DA 4EHVA 4KSQA 4EK8A 4BRXA 1KOAA 2R3IA 1GZKA 2JBPA 3E62A 3SRVB 3FMKA 3KCFA 3ALNA 4IADA 2X1NA 4M69A 1DAWA 1Z9XA 3LLAA 3C0IA 2PL0A 2VWWA 3A2CA 4H1MA 3TKHA 3DZOA 4AA4A 4DEGA 3OBJA 2UZLA 1IG1A 3O71A 4FSMA 5KX8A 4EYJA 3R1QA 3BBTB 4ZTNA 3DAKA 4RX8A 2R3MA 3VF8A 5ANJA 4E93A 3PRIA 4DFZE 4QYGA 3R6XA 4O0YA 1XBBA 4WIHA 3O7LB 3PSDA 4HCTA 3U4UA 2VUWA 4C4EA 3ZEPA 3SGCA 4EJ7A 5GIOE 3MFUA 4YJNA 1ZWSA 2YA9A 4FNZA 2ITTA 5EI8A 1PXPA 2OIBA 5EM6A 4W4VA 3PVGA 3R0TA 3HUBA 1CTPE 1NA7A 5DR2A 5I0BA 1LPUA 3L9LA 2QVSE 3ET7A 3GCQA 3MA3A 3GU5A 3LHJA 4GFOA 3FLZA 2XNBA 3NW5A 4IH8A 3TT0A 5JQ5A 3BHVA 1SNUA 2RIOA 3V6SA 5GJFA 4B9DA 4ITHA 3F2AA 4JXFA 3EOCA 2PE0A 3V8TA 1A06A 3CKXA 3T3VA 3NNUA 5A46A 2BVAA 3VBWA 2B1PA 5KBQA 3LXLA 4WBBB 4F64A 1TQMA 4R7IA 5BNJA 2ZV8A 2J2IB 3GQIA 3ZM9A 5K4JA 3FDNA 2KTYA 3QTSA 4L67A 3KF7A 4C38A 2WMRA 3Q9ZA 2GQGA 3QQHA 3UNJA 3N4VA 3PFQA 4BR3A 1YHSA 4DG3E 4AUAA 3IDBA 2W7XA 5EM5A 2W4OA 4GT4A 2C3LA 4KBCA 3QZHA 4ZK5A 5IQGA 1WBSA 2W4KA 1FPUA 1FQ1B 2PUUA 4PMTA 2YZLA 5AAEA 2B52A 2Z2WA 2W1IA 4M97A 4EH5A 3W33A 4KS8A 4YR8A 2C3IB 4KIKB 1PHKA 3GC9A 4BIBA 2PUIA 5HE1A 3AT4A 3ORLA 4O81A 3DLSA 3OXTA 3LQ5A 2RG5A 1ZZLA 4FX3A 2RG6A 4YTHA 4ERKA 2UZNA 3DV3A 3DCVA 2XNEA 4MKCA 3L8VA 5EDRA 3Q9YA 3ZO3A 4BDBA 3HA8A 2VTPA 2O2UA 4FSWA 2BILB 4FBXA 2ITZA 3FQEA 3KMUA 4L43A 4MH7A 2PMNX 1OZ1A 3WILA 4IVCA 4DFLA 1U5RA 4J1RA 3GNIB 5AP2A 4BVUA 2H96A 4DE4A 3I7BA 3CC6A 4IFCA 1AD5A 3FLQA 2WMUA 3I6UA 2XF0A 5J95A 3WE4A 2B4SB 5L2SA 3QQJA 3KRXA 3DAJA 3QCQA 4FVPA 3CPBA 2UUEA 4QMPA 4BDGA 4Z55A 2YIWA 3G6HA 4QYFA 1PF8A 3NW6A 4XLIA 4I6QA 4NFNA 2VTTA 4GVJA 5CQUA 3VS2A 2Q0NA 2J0IA 4QQCA 3D83A 5FDXA 3UQGA 2F49A 1JKSA 3O8TA 3QLFA 5CEMA 4CKJA 1RE8A 3PP1A 2QQ7A 4LGGA 4A9SA 3ZEWA 3LLTA 4ANNA 4BZOA 1ZZ2A 2LAVA 2GMXA 3UIUA 3NZ0A 3KRLA 5AV3A 3RPVA 5AP6A 1Y6BA 3BQRA 5D11A 3G33A 3F3UA 4FKJA 2AUHA 3W2OA 3I79A 5B2LA 3ZCLA 2W06A 3AGLA 4PQNA 3ZOSA 1O6YA 4HCVA 4C59A 4D28A 5KHXA 5I9VA 4G5JA 5EYCA 3I5NA 4QMMA 3SW4A 4I6FA 4BCHA 4FV5A 4KNBA 3OVVA 3IW7A 3Q6UA 2BTSA 1PXIA 3QA8A 5FTOA 