3KQ7A

Structure of human p38alpha with n-[4-methyl-3-(6-{[2-(1-methylpyrrolidin-2-yl)ethyl]amino}pyridine-3-amido)phenyl]-2-(morpholin-4-yl)pyridine-4-carboxamide
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
348
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human p38alpha with N-[4-methyl-3-(6-{[2-(1-methylpyrrolidin-2-yl)ethyl]amino}pyridine-3-amido)phenyl]-2-(morpholin-4-yl)pyridine-4-carboxamide
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase p38 alpha
total genus 112
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kq7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kq7A01
4L3JA 3EFJA 2FVDA 4GK2A 2CMWA 4U9AA 4O7WA 3CBLA 5AUXA 3NUYA 3R73A 2PVJA 2WTJA 4WHZA 3DXNA 3FLWA 4I5MA 3QC9A 4F7JA 1QPDA 5EDPA 1W82A 3NPCA 4RIXA 4PUZA 4EZ7A 3TDVA 3B2TA 3FSKA 4QMOA 1YWVA 4L43A 2HZIA 2YWVA 4EK3A 4BTFA 5DH3A 3QCXA 2C6DA 3BELA 4LV5A 2J5FA 4O2PA 5AIRA 4USDA 5DWRA 5I3OA 2YACA 3FZ1A 5E1EA 4AZWA 3L9PA 3PXZA 3PVGA 1OB3A 1MQBA 4X3FC 3MESA 5HVKA 4FIGA 2W4KA 2UUEA 4EK6A 5FEDA 2P2HA 4RX8A 4UV0A 3F3ZA 4EH2A 2KTYA 3W2OA 5DI1A 3E3PA 3E88A 4G3CA 3LZBA 5HE2A 3F5UA 3PXQA 5AX9A 2VX1A 4ACGA 3OOGA 2VWYA 3PJCA 3I7CA 4MBIA 1GAGA 4IW0A 2C5XA 4G9CA 3QQHA 4WUNA 4YZ9A 4ZXTA 3ORNA 5JQ8A 2RG5A 4ZJJA 3RBWA 4AOJA 1H07A 5B2LA 3V8SA 2GQRA 3U6JA 4ZZMA 3IGGA 2WTIA 5HO8A 2CN8A 3OY3A 1UNGA 4Z3VA 4F1MA 1ZARA 5M57A 4G3GA 4QMTA 2XB7A 4IAYA 4C62A 3MBLA 4MYGA 4XG4A 4GU9A 3PXRA 3NDMA 3EFLA 5HX8A 5FBNC 3CSVA 2FSOX 1YWNA 2WTCA 3QC4A 4RC2A 2P0CA 4YJSA 4EOSA 4GYIA 5BVNA 5TR6A 1DI9A 5H8GA 3LXKA 3RPVA 5IDPA 5G6VA 5ACKA 2YAAA 4EKKA 3LKMA 1J7LA 1DS5A 2VWBA 3VC4A 4C4EA 2VO7A 3SOCA 3HVCA 5BUJA 3Q9YA 1BL6A 4D2VA 4RG0A 3AMBA 1R1WA 1JOWB 3FI3A 4TWPA 2B4SB 2C3LA 2PVRA 3EIDA 4EUTA 5L2WA 4M66A 3RM6A 1ZMWA 3A4OX 3GCUA 3DTWA 3OEFX 1JSUA 4MBLA 4QP7A 4K33A 5A9UA 4LGGA 2OI4X 4XG3A 5BMMA 3VUGA 4I6FA 3NLBA 5B2MA 