1M7NA

Crystal structure of unactivated apo insulin-like growth factor-1 receptor kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
305
structure length
299
Chain Sequence
SAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor I receptor
publication title Crystal structure of the Apo, unactivated insulin-like growth factor-1 receptor kinase. Implication for inhibitor specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m7nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m7nA01
2XYNA 2PUNA 3P7AA 4FOBA 4Y83A 3H9OA 5TT7A 4RC3A 4ZTRA 3FC2A 2G1TA 3COIA 3EQCA 3QWKA 4EYMA 4FMQA 2DYLA 5AV1A 3DK6A 5EH0A 1JAMA 2B54A 2F9GA 4DA5A 4G9CA 4H1JA 1M17A 3NVMB 1J1BA 4IMYA 5ANGA 2OH0E 1O9UA 4FSUA 4DE4A 4F70A 4UMPA 1P14A 3F7ZA 3D9VA 4YMJA 4TWOA 2ERKA 4FZFB 3ZFXA 3DY7A 3BYSA 3OBJA 5CAPA 5CF5A 4QRCA 2JIUA 2BCJA 3RTPA 3UG1A 4EC9A 1B38A 5CNOA 3TEIA 5B7VA 3MVMA 4O6EA 5HBJA 5M4UA 5EHYA 5DT3A 1M7QA 4MNEB 1K9AA 2B4SB 2EXCX 2WIHA 3CBLA 3KRRA 3LXLA 5AP3A 3UOKA 5E8SA 3F88A 3UIBA 3OUNB 4RG0A 1NY3A 4TYHB 3FUPA 3AT3A 2X1NA 4YJSA 2ZM4A 2GDOA 3TTJA 2X4FA 4GL9A 4BF2A 3ZCLA 2ERZE 5JFWA 3PJCA 5TOZA 3NUXA 1FINA 2HYYA 4ZS0A 4C4GA 2PY3A 4DFZE 2VTPA 3WE4A 5JMSA 2VTLA 3EQPA 3HL7A 3T3UA 4C37A 2XYUA 3D5WA 4GEOA 3GP0A 2QQ7A 3MS9A 4FV1A 4USFA 5L2SA 1Q99A 3C4EA 4J52A 3TNWA 2QR7A 2ZM1A 5E8TA 2PZYA 3HEGA 1QPCA 2R3QA 3ACKA 1ZARA 3QKMA 4FKVA 1ZXEA 4FL2A 4M15A 2HW6A 3DKFA 4TYJA 2BZJA 4Y73A 2QOFA 3FLYA 2XS0A 4EEVA 3PLAE 4PPAA 4G3EA 4RIYA 4Y85A 2OSCA 5CEKA 4EOMA 3ZH8A 3ZUVA 1H27A 4IJPA 4JDHA 3RMFA 3RPYA 4A4OA 4YP8A 3R28A 1XHAA 2XNEA 3SXSA 1H4LA 5CYIA 1PRYA 5HX8A 4CZUA 1Q62A 4I22A 4D0WA 3KVXA 4NJ3A 3LPBA 3Q4UA 5D12A 2PK9A 3AC3A 3BIZA 3MDYA 5BX0A 3PE1A 3PIYA 2CNVA 1Z9XA 3ZSIA 3R8UA 3IDPA 3PJ1A 1LPUA 3O8PA 4TNDA 5DR2A 2JIIA 5DVRA 4I23A 4JQ7A 3O7LB 3BYMA 4YHFA 5JFXA 1ZYDA 3QRTA 3NW6A 3FYJX 3HMIA 3PA5A 3PPJA 2J9MA 2YJRA 3CTJA 1SNUA 2QOKA 4LYNA 3BU3A 4U43A 4W8EA 3NIZA 5HVJA 1OECA 4DEGA 2QOCA 4C02A 5HU3A 3ZDUA 3NNVA 3NYNA 2PMLX 4RQKA 3RM7A 4OTWA 2AYPA 3HDMA 3CIKA 4J99A 3PSDA 5ANJA 2P0CA 4BDDA 2W4JA 3CQUA 3DKCA 5LMAA 5KMNA 3RPOA 2HWPA 5C8NA 4C38A 3C5UA 3H4JA 1PMEA 1R3CA 3CPCA 2WXVA 5I9UA 4BFMA 1XH7A 4ZY4A 2JDRA 2WQMA 3PDTA 5HNBA 2B53A 5KNJA 3E8DA 4O83A 2WD1A 2Q0BA 4AGUA 5CQWA 3LCKA 4G6OA 3R2BA 3Q4TA 3QTZA 4YZ9A 2UW5A 4IE9A 5FP5A 2W4OA 2QO7A 4PL5A 4S33A 1JWHA 5L4QA 3HAMA 1AD5A 4NJDA 3A7IA 4ITJA 4BGHA 4EKKA 2CDZA 3MJ2A 1GAGA 1PYEA 2DQ7X 3MFTA 4S30A 5AV0A 4DG2E 2GSFA 3A4OX 2IZSA 5CLPA 1PXIA 1YW2A 3R9DA 1FGKA 3FI4A 3VBQA 3P79A 4BGQA 3Q04A 4TW9A 4IWOA 4QMVA 3TUCA 4UYAA 1WAKA 2OJIA 4O91A 5CTPA 1W7HA 4NYEA 4GU9A 2C6OA 4NM5A 3MTFA 3Q96A 3NNXA 3VS7A 2V0DA 1J7UA 5AUTA 4O7TA 3FY2A 4CG8A 3EFJA 4U7ZA 2R3MA 2W17A 3U9NA 4F9BA 2OW3A 2F57A 2YIQA 2H6DA 4K6ZA 4F1OA 4ZZNA 4QP8A 3OTUA 4L52A 4HVSA 2VO6A 2X6EA 2DS1A 1OBGA 3UIXA 4EBWA 4TYHA 3TV4A 3TCPA 3NS9A 4ARKA 5CF8A 3TM0A 5T6KA 2IZUA 4RVMA 3CCNA 5ANEA 2ACXA 4PUZA 2AC3A 4ZZOA 5K5NA 3EQBA 2Y0AA 5HO8A 1CM8A 3SG8A 3QTQA 4DGGA 2E9VA 4JRNA 3C0HA 5GINE 2RG6A 1JOWB 4NSTA 4D2SA 2YDJA 4Z3VA 3VS2A 3CSVA 4XS2A 3L9NA 4KSPA 1CKPA 3AT2A 3GEQA 3LCOA 3DBFA 4XMOA 4IANA 3OXZA 5ETFA 1U4DA 2JDSA 3ANQA 5KZ0A 3VS6A 4AUAA 4FNXA 4FOCA 2O63A 4IM2A 2R2PA 3RVGA 3ZRKA 3R01A 1Y8YA 2OFUA 1YOLA 3F3ZA 4RX5A 1J1CA 4U40A 4PTGA 4EH3A 3P7CA 4I21A 4TYEA 5M53A 5EKOA 4I92A 4DH1A 1YVJA 3W8QA 2VTHA 4EQUA 4RX7A 3RAIA 3H3CA 4F9WA 4ERWA 4ZOGA 4BTMA 4YTCA 1H1PA 2F4JA 4TL0A 3E62A 3A8WA 1SMHA 1WBPA 4EOJA 2R3NA 2RIOA 4K0YA 2IW9A 3GU8A 4O7LA 3KXGA 3VUMA 3A7JA 3QTXA 4G3DA 4IM0A 3ATSA 4RJ8A 4F99A 5HG8A 1H0WA 2JAVA 3NX8A 4C59A 2CKEA 4JL9A 4OW8A 2XJ2A 4C8BA 5KKRC 2C5YA 5FGKA 3BKBA 3BV2A 3VUGA 4FV9A 2CKQA 2XEYA 3UNJA 3DS6A 4N70A 3LJ1A 4DHFA 4DGNA 2UVZA 3COMA 5IEVA 3FL5A 3BYOA 4V0GA 3G5DA 3IW6A 4IWQA 4FA2A 1PXMA 5DG5A 3UODA 4IH8A 5HGIA 1YDTE 4BCHA 2EB3A 2PE2A 3SOAA 3E5AA 4X2NA 3ULZA 1OVEA 4OR5A 5JRQA 5CAOA 4LOOA 4MXOA 1YOMA 4DFLA 5BYYA 4QYYA 3KEXA 5DT4A 3HMMA 5AP6A 4AA0A 4AT5A 2BDFA 3VQUA 5JGBA 4BI2A 5JN2A 3QQLA 2WTWA 2YLFA 3EZRA 2PVHA 3DOGA 1H1RA 4BRXA 4IWDA 2C0OA 3VC4A 3IKAA 4IZ7A 2QLQA 3ZC5A 3V01A 4Y5HA 2J5FA 3C13A 2XNBA 4I41A 1Q3WA 3NYOA 5IQHA 1NA7A 3FLQA 3CR0A 5IUGA 4IIRA 5JSMA 2ETKA 3TG1A 4IB0A 3IOKA 3WYXA 4WNMA 3V51A 5GZ8A 4ANQA 3IOPA 4M0ZA 4XH6A 5CASA 5KZIA 3SV0A 4CTBA 1PXKA 2ITVA 4IHPA 4R8QA 4L7SA 3CPBA 3KCFA 4JAJA 1M2RA 2WO6A 3Q4ZA 4ZMEA 4O0VA 1W0XC 4FUXA 3O50A 3FKLA 3RCDA 3LM5A 2FSOX 2YM4A 3PVWA 5AR2A 5KHWA 3R7GA 1XH5A 4L00A 3LFNA 3I5NA 1TQMA 1XH8A 2GNLA 2QC6A 3OWKA 3DB8A 3GFWA 3PXZA 5BMMA 1BKXA 2XRWA 5D7VA 3VHKA 3ID6C 3N4TA 1NVQA 4E4MA 5IA1A 3HAVA 3NW5A 3KQ7A 3G9NA 3FI8A 3D5UA 4YHJA 3EYGA 4XG6A 2XIKA 3HMOA 4HYHA 5AUWA 3A4PA 4GVAA 3RK9A 5IEXA 2GS6A 3SOCA 2B9IA 1H01A 3EFKA 3OFMA 2C1AA 2JAMA 4JIAA 4C33A 3QU0A 2A1AB 2OXYA 4G9RA 4EH7A 1JLUE 5B0XA 4CRLA 4RX9A 3AMAA 3UE4A 1HOWA 2PUUA 4LGHA 5JFSA 3LMIA 1LEZA 1XBAA 2HENA 2Z7LA 3PXFA 3Q32A 4JG7A 5E92A 4E1ZA 4EH5A 2WPAA 4XOZA 4WBBB 4AZEA 4RX8A 4AT4A 2NO3A 4ANOA 4XV9A 3HV7A 4RVLA 3UP2A 2R3OA 3TT0A 4I0SA 4FVPA 4RPVA 3WF9A 5LVPA 3TWJA 4XLIA 2CKPA 3GU7A 