2RFDA 3LPBA 4FTRA 5DHJA 4CG8A 1JPAA 4CQEA 4BDHA 3V6RA 5EM7A 4GG5A 3VW6A 2F7ZE 4E6AA 5HTIA 4O84A 1G3NA 4YNEA 5DGZA 3PLAE 1OM1A 5EQEA 4FIIA 4M8TA 2IW8A 4IDTA 2QOKA 4JR3A 3E8EA 4WRGA 5E8SA 5LVNA 3II5A 4TWNA 4W8EA 5J5SA 3EQCA 2J6MA 1PXLA 2OXYA 3FXXA 3KRWA 1GNGA 5J9YA 5CZHA 4KIPA 3K54A 3NUAA 4G3EA 2YDJA 3R7EA 2W17A 4WSQA 1NXKA 2FYSA 3SG9A 3WOWA 4RJ4A 4L00A 3FKNA 1H01A 4I41A 2ESMA 2PVRA 4FGRA 4J52A 3V5LA 3PXRA 5AR4A 2B9IA 3O8PA 1UU8A 4E4LA 4O0SA 4YUQA 2QKRA 5ANDA 2NP8A
chains in the Genus database with same CATH superfamily
3DNDA 4M67A 3OXIA 3VS1A 3ATTA 2R3RA 4FV2A 5EG3A 1EH4A 1STCE 3DOGA 3KN6A 3QU0A 1OGUA 3ACKA 4PF4A 4QYYA 5EI2A 3RAIA 3VAPA 4AQCA 4BICA 3R8ZA 4D9UA 2Z7LA 4NIFA 5HBEA 5ANGA 4AT4A 3H3CA 4CT2A 1WBNA 4UXLA 2XAOA 4JOAA 4F0GA 1ST0A 3UVQA 2G01A 2RKUA 4FIEA 2R3LA 3B8QA 3JY0A 4IACA 1ST4A 2X6DA 3WIKA 1IEPA 4EJNA 2XK3A 3TCPA 1H08A 3AD5A 3QTUA 5BVWA 4MHAA 5DR6A 1ZYJA 3DZQA 3GCUA 2CKOA 1ND4A 4FSZA 1YWRA 3ZONA 3EH9A 1ZMUA 4YBJA 2PHKA 3E88A 3FLYA 4KINA 5EYDA 4CFVA 5FEDA 3O17A 3ORTA 2X9EA 4NYEA 4FT5A 2DYLA 4AACA 5BVEA 4IX4A 4U0IA 3DFAA 4YJRA 5IH4A 4G1WA 2XCHA 3Q4TA 3U51A 2FB8A 4FEUA 1F5QA 3OTUA 2OW3A 3RNYA 4AZFA 4HYIA 2FA2A 5F94A 4JRVA 3N9XA 3VBYA 5IMEA 3A7GA 5CU6A 5KMJA 5IH5A 5HVKA 5ICPA 3ALOA 5J1VA 2BZIB 5CNOA 2CKPA 4FV4A 4NT4A 3PXYA 4YJOA 3FZSA 3A7IA 4XG9A 3P0MA 5LXMA 4LDTA 3PIXA 4FTCA 4CCUA 4XP2A 4ACCA 3PSBA 4LOPA 3CJGA 5T68A 1LR4A 4GFMA 4GK2A 4L3JA 4MWIA 4OBOA 4R6VA 3TG1A 1PXJA 1JKLA 4NUSA 4E5BA 4UYAA 4DT9A 3MSSA 5A14A 3OS3A 5HLPA 4FEVA 1YDSE 4GEOA 4JX3A 4EH8A 3RAHA 4CZUA 2Y4PA 4FG9A 4CKIA 4M15A 4PRJA 2ERZE 4HYUA 2JD5A 4CTCA 5BUIA 4DF3A 4NTTA 1OL5A 5ANKA 4YLJA 4EQUA 3F2RA 3LMHA 4FUYA 1MRYA 2QR7A 2CGVA 4TYHB 2WMQA 5L8JA 3UC4A 3ODYX 2UW7A 3ODZX 4YC6A 2YAKA 4W4YA 3ACJA 5IDNA 3TNPC 4MAOA 5CT7A 5HICA 3QX2A 3EFKA 3NUUA 3HMPA 3QHRA 3QRIA 3DGKA 4ONAA 4F6UA 5JFWA 3ANQA 4QPAA 2A0CX 4GIHA 4IAFA 3NGAA 3LFNA 3KXZA 2I0HA 4EK5A 3E87A 1PMEA 4NSTA 3VULA 2WFYA 3FLSA 2XKFA 4E4MA 4QMNA 5AUWA 1Q8WA 4UMUA 3M11A 2IVSA 4QO9A 