4NW6A 4GJ3A 2C69A 3QL8A 5EDQA 1XH5A 4CZTA 4DAWA 5L3AA 5BPYA 4GIHA 1H1QA 3VHEA 5FD2A 4UZDA 2XEZA 3G90X 4AFJA 3LMHA 4ENYA 1PMEA 4CKRA 1PXJA 4OUCA 4RWJA 5CSVA 5DOSA 3VAPA 2WZJA 4C2VA 2ESMA 1JKTA 3PFQA 4NL0A 3SXSA 2BRHA 4EQCA 3HNGA 3RK5A 2W5AA 3FY2A 1TQPA 2QR8A 3RCDA 4II5A 4CMTA 4D55A 4D2SA 5BVDA 3PIZA 3P23A 4GYGA 1W98A 4H58A 4IWQA 4PMTA 4AGDA 4BDJA 2P55A 2ZV7A 3AC3A 4WG3A 1Y91A 4MXZA 1EH4A 2R3IA 3QBNA 3QZFA 3EQCA 2BRGA 3UPXA 3PVUA 3R21A 5CEKA 3R7UA 3R9NA 3PJ1A 3FWQA 4DBXA 4LL5A 2JFMA 3GU6A 3KRLA 4C4GA 2PU8A 4HCTA 5DG5A 3F5XA 3I7BA 4IB1A 3FL4A 4X0MA 1R78A 3MH2A 1ATPE 4XCUA 5HCYA 4ALWA 5I9XA 2YM3A 4CT1A 5IEYA 2PMLX 4O7LA 2UZLA 5E8SA 4DA5A 4AF3A 3A2CA 3AXWA 3PY0A 1YXTA 3NAYA 2QG5A 2XF0A 5HLPA 4HVDA 5I9VA 1P14A 4DE4A 3GXLA 1O9UA 2X2LA 2R3PA 1H08A 3A7IA 4UXQA 3HL7A 4BVUA 2XJ1A 5LWNA 3U6IA 1M2RA 3FLQA 3SOAA 3JUHA 5KHXA 2VWXA 3TTIA 4HVSA 5EI6A 2Y6MA 5E1SA 5TKDA 4RJ7A 4D1SA 4BKYA 2AYPA 2A0CX 4FL1A 1J1BA 4V05A 1VZOA 2BIYA 4RIYA 2HZNA 1SVEA 3DFAA 4BBMA 4RGJA 2B7AA 2YIYA 4NTSA 4QYGA 4GSBA 3N4UA 5LMAA 4AE6A 2NP8A 5CALA 4C58A 4CD0A 5HLNA 4O7RA 3NWWA 4GH2A 3FUPA 4RRVA 2Y6OA 4AG8A 1GIHA 5ANGA 3KF7A 3H0ZA 4IAIA 5D9HA 3P9JA 3BGQA 4O96A 3R83A 5E8WA 5J5SA 5C4LA 3Q04A 2Y4PA 3SV0A 4ANLA 4BGHA 3Q6UA 4R5SA 5HD4A 3UMWA 3BLQA 4USFA 3OXTA 2B54A 3QKKA 3BWFA 3SD0A 4BTJA 3ORTA 2BHEA 4AN3A 3QWJA 1Y8GA 3W2CA 2XIRA 4QO9A 4BDAA 2EXCX 2VAGA 3BLRA 4Y83A 5FDXA 3UP7A 3LAUA 4FV1A 4IE9A 4CCUA 3E8NA 4HVGA 3DZQA 5HVYA 2I7QA 4KKEA 5IQGA 5CLPA 3F5GA 3BCEA 3DDPA 4YURA 4C34A 4W9WA 5L2TA 4GK3A 2OKRA 3REPA 3ULZA 5IZFA 3TUBA 3KXNA 3RWQA 1SYKA 2J9MA 3KVXA 4JBOA 5CQUA 3T8OA 3BGPA 4EZ3A 2ITTA 2XK8A 2C6LA 3Q9WA 5HNGA 5CEQA 2VX3A 3DU8A 2AUHA 4NJDA 4ZTLA 3SQQA 2YJRA 2YISA 3R1QA 4YTHA 3OHTA 3CPCA 3O2MA 3PZHA 3LLAA 3WYYA 3U54A 4AZVA 3GFEA 4CV9A 4K2RA 4F7LA 4YJPA 1DM2A 1IA9A 3NUSA 5GIOE 2UW3A 2ZDTA 4JT3A 4YP8A 4YHTA 2BFYA 3QA0A 3UZTA 