4GRBA 4FKOA 2Q83A 1YHVA 3BELA 3KKVA 2CGWA 4FNYA 2OF4A 4D28A 2W0JA 2OLCA 4G31A 3DBDA 4J95A 4M8TA 4AZSA 3AC1A 3MVJA 4M69B 4O82A 4DFBA 5HESA 1JQHA 3R04A 3W32A 4RWKA 4NKAA 1CMKE 1WVYA 4N4SA 1PMUA 1JVPP 5KUPA 4HGTA 3OCSA 2AC5A 4JJRA 4S31A 4H3BA 4I20A 1WBOA 3F3TA 2YCQA 4IAZA 4P5QA 3WF7A 3R6XA 4FV6A 4BL1A 4E6AA 2GS2A 3O7LD 4LMNA 4WHZA 4JDJA 2YACA 4RRVA 2W1CA 2OO8X 4I94A 5AP4A 4L68A 2ONLC 4DF3A 2XNNA 2YAKA 2YM5A 4X2GA 4O22A 1UU9A 4XCUA 4MNFA 4OBOA 5A6NA 4WG5A 4QMYA 4AWIA 3OD6X 4X3JA 3Q6UA 3E8NA 3L9LA 3HV5A 5GNKA 4EK4A 2IVVA 2QU6A 4D2VA 1A9UA 4D58A 4O84A 5CT7A 4KUJA 4XJ0A 3CE3A 4UN0C 4ALVA 4FEUA 5IA2A 1OKZA 2PZIA 2WTDA 2YIWA 2CCIA 3K5UA 3QCQA 4NCTA 3OG7A 2JFLA 3FMHA 4D1SA 2F49A 2G01A 4UWBA 4ZLYA 5LWNA 2WIPA 3UQCA 4CYJA 4Z16A 2WU6A 2IVUA 4F6SA 3R8PA 3PG1A 4JDIA 1CDKA 4HNFA 4DTBA 2C4GA 1YI6A 3HA6A 1U5QA 2CCHA 2G2IA 3F66A 3QQFA 1J7LA 2EB2A 4GK4A 3ITZA 2VO3A 3NAYA 1QL6A 3PUPA 4QMTA 4O27B 4QOXA 4IAYA 3EIDA 3IO7A 1YHSA 3IS5A 4KKEA 4ZTHA 3F5PA 1V0BA 5HG7A 4ALWA 3UGCA 4YSMA 4JX7A 1L3RE 3LM0A 4PDSA 2FSTX 4AFJA 4AGDA 4RVKA 2XCHA 2WMQA 3FDNA 3LQ3A 3PYYA 2UUEA 3FSKA 3I4BA 2OICA 3REPA 1ZYLA 3PG3A 4FT0A 2Z02A 3N4UA 4ZLOA 2ITYA 2WOTA 2UZBA 5DOSA 2PU8A 2X0GA 5AR7A 1GIIA 5HLNA 2XF0A 4I5CA 3ZSGA 4AGCA 3GENA 4EWQA 5BVKA 3CGFA 3GB2A 3IECA 1HCKA 4UZDA 2PVMA 4HZSA 1JKKA 5DBXA 2XKFA 3HV6A 5J7HA 1NW1A 5EI2A 2O8YA 1I44A 3E64A 3KCKA 4FSRA 3UJGA 3MY1A 5D7AA 5AA9A 4B7TA 4HVDA 3GCPA 5AUYA 4TT7A 4YZBA 4L67A 4WT6A 3WILA 4K8AA 4D0XA 4RA4A 4F63A 3Q3BA 3OOMA 3CEKA 1OPKA 2JDTA 2QCSA 3ORZA 2H34A 4FV3A 3BWFA 1WBWA 3TI1A 4ACGA 4CZYB 5A54A 5EDQA 3EQIA 3HUCA 4HGSA 4DGLC 5C4LA 4FTQA 4O7ZA 4TKSA 4DG3E 2R3GA 4GV1A 3QFVA 4QP3A 5KMOA 4LL5A 2ZV8A 5AIKA 4EUTA 3FSFA 4EZ7A 3KXMA 2XBJA 3VQHA 1IR3A 4PP7A 2ITOA 4AP7A 4FTMA 3UO4A 1FVTA 4DEHA 4G34A 2XMYA 4KNBA 3PZHA 3UZRA 2R7IA 4FTCA 4PPCA 3ZHPC 1IAHA 5DRBA 5AP1A 4IQ6A 4CFFA 4FTKA 3OEFX 3V5JA 5FDPA 2J2IB 2VWBA 5J5TA 4FK3A 2QHNA 3F7WA 4GYGA 1STCE 1E9HA 2EWAA 2Y8OA 5BMSA 3F5UA 3GC8A 1JKLA 5E9EA 2ITPA 3ZO2A 2Y4IB 3QGYA 1PXLA 1WBNA 3P23A 2RF9A 5ANIA 4R7IA 4ORKA 3EN4A 2A0CX 2DUVA 2XK8A 4WSQA 5HX6A 5B2KA 3R1QA 3FPMA 3RHXA 4A9TA 3N4VA 3AMYA 1W82A 4F9YA 2XKEA 2YIRA 4YHTA 3KXZA 2ZM3A 5C1QB 2C47A 3PXRA 2R7BA 3DK3A 4JT3A 1H1SA 2J51A 3F3VA 2C69A 3KL8A 2CHLA 4BDJA 5CT0A 4FIIA 4GK3A 3R7OA 3GOPA 4XG8A 4DLIA 3COHA 4GCJA 4BCJA 5CQUA 2PMOX 3S3IA 3D5XA 3QUEA 5CZHA 1XBCA 2WTIA 1FOTA 2WHBA 4E5AX 1BX6A 4GT4A 3V3VA 1UWJA 3LE6A 4C7TA 3R7VA 3PTGA 2YZAA 4FKSA 4H05A 1ZYJA 4HZRA 3MIAA 3JVSA 1V0OA 5DGZA 3UC4A 5EFQA 5FP6A 4E4XA 4IB5A 4RWJA 3BHVA 3TNPC 2O64A 2QOHA 4K18A 5FXQA 5C8KA 4QMSA 4ZLZA 3QCSA 4O0TA 3EWHA 3BGPA 4H3PA 3I6WA 2C5OA 3E87A 3HRCA 1XJDA 5I3OA 3GNIB 3ZYAA 4LFIA 2VWWA 4FVRA 5CEIA 2YWPA 1JNKA 2X8DA 4RLLA 4BKZA 4K77A 4X6QC 4II5A 5D9HA 2QOBA 4AA4A 1Q41A 5TE0A 2EU9A 2OG8A 2OXDA 3QZIA 1ZLTA 2R5TA 4C4FA 4DFNA 2P2IA 2VWVA 4QYFA 4ZSLA 4ZZMA 3C4WA 2QODA 5EYCA 4EK6A 4FT7A 3QTSA 2XK3A 4A06A 3WZJA 5A4EA 4EH6A 4L44A 1XWSA 2BAKA 4EK3A 1E1XA 3LQ5A 4UMQA 4BGGA 5KCVA 3SA0A 5L6PA 2PVFA 2O0UA 3Q9ZA 4FKWA 3EKNA 4ZSJA 2W1ZA 3B8QA 3F5XA 4J97A 3ORKA 4CQGA 2GFCA 3A60A 4GJ2A 1BMKA 4YZDA 3C5IA 4GKHA 2BKZA 4PY1A 2WMAA 4FZAB 1KE9A 1VJYA 4APCA 5HNIX 4JRVA 4WA9A 3MESA 4PMMA 4H36A 3LCSA 3CJGA 1MRYA 3NYXA 3SD0A 3WZKA 3HP5A 2XNPA 1GZ8A 4GSBA 3SVVA 4U80A 2X2KA 4C3PA 2WTVA 5HNGA 1PXOA 2ONLA 3EQDA 4EBVA 2OIBA 3PRIA 1LUFA 3TIZA 4BDIA 2RFEA 3DV3A 3UIMA 4DG0E 4TRLA 5EG3A 2C5XA 2W5AA 2ITZA 5LARA 4WNPA 3OXTA 3EYHA 3T3VA 5IMXA 5TR6A 3NLBA 4EOLA 5HTBA 5IA3A 3N9XA 4CGAA 4FE2A 3ZEWA 4C58A 1G5SA 4AN9A 2C68A 3E92A 3F2AA 2YABA 2JKKA 4N6YA 4BVUA 4NM0A 2RL5A 3DXNA 3R83A 5ANDA 2YM3A 5HTIA 3OBGA 3VRYA 4CKJA 1U54A 3BV3A 4DN5A 2OBJA 4QD6A 2UZUE 3FAAA 5HIDA 2PUPA 4Y8DA 4KA3A 1F0QA 2HAKA 3A2CA 4GIIA 4XV1A 4QTBA 2LAVA 5CEOA 3S4QA 5B2MA 3MY5A 3EB0A 1FMOE 3DT1A 1ATPE 2BVAA 3KMWA 4M84A 3CD8A 5HCYA 2E9UA 2QD9A 3QKLA 2ZB1A 4CFXA 3NPCA 3P08A 2XZSA 3QYZA 4F65A 5HHWA 3PA3A 1OUYA 3A7HA 3IW7A 5M09A 4BY9E 3VJNA 2LGCA 4D4VA 5IA5A 4NT4A 4F0GA 4PTCA 5CSHA 2BIKB 2V55A 3GU4A 2YDIA 3RINA 3UTOA 4HGEA 4DEDA 3HMNA 2CPKE 3TUBA 2XM8A 1Q8WA 2F2CB 4BI1A 1YXUA 5L2TA 4CFVA 5DHJA 1WZYA 1ZRZA 3ZO3A 1XR1A 4O38A 2RGPA 3D83A 4LRJA 2XUUA 1XBBA 3IW8A 4X7QA 2WTKB 4U42A 4YURA 3RGFA 2P55A 2WMSA 3RK5A 3L8VA 5AUZA 3VRZA 3BHTA 4M0YA 2QI8A 5FLFA 4L8MA 1S9IA 2EUFB 5IH4A 3PWYA 4LG4A 2GHGA 4R78A 5GJFA 5CU4A 4D2PA 2I6LA 3FQEA 4XG2A 2QNJA 2G2HA 2RKUA 4LUDA 5HI2A 2YFXA 3UP7A 2REIA 4JQ8A 4MWHA 3FLWA 3BX5A 3D7TB 2R3PA 1YWVA 2BIYA 3NWWA 5FEDA 4C3RA 4DBNA 2UVYA 1BLXA 4KS7A 3HA8A 3UC3A 4C4IA 5KMKA 3IPHA 5LMBA 3TZ8A 1UV5A 2PE0A 2R9SA 5BUIA 3ZFYA 1V0PA 5HIEA 4AQCA 3IW5A 2FYSA 4HVHA 3VAPA 5HIBA 3R22A 3T8OA 3JPVA 2PUIA 3JS2A 3PY3A 4L3JA 2VX3A 4OTGA 3R71A 2NRUA 4QMNA 4GFGA 4BN1A 4KIOA 3FC1X 4ZTLA 4L46A 3ZXZA 5IISA 2GQSA 4ACMA 4FR4A 5KHXA 4AW2A 3Q53A 3RPSA 2UW6A 4BDGA 4M97A 3F5GA 4U3ZA 4XLVA 5BVWA 3IW4A 4UB7A 2OJFE 5LMKA 4PTEA 3D15A 1KE6A 5CF6A 2V7AA 4IFCA 4XBUA 3ZLSA 4C35A 3QUPA 5FQDC 4WG3A 4RBLA 3MI9A 1H07A 1H8FA 3NNWA 4MHAA 4QPAA 1YDSE 5FTQA 2VO7A 3LMHA 3QQHA 5CVGA 