4XP3A 4J96A 2I7QA 3F6XA 1U5QA 3HV3A 3TUCA 2FH9A 4YMJA 3BKBA 3VBTA 4O0UA 1Q5KA 2Y4IC 4YSMA 3RZBA 3V04A 3S1HA 4O21A 1G8KA 1JSTA 5KMLA 4D2PA 3R8UA 4FOCA 1PRYA 2JGZA 3ZSGA 1REJA 2YITA 3KN5A 3BLQA 4IVAA 2YCRA 4FODA 4AXAA 2OLCA 4FT3A 3TV6A 3SXFA 1ZMVA 1DI8A 4RIWB 2GCDA 2FSTX 2XNOA 2XJ1A 3COMA 4JAIA 3ZZWA 4E6CA 2W1EA 2XBAA 3NUXA 4G5PA 3ZRKA 4U41A 1OBGA 2W1ZA 4FV0A 5IQEA 4D5HA 2RFEA 3TNQB 3PVUA 2BDFA 2R64A 4O6EA 3ZO1A 4FYNA 3AGMA 3Q4CA 4EHGA 2G1TA 3FE3A 3NUNA 4V01A 5C8NA 2JDSA 2XNNA 1BKXA 4NW5A 3ZC6A 4BTKA 2QOHA 4MNFA 1MQ4A 3Q5ZA 4ZS4A 3QZGA 4BY9E 5HORA 2W5AA 2HZNA 4WD5A 3V5JA 4DGLC 3E64A 5JFXA 5AP0A 1R39A 2Y4IB 3DBEA 4GG7A 5L6WL 2XCKA 3VUIA 3ZRLA 2GS6A 4M14A 4N6YA 5DRBA 4ASZA 1W83A 2AC3A 3P78A 4EQMA 5CZIA 4LYNA 2W96B 3KRRA 3MW1A 4TNDA 3TZ7A 3PPZA 3P7AA 4FKRA 5KE0A 3F3VA 4AA5A 3DK7A 3FQHA 4YHFA 5AAFA 1MRUA 5IISA 4QPSA 5E8ZA 5HQ0A 4D4YA 1ZXEA 3LFSA 1Q4LA 4HYHA 4RRVA 1H1SA 4Y8DA 4MD9E 2Y6OA 3C4ZA 3PA3A 5CSVA 2NYAA 4D0XA 4BHZA 4AF3A 5CU2A 3PY1A 2C6IA 2JIIA 5EDQA 3ATSA 4HYSA 3DY7A 5D7VA 5CAVA 1UWJA 4BCOA 3VS4A 4WG5A 5DNRA 5EOLA 5F95A 2ITOA 3BYSA 4LOOA 5D1JA 4AXFA 3QL8A 4QPMA 5M55A 1OKZA 2UV2A 4ZTRA 1JOWB 3LVPA 4RVKA 4FSQA 4WUNA 4AWIA 3CPCA 5E8WA 3EMGA 3QUPA 4MF0A 4R78A 4RMZA 4AZTA 5EI6A 2X0QA 1J7LA 4HGTA 3R30A 5C4KA 5FLFA 4CMOA 4JBPA 4IX5A 2V5QA 3D7TA 3EHAA 5AIRA 2VTAA 3D4QA 3WZUA 3R22A 5BVDA 4C4HA 5ANIA 2UZEA 3OD6X 5JFVA 2IPXA 1Q3DA 3ZXTA 1W84A 4ZTMA 4QMWA 4PTCA 2C6TA 2YZAA 3QUDA 4QMLA 3U9NA 5CEPA 4F08A 4D4SA 3R9HA 4RJ7A 4IJPA 3O8UA 2VWUA 2PVJA 3CGOA 2FSOX 3FQSA 3U9CA 2OWBA 3PXKA 2CGXA 3R63A 3PVBA 3KIOC 3IKAA 4LL5A 1WBWA 4G16A 3ZMMA 3EL8A 4IC8A 3DB6A 4OTWA 4F9WA 4U45A 4A4LA 4AZWA 3GEQA 5AA9A 3A60A 3VHKA 5CI7A 2BIKB 4DC2A 4O82A 5KCVA 4FIHA 4QP4A 2BHHA 3R7OA 2YIQA 5DT3A 5JSMA 1SYKA 2ZV2A 3VS5A 3ORXA 4AFEA 4C37A 4H36A 4FZDB 2HAKA 3BYVA 3FPMA 5IPJA 2F7XE 1GZOA 4MEDA 4ACDA 3KKVA 3GXLA 4B0GA 5I5ZA 4PDPA 4LV5A 3UP2A 3MN3A 2Z8CA 4LL0A 4HVIA 2OO8X 3SXSA 3I81A 1U59A 5KZ0A 4NTSA 4YJUA 3AD6A 4RBLA 4CZYB 3H30A 5FM2A 3EN7A 2EB2A 