4FODA 1OIUA 2QOBA 1F3MC 4I6HA 4ITJA 4W8EA 4C4HA 4UN0C 3ORLA 3AC4A 4E4LA 4ACCA 3E8DA 5T68A 1YWRA 4I5PA 4H1MA 4JQEA 3BEGA 4G1WA 2B9HA 2BILB 4EBWA 4C38A 3OBGA 2XCKA 2Z7RA 2IZSA 1CDKA 2W1EA 4XUFA 1PHKA 4KINA 2W1CA 4I23A 4S2ZA 4DEGA 4MXAA 4C0TA 3AD6A 3G6GA 3Q60A 1VJYA 2J0MB 3OCBA 3V5QA 3P0MA 4LGDA 5L4QA 1MRVA 3HGKA 5B0XA 5DEWA 4DYMA 2EWAA 4B8LA 3DTCA 4BCKA 4QTBA 3EQHA 2Z60A 4GKHA 3BYOA 1YRPA 3SW7A 3GCQA 4QYFA 2PVLA 1ZXEA 4IANA 2YAKA 4G5PA 3MSSA 5CEPA 2PVMA 4FKIA 1GZNA 4JDKA 3QTQA 3OVVA 5IA4A 1H4LA 4HW7A 4J52A 2JAMA 3JY0A 4L68A 5DGZA 4F6SA 5K5NA 4QP1A 3SHEA 4RX9A 1U5QA 1SNUA 5ETAA 4D2PA 3HEGA 2YIXA 3FAAA 2Y0AA 3VF8A 2BALA 3OG7A 4LRKA 2BPMA 4G3EA 3B2WA 4P4CA 4Y72A 5EKOA 4ORKA 3D5XA 5AR5A 1OKZA 4WA9A 3TWJA 1GJOA 2FSTX 2OIQA 3C4EA 4LMNA 5CX9A 3RI1A 4QMSA 3I81A 1B6CB 4HPTE 3COHA 1WBPA 3PXYA 3IW5A 4G6LA 4IZYA 3FEGA 2ERKA 4YUQA 4RFZA 5BMSA 1IR3A 4L53A 3U4UA 2I0EA 3QX2A 1JPAA 5C03A 4UX9A 4AZTA 3DT1A 4GU6A 4P2KA 3ALNA 2BCJA 3T3VA 4K8AA 3BBTB 3EL8A 2Q0BA 3UVRA 5CXZA 2CKOA 3KRWA 3UOLA 5M06A 3ZSHA 3E5AA 1BYGA 2JC6A 2XNNA 3LFEA 3MIYA 3D9VA 3VWAA 4CV8A 3EQFA 3H9FA 3R9OA 4PWNA 4F6WA 4BDCA 4AW2A 5CEMA 1TQIA 2GFSA 4FICA 3UC4A 4UWBA 2UZBA 2R3JA 4L52A 1XBBA 3MDYA 1AD5A 5D12A 2VO3A 2VTAA 2QHNA 4B8MA 5BVFA 4DITA 3ANQA 3PSCA 2JAVA 3UODA 4EEVA 5A6OA 4A9SA 2PSQA 1OKYA 3PVBA 3WF5A 3V8TA 2UZWE 3ACKA 5GZ8A 4DFNA 1QPJA 4U7ZA 4IX4A 2EU9A 1H1WA 3RZFA 3PJ2A 4JX7A 4O27B 3EL7A 4JRVA 3ZXZA 5F1ZA 1UWJA 3ZO2A 3NRMA 4ZTQA 1NT2A 4EOMA 3VS1A 4FGBA 4WBBB 3D5WA 1Q62A 4R7HA 3I60A 4M0ZA 2VTRA 3K5VA 3O8TA 4IB0A 5D41A 3PA3A 5C4KA 2OFVA 3DJ5A 3GFWA 4O0XA 4K0YA 5A4TA 3UGCA 2PL0A 1PXIA 3C0HA 5IQDA 5HCXA 3UBDA 4J71A 2B55A 5A4CA 1XKKA 4AT4A 3LVPA 1OIQA 1PKDA 1YXUA 3KGAA 4MBJA 4GUBA 4L6QA 3IS5A 4YGAA 5CZIA 4ACMA 2W1ZA 3DK3A 3DK7A 3RK7A 5ETFA 2ZM1A 1FVVA 4Y5HA 3CP9A 3PSBA 2Y9QA 3RHKA 5A54A 4CKIA 3UIUA 1YHSA 3R1NA 4BWPA 4EH9A 