1TQPA 2GNJA 2UW4A 3OWJA 4FIHA 4MD7E 4I3ZA 4FSZA 4QP2A 2JD5A 4RA5A 4FZDB 4HYIA 3FHIA 3GC7A 5ICPA 3KU2A 1ZZLA 5I0BA 3MFUA 3VUIA 3ZRMA 4UX9A 1OZ1A 4YU2A 3UZPA 4PF4A 3LFCA 5I9ZA 4AS0A 2P3GX 4MQ2A 5M56A 4WUNA 4QT1A 4H3QA 4JQEA 5DYJA 2CLXA 4UWYA 3OZ6A 5FTOA 4H1MA 5HBHA 4FKGA 2QOIA 3W18A 3PJ8A 2IZRA 2VTSA 4LOQA 4FV4A 3PY0A 4I93A 2CN8A 1YWNA 2BAQA 5J9YA 2CGUA 2B9JA 4YO6A 1ZZ2A 3CLYA 3TJCA 3TZ9A 3W10A 4EH8A 2W9ZB 5H8BA 3UVQA 4CRSA 1M2QA 3SG9A 5E91A 4GFOA 3B2WA 1GIHA 4JVGA 4PQNA 3QZGA 4YUQA 4IACA 4QPMA 1BI7A 2R64A 3VHEA 3UDBA 2H8HA 2YEXA 4NWMA 1IASA 4LGDA 3UQGA 1OBDA 3ZEPA 1NVSA 4BKJA 4FEVA 4EK8A 2JIVA 2RSVA 2JITA 2BRBA 1GY3A 3Q5IA 1LR4A 3VBYA 3H30A 3HNGA 4A07A 5J9ZA 4BDEA 4X3FA 3JXWA 4XP0A 4O7NA 1UNHA 1H24A 3BEGA 3DJ7A 2V22A 4U5JA 4QP6A 5I9VA 1SVGA 2X81A 5C01A 2UW3A 1KE7A 3RWQA 2JBPA 4IB3A 3QKKA 4MTAA 3PJ2A 4C2WA 2WMRA 1VEBA 5AIRA 4IZAA 4UMTA 4PDOA 3CC6A 5ETAA 3Q2JA 4FZ6A 5AADA 1OIUA 3QHRA 3AD4A 5HZNA 2V5QA 5FWKK 1SZMA 2P2HA 3MVLA 1UKHA 5BPYA 2C6LA 5C03A 4E73A 3ZBXA 4DT9A 2JEDA 2QKWB 4IVDA 3CTHA 5GJDA 4V05A 4KKGA 4TWCA 1OKWA 2VUWA 3NIEA 3TDVA 5M51A 4PDYA 3QAME 4BTJA 5LXMA 5CY3A 5J7BA 4RC4A 3QLGA 3FXWA 5K4JA 3QZHA 3VF8A 4MXXA 5LVNA 5TKDA 2WQNA 2I1MA 4HPTE 3NCGA 4AF3A 2VTTA 3HKOA 4KRCA 4PMPA 3UO6A 4L7FA 3KK8A 3DNEA 4L01A 4J98A 4O2ZA 1ZWSA 4DAWA 4EHEA 5LVOA 3R30A 2PMNX 2PVYA 2XKCA 2I0EA 3IG7A 1KWPA 4YJRA 5AUVA 4BBMA 1MRVA 2RFNA 3BU5A 4OTPA 4CFNA 4XUFA 4MNEA 4HPUE 4JLCA 5IEYA 1UNLA 4G1WA 4GJ3A 3OT3A 3QRUA 4I6BA 4BIEA 3MPMA 4YJPA 3FJQE 4RIOA 4RLKA 4F7SA 5EK7A 3NUUA 3L9MA 3U54A 4AN3A 4IAFA 3VS0A 4BWPA 3RI1A 2R4BA 4BBFA 3UQFA 5J8IA 5M07A 3BRBA 4G3GA 4BI0A 1R39A 2ZV9A 4M68A 2QKRA 3MH0A 1KOAA 1DAYA 3AD6A 4NCTC 5IQIA 4USDA 3ZBFA 3OEZA 4ZTNA 5ITAA 4JG8A 5E4HA 4IZYA 2OKRA 5K0XA 2QU5A 1OUKA 3KXNA 3KN6A 4XP2A 3DGKA 3CTQA 4PDPA 4EYJA 1Y6AA 4O7RA 3R1NA 3R0TA 3EFWA 4MBLA 4ANBA 4DEIA 5BYLA 1Z57A 4M14A 3W2PA 1J91A 2BZKB 4RZWA 2W1GA 3HLLA 1CKJA 3P78A 4I24A 1MRUA 1OIYA 2VNYA 3LVPA 4EOSA 1RW8A 4IVCA 3RPRA 1I09A 4F08A 1U5RA 4BDFA 3LLAA 4MYGA 4GK2A 1BL6A 5EDPA 2J90A 5IH6A 4NL0A 3KULB 3ORNA 1K3AA 2XB7A 4JAIA 3CQEA 4B99A 2VV9A 4YPSA 3RBWA 4NIFB 5BUJA 4F6WA 2WELA 5BNJA 5DMZA 4PX6A 4EUUA 2IW8A 3ZUUA 3UOJA 4R3RA 1Q8TA 4D4RA 2VWXA 3BHUA 2CMWA 4FEQA 3IDBA 4UYNA 3ZMMA 3NEWA 4NKSA 3MFSA 4DH5A 3S00A 4YLKA 3LXPA 4LRKA 4FSNA 2UZDA 3ZLXA 5HU9A 3D4QA 4FKIA 4A4LA 4R1YA 3RKBA 4O7YA 4IM3A 4N57A 3LJ0A 3NRMA 4HNIA 3VS5A 1A06A 2IVSA 3GQIA 4FV5A 4MX9A 4XYFA 2UZLA 3FKOA 4A4XA 1Q8UA 4UMUA 2F7EE 4G3FA 1KUTA 3UNKA 5AEPA 4Q9ZA 1SM2A 4O7VA 1PXNA 4YPDA 5FRIA 1DM2A 2GNFA 2PVKA 1UKIA 5J95A 3F9NA 4R3CA 4WO5A 3AQVA 2WNTA 3VBXA 3EN6A 4S32A 2Z7SA 4R7HA 2BRNA 2VTAA 4FTLA 3NUAA 5DN3A 5HTCA 3WIKA 2JDOA 4GU6A 3FE3A 1QPDA 2E9PA 2YITA 2VTRA 4CV8A 4QMZA 3EN5A 4QMXA 4P90A 1LP4A 3MVHA 4RJ5A 3HRFA 5ETCA 4ANNA 1O6KA 3LFBA 2BKKA 4OTDA 4FSYA 4BTFA 3CKXA 3FI3A 4FSQA 3RAHA 2VAGA 3R00A 2Z7QA 4D1XA 5M44A 4DBXA 4NFMA 4KWPA 5CXZA 3W16A 2VGOA 3VN9A 5A4TA 4RC2A 4AZTA 3PSCA 3ZU7A 4RGJA 2QOLA 4BWXA 2UZTA 5IQEA 3R02A 4O0YA 3NR9A 5F95A 3RNYA 3GOKA 3AGMA 3FZ1A 3BLHA 3A8XA 4O0WA 3R8ZA 5JQ8A 4EJ7A 1YI4A 5EOBA 1XH9A 4BCGA 3R7IA 4K11A 3Q5ZA 2JGZA 1P5EA 3TN8A 2C3KA 2R3LA 2YM7A 1XKKA 1ZYCA 4JBQA 2BAJA 3HUBA 4MWIA 3VUKA 4DH3A 2BUJA 2ZDUA 2W05A 1WVXA 2QOQA 3DLSA 5M4FA 3CD3A 3GCQA 5E1SA 5DE2A 3U55A 3ORMA 3O8UA 1P2AA 2UV2A 4YNOA 2VWZA 3C1XA 4PPBA 1TKIA 5A14A 4FODA 3FQHA 3O71A 2W4KA 2IWIA 3P86A 4YC6A 5AP5A 3CS9A 4O6LA 1XH6A 3DPKA 3UYSA 2HZ0A 4FNZA 4GIHA 3B2TA 4M66A 1OPJA 4CTCA 3VUHA 1Z5MA 1YXSA 2BROA 4YZCA 3VBWA 4HYSA 4WUAA 3OROA 3FMEA 3CXWA 4O0SA 1E1VA 3QYWA 3BPRA 3WI6A 3LW0A 5HD7A 1YKRA 5I9YA 1FMKA 4LL0A 1WBVA 2HCKA 2XNOA 4FSWA 5KKRB 4E5WA 5G6VA 3GBZA 4AOJA 5CSVA 4AZFA 2X4ZA 2Z60A 3FXZA 1OI9A 3BQRA 3I1AA 3O8TA 5A6OA 2GQRA 4ZY5A 3W2QA 2BZIB 2XM9A 3OT8A 5AUUA 4BC6A 3MV5A 3TUDA 3KGAA 4KIPA 5DH3A 3FMNA 4EZ5A 4MBJA 3KXXA 3D7ZA 5CU6A 2J0MB 3CY2A 1KOBA 4O0RA 3DJ5A 3UNZA 4B8LA 2NPQA 5D10A 5T68A 4HJOA 4QNYA 4EHVA 3E7OA 5GZAA 5FD2A 2BHEA 3NNUA 5C26A 4CVAA 2QHMA 4ACDA 3HDNA 4DFYA 2FSLX 3TDWA 3U6JA 4QNAA 3F3WA 4ZJIA 3W8LA 3WF5A 2XNMA 3WARA 1MUOA 5E8VA 5FBOA 5CENA 3WBLA 4BWKA 3LMGA 3S0OA 1FBNA 3FMLA 1U59A 3W33A 1OL5A 3BBTB 1H26A 3PE2A 5IQAA 3OCBA 2HY81 5E1EA 4CG9A 4BTKA 1IA8A 3VWAA 2FGIA 3LCDA 4ZSGA 5AX9A 5H9BA 5BQ0A 3WOWA 3OW3A 4L43A 2WMWA 3I7BA 3NCZA 4OTIA 4D1ZA 5HE2A 1S9JA 1AQ1A 1PF8A 1Q5KA 1JSUA 3CJFA 2G15A 5JT2A 5GIOE 5DI1A 4O21A 2UW8A 2ZMDA 4QTEA 2VNWA 3Q4CA 4K1BA 4KABA 3NW7A 4HGLA 2YLEA 2Y7JA 3K3JA 3H0YA 4EOIA 2PE1A 3C4XA 4C4HA 3NDMA 2B7AA 3M2WA 4BIBA 5EQYA 3Q9WA 2X7GA 4GMYA 4R77A 1R78A 4H39A 5GZ9A 1PXPA 5AV3A 3ELJA 4AG8A 5CAUA 3V5TA 4IVBA 4Z7HA 4AOTA 3QF9A 1PHKA 4J53A 2BFYA 3MH2A 3ROCA 2Y6MA 4YC3A 3RWPA 4Q9SA 4UV0A 2EVAA 5K3YA 4C4JA 3LFAA 3OC1A 2EXEA 3QXPA 4NZWB 4C2VA 5CZIA 1VYZA 3PXYA 2C3JA 1KE5A 2Y4IC 3BEAA 5L8JA 1JSTA 4OAVB 4RQVA 5DWRA 3QLFA 2C6MA 5BVNA 5C9CA 4FC0A 4XNEA 5KBRA 3V8SA 3T9TA 1MQ4A 3E8CA 3E93A 3G0FA 3F82A 1M14A 2DWBA 5ANKA 4LM5A 4QMUA 3F69A 2VWUA 4NEUA 1J7IA 3E7VA 1A48A 3SW7A 3LXNA 4BDCA 3QRJA 4I5PA 3U6IA 4TPTA 3MH3A 