4A4XA 4AAAA 4C4IA 5EW8A 1Q8UA 4ZXTA 4RQKA 3BHYA 4Y73A 3DK6A 4YURA 5CXZA 2YCSA 2QOCA 5E9EA 1UU7A 2CSNA 2VO3A 5CEIA 4O7TA 4ALWA 2R3PA 3RHXA 3QRTA 3TMOA 2OJJA 4CFUA 4AQKA 3GC0A 3RM6A 1V0BA 3QQLA 2W99B 2WZJA 4E4NA 5LVPA 3KVXA 4GKHA 4DHIB 4FK6A 4A9RA 2JFMA 3MH2A 1V1KA 3DBCA 2A1AB 2GHGA 4EZ3A 3W55A 2PULA 5K5NA 4UWBA 3PP0A 3KREA 4WNMA 3KULA 2YIXA 1OI9A 4FKUA 2V22A 4DEBA 4MCVA 2SRCA 4W9WA 2X2MA 4AGCA 4HVGA 1YHVA 1W82A 3NDMA 4KWPA 5GZ8A 1XH4A 2JFLA 3BU3A 4XP0A 3SRVA 4YGAA 3PJ1A 4FKOA 4F7JA 5JEBA 4BZDA 4GKIA 1PY5A 3PTGA 5EDPA 1OPLA 2BUJA 2YJSA 4WNOA 2HYYA 4IAIA 2ITWA 2QOFA 3MVMA 3HDNA 1UNHA 2HCKA 3KK9A 2PK9A 5A4CA 2OJFE 2UZBA 3TNWA 3ZDIA 4AX8A 1Q8YA 5KMOA 4GUBA 1KV2A 1YKRA 2ZYBA 2J50A 4CVAA 2OG8A 3FI3A 1BX6A 4BCKA 3Q4ZA 4L6QA 2OFVA 5CVFA 2VTSA 3L9PA 1REKA 1Q8ZA 4BKZA 4C36A 4D9TA 4RWLA 2C47A 4Q5HA 2WU6A 4C8BA 4L68A 4K2RA 3FUPA 4WRSA 3PG3A 5CENA 3C4EA 4F9YA 2R5TA 3RWPA 5E91A 3BU5A 2OBJA 3KY2A 4XV9A 2C3KA 3PJ8A 4G6NA 3NW7A 5AM7A 5AX9A 2O5KA 4K6ZA 4FSNA 4AN2A 3VUTA 4KS7A 3R9OA 1OPKA 3W0MA 5A6NA 1SNXA 4M66A 2BRBA 2WMSA 3QHWA 4M0YA 4M0ZA 3A7HA 3P5KA 2CNVA 2QR8A 2WMBA 5AV4A 2W1GA 4PDOA 4BL1A 3FZ1A 3JS2A 4RG0A 4EH6A 2W1HA 4RVLA 4X6RA 5TR6A 2HIWA 5IMXA 2VO6A 5FDPA 2ZMCA 3LXNA 2ITNA 2ERKA 4HPTE 5LMKC 3HMOA 1OKWA 5M4IA 3EQBA 3OY3A 3ORKA 4CRSA 4JBOA 2KULA 4JT3A 5K3YA 3V01A 3OHTA 5G6VA 3GB2A 1KSWA 2UW6A 3QKMA 1Q24A 3VUMA 1TFFA 3ULZA 3QF9A 2J9MA 2DUVA 5FP6A 4DCAA 3HNGA 3ORMA 5E8YA 4DTAA 5AP5A 1VYZA 2PE1A 2V55A 2XIYA 3HMMA 3MB7A 3VW8A 2V7OA 5CU0A 3TYKA 3W0OA 4DT8A 3EJ1A 2QG5A 4C3RA 5D10A 2YJRA 2C6LA 2ZB0A 4IWDA 3HA6A 3IW4A 2P2IA 5AX3A 4C57A 4B7TA 1UNLA 5FP5A 1OBDA 3RPYA 5A3XA 3FZPA 4PY1A 2YM7A 4ANSA 3UNKA 3H0ZA 4QDVA 2XIZA 1JLUE 2C6MA 5GJDA 3RK7A 1NY3A 1JQHA 3TXOA 4CKRA 4EK3A 3I0QA 2XNMA 2BRHA 4RGJA 1E1XA 1H27A 3ANRA 2A19B 3BL7A 4USFA 5AR3A 4UBAA 4BDAA 3COIA 2UZTA 1O6KA 3WF8A 4AGDA 3O5AA 3TM0A 3F69A 2YERA 1UNGA 2R3KA 3DTWA 4JLCA 1DM2A 1P14A 3IONA 1PYXA 4UY9A 4ENYA 5DEWA 4F63A 4I6LA 5M51A 3LCKA 4APPA 4PMPA 3P5JC 1QPCA 4C4FA 