3QTIA 3HMNA 4J97A 5HI2A 5DMZA 4KKHA 4BY9E 2XCHA 2QOQA 3OWPA 3PWYA 4FTJA 4O0YA 5IPJA 4OTFA 3ZUTA 4WD5A 3DV3A 3G33A 2WOTA 3E64A 1FGKA 3OTUA 3VN9A 4YZNA 3L9MA 3DDQA 4RZVA 3D0EA 3BLHA 3A61A 3FY0A 4N70A 2XNGA 3QLGA 2Y8OA 3F3TA 4WRSA 3LCSA 5AX3A 5IU2A 2F49A 2YLFA 3PTGA 3DAEA 4M67A 4HYSA 4GJ2A 2J4ZA 3WZJA 5GZ9A 4XH6A 3RVGA 3M42A 4BIEA 1G8AA 3BYUA 2UZNA 3KXGA 4O22A 4QP2A 2OIDA 3TNWA 2C6KA 4ZSAA 3DQWA 1UWHA 4FT5A 1LR4A 5IMEA 5HD7A 3H0YA 4W4YA 4NCTA 4DTKA 3DOGA 2HYYA 5LCKA 4MWIA 3PZEA 1Q3DA 3GOKA 2BIKB 2OIBA 2QC6A 1BI8A 3CTQA 3NW7A 5ACBC 4DFLA 5HQ0A 5FTQA 2IW8A 1NVRA 1UU7A 2GS2A 2X4ZA 2WEIA 2XNOA 3BHTA 4FSYA 5HBEA 2ZV9A 2BRNA 4PL5A 3EQDA 1WBNA 2QO2A 4H1JA 2YM7A 4AZSA 4U79A 1WAKA 3ZUUA 3RM7A 4AN9A 3OW4A 5AP4A 2PUIA 3CCNA 2IZTA 4O81A 2CLQA 1FMOE 3PP1A 4E5BA 1J3HA 3AC1A 5J1WA 5KO1A 4BKZA 3MH0A 4MNFA 4EORA 4H3PA 4AFEA 1JSTA 2ERZE 4I0TA 5KMNA 5KUPA 3UDBA 4K1BA 4CFWA 3Q53A 3QZHA 4UMUA 3LCKA 1J7UA 2WMTA 4BCGA 4L42A 3BYSA 4DHFA 3DCVA 3IO7A 1FVTA 4C61A 2VV9A 3MVHA 3LQ5A 3FYKX 4PP9A 3R8VA 5CF8A 4KRCA 2OXYA 5C8KA 1WZYA 2HY0A 3TKHA 1Z9XA 4V04A 3DJ6A 2XBAA 4IX5A 3C5UA 3F2AA 3FMNA 4Q5HA 2PZ5A 4Y46A 2IVTA 2G2FA 5D11A 5FRIA 1NW1A 1VR2A 2WKMA 3VVHA 3R01A 5L8JA 3COMA 4NK9A 4EJ7A 4PX6A 4ZSEA 3RPRA 2C6MA 3V5LA 4AXAA 2PY3A 4TN6A 3UO4A 2BDJA 5FTGA 1XBAA 3QYZA 5ANIA 4O1OA 2HZ4A 5JGAA 3F5PA 3BHHA 2GS6A 4BDDA 3ODZX 2XA4A 2WELA 1BI7A 5CNOA 4DEIA 2UW6A 4IDVA 4WRGA 4FEVA 3UIXA 3NCGA 5HG9A 4CRSA 2R64A 4DG3E 2CGXA 4GS6A 3KVWA 3IW7A 5E8UA 4R3CA 2OW3A 5EHLA 4CFUA 2I0YA 4D4YA 1R39A 4DGOA 4ZZOA 2Q83A 2HAKA 4DBNA 3OUKA 4G16A 1KE6A 3KKVA 4WBOA 2E9PA 3PRIA 4ASXA 4EC8A 4ONAA 3CJGA 3QKLA 1IASA 2HK5A 1W8CA 3NNVA 3HMOA 5AV4A 2CN5A 2QOKA 3U87A 3R02A 2EB3A 4L67A 3QQJA 4PRJA 1CKJA 4U41A 4FA2A 3IECA 2G2IA 1JSVA 2KULA 3HV7A 3R22A 4J98A 4BI2A 3UTOA 1OKWA 3WBLA 3Q9ZA 2YDKA 4FTIA 2JKMA 2DYLA 3QQKA 4KIKB 2PE1A 3VUIA 4X2NA 5IEXA 