4YLJA 3K3IA 5HVYA 3UOHA 4AX8A 3OMVA 3V5LA 4W4YA 5K5XA 3WZEA 4OTRA 3QD0A 4RIXB 4EORA 3QD3A 4FEXA 2IVTA 4FGBA 1UU7A 2J0IA 4FTAA 1QMZA 1YXVA 4MVFA 2GNHA 1EH4A 4L42A 3TKUA 4MD8E 3EQHA 4XHKB 5L6WL 2O2UA 3IGOA 4FG8A 2OJJA 3R7UA 4D5HA 2F2UA 5CEMA 4DGMA 5AR8A 5FBNC 4DH7A 5HQ0A 4AGWA 5A3XA 4L3PA 5CEQA 5HO7A 5CSPA 2R0UA 5FDXA 2XK9A 4Y72A 1G3NA 5F4NA 2P4IA 2OJGA 5M06A 1CTPE 2WB8A 4Q2AA 1O6YA 4EH4A 4EQCA 4ZS4A 5HE0A 4FNWA 3L8SA 3DKOA 5FEQA 3U4WA 1GOLA 3PRFA 3E63A 3MY0A 4S2ZA 5JEBA 1NXKA 3C50A 3VS1A 2HXLA 2KULA 2XVDA 3BGQA 5B2LA 2SRCA 3O0GA 3DAKA 3LFFA 3MPTA 4LGGA 5LMKC 3UMWA 3DXQA 2QG5A 3ZC6A 3POOA 1BI8A 3RP9A 3GCUA 3KF7A 4M69A 1FVRA 1OL7A 4HYUA 1ZMWA 2P33A 4QTDA 4U3YA 5JRSA 4ASDA 3FI2A 2JKOA 3EN7A 3ZLYA 5AP2A 3ODZX 4G6LA 4IAAA 3WF6A 3O17A 4FT3A 3WZUA 5DA3A 2WGJA 5AR3A 2E9OA 1R0PA 4RMZA 3G15A 3R1YA 2GPHA 4OBQA 5DIAA 3AC2A 3R9HA 2WKMA 1F5QA 1PYXA 2W9FB 3P4KA 4GT3A 4IVAA 4QPSA 4FIJA 3TACA 2PSQA 3CKWA 4F9AA 1T45A 4Y95A 3COKA 3PZEA 1BYGA 4KS8A 4K9YA 4XX9A 5F9EA 1PKGA 3F6XA 3O51A 5C27A 4XOYA 3VF9A 3GVUA 4A7CA 4EJNA 5CU2A 3OP5A 4CFUA 3BWJA 2O5KA 3CY3A 1R1WA 4ENYA 4F4PA 4O86A 2GHLA 3MBLA 1T46A 5CEPA 4WNKA 5ETIA 1SVEA 2VTOA 4GT5A 1B39A 5HD4A 4NTSA 5KMLA 3KREA 2OIDA 4QMPA 3UG2A 5LVMA 3TXOA 4PP9A 2GQGA 2WU7A 3FYKX 4QMMA 5TF9A 5JGAA 4QO9A 2X2LA 4DEEA 5IDNA 3BI6A 4RZVA 4UXLA 3VBTA 3ZM9A 2WTCA 3EFLA 3DQWA 3FMMA 3BGZA 3KB7A 4ANLA 4NM3A 4AE6A 1FGIA 3OY1A 1F3MC 4WRSA 1TQIA 2XKDA 4N6ZA 2ZJWA 2XIRA 4C34A 3HYHA 3JY9A 4KSQA 2FB8A 4BYJA 2YCSA 4KIKB 5C8MA 4F64A 4PNIA 3KRXA 4BCPA 4OT6A 4BKYA 4MF0A 3VULA 3ORLA 4FK6A 4ITIA 4EOOA 2YAAA 2XK4A 3L9PA 5CVHA 2Z7RA 4LV5A 4E3CA 3QQUA 3QALE 3EL7A 4O0XA 4FTOA 3AGLA 2V62A 3D2IA 4X3FC 4CSVA 5EQPA 3RALA 4E6DA 4U79A 3OTVA 3KMUA 4IFGA 4FKLA 4F0IA 1ZMVA 5HEZA 1WFCA 3V6SA 1VZOA 2BTRA 4CMUA 2B55A 4CCBA 3QA0A 4ASEA 1P4FA 3R21A 3QTRA 2B0QA 2ITNA 3HZTA 5EI6A 3SKCA 5L8KA 3A7FA 4GS6A 1BL7A 4DLJA 4EI4A 5J1WA 2ZMCA 4KRDA 2UZWE 3ANRA 3GC0A 3I5ZA 3C4ZA 4DCAA 4TYGA 4CD0A 5IKWA 4AN2A 4BZNA 3HV3A 3O2MA 2JBOA 5JGDA 4O96A 3AT4A 3KFAA 4RIXA 3BCEA 3EKKA 5FXRA 3QCYA 2C6KA 5D41A 2HZIA 4TWNA 3WF8A 3B8RA 3GUBA 2XK6A 4WOVA 4FKPA 2VTMA 2C6DA 3QRIA 3R73A 5AAFA 3S1HA 2GNIA 2HXQA 3FY0A 3NZ0A 2W5HA 3ZM4A 4JI9A 1M52A 2UZVA 3QQGA 1Y57A 5HO6A 2PULA 3A99A 4JBOA 2UZEA 5IH5A 2PZPA 4OBPA 1ZYSA 2C5NA 3FMKA 4IX3A 4BIDA 4BHZA 2R3HA 2C6EA 3I0QA 3S95A 4J1RA 4FTJA 3QWJA 4QTCA 3FQSA 2OK1A 1OL6A 4FSTA 2GS7A 2ZDTA 2ITUA 5E8XA 4RIYB 4QYEA 2IJMA 3IONA 4OAUC 2J0KA 4MXZA 3THBA 1L8TA 3ETAA 1OL1A 4IX5A 3PJ3A 1IEPA 3GCVA 3LOKA 3C0IA 1BUHA 2XRUA 4ZXTA 2QR8A 2UVXA 2YWVA 3EZVA 4LI5A 3GU6A 4YTFA 2JKQA 3MA6A 3LLTA 4QP7A 4QQTA 4TZRA 5GIPE 5IG1A 1TVOA 4AOIA 2HIWA 2ZVAA 2PVLA 4FTNA 4CEGA 3FLNC 2WTJA 5EHLA 5K4IA 4XG9A 2CJMA 2VRXA 4YO4A 2YM8A 4DGOA 2Q0NA 4O0UA 3RK7A 3ROYA 4BCFA 3NVKI 5DLSA 3PY1A 3P9JA 3MA3A 2BILB 4YR8A 3OS3A 4NM7A 2W1IA 4BCNA 1KSWA 5AUXA 2YCRA 3N51A 3D14A 3PXQA 1QPJA 1GJOA 3U6HA 3BHHA 4EH9A 3LHJA 3ZOSA 5DEYA 1XQZA 3IQ7A 3BYVA 4O1PA 3F2RA 3R9OA 3G33A 5LOHA 2OXXA 1KE8A 4FVQA 5KO1A 3NUNA 1QPEA 3QD4A 3F2NA 2ETRA 1WMKA 1DAWA 4U97A 5T3QA 5D11A 5LJJA 3DU8A 3FZPA 1SNXA 4B6LA 3OWLA 3I60A 5IPJA 2J50A 4LQMA 4DH8A 2ZYBA 3NUPA 5IQCA 3EH9A 3ACJA 5AV4A 1OITA 4DC2A 2PPQA 5L8LA 2W1DA 4KIKA 3EN9A 1CKIA 1OL2A 3GQLA 4FICA 4TTHB 5AP0A 3RZBA 3TIYA 1PW2A 4F1MA 2CNUA 5IQBA 4ZTSA 4D55A 3ZO4A 2OWBA 4R6VA 4WIHA 4B0GA 3BQCA 3FZSA 4V01A 3KRLA 1YI3A 2WMXA 2WQBA 4G16A 4IC7A 5AV2A 4FI1A 4C61A 2NNWB 3FL4A 2C3IB 3TTIA 4BZDA 3G6GA 2NRYA 5IZFA 1PJKA 4HCUA 3BLRA 3RJCA 5KMJA 4E93A 5DPVA 1FQ1B 1UWHA 4RVTA 1Q3DA 4YJQA 1IRKA 2ITWA 2X39A 2ESMA 1UNGA 2YA9A 1H00A 4BDHA 3DZQA 5FM3A 3ZLWA 1NT2A 1Q4LA 2XH5A 5ACBC 4LMUA 4QQ5A 2CKOA 4FG7A 4C4EA 4P7EA 4FBXA 4PNKA 4I6FA 3QCXA 4OLIA 1REJA 4ZSAA 4CKRA 2I0VA 4FV2A 2YIYA 4TN6A 3UOLA 4AW5A 4FEWA 2ZAZA 3MJ1A 1JPAA 4JR7A 4MAOA 1VR2A 4C57A 2Y4PA 4G2FA 2GTMA 1Q24A 1OGUA 3ORPA 4KKHA 2IN6A 2PWLA 4D2WA 4PV0A 2BRGA 3SDJA 4F0FA 5HLPA 5IA0A 4FKQA 3IGGA 3QXOA 1YRPA 4IXPA 2KTYA 4QMLA 4UALA 1RDQE 1URCA 3KA0A 4YTHA 4DT8A 2O3PA 5TO8A 4J96A 1H1WA 3ET7A 5CANA 3QGWA 5KX8A 2QO2A 5EHOA 3DZOA 4GFMA 4B8MA 2B1PA 3D94A 5DT0A 4KBCA 2VX1A 2QONA 4X21A 5E7RA 4O1OA 3VO3A 4QP1A 3HGKA 5CU3A 2I0YA 4LUEA 4HVGA 4CV9A 1IAJA 3PA4A 4UBAA 3QL8A 3QX4A 2FO0A 3L8PA 3NYVA 3MSSA 1YQJA 4LOPA 3AD5A 3NMUF 2OF2A 3I6UA 5DFPA 3ZDIA 4EHZA 5M4CA 3H0ZA 4Q5HA 4D2RA 4IDVA 3AG9A 4G5PA 3VBVA 1YOJA 2XA4A 3G51A 4N0SA 3TKIA 3LFDA 3BHYA 3R1SA 3RHKA 3L8XA 3DK7A 5BVFA 4XP3A 5I9WA 5KMIA 4FL3A 4FZ7A 4AACA 4ZJVA 2OGVA 4RWLA 3UPXA 5FUTA 3ORTA 3DA6A 1W83A 4JNWA 3VW6A 3EL8A 3K54A 1HCLA 4WG4A 3FPQA 2X7FA 2GCDA 2PHKA 4JX3A 3UYTA 3DJ6A 4EOKA 5AFVA 3FLSA 2BPMA 3Q9YA 4V0GB 4A9UA 4GVJA 3I7CA 3RNIA 5K0KA 2ITTA 2W7XA 3I79A 4FX3A 4YNEA 3HX4A 4C62A 1W8CA 3PP0A 3BBWA 2WMUA 1UA2A 4TYIA 4CFWA 5EKNA 5JKGA 1Y8GA 2BRMA 4U81A 4UZHA 5CALA 1OIQA 1UVRA 3KRJA 3D7TA 3R8MA 3AC4A 1PMNA 3VUDA 3II5A 3U51A 4EWHA 2XNGA 2JC6A 4F7JA 3QTUA 2QOOA 3MN3A 3U4UA 5EM5A 4ZTQA 2BDJA 5ANOA 4RJ3A 3OVVA 3C51A 3G9LX 5LCJA 1ZOEA 2WQEA 4KB8A 2CSNA 1GNGA 1GZNA 5BVEA 3OWPA 5DR6A 2WMTA 4YSJA 