2YIYA 2QONA 1NVQA 1Y8YA 2XEYA 1PXMA 2J0KA 2WPAA 3R00A 4ID7A 3MI9A 4XX9A 4PNKA 5CALA 1VZOA 5BMMA 2OZAA 4EQCA 4ALVA 2YEXA 4G3DA 1Z5MA 1BMKA 4JVGA 4MXXA 4QP6A 3MY1A 1RDQE 5I3OA 4FZAB 3UTOA 2UZUE 5KNJA 3EL7A 5HX6A 2C30A 5LCKA 3OG7A 4OT5A 1P2AA 2FO0A 2E9OA 4FF8A 4IWQA 4OBQA 2HELA 3LCTA 2YACA 1AQ1A 4ZS0A 3SC1A 2WB8A 3KA0A 4FL3A 4OTPA 4QRCA 3DK3A 3LFFA 1IAHA 2QO2A 5FEEA 5AUUA 5HZNA 1TVOA 3VC4A 4GJ3A 5HCYA 4KIOA 4LRKA 4P2KA 2W1FA 2OK1A 2F2CB 1K3AA 1OITA 3A99A 1YOJA 3KQ7A 4YP8A 3FYJX 3ZSIA 4R77A 3EN5A 5AAGA 2G15A 3CKWA 4MYGA 3VBXA 4L45A 3HECA 2B7AA 4O38A 1Q3WA 4QQ5A 5HESA 3ZLSA 3FI4A 1SM2A 3LZBA 2X2LA 4W9XA 4MQ2A 4RX5A 2QI8A 4R7BA 3FLWA 2Y0AA 4TY1A 1Q99A 3NUYA 2VNWA 3FKOA 3OY1A 3PPKA 4K8AA 4UZDA 3CEKA 4FIJA 3VUHA 2ITYA 4QMXA 3AQVA 2YISA 2JLDA 3DNEA 3M2WA 4L46A 4RIOA 4XG6A 4XS2A 3DBDA 1Q62A 4OAUC 4JR7A 4U6RA 4BDFA 5D12A 3I6WA 3N51A 4GIIA 3WZJA 4JMQA 2X8IA 4FSYA 3A7FA 4X3FC 4O86A 3IOPA 3K5UA 4ZZMA 3SLSA 2C6OA 4R5YA 2CGUA 4BCFA 4DH3A 3U87A 1JSUA 4DYMA 1M7QA 3EQDA 4CQGA 4AXCA 4NWMA 3W2CA 2G2HA 5CAQA 4X6QC 3PJ3A 4O2ZA 1YI3A 5CTPA 1K2PA 2C6DA 3WF9A 2J5FA 1NW1A 4P5QA 4FVRA 4TTHB 2WNTA 2VTNA 4QMYA 1GJOA 2A2AA 4WT6A 2VGPA 4LV7A 4O4CA 4DH1A 1R0PA 1YQJA 4RIXB 4NH1A 4RLLA 5EK7A 5LARA 5CI6A 1LUFA 1PKDA 4I5CA 4J7BA 1A9UA 4O4EA 5ITAA 2ITXA 4S34A 5EFQA 5CEOA 1FMKA 5HLNA 2YM4A 2OJGA 4BDIA 4FT0A 3TEIA 4JX7A 5J79A 4JDJA 3HYHA 2VX1A 2J4ZA 3I5ZA 5CVHA 4C3FA 2YDIA 2XIRA 2JDTA 4X3FB 2NPQA 3C5IA 3DBQA 5CSWA 4AP7A 3OXZA 3BLRA 4UEUA 4BIDA 4CNHA 4D2TA 2XVDA 4G3FA 4NCTA 3MYGA 3COHA 3V5WA 3RINA 3QRJA 5KO1A 4W8DA 3HMIA 4IE9A 5HBJA 1V0OA 3RPOA 3WYYA 4Z9LA 4R3CA 4ACMA 4B8MA 2X4ZA 4DG2E 5EHLA 1WVXA 4PPBA 2IF8A 2BALA 4Y85A 3E3PA 4K18A 1YVJA 4K11A 4BWKA 4EBVA 4QMVA 1VR2A 2VWYA 3WYXA 4CRLA 3UG1A 2QC6A 3G2FA 4FG8A 4PL4A 5J8IA 5B2KA 2XAMA 3MTLA 5DE2A 4K0YA 4OT6A 1FINA 4Q9SA 5C01A 4FZ7A 3R9RA 4E8AA 3AG9A 3W0QA 4YJTA 3GVUA 4FV9A 3OCSA 3RBWA 2JKQA 4OTFA 5A4EA 5BYLA 2I6LA 4X2KA 2JIUA 4RWIA 5AM6A 1XO2B 4ACGA 3UG2A 3DQXA 3KL8A 2VTOA 4PDSA 3ZSHA 2PUPA 