4U0IA 3TJCA 4X2GA 2BFXA 3NVKI 4XHKB 5HG8A 4PTGA 2XNEA 5AP1A 5L2SA 4RIOA 4YZDA 1PXLA 3C4FA 4MXCA 4JNWA 1CKPA 4KBKA 2LGCA 3OF0A 2YM4A 4XOZA 4F0FA 3EN6A 4E5WA 2PZPA 3A7GA 3QD2B 4DC2A 3D94A 3U9NA 4OAVB 5AP7A 3U8WA 3ZRKA 5JSMA 1RW8A 2CDZA 4EH7A 4PY1A 4IEBA 4WUAA 3FMHA 5JGBA 3KRXA 5EOBA 2QI8A 1ZYDA 1WBSA 4PDYA 3COIA 3FPQA 2ZM4A 1BMKA 4A7CA 5BUIA 3OCTA 3P08A 4Z7GA 2V5QA 3IOPA 3QUPA 5IDNA 4KIPA 4X2JA 3UO6A 2C5VA 4QPAA 4XG7A 2OGVA 3ZFYA 3BE9A 4S34A 4XMOA 2Y4IB 2W7XA 2WQBA 3UQCA 5CWZA 1FPUA 1SVHA 4WNKA 1GZKA 2RGPA 3FMLA 3ROYA 3UOKA 5HU3A 3ZH8A 1U54B 3VW8A 3CJFA 2YEXA 4CMOA 5CVHA 5J9YA 2QKRA 4IC8A 3OT3A 5AR3A 4EH6A 3GENA 3OY1A 5K9IA 4W4WA 3QTWA 3IW6A 3NNUA 1H1RA 4QTDA 2F57A 2WB8A 3K2LA 3FZTA 3KRJA 4RJ6A 5DT0A 3BHVA 3DKGA 1OGUA 4D58A 3H9OA 5GINE 1Q8ZA 4NSTA 5DT4A 4FSTA 1W7HA 4QQCA 4GRBA 5E7RA 4BYJA 4UMTA 1IA8A 4O2ZA 4JR3A 4EHGA 4A9TA 1M7QA 4D1XA 3C5IA 4OTPA 3FQEA 4MNEA 3SC1A 3F7WA 3NW6A 5HIDA 2FSMX 2YHVA 3LFFA 3GB2A 4DH8A 4O82A 4D9UA 1OPLA 5M4FA 3TDWA 3QRTA 3TNIA 4YJRA 5IUHA 3F61A 2R3GA 5M09A 4IADA 2J0JA 1XH9A 3D14A 1J1CA 3I79A 4M7IA 3VQHA 1WBVA 5JFSA 2IG7A 2BHHA 1YDSE 2FA2A 3D7ZA 5EYMA 3FL5A 2C1BA 3FLNC 5J7BA 1UNLA 4D9TA 3EFKA 4FIJA 3OFMA 2QODA 5GJDA 2C6TA 2C0OA 5FQDC 3RAWA 4JS8A 4OBOA 4ERKA 2BZHB 4DINA 2V7OA 5J1VA 1V0OA 1OECA 4OTDA 1PXPA 3TNHA 3TV6A 1MP8A 1OVEA 2ITXA 2VTTA 3HAMA 4HPUE 3EN4A 1ZY4A 2IVSA 3ZXTA 3LCOA 4MF1A 3ZDUA 4D4SA 1KOBA 4UMPA 2R9SA 4CTCA 3L8PA 2WMAA 5EQPA 2QONA 5JFXA 3MPMA 4I4FA 1XH4A 4B4LA 4R7IA 4E6AA 5IA0A 3L8XA 3EWHA 2ONLC 3O17A 1OPJA 4AE9A 3II5A 4TYHA 3GQIA 2UW9A 4JX3A 3V5JA 3MV5A 3D7TA 3KULA 3QCQA 1UVRA 4O0RA 2R2PA 3LLTA 4FT3A 4KWPA 3OROA 4QMYA 2PVNA 2WTDA 3UJGA 3R8MA 2VTSA 3D15A 3P5KA 3ZO3A 4QNYA 4RSSA 1MRUA 5IA2A 2X9FA 5D10A 4U8ZA 4RFMA 3NNXA 4R3RA 2XJ0A 5CSWA 3DAKA 4FKRA 3PLSA 2XEYA 2VRXA 4IB5A 3V5TA 3QAME 5L2IA 1LEWA 5HZNA 1BL7A 1NY3A 3R7VA 1YHWA 4I20A 2OH4A 