3EQGA 1P4OA 4NFNA 4MD9E 5CVFA 3VNTA 4M7IA 3BE2A 3WIGA 4MCVA 4PWNA 4NUSA 1W84A 2BMCA 3ALNA 4DTAA 4DEBA 3JVRA 2OU7A 4IEBA 2YDKA 4K2RA 5EYDA 1GZKA 5GJGA 5CWZA 3RAKA 4R5SA 3SX9A 2XIYA 3K5VA 4BCMA 4RJ7A 4OT5A 3QTIA 1JBPE 1OPLA 2WMVA 2W99B 1YHWA 3LFQA 1O6LA 1Q8YA 5EW8A 2YERA 2GMXA 4G3CA 2HK5A 2E9NA 3UO5A 4PMSA 3BLQA 4FYNA 4ONAA 3LFSA 2J0JA 4YTIA 2C0IA 3BE9A 4U8ZA 5BVOA 5A46A 4U45A 2J5EA 4L6QA 5EW9A 2YN8A 3MIYA 4ZK5A 2OH4A 4Z9LA 4I0TA 4P2KA 5EYMA 2YHVA 4AW1A 4Z7GA 5IUHA 2OFVA 5AM6A 4YGAA 3ZSHA 4BZOA 2ETMA 3R9NA 3V5WA 1DI9A 5EW3A 3MTLA 4UY9A 5GHVA 5CNNA 4ACHA 4KIQA 4MEDA 3SXFA 4WBOA 1G8AA 3WZDA 4WD5A 3BU6A 3QQJA 4HOKA 4GKIA 2PL0A 3F61A 4IBMA 2IO6A 3C4FA 3TZ7A 2X9EA 3UIUA 5JK3A 2I0HA 4RIWB 4MBIA 3MFRA 5H3QA 2JLDA 4RT7A 2YIXA 1REKA 3I81A 3ZRLA 5C4KA 3VIDA 4IDTA 3EQRA 4KBKA 4DFUA 3QTWA 1DS5A 3QUDA 4UXQA 2WMBA 4X0MA 4Y5QA 3IDCA 4ZY6A 3OXIA 2W1FA 5CAQA 3DDQA 2HWOA 2OZOA 4YLLA 3FKNA 4NK9A 2YISA 3SW4A 2R3IA 3AC5A 3QBNA 4FTIA 4YJOA 3PFQA 3DTWA 3FZOA 1KV2A 4S34A 3SGCA 5L2QA 4CXAA 3L1SA 4U6RA 4A9YA 3OW4A 4PRJA 5FEEA 5HLWA 5IQGA 2C6IA 3SQQA 4KINA 4AZWA 2IW6A 4QYGA 4BHNA 4D5KA 3PIXA 4MH7A 4EQMA 3V5PA 1WVWA 3VW8A 5JZJA 3HVCA 4DYMA 4BICA 3EMGA 2F7XE 3ZTXA 5EM8A 5J5SA 3K2LA 2BTSA 1Y6BA 1MQBA 2BHHA 2WQOA 3BYUA 4MXAA 5DR9A 2VZ6A 4R3PA 4O2PA 4FF8A 3W1FA 3R9RA 3FEGA 4M12A 3RZFA 4ANSA 5IU2A 5AAEA 2QLUA 3ZZEA 4FIGA 4IJ9A 4USEA 5CF4A 4F7LA 3FV8A 3LAUA 5CSWA 3PPKA 4OUCA 3LQ8A 4U41A 3DFCB 3EQFA 2A27A 3QX2A 4GUBA 4UEUA 4OTQA 3SHEA 4BCOA 4EKLA 1ZAOA 3DFAA 2X9FA 5AA8A 5L2IA 3ZS5A 3LZBA 4E20A 2O65A 4MXCA 4RJ6A 3ORXA 3E3BX 4E5BA 4XRJA 1ZMUA 4IW0A 2PVRA 3CP9A 1SYKA 3QHWA 1IA9A 2OIQA 4RWIA 3HP2A 4X2FA 4FKUA 3DAEA 2ITQA 2IG7A 4D9UA 3FXXA 4XBRA 5KBQA 3DKGA 2C0TA 2A4LA 2NP8A 4M3QA 5CXHA 4V04A 2XIXA 4YJVA 5L2WA 2W96B 1UU8A 3ZXTA 3QD2B 5LCKA 5CI6A 5I3RA 2WEIA 3FZRA 4XRLA 1JKTA 2OZAB 2PVJA 4YZMA 5JQ5A 2I7QA 3A62A 3MYGA 5HG5A 3IK3A 1YDRE 2HZNA 3I0OA 1JKSA 1X8BA 5HE1A 4BR3A 2JFMA 4W8DA 5CX9A 5A4LA 2UW7A 3PSBA 5HCXA 5IDPA 2HY0A 4IAIA 1W98A 5HBEA 4F9CA 3U9CA 4CMTA 5I9XA 5AM7A 2GHMA 4BDAA 4GG7A 4P5ZA 4WKQA 4IZ5A 2G9XA 4QYHA 2WZJA 4IWPA 3FWQA 2H96A 2R3KA 2FUMA 4E6QA 3CGOA 4FV8A 1PMVA 2W5BA 2HZ4A 3G6HA 2G2FA 2BALA 4DTKA 4MXYA 2PZ5A 3DDPA 5J1VA 1ZOHA 1OKYA 3V6RA 3M11A 4EONA 4UWCA 4FIEA 2YM6A 3R7EA 1AGWA 1H1QA 3OUKA 4FKRA 4XG4A 3JR1A 2X8EA 4APPA 3KULA 5FG8A 3KY2A 2B9FA 4D2TA 5J87A 2XP2A 4I6HA 4WNOA 4J71A 3AMBA 5FXSA 4NIFA 5EI8A 3MH1A 4DCEA 3POZA 4UMRA 3VJOA 2PTKA 4O81A 2BR1A 4JG6A 4RIWA 2R3JA 4JOAA 1YWRA 3TNHA 5I5ZA 4X2KA 4ZSEA 4ALUA 3Q52A 3F3UA 2GTNA 3NUSA 5H2UA 4AU8A 4B9DA 2J7TA 3FHRA 5CSXA 1APME 4AAAA 3D2KA 3DBQA 3FZTA 4F09A 2BDWA 4ASZA 4HCVA 3MW1A 4FT9A 3O96A 1ND4A 4R5YA 4FKJA 3Q2MA 4GH2A 2UW9A 2XJ1A 3KN5A 4L9IA 5EQEA 2X7OA 3O23A 2A19B 3NSZA 4CKIA 4EHGA 4HW7A 4QTAA 4GUEA 3TL8A 4L53A 5HORA 3UPZA 5DNRA 4YBKA 4C0TA 5IF1A 3R2YA 1R0EA 2C30A 4G5JA 1FVVA 4D9TA 1OB3A 3TNIA 3OY3A 4CNHA 1U46A 2CLQA 2HW7A 4P4CA 2VTIA 3U8WA 4ZEGA 4X6RA 4ASXA 2OJ9A 5M08A 4JXFA 5BVDA 3QRKA 2JDVA 5EM6A 1J3HA 2RFSA 3DLZA 3SRVB 3NGAA 5IQFA 2QG7A 4JR3A 2XCKA 4I0RA 3OCTA 4E4NA 3UVRA 4EC8A 4QP4A 3PWDA 5FTGA 3ENHA 4FIFA 1ERKA 1OKVA 5IA4A 5JH6A 3GC9A 4J8MA 4QP9A 1CSNA 3SC1A 2I40A 4ERKA 4LV8A 4NTTA 4AE9A 4ZTMA 4FTUA 4G6NA 4ACCA 4QMQA 3MB6A 3E3PA 3LIJA 4R1VA 2W06A 4YBJA 3VS4A 2YZLA 5J9LA 2X6DA 4HVIA 3QA8A 3C4CA 4RFZA 4RSSA 4U0IA 2VU3A 4W4WA 4ZAUA 5BUEA 3MB7A 3TKHA 2VO0A 5EOLA 4ZIMA 2WOUA 3RPVA 3SXRA 1DI8A 3S2PA 4ANMA 5J79A 4AA5A 5HVKA 4ITHA 4TWPA 2VN9A 3W2CA 2Z2WA 4PL4A 3QQKA 1RQQA 5E8UA 5EM7A 5HCZA 3DBEA 1B6CB 3GGFA 4E7WA 2OZAA 2R0IA 3EOCA 1QCFA 3W2SA 3BZ3A 1WBSA 5LQFA 4L3LA 2YCFA 2WEVA 3JUHA 2XJ0A 4CFMA 3DQXA 4PL3A 1RE8A 4DINA 3NUYA 3FLZA 4QQCA 1LEWA 4I6QA 4AZVA 3D0EA 3V5QA 5L3AA 4I5MA 3DBCA 3VUTA 3UZTA 2VWYA 3AC8A 1H25A 5CS6A 2Y6OA 4AW0A 3M1SA 4AXAA 2Z8CA 4U44A 5LWMA 3PVUA 2HELA 3P5KA 5H8EA 5BYZA 4E6CA 4FKTA 3H9RA 5M4IA 4K33A 2H9VA 5EYKA 5A4CA 2ZB0A 3CQWA 4YJTA 4IC8A 2EXMA 1ZY5A 4KAOA 4M67A 3TV6A 4ENXA 5G1XA 4EOPA 2B52A 1FPUA 3RM6A 4RJ4A 1ZOGA 1H28A 4XV2A 4XEYA 3RAWA 3TJDA 4DITA 3PVBA 5E90A 4ZP5A 3SAYA 3HMPA 2R3FA 4BDKA 2ITXA 1U54B 2XK7A 3P7BA 2JKMA 4G17A 2QO9A 4IX4A 2AUHA 3V8TA 5HOAA 4L45A 3UMXA 4EOQA 2VGPA 5ACKA 2FA2A 2BRHA 5L6OA 1H08A 2VWIA 3AOXA 3HECA 3ULIA 4HCTA 1RJBA 3V04A 1MP8A 3A61A 4AFEA 5KMMA 4TXCA 2UW0A 3ALOA 4TY1A 2WAJA 3RCJA 2QURA 3GFEA 4ZMFA 4GYIA 4XG7A 3MPAA 4QQJA 3DNDA 3FBVA 4IB1A 3ZUTA 2VTNA 2OI4X 4C3FA 4KD1A 2V7OA 3WE8A 1XO2B 2GU8A 2W1EA 4X2JA 4D4SA 3E88A 1K2PA 3MGYA 4FSMA 3A7GA 3OHTA 4A9RA 2XEZA 4FV7A 3EHAA 4FUYA 3W55A 4DEAA 4RFMA 3V8WA 4TNBA 4XG3A 2PYWA 3PP1A 3PVGA 5DRDA 4FTTA 5AR4A 3OOGA 1OIRA 1PY5A 2FSMX 3FMDA 1V1KA 2QVSE 4FYOA 4W9XA 5KE0A 3LKMA 5AAGA 4YJUA 1M7NA 2IZTA 4W9WA 4DFXE 4MK0A 5AP7A 1PXJA 3QC9A 2VX0A 2R3RA 3KF4A 3LCTA 4I4EA 4IADA 3SRVA 4W4XA 3HV4A 4CT1A 4MF1A 5IQDA 5AWMA 4JS8A 3JY0A 4NU1A 4LRMA 4BDBA 3C7QA 3DCVA 1H0VA 3DB6A 2XBAA 3DTCA 4YZNA 2C3LA 5AMNA 5E8YA 4WSYA 4BYIA 5F20A 5D1JA 2YJSA 3UVPA 3NAXA 4QMOA 3ZONA 4NW6A 4EZ3A 1ZY4A 1OMWA 5CI7A 5E8WA 4F1TA 2VTJA 4ID7A 2J6MA 4BCQA 