1T46A 4QEBA 4FV8A 4BYIA 1YXXA 4IWOA 1UA2A 3FY0A 3MFSA 2QOOA 3S0OA 2ONLA 2JBOA 4JQ7A 2VTHA 3R2YA 3RK5A 2HOGA 2XIXA 2W1DA 3LJ1A 5JGBA 3A4PA 1X8BA 2B0QA 4Y83A 3MBLA 4ZP5A 3QRKA 3TJDA 3I7CA 2OZAB 4YJVA 1P4FA 4DFNA 4KBKA 4E1ZA 5AADA 1PKGA 2WTWA 4J95A 5AR7A 2X8EA 3V51A 4TT7A 4A07A 4U8ZA 4UMPA 4LMUA 4PDYA 5FTGA 4DDIA 4AOTA 4M68A 4GCJA 1DS5A 4OTHA 3D0EA 4F70A 3BE2A 4NM5A 3WZDA 4N70A 2GNFA 4NK9A 2ZV9A 2JDRA 3KFAA 3PXZA 2J51A 2BKZA 3LM0A 4APCA 4EOMA 3D14A 4TYHA 5HCZA 3N4UA 1QMZA 3DPKA 5AP1A 4IVDA 4IMYA 3BGQA 2QNJA 1JKTA 2VU3A 4I93A 2IZSA 3F3WA 5M09A 5EKOA 4BBMA 4CFMA 5BVNA 4MD7E 4WUAA 5AV1A 5LMAA 3ZTXA 3GFWA 2VWIA 5F4NA 5L2IA 2VTQA 4BYJA 3Q6WA 3LJ2A 4YC3A 4Z7HA 1YXUA 2JDOA 3RTPA 4F9CA 4Q2AA 4O96A 3PRFA 5HIDA 5DA3A 2XZSA 2QOIA 3UVRA 2O3PA 4JDKA 4RA5A 5M53A 4GH2A 3FHRA 4C4GA 2Y7JA 3PZEA 2BAQA 2UZVA 4LOQA 4ZJJA 3W16A 2PVHA 4FV3A 5CU3A 3WARA 2VTRA 2PPQA 3FC2A 4DTKA 4Z3VA 4FE2A 4FKLA 4B8LA 1NVRA 4EH3A 4DDGA 4O0XA 2XP2A 3TWJA 4PV0A 2XB7A 3BLHA 3ZU7A 2CKEA 2E9PA 2H8HA 4TYIA 4O7SA 4GL9A 3W0RA 1WBVA 2PY3A 4IZAA 4MNEA 4RIWA 4BWXA 3WI6A 4NCTC 1JBPE 3KCKA 3H4JA 4BCNA 4FRFA 3V5QA 5GIPE 5LVLA 5DYJA 5CT0A 5IQAA 4BI1A 3EFLA 4IBMA 4N4SA 1FGKA 3NYNA 3HV5A 4Y5HA 4ANMA 3C1XA 2YWPA 3MDYA 3R7GA 4QYHA 3EWHA 2A98A 4LUEA 3LCSA 4PMSA 3TUBA 1J7UA 3TL8A 4EK6A 3M1SA 5LVMA 4BB4A 4M7IA 2J90A 4MVFA 1J1BA 2Y8OA 3C9WA 3P08A 4QMUA 3FXWA 5CF5A 4FK3A 2Z02A 4RFYA 3JYAA 1H1RA 4UXQA 5AJQA 3BPRA 3S95A 5HIEA 5I9UA 4C58A 3NNVA 3NVMB 3OT3A 3BYUA 4BDEA 2F7EE 3LCOA 3TI1A 4EKKA 3JR1A 4AZVA 2ETRA 3MJ2A 5T3QA 1BL7A 2YHVA 3GC8A 3VWAA 3OROA 4J99A 5LOHA 2QG7A 1LEWA 4MXYA 4NW6A 2BTRA 3C7QA 2ONLC 4HNFA 4I24A 1TQPA 4O0TA 4D4RA 4O0VA 3OOGA 5EM8A 4WOVA 5AFVA 4DH7A 1R1WA 3QXOA 2BZHB 4QP1A 3VS0A 4FT9A 3K3IA 1RJBA 3LMGA 4HGLA 1XBAA 2OF2A 3QCYA 4IM0A 4WO5A 4CEGA 2IZTA 1A48A 3ZUUA 4FKIA 4HVDA 3BWJA 3U4WA 3GQLA 4ALUA 4BGQA 4L52A 4OLIA 5EH0A 4EHEA 1QPJA 3LFQA 1ZY5A 4RJ3A 2R3JA 1DAYA 1SVHA 2GS7A 4O4DA 4I22A 4G9RA 5JZNA 1RQQA 4ZY4A 3NIEA 1ZYLA 4X2FA 5AUZA 4EH9A 5KMMA 5IQBA 4FKPA 