2WMQA 2GDOA 1A9UA 4ZS4A 3DKCA 4W8DA 2QO7A 2V62A 4IDTA 4ZTNA 3GEQA 2CCHA 3MW1A 5I4NA 4DT9A 1SVGA 3HX4A 5LJJA 5LOHA 4U3YA 4GT5A 4D1ZA 3DGKA 4APPA 1Z57A 3FI8A 4FTQA 3C50A 3PA4A 4UYAA 4XEYA 5EHYA 5AV1A 2QG7A 3ID6C 2ZDUA 5AP2A 3BE2A 2VO6A 3ATSA 2JDOA 3EQRA 2W9ZB 4IJPA 4EC9A 4Q2AA 4YLKA 3RMFA 3AC2A 4EHVA 3KXXA 1REKA 2G9XA 2W0JA 2XVDA 2R5TA 5EI2A 4FUYA 5LXMA 4O7TA 1NVSA 3DLSA 2Y4IC 3A7JA 3GC7A 2UVZA 3AT2A 3RGFA 1T46A 2UZUE 5ANEA 3Q4CA 5LMBA 3UNKA 2PPQA 4QMVA 5DHJA 3IG7A 3O0GA 1ZAOA 4J95A 3F3UA 1IAJA 5J79A 2JBPA 3C0GA 2QLUA 2Z2WA 1QCFA 3HMMA 3OD6X 4FOCA 4E5AX 3V5WA 5KBRA 2JGZA 5E8TA 4JBVA 2OWBA 4O7VA 4FNZA 5JH6A 5LVMA 4XP3A 4L3PA 3W33A 2HCKA 1QPCA 2IJMA 3QXOA 2XM8A 3JYAA 1PW2A 2C47A 2BKZA 3D5UA 3COKA 3OC1A 3CEKA 4O38A 4QP4A 3MFTA 4RA5A 4ZEGA 5FDPA 3OEZA 3EQPA 3GC9A 2GS7A 2RSVA 1FMKA 1R0PA 1SZMA 2X1NA 1XBCA 3V51A 4LOQA 4FV6A 4DTAA 2EVAA 4NM3A 2JITA 2ZJWA 1K2PA 3OP5A 2DQ7X 4IAAA 2GNGA 1UKHA 4MAOA 4YPSA 3KN5A 3EN7A 3SXRA 3PVWA 2O64A 5EM5A 3CE3A 3QZGA 4UALA 3VNTA 1J7IA 5C27A 2VNYA 4I6BA 3VS0A 4EYJA 3D4QA 4HJOA 5HIBA 3ZC6A 5EDRA 3RPSA 4C36A 4P5QA 4CEGA 1GOLA 3QYWA 4QQTA 3DQXA 3MVLA 2EXMA 1YXVA 4GMYA 4H3BA 4O0WA 3R28A 4C59A 4FC0A 4KKGA 4FSZA 4O6EA 4OTIA 5BNJA 2BZJA 1UU3A 4FL3A 4AAAA 5HEZA 1BKXA 3BV3A 5FWKK 4BI1A 3C4ZA 1Q8YA 5CU2A 4C37A 2XNMA 1I09A 3ALOA 3KK8A 5H3QA 4D28A 4GIIA 4EOIA 1WVYA 4I4EA 2I0HA 4O0UA 4JI9A 3QD0A 1BX6A 4JAJA 4MF0A 4PDOA 5FEQA 3QKMA 3ZONA 4BCJA 3KL8A 2XK4A 1RJBA 4U5JA 1ZMVA 2X6DA 4MXXA 1UA2A 1OPKA 3PY3A 1HOWA 4ANQA 1DI8A 1YDRE 4UWCA 2BAJA 4AA5A 3MVMA 2EXEA 1TKIA 4LG4A 3BWJA 2JDVA 2ZVAA 3S4QA 4X3FB 4TZRA 4C4JA 5CI6A 4Z7HA 3ZC5A 5JK3A 1RQQA 3DBDA 4FKLA 3O7LD 3V5PA 1XO2B 3CKXA 5TT7A 2VUWA 3WE4A 5AA9A 2WOUA 3BI6A 1Q41A 1QL6A 3DBCA 4Y8DA 2PUPA 2XZSA 2ETRA 4IBMA 2VZ6A 1Q4LA 3FQSA 3POOA 4PV0A 5IF1A 4CQEA 4A4XA 3QTUA 4RWLA 4Z9LA 4EQMA 4LL0A 4QMXA 4UEUA 4N6YA 2X0GA 2R3KA 