4FTRA 3EJ1A 5LVLA 3KRWA 4CQEA 1XH4A 5IUIA 4ZJJA 3UBDA 1OM1A 3AXWA 1Y91A 1YXTA 4R7BA 4M13A 3KC3A 3ZO1A 2ZV7A 2BFXA 2E2BA 3LFEA 2XIZA 3H9FA 2FH9A 2RG5A 4Y46A 3KVWA 2WTKC 3H10A 4W4VA 3QC4A 3KMMA 4J8NA 3W2RA 5HKMA 3LXKA 2CN5A 1WBTA 4E26A 5K9IA 4NH1A 3FMJA 4YJNA 3G2FA 5HG9A 3T9IA 4CT2A 2GFSA 2VTQA 4I5HA 5F1ZA 1Q8ZA 4PMTA 3TV7A 1NVRA 1GIJA 4YC8A 2FVDA 2UZNA 2C6TA 5CAVA 3DAJA 1Q97A 5JZNA 4F6UA 3R7YA 3ORIA 1VYWA 2PVNA 3G90X 4GG5A 4D4YA 3ZFMA 4OGRA 2J4ZA 2HOGA 3Q6WA 3E8EA 1UU3A 2BZHB 2F7ZE 3Q60A 4A9SA 4OTFA 2J0LA 2X8IA 3ZZWA 4EK5A 1PKDA 4BBEA 2IPXA 5A9UA 3Q9XA 4F7NA 4IX6A 4FGRA 3ENMA 2ZOQA 4MKCA 3R8LA 4O7WA 2C5VA 4FL1A 5E8ZA 2PMIA 2Y9QA 2C1BA 5EDRA 4JDKA 3HRBA 5CU0A 4RFYA 2B9HA 3R63A 2W1HA 3MWUA 4XV3A 1JSVA 3ATTA 3P0MA 4MQ1A 4NW5A 4Q5EA 5F94A 3KK9A 4U9AA 4B4LA 3GU5A 3OCGA 2A2AA 3GXLA 2RFDA 4JBPA 5DEWA 4FG9A 4BB4A 4BCKA 4I4FA 2PZRA 4E4LA 1IG1A 2VD5A 3PLSA 4H58A 3PIZA 4AT3A 4CZTA 4KBAA 4QMWA 5JFVA 1Q61A 2CNQA 3OF0A 4WRGA 3GT8A 4GW8A 1WCCA 2WFYA 3C9WA 3M42A 3C0GA 2CGVA 4JBVA 4J7BA 3WYYA 4BCIA 4IAKA 5I4NA 4E8AA 4CLIA 3R8VA 3GI3A 4FT5A 1GZOA 3KXHA 5AR5A 5M57A 5IMEA 3QZFA 5FM2A 3DXPA 3W2OA 5A4QA 3PXKA 4EL9A 4JIKA 4X3FB 4CYIA 1KV1A 3GCSA 3U87A 5HICA 4CCUA 4OTHA 4EH2A 4Z55A 4O7SA 4C36A 2X2MA 3JYAA 3LJ2A 2CGXA 2UZOA 3P1AA 5AJQA 3VVHA 5H8GA 5AX3A 4CLJA 3ODYX 3D5VA 1URWA 3TNQB 4CMOA 3SLSA 3VS3A 3TZMA 2ZV2A 2GNGA 3ERKA 5HE3A 1YXXA 3PPZA 4FV0A 1SVHA 1G8SA 3G0EA 5M55A 4I1ZA 1M2PA
chains in the Genus database with same CATH superfamily
2XYNA 2PUNA 3P7AA 4FOBA 4Y83A 3H9OA 5TT7A 4RC3A 4ZTRA 3FC2A 2G1TA 3COIA 3EQCA 3QWKA 4EYMA 4FMQA 2DYLA 5AV1A 3DK6A 5EH0A 1JAMA 2B54A 2F9GA 4DA5A 4G9CA 4H1JA 1M17A 3NVMB 1J1BA 4IMYA 5ANGA 2OH0E 1O9UA 4FSUA 4DE4A 4F70A 4UMPA 1P14A 3F7ZA 3D9VA 4YMJA 4TWOA 2ERKA 4FZFB 3ZFXA 3DY7A 3BYSA 3OBJA 5CAPA 5CF5A 4QRCA 2JIUA 2BCJA 3RTPA 3UG1A 4EC9A 1B38A 3W0MA 5CNOA 3TEIA 5B7VA 3MVMA 4O6EA 5HBJA 5M4UA 5EHYA 5DT3A 1M7QA 4MNEB 1K9AA 2B4SB 2EXCX 2WIHA 3CBLA 3KRRA 3LXLA 5AP3A 3UOKA 5E8SA 3F88A 3UIBA 3OUNB 4RG0A 1NY3A 4TYHB 3FUPA 3AT3A 2X1NA 4YJSA 2ZM4A 2GDOA 3TTJA 2X4FA 4GL9A 4BF2A 3ZCLA 2ERZE 5JFWA 3PJCA 5TOZA 3NUXA 1FINA 2HYYA 4ZS0A 4C4GA 2PY3A 4DFZE 2VTPA 3WE4A 5JMSA 3KIOC 2VTLA 3EQPA 3HL7A 3T3UA 4C37A 2XYUA 3D5WA 4GEOA 3GP0A 2QQ7A 3MS9A 4FV1A 4USFA 5L2SA 1Q99A 3C4EA 4J52A 3TNWA 2QR7A 2ZM1A 5E8TA 4DDIA 2PZYA 3HEGA 1QPCA 2R3QA 3ACKA 1ZARA 3QKMA 4FKVA 1ZXEA 4FL2A 4M15A 2HW6A 3DKFA 4TYJA 2BZJA 4Y73A 2QOFA 3FLYA 2XS0A 4EEVA 3PLAE 4PPAA 4G3EA 4RIYA 4Y85A 2OSCA 5CEKA 4EOMA 3ZH8A 3ZUVA 1H27A 4IJPA 4JDHA 3RMFA 3RPYA 4A4OA 4YP8A 3R28A 1XHAA 2XNEA 3SXSA 1H4LA 5CYIA 1PRYA 5HX8A 4CZUA 3BL9A 1Q62A 4I22A 4D0WA 3KVXA 4NJ3A 3LPBA 3Q4UA 5D12A 2PK9A 3AC3A 3BIZA 3MDYA 5BX0A 3PE1A 3PIYA 2CNVA 1Z9XA 3ZSIA 3R8UA 3IDPA 3PJ1A 1LPUA 3O8PA 4TNDA 5DR2A 2JIIA 5DVRA 4I23A 4DHZA 4JQ7A 3O7LB 3BYMA 4YHFA 5JFXA 1ZYDA 3QRTA 3NW6A 3FYJX 3HMIA 3PA5A 3PPJA 2J9MA 2YJRA 3CTJA 1SNUA 2QOKA 4LYNA 3BU3A 4U43A 4W8EA 3NIZA 5HVJA 1OECA 4DEGA 3O5AA 2QOCA 4C02A 5HU3A 3ZDUA 3NNVA 3NYNA 2PMLX 4RQKA 3RM7A 4OTWA 2AYPA 3HDMA 3CIKA 4J99A 3PSDA 5ANJA 2P0CA 4BDDA 2W4JA 3CQUA 3DKCA 5LMAA 5KMNA 3RPOA 2HWPA 5C8NA 4C38A 3C5UA 3H4JA 1PMEA 1R3CA 3CPCA 2WXVA 5I9UA 4BFMA 1XH7A 4ZY4A 2JDRA 2WQMA 3PDTA 5HNBA 2B53A 5KNJA 3E8DA 4O83A 2WD1A 2XARA 2Q0BA 4AGUA 5CQWA 3LCKA 4G6OA 3R2BA 3Q4TA 3QTZA 4YZ9A 2UW5A 4IE9A 5FP5A 2W4OA 2QO7A 4PL5A 4S33A 1JWHA 5L4QA 3HAMA 1AD5A 4NJDA 3A7IA 4ITJA 4BGHA 4EKKA 2CDZA 3MJ2A 1GAGA 1PYEA 2DQ7X 3MFTA 4S30A 5AV0A 4DG2E 2GSFA 4QDEA 3A4OX 2IZSA 5CLPA 1PXIA 1YW2A 3R9DA 1FGKA 3FI4A 3VBQA 3P79A 4BGQA 3Q04A 4TW9A 4IWOA 4QMVA 3TUCA 4UYAA 1WAKA 2OJIA 4O91A 5CTPA 1W7HA 4NYEA 4GU9A 2C6OA 4NM5A 3MTFA 3Q96A 3NNXA 3VS7A 2V0DA 1J7UA 5AUTA 4O7TA 3FY2A 4CG8A 3EFJA 4U7ZA 2R3MA 2W17A 3U9NA 4F9BA 2OW3A 2F57A 2YIQA 2H6DA 4K6ZA 4F1OA 4ZZNA 4QP8A 3OTUA 4L52A 4HVSA 2VO6A 2X6EA 2DS1A 1OBGA 3UDTA 3W0PA 3UIXA 4EBWA 4TYHA 3TV4A 3TCPA 3NS9A 4ARKA 5CF8A 3TM0A 5T6KA 2IZUA 4RVMA 3CCNA 5ANEA 2ACXA 4PUZA 2AC3A 4ZZOA 5K5NA 3EQBA 2Y0AA 5HO8A 1CM8A 3SG8A 3QTQA 4DGGA 2E9VA 4JRNA 3C0HA 5GINE 2RG6A 1JOWB 4NSTA 4D2SA 2YDJA 4Z3VA 3VS2A 3CSVA 4XS2A 3L9NA 4KSPA 1CKPA 3AT2A 3GEQA 3LCOA 3DBFA 4XMOA 4IANA 3OXZA 5ETFA 1U4DA 2JDSA 3ANQA 5KZ0A 3VS6A 4AUAA 4FNXA 4FOCA 2O63A 4IM2A 2R2PA 4O4DA 3RVGA 3R01A 1Y8YA 2OFUA 1YOLA 3F3ZA 3ZRKA 1J1CA 4U40A 4PTGA 4EH3A 3P7CA 4I21A 4TYEA 5M53A 5EKOA 4I92A 4DH1A 1YVJA 3W8QA 2VTHA 4EQUA 4RX7A 3RAIA 3H3CA 4F9WA 4ERWA 4ZOGA 4BTMA 4YTCA 1H1PA 2F4JA 4TL0A 3E62A 3A8WA 1SMHA 1WBPA 4BJJB 4EOJA 2R3NA 2RIOA 4K0YA 2IW9A 3GU8A 4O7LA 3KXGA 3VUMA 3A7JA 3QTXA 4G3DA 4IM0A 3ATSA 4RJ8A 4F99A 5HG8A 1H0WA 2JAVA 3NX8A 4C59A 2CKEA 4JL9A 4OW8A 2XJ2A 4C8BA 5KKRC 2C5YA 5FGKA 3BKBA 3BV2A 3VUGA 4FV9A 2CKQA 2XEYA 3UNJA 3DS6A 4N70A 3LJ1A 4DHFA 4DGNA 2UVZA 3COMA 5IEVA 3FL5A 3BYOA 4V0GA 3G5DA 3IW6A 4IWQA 4FA2A 1PXMA 5DG5A 3UODA 4IH8A 5HGIA 1YDTE 4BCHA 2EB3A 2PE2A 3SOAA 3E5AA 4RX5A 4X2NA 3ULZA 1OVEA 4OR5A 1W2CA 5JRQA 5CAOA 4LOOA 4MXOA 1YOMA 4DFLA 5BYYA 4QYYA 3KEXA 5DT4A 3HMMA 5AP6A 4AA0A 4AT5A 2BDFA 3VQUA 5JGBA 4BI2A 5JN2A 