2X0OA 3TTIA 4BJJB 4RVTA 2VX3A 1Y6AA 3MB6A 1GIJA 1FGIA 3AC4A 4GT5A 4DEHA 3HX4A 3R01A 1R3CA 3CE3A 1W8CA 3F5XA 1Y8GA 4J8MA 1GAGA 4GK3A 4IB3A 3LQ8A 3MH3A 3UZTA 1FBNA 3UYTA 3QD0A 1E1VA 2JKOA 4JQ8A 2X6EA 5J87A 4E26A 1TZDA 2XYUA 4C2WA 4RX7A 2O64A 2VWVA 2Z7SA 3QGWA 1PW2A 1H28A 4XBUA 3S3IA 4O1OA 2JKMA 3GU6A 3A4OX 5L8KA 4ARKA 3FJQE 5H3QA 4QP3A 3MVHA 4MXCA 5E90A 3QRUA 3DJ5A 3P86A 3KEXA 4BKYA 4AOIA 4OTDA 4MBIA 5AUVA 5A54A 1V0PA 1QCFA 3BIZA 3QGYA 2HW6A 1WVWA 3KB7A 4KKEA 3VVHA 2JC6A 4XG3A 4D2WA 4NM3A 3NRMA 3VJOA 2WQNA 1SZMA 4PPCA 3PVWA 5I9WA 2XH5A 3QD3A 4C02A 4CT1A 1OB3A 2PMOX 4GU9A 5JN2A 2CMWA 2YFXA 3NPCA 3HV7A 4I20A 3FXZA 3POZA 2XUUA 2IZUA 1S9JA 4S30A 1IA9A 5AV2A 4F6SA 2VAGA 3AT2A 4KKGA 3FMHA 3R1NA 4NM0A 2PSQA 5F1ZA 3QCSA 3ZHPC 4O7ZA 3QUEA 3R8PA 5M08A 5L2QA 5LMBA 5DT0A 1Z57A 4M84A 3A62A 5AEPA 1OL7A 3C4XA 4KSPA 5JMSA 1OMWA 2OIDA 4MUQA 5C4LA 4I3ZA 3LJ0A 4K77A 4RC4A 5B0XA 4M12A 2C68A 4WNKA 2WMWA 4YZ9A 4D2VA 5AA8A 1H26A 5BUJA 3IOKA 4FL2A 3HV4A 4O6LA 4QTBA 4QYEA 5J7HA 3TDVA 5IA5A 5IF1A 3S2PA 4YTFA 4MNEB 5IEVA 1M17A 4KUJA 3AKKA 3CQEA 1G8AA 4K33A 5ANEA 5M44A 4YJQA 4XV1A 2PVKA 4DCEA 3FYKX 4DLIA 5FUTA 3C4WA 5L6PA 3ERKA 1KE7A 3C0HA 2B9HA 1OECA 3UZRA 2GDOA 1G5SA 3RHKA 4GW8A 2ZVAA 3T9TA 1S9IA 4I94A 4AT5A 4O7LA 4ANQA 5TE0A 3CXWA 4RFMA 4C3PA 5KHWA 4XJ0A 4YC8A 2GQRA 3Q2JA 3NAYA 3DU8A 2ZM1A 4E20A 3MPAA 3GI3A 2CLQA 2GTNA 3OC1A 2ZAZA 4RX9A 4DEDA 3W0NA 3Q5IA 4BBEA 1G8JA 5HO7A 3CTQA 5JRSA 3QLGA 2HZ0A 1M2PA 4JG7A 3C4FA 4O4BB 5E1SA 4PL3A 3UDZA 4WA9A 5HD4A 2YM3A 1VYWA 2YAAA 3MTFA 4HJOA 4L44A 3SDJA 4AW0A 5IQDA 2BIYA 4Y72A 4CMUA 3PYYA 1R78A 2BZJA 4UV0A 4FTOA 2UW9A 3JUHA 1YW2A 2QLQA 1GZNA 5HG5A 2YIRA 3E5AA 4LMNA 4EOOA 2OZOA 4IB1A 4TXCA 5BYYA 2UW3A 3QTWA 4WBOA 3KF4A 3UO6A 2W9FB 3H0YA 3JXWA 4DAWA 2NNWB 3COKA 5EHOA 4RIYA 1JKKA 1M2RA 1YI6A 4JIAA 5KMKA 4ZEGA 1MRVA 4DH5A 3HEGA 4U7ZA 3AD4A 4IM3A 3Q2MA 5AR8A 4OTGA 2R3GA 3BYMA 1IAJA 2E2BA 3DA6A 3U8WA 3V8WA 5HX8A 2W5BA 3QD4A 1CKIA 4KA3A 2OU7A 4L3PA 4C35A 4NU1A 5DH3A 1GZ8A 3EKKA 4JG8A 2R3OA 3GU8A 3MS9A 2C0IA 3U6IA 3HP5A 4ZJVA 5M06A 3VN9A 5CASA 4DH8A 2X7FA 4DEAA 4F65A 4FKQA 2HZIA 4JAJA 5IUGA 4UB7A 5EQYA 1OL2A 3E92A 2CNUA 3NUPA 4I1ZA 3LKMA 1U46A 1U54B 2C0TA 5ETFA 2BRMA 1BYGA 2WELA 1OIRA 2REIA 3HUCA 4JNWA 3ZC5A 4QTEA 1YWVA 1G8SA 4AN3A 4D1SA 2X39A 5B2MA 4YZNA 4DTBA 2WMXA 3EFJA 4JI9A 3SV0A 3RAWA 3QBNA 4DEIA 4YO4A 3IG7A 5L2WA 2PZYA 2HW7A 1ZOHA 1OPJA 5H8GA 1CM8A 3MESA 1YDRE 3QXPA 5AUXA 1FOTA 3EN6A 5C8MA 3EZVA 5C9CA 3UODA 3REPA 4FEWA 2XK7A 4FC0A 4D1ZA 1PMUA 4XBRA 3N4TA 1F0QA 3CBLA 4ZSJA 4YNOA 4FL1A 5BV3A 1KV1A 3CTJA 4KD1A 4O7VA 5H8EA 2QOQA 2ITUA 2DWBA 2J0JA 2WTKC 4FTLA 3QCXA 2WMAA 3MIAA 5A4QA 4U80A 2W0JA 5BMSA 1P5EA 4O0RA 2ZFYA 1F3MC 5HNIX 1W2DA 3C50A 1XMMA 3UNZA 3DXQA 2YLEA 3BHUA 1W7HA 5E8TA 3W10A 5LMKA 4DGOA 3KU2A 4H58A 3AXWA 3KXHA 2VV9A 3UIMA 3C5UA 3ENHA 4BDDA 3K3JA 2H6DA 2J5EA 3G9LX 5BYZA 5BX0A 3WF7A 2RSVA 3HRFA 4U43A 2R3NA 1JNKA 4GT3A 2WIPA 4A06A 3ZZEA 4I92A 3WBLA 2C1BA 4G9CA 5JT2A 2F2UA 3MPTA 2PZIA 3DDPA 5CAUA 3UPZA 3SA0A 4DBXA 3OW4A 4EI4A 2X9FA 2QHMA 3CQUA 4U9AA 3OEFX 2QHNA 3L9NA 4R5SA 5LWMA 3H9RA 4FVQA 3KVWA 3RI1A 1Q41A 5HU9A 2WTKB 2CKQA 3OWLA 3BQCA 3HL7A 4ENXA 3FY2A 4GMYA 1M14A 2VWZA 2WTDA 4UMTA 3UJGA 2UZWE 3LM5A 3R7IA 3DLZA 2X4FA 4JDHA 1Y91A 4IIRA 4ASXA 3QTRA 5CSPA 3O2MA 3NVKI 4ASDA 3UOLA 3D5UA 3Q96A 3Q9XA 5CX9A 3GENA 4TL0A 4O27B 4UMRA 4PTGA 3R1YA 4G34A 2WXVA 4CZTA 4BI2A 3GGFA 2B54A 3RVGA 4K1BA 5C1QB 2OICA 2I40A 4LUDA 3BI6A 2EXEA 3OCGA 3UYSA 1H07A 5KBRA 5LJJA 4WHZA 3UOJA 5LVOA 2QLUA 3LFCA 5J9LA 3G6GA 2PVNA 3LCDA 5M4UA 3ZS5A 3F7ZA 3TIYA 3OWPA 4RVMA 3TV7A 1JWHA 3UDBA 2CHLA 2UVYA 4KABA 1CKJA 4QMOA 4EOSA 2HWPA 1BI8A 4QMSA 4CSVA 2VWBA 4R7HA 3HAVA 3MGYA 3UVPA 1PYEA 4AU8A 2Y6MA 2P33A 1WFCA 2BR1A 4ZZOA 3PY0A 2CDZA 3EYHA 3IGOA 3DJ6A 4B6LA 4BFMA 4I5HA 3EYGA 4ZLYA 3W2PA 3PE1A 1UU9A 2VO7A 3QALE 2JIVA 4JG6A 4JBVA 4ZJIA 3QQGA 3MY0A 1H00A 1NVSA 1QPDA 3ITZA 2XANA 5I4NA 4EC8A 3RAKA 4ZMEA 3QQFA 1B39A 2GU8A 4OTQA 2CGWA 4RIYB 3F5PA 4YZBA 1E9HA 4XRJA 5EKNA 3FSKA 2QKWB 2ITPA 3V3VA 5CAPA 4XNEA 4N57A 2ZOQA 3R9NA 3GFEA