3QQLA 2WTWA 2YLFA 3EZRA 4AXDA 2PVHA 3DOGA 1H1RA 4BRXA 4IWDA 2C0OA 3VC4A 3IKAA 4IZ7A 2QLQA 3ZC5A 3V01A 4Y5HA 2J5FA 3C13A 2XNBA 4I41A 1Q3WA 3NYOA 5IQHA 1NA7A 3FLQA 3CR0A 5IUGA 4IIRA 5JSMA 2ETKA 3TG1A 4IB0A 3IOKA 3WYXA 4WNMA 3V51A 5GZ8A 4ANQA 3IOPA 4M0ZA 4XH6A 5CASA 5KZIA 3SV0A 4CTBA 1PXKA 2ITVA 4IHPA 4R8QA 4L7SA 3CPBA 3KCFA 4JAJA 1M2RA 2WO6A 3Q4ZA 4ZMEA 4O0VA 1W0XC 4FUXA 3O50A 3FKLA 3RCDA 4DDGA 3LM5A 2FSOX 2YM4A 3PVWA 5AR2A 5KHWA 3R7GA 1XH5A 4L00A 3LFNA 3I5NA 1TQMA 1XH8A 2GNLA 2QC6A 3OWKA 3DB8A 3GFWA 3PXZA 5BMMA 1BKXA 2XRWA 5D7VA 3VHKA 3ID6C 3N4TA 1NVQA 4E4MA 5IA1A 3HAVA 3NW5A 3KQ7A 3G9NA 3FI8A 3D5UA 4YHJA 3EYGA 4XG6A 2XIKA 3HMOA 4HYHA 3ML1A 5AUWA 3A4PA 4GVAA 3RK9A 5IEXA 2GS6A 3SOCA 2B9IA 1H01A 3EFKA 3OFMA 2C1AA 2JAMA 4JIAA 4C33A 3QU0A 2A1AB 2OXYA 4G9RA 4EH7A 1JLUE 5B0XA 4CRLA 4RX9A 3AMAA 3UE4A 1HOWA 2PUUA 4LGHA 5JFSA 3LMIA 1LEZA 1XBAA 2HENA 2Z7LA 3PXFA 3Q32A 4JG7A 5E92A 4E1ZA 4EH5A 2WPAA 4XOZA 4WBBB 4AZEA 4RX8A 4AT4A 2NO3A 4ANOA 4XV9A 3HV7A 3PUFC 4RVLA 3UP2A 2R3OA 3TT0A 4I0SA 4FVPA 4RPVA 3WF9A 5LVPA 3TWJA 4XLIA 2CKPA 3GU7A 4GRBA 4FKOA 2Q83A 1YHVA 3BELA 3KKVA 2CGWA 4FNYA 2OF4A 4D28A 2W0JA 2OLCA 4G31A 3DBDA 4J95A 4M8TA 4AZSA 3AC1A 3MVJA 4M69B 4O82A 4DFBA 5HESA 1JQHA 3R04A 3W32A 4RWKA 4NKAA 1CMKE 1WVYA 4N4SA 1PMUA 1JVPP 5KUPA 4HGTA 3OCSA 2AC5A 4BJJA 4JJRA 4S31A 4H3BA 4I20A 1WBOA 3F3TA 2YCQA 4IAZA 4P5QA 3WF7A 3R6XA 4FV6A 4BL1A 4E6AA 2GS2A 3O7LD 4LMNA 4WHZA 4JDJA 2YACA 4RRVA 2W1CA 2OO8X 4I94A 5AP4A 4L68A 2ONLC 4DF3A 2XNNA 2YAKA 2YM5A 4X2GA 4O22A 1UU9A 4XCUA 4MNFA 4OBOA 5A6NA 4WG5A 4QMYA 4AWIA 3OD6X 4X3JA 3Q6UA 3E8NA 3L9LA 3HV5A 5GNKA 4EK4A 2IVVA 2QU6A 4D2VA 1A9UA 4D58A 4O84A 5CT7A 4KUJA 4XJ0A 3CE3A 4UN0C 4ALVA 4FEUA 5IA2A 1OKZA 2PZIA 2WTDA 2YIWA 2CCIA 3K5UA 3QCQA 4NCTA 3OG7A 2JFLA 3FMHA 4D1SA 2F49A 2G01A 4UWBA 4ZLYA 5LWNA 2WIPA 3UQCA 4CYJA 4Z16A 2WU6A 2IVUA 4F6SA 1OGYA 3R8PA 3PG1A 4JDIA 1CDKA 4HNFA 4DTBA 2C4GA 1YI6A 3HA6A 1U5QA 2CCHA 2G2IA 3F66A 3QQFA 1J7LA 2EB2A 4GK4A 3ITZA 2VO3A 3NAYA 1QL6A 3PUPA 4QMTA 4O27B 4QOXA 4IAYA 3EIDA 3IO7A 1YHSA 3IS5A 4KKEA 4ZTHA 3F5PA 1V0BA 5HG7A 4ALWA 3UGCA 4YSMA 4JX7A 1L3RE 3LM0A 4PDSA 2FSTX 4AFJA 4AGDA 4RVKA 4LV7A 2XCHA 2WMQA 3FDNA 3LQ3A 1G8KA 3PYYA 2UUEA 3FSKA 3I4BA 2OICA 3REPA 1ZYLA 3PG3A 4FT0A 2Z02A 3N4UA 4ZLOA 2ITYA 2WOTA 2UZBA 5DOSA 2PU8A 2X0GA 5AR7A 1GIIA 5HLNA 2XF0A 4I5CA 3ZSGA 4AGCA 3GENA 4EWQA 5BVKA 3CGFA 3GB2A 3IECA 1HCKA 4UZDA 2PVMA 4HZSA 1JKKA 5DBXA 2XKFA 3HV6A 5J7HA 1NW1A 5EI2A 2O8YA 1I44A 3E64A 3KCKA 4FSRA 3UJGA 3MY1A 5D7AA 5AA9A 4B7TA 4HVDA 3GCPA 5AUYA 4TT7A 4YZBA 4L67A 4WT6A 3WILA 4K8AA 4D0XA 4RA4A 4F63A 3Q3BA 3OOMA 3CEKA 1OPKA 2JDTA 2QCSA 3ORZA 2H34A 4FV3A 3BWFA 1WBWA 3TI1A 4ACGA 4CZYB 5A54A 5EDQA 3EQIA 3HUCA 4HGSA 4DGLC 5C4LA 4FTQA 4O7ZA 4TKSA 4DG3E 2R3GA 4GV1A 3QFVA 4QP3A 5KMOA 4LL5A 2ZV8A 5AIKA 4EUTA 3FSFA 4EZ7A 3KXMA 4AXFA 2XBJA 3VQHA 1IR3A 4PP7A 2ITOA 4AP7A 4FTMA 3UO4A 1FVTA 4DEHA 2XANA 4G34A 2XMYA 4KNBA 3PZHA 3UZRA 2R7IA 4FTCA 4PPCA 3ZHPC 1IAHA 5DRBA 5AP1A 4IQ6A 4CFFA 4FTKA 3OEFX 3V5JA 5FDPA 2J2IB 2VWBA 5J5TA 4FK3A 2QHNA 3F7WA 4GYGA 1STCE 1E9HA 2EWAA 2Y8OA 5BMSA 3F5UA 3GC8A 1JKLA 5E9EA 2ITPA 3ZO2A 2Y4IB 3QGYA 1PXLA 1WBNA 3P23A 2RF9A 5ANIA 4R7IA 4ORKA 3EN4A 2A0CX 2DUVA 2XK8A 4WSQA 5HX6A 5B2KA 3R1QA 3FPMA 3RHXA 4A9TA 3N4VA 3AMYA 3AKLA 1W82A 4F9YA 2XKEA 2YIRA 4YHTA 3KXZA 2ZM3A 5C1QB 2C47A 4O4FA 3PXRA 2R7BA 3DK3A 4JT3A 1H1SA 2J51A 3F3VA 4AXEA 2C69A 3KL8A 2XAOA 2CHLA 4BDJA 5CT0A 4FIIA 4GK3A 3R7OA 3GOPA 4XG8A 4DLIA 3COHA 4GCJA 4BCJA 5CQUA 2PMOX 3S3IA 3D5XA 3QUEA 5CZHA 1XBCA 2WTIA 1FOTA 2WHBA 4E5AX 1BX6A 4GT4A 3V3VA 1UWJA 3LE6A 4C7TA 3R7VA 3PTGA 2YZAA 4FKSA 4H05A 1ZYJA 4HZRA 3MIAA 3JVSA 1V0OA 5DGZA 3UC4A 5EFQA 5FP6A 4E4XA 4IB5A 4RWJA 3BHVA 3TNPC 2O64A 2QOHA 4K18A 5FXQA 5C8KA 4QMSA 4ZLZA 3QCSA 4O0TA 3EWHA 3BGPA 4H3PA 3I6WA 2C5OA 3E87A 3HRCA 1XJDA 5I3OA 3GNIB 3ZYAA 4LFIA 2VWWA 4FVRA 5CEIA 2YWPA 1JNKA 2X8DA 4RLLA 4BKZA 4K77A 4X6QC 4II5A 5D9HA 2QOBA 4AA4A 1Q41A 5TE0A 2EU9A 2OG8A 2OXDA 3QZIA 1ZLTA 2R5TA 4C4FA 4DFNA 2P2IA 2VWVA 4QYFA 4ZSLA 4ZZMA 3C4WA 2QODA 5EYCA 4EK6A 4FT7A 3QTSA 2XK3A 4A06A 3WZJA 5A4EA 4EH6A 4L44A 1XWSA 2BAKA 4EK3A 1E1XA 3LQ5A 4UMQA 4BGGA 5KCVA 3SA0A 4O4BB 5L6PA 2PVFA 2O0UA 3Q9ZA 4FKWA 1ST4A 3EKNA 4ZSJA 2W1ZA 3B8QA 3F5XA 4J97A 3ORKA 4CQGA 2GFCA 3A60A 4GJ2A 1BMKA 4YZDA 3C5IA 4GKHA 2BKZA 4PY1A 2WMAA 4FZAB 1KE9A 1VJYA 4APCA 5HNIX 4JRVA 4WA9A 3MESA 4PMMA 4H36A 3LCSA 3CJGA 1MRYA 3NYXA 3SD0A 3WZKA 3HP5A 2XNPA 1GZ8A 4GSBA 3SVVA 4U80A 2X2KA 4C3PA 2WTVA 5HNGA 1PXOA 2ONLA 3EQDA 4EBVA 2OIBA 3PRIA 1LUFA 3TIZA 4BDIA 2RFEA 3DV3A 3UIMA 4DG0E 4TRLA 5EG3A 2C5XA 2W5AA 2ITZA 5LARA 4WNPA 3OXTA 3EYHA 3T3VA 5IMXA 5TR6A 3NLBA 4EOLA 5HTBA 5IA3A 3N9XA 4CGAA 4FE2A 3ZEWA 4C58A 1G5SA 4AN9A 2C68A 3E92A 3F2AA 2YABA 2JKKA 4N6YA 4BVUA 4NM0A 2RL5A 3DXNA 3R83A 5ANDA 2YM3A 5HTIA 3OBGA 3VRYA 4CKJA 1U54A 3BV3A 2X0PA 4DN5A 2OBJA 4QD6A 1XMMA 2UZUE 3FAAA 5HIDA 2PUPA 4Y8DA 4KA3A 1F0QA 2HAKA 3A2CA 4GIIA 4XV1A 4QTBA 2LAVA 5CEOA 3S4QA 5B2MA 3MY5A 3EB0A 1FMOE 3DT1A 1ATPE 2BVAA 3KMWA 4M84A 3CD8A 5HCYA 2E9UA 1TFFA 2QD9A 3QKLA 2ZB1A 4CFXA 3NPCA 3P08A 2XZSA 3QYZA 4F65A 5HHWA 3PA3A 1OUYA 3A7HA 3IW7A 5M09A 4BY9E 3VJNA 2LGCA 4D4VA 5IA5A 4NT4A 4F0GA 4PTCA 5CSHA 2BIKB 2V55A 3GU4A 2YDIA 3RINA 3UTOA 4HGEA 4DEDA 3HMNA 2CPKE 3PFYA 3TUBA 2XM8A 1Q8WA 2F2CB 4BI1A 1YXUA 5L2TA 4CFVA 5DHJA 1WZYA 1ZRZA 3ZO3A 1XR1A 4O38A 2RGPA 3D83A 4LRJA 2XUUA 1XBBA 3IW8A 4X7QA 2WTKB 4U42A 4YURA 3RGFA 2P55A 2WMSA 3RK5A 3L8VA 5AUZA 3VRZA 3BHTA 4M0YA 2QI8A 5FLFA 4L8MA 1S9IA 2EUFB 5IH4A 3PWYA 4LG4A 2GHGA 4R78A 5GJFA 5CU4A 4D2PA 2I6LA 3FQEA 4XG2A 2QNJA 2G2HA 2RKUA 4LUDA 5HI2A 2YFXA 3UP7A 2REIA 4JQ8A 4MWHA 3FLWA 3BX5A 3D7TB 2R3PA 1YWVA 2BIYA 3NWWA 5FEDA 4C3RA 4DBNA 2UVYA 1BLXA 4KS7A 3HA8A 3UC3A 4C4IA 5KMKA 3IPHA 5LMBA 1XMLA 3TZ8A 1UV5A 2PE0A 2R9SA 5BUIA 3ZFYA 1V0PA 5HIEA 4AQCA 3IW5A 2FYSA 4HVHA 3VAPA 5HIBA 3R22A 3T8OA 3JPVA 2PUIA 3JS2A 3PY3A 4L3JA 2VX3A 4OTGA 3R71A 2NRUA 4QMNA 4GFGA 4BN1A 4KIOA 2AQXA 3FC1X 4L46A 4ZTLA 3ZXZA 5IISA 2GQSA 4ACMA 4FR4A 5KHXA 4AW2A 3Q53A 3RPSA 2UW6A 4BDGA 4M97A 3F5GA 4U3ZA 4XLVA 5BVWA 3IW4A 4UB7A 2OJFE 5LMKA 4QDVA 4PTEA 3D15A 1KE6A 5CF6A 2V7AA 4IFCA 4XBUA 3ZLSA 4C35A 3QUPA 5FQDC 4WG3A 4RBLA 3MI9A 1H07A 1H8FA 3NNWA 4MHAA 4QPAA 1YDSE 5FTQA 2VO7A 3LMHA 3QQHA 5CVGA 1TQPA 2GNJA 2UW4A 3OWJA 4FIHA 3AKJA 4MD7E 4I3ZA 4FSZA 4QP2A 2JD5A 4RA5A 4FZDB 4HYIA 3FHIA 3GC7A 5ICPA 3KU2A 1ZZLA 5I0BA 3MFUA 3VUIA 3ZRMA 4UX9A 1OZ1A 4YU2A 3UZPA 4PF4A 3LFCA 5I9ZA 4AS0A 2P3GX 4MQ2A 5M56A 4WUNA 4QT1A 4H3QA 4JQEA 5DYJA 2CLXA 4UWYA 3OZ6A 5FTOA 4H1MA 5HBHA 4FKGA 2QOIA 3W18A 3PJ8A 2IZRA 2VTSA 4LOQA 4FV4A 3PY0A 4I93A 2CN8A 1YWNA 2BAQA 5J9YA 2CGUA 2B9JA 4YO6A 1ZZ2A 3CLYA 3TJCA 3TZ9A 3W10A 4EH8A 2W9ZB 5H8BA 3UVQA 4CRSA 1M2QA 3SG9A 5E91A 4GFOA 3B2WA 1GIHA 4JVGA 4PQNA 3QZGA 4YUQA 4IACA 4QPMA 1BI7A 2R64A 3VHEA 3UDBA 2H8HA 2YEXA 4NWMA 1IASA 4LGDA 3UQGA 1OBDA 3ZEPA 1NVSA 4BKJA 4FEVA 4EK8A 2JIVA 2RSVA 2JITA 2BRBA 1GY3A 3Q5IA 1LR4A 3VBYA 3H30A 3HNGA 4A07A 5J9ZA 4BDEA 4X3FA 3JXWA 4XP0A 4O7NA 1UNHA 1H24A 3BEGA 3DJ7A 2V22A 4U5JA 4QP6A 5I9VA 1SVGA 2X81A 5C01A 2UW3A 1KE7A 3RWQA 2JBPA 4IB3A 3QKKA 4MTAA 3PJ2A 4C2WA 2WMRA 1VEBA 5AIRA 4IZAA 4UMTA 4PDOA 3CC6A 5ETAA 3Q2JA 4FZ6A 5AADA 1OIUA 3QHRA 3AD4A 5HZNA 2V5QA 5FWKK 1SZMA 2P2HA 3MVLA 1UKHA 5BPYA 2C6LA 5C03A 4E73A 3ZBXA 4DT9A 2JEDA 2QKWB 4IVDA 3CTHA 5GJDA 4V05A 4KKGA 4TWCA 1OKWA 2VUWA 3NIEA 3TDVA 5M51A 3NFFB 4PDYA 3QAME 4BTJA 5LXMA 5CY3A 5J7BA 4RC4A 3QLGA 3FXWA 5K4JA 3QZHA 2X0QA 3VF8A 4MXXA 5LVNA 5TKDA 2WQNA 2I1MA 4HPTE 3NCGA 4AF3A 2VTTA 3HKOA 4KRCA 4PMPA 3UO6A 4L7FA 3KK8A 3DNEA 4L01A 4J98A 4O2ZA 1ZWSA 4DAWA 4EHEA 5LVOA 3R30A 2PMNX 2PVYA 2XKCA 2I0EA 3IG7A 1KWPA 4YJRA 5AUVA 4BBMA 1MRVA 2RFNA 3BU5A 4OTPA 4CFNA 4XUFA 4MNEA 4HPUE 4JLCA 5IEYA 1UNLA 4G1WA 4GJ3A 3OT3A 4LDTA 3QRUA 4I6BA 4BIEA 3MPMA 4YJPA 3FJQE 4RIOA 4RLKA 4F7SA 5EK7A 3NUUA 3L9MA 3U54A 4AN3A 4IAFA 3VS0A 4BWPA 3RI1A 2R4BA 4BBFA 3UQFA 5J8IA 5M07A 3BRBA 4G3GA 4BI0A 1R39A 2ZV9A 4M68A 2QKRA 3MH0A 1KOAA 1DAYA 3AD6A 4NCTC 5IQIA 4USDA 3ZBFA 3OEZA 4ZTNA 5ITAA 4JG8A 5E4HA 4IZYA 2OKRA 5K0XA 2QU5A 1OUKA 3KXNA 3KN6A 4XP2A 3DGKA 3CTQA 4PDPA 4EYJA 1Y6AA 4O7RA 3R1NA 3R0TA 3EFWA 4MBLA 4ANBA 4DEIA 5BYLA 1Z57A 3BL7A 4M14A 3W2PA 1J91A 2BZKB 4RZWA 2W1GA 3HLLA 1CKJA 3P78A 4I24A 1MRUA 1OIYA 2VNYA 5BV3A 3LVPA 4EOSA 2IF8A 1RW8A 4IVCA 3RPRA 1I09A 4F08A 1U5RA 4BDFA 3LLAA 4MYGA 4GK2A 1BL6A 5EDPA 2J90A 5IH6A 4NL0A 3KULB 3ORNA 1K3AA 2XB7A 4JAIA 3CQEA 4B99A 2VV9A 4YPSA 3RBWA 4NIFB 5BUJA 4F6WA 2WELA 5BNJA 5DMZA 4PX6A 4EUUA 2IW8A 3ZUUA 3UOJA 4R3RA 1Q8TA 4D4RA 2VWXA 3BHUA 2CMWA 4FEQA 3IDBA 4UYNA 3ZMMA 3NEWA 4NKSA 3MFSA 4DH5A 3S00A 4YLKA 3LXPA 4LRKA 4FSNA 2UZDA 3ZLXA 5HU9A 3D4QA 4FKIA 4A4LA 4R1YA 3RKBA 4O7YA 4IM3A 4N57A 3LJ0A 3NRMA 4HNIA 3VS5A 1A06A 2IVSA 3GQIA 4FV5A 4MX9A 4XYFA 2UZLA 3FKOA 4A4XA 1Q8UA 4UMUA 2F7EE 4G3FA 1KUTA 4O4EA 3UNKA 5AEPA 4Q9ZA 1SM2A 4O7VA 1PXNA 4YPDA 5FRIA 1DM2A 2GNFA 2PVKA 1UKIA 5J95A 3F9NA 4R3CA 4WO5A 3AQVA 2WNTA 3VBXA 3EN6A 4S32A 2Z7SA 4R7HA 2BRNA 2VTAA 4FTLA 3NUAA 5DN3A 5HTCA 3WIKA 2JDOA 4GU6A 3FE3A 1QPDA 2E9PA 2YITA 2VTRA 4CV8A 4QMZA 3EN5A 4QMXA 4P90A 1LP4A 3MVHA 4RJ5A 3HRFA 5ETCA 4ANNA 1O6KA 3LFBA 2BKKA 4OTDA 4FSYA 4BTFA 3CKXA 3FI3A 4FSQA 3RAHA 2VAGA 3R00A 2Z7QA 4D1XA 5M44A 4DBXA 4NFMA 4KWPA 5CXZA 3W16A 2VGOA 3VN9A 5A4TA 4RC2A 4AZTA 3PSCA 3ZU7A 4RGJA 2QOLA 4BWXA 2UZTA 5IQEA 3R02A 4O0YA 3NR9A 5F95A 3RNYA 3GOKA 3AGMA 3FZ1A 3BLHA 3A8XA 4O0WA 3R8ZA 5JQ8A 4EJ7A 1YI4A 5EOBA 1XH9A 4BCGA 3R7IA 4K11A 3Q5ZA 2JGZA 1P5EA 3TN8A 2C3KA 2R3LA 2YM7A 1XKKA 1ZYCA 4JBQA 2BAJA 3HUBA 4MWIA 3VUKA 4DH3A 2BUJA 1G8JA 2ZDUA 2W05A 1WVXA 2QOQA 3DLSA 5M4FA 3CD3A 3GCQA 5E1SA 5DE2A 3U55A 3ORMA 3O8UA 1P2AA 2UV2A 4YNOA 2VWZA 3C1XA 4PPBA 3W0QA 1TKIA 5A14A 4FODA 3FQHA 3O71A 2W4KA 2IWIA 3P86A 4YC6A 5AP5A 2XAMA 3CS9A 4O6LA 1XH6A 3DPKA 3UYSA 2HZ0A 4FNZA 4GIHA 3B2TA 4M66A 1OPJA 4CTCA 3VUHA 1Z5MA 1YXSA 2BROA 4YZCA 3VBWA 4HYSA 4WUAA 4AXCA 3OROA 3FMEA 3CXWA 4O0SA 1E1VA 3QYWA 3BPRA 3WI6A 3LW0A 5HD7A 1YKRA 5I9YA 1FMKA 4LL0A 1WBVA 2HCKA 2XNOA 4FSWA 5KKRB 4E5WA 5G6VA 3GBZA 4AOJA 5CSVA 4AZFA 2X4ZA 2Z60A 3FXZA 1OI9A 3BQRA 3I1AA 3O8TA 5A6OA 2GQRA 4ZY5A