2VX0A 4I3ZA 4ANNA 2F7XE 2J51A 2OO8X 4CGAA 2O63A 3NIZA 4M97A 2PMNX 5KMIA 2QQ7A 3Q4ZA 5GJFA 2CKPA 4EOOA 4TYEA 2WFYA 3LXNA 2QO9A 5EFQA 5HICA 5EM7A 4BGGA 2WHBA 3QLFA 4O83A 2WAJA 5KX8A 3BQCA 5LMKC 2JKOA 4Q5EA 3TKUA 5CZHA 3VO3A 5A4QA 2BTRA 5IQEA 3Q52A 3R0TA 1FGIA 2OK1A 2JD5A 3LFNA 3QTRA 2NPQA 3LCTA 4XV3A 4AWIA 3BBWA 4WNPA 1GNGA 3DPKA 5H9BA 3UG1A 3NUAA 4ENXA 3FE3A 4FEWA 2QKWB 4RT7A 4BHNA 4OTGA 5LWMA 5H2UA 1ZMUA 3KC3A 2ZV8A 2RG6A 2W4JA 3OT8A 4XP2A 4CFMA 2UZEA 5AFVA 4M69B 2I1MA 5AUTA 4QNAA 4C02A 3THBA 1TVOA 3AD5A 1BLXA 4RWKA 4UBAA 2QLQA 1T45A 5F94A 5EG3A 3F69A 3ZBXA 4D2TA 5L6PA 4F1OA 2CKQA 4BDFA 2B9JA 4FNWA 1Y6AA 3GU4A 4ZP5A 2B0QA 4JL9A 2UZDA 3FHRA 4E1ZA 1OM1A 1YOMA 4KSQA 2QOFA 2VTNA 3FSFA 3LW0A 2ZM3A 4NUSA 2F4JA 1UU9A 3EKKA 1K9AA 2VTHA 4MQ2A 3MY1A 4U81A 1S9IA 4IX3A 3ZFXA 1PRYA 2HOGA 2XK3A 2HW6A 4PTCA 3ZOSA 1ZYJA 2QCSA 2FSLX 3M2WA 3O7LB 3TI1A 4BYIA 3C7QA 4HVIA 3DFCB 4YC8A 3W55A 4DFXE 3WZUA 3ZMMA 3JY9A 2X8DA 1JNKA 1ZOGA 1KV1A 2WPAA 2X8IA 1KV2A 4FT0A 4F7NA 4I1ZA 5IA5A 4ZLOA 3ZU7A 4OBPA 2RFNA 5DIAA 1YHVA 1O6YA 2C68A 4BRXA 2IVVA 3VJNA 3E92A 3KF4A 4C35A 3CS9A 2HZ0A 3D7TB 3KULB 4AW0A 4CFNA 1JVPP 3BX5A 3TUDA 2V22A 1S9JA 2YZLA 4JR7A 3LIJA 5FG8A 1SMHA 2VGPA 3QXPA 1RE8A 4GK4A 2WIPA 1LEZA 1OITA 4C3PA 2PVHA 3PE2A 2W99B 3ZLXA 1XQZA 4CQGA 2OZAB 2XJ2A 3PA5A 2YIQA 5HO7A 3BGZA 5AP3A 4A06A 2WTWA 1YI6A 2WMXA 1WBWA 4OT5A 2R7BA 4QYEA 4ALUA 5EW8A 3WILA 4BCMA 3VBQA 1W84A 2WGJA 3C4WA 3PJ8A 3CQWA 5AUZA 3JPVA 4QD6A 5EHOA 4QMUA 1JAMA 3QD3A 4BTKA 5HHWA 2SRCA 5IQBA 5ETIA 4FSNA 2GQGA 4L8MA 5JRSA 4ZS0A 3RK9A 4QYHA 4ANMA 3IGOA 1Q97A 5E8ZA 5IH5A 2FH9A 2W1FA 3MPAA 3VRYA 2RIOA 2BTSA 4I94A 4YHFA 4TWNA 1PXNA 2C6IA 2YZAA 2OF2A 3AMAA 3SW4A 4G6NA 3UVQA 4MX9A 1YQJA 2R0IA 4G3FA 3UQGA 3WF9A 3SG9A 2CKEA 1Q8TA 4BCHA 2ETKA 3V01A 4C33A 4LUDA 2PE0A 4IWDA 5F95A 1JKSA 4D2WA 4A07A 1H1SA 3VBWA 3GI3A 3PE1A 4IFGA 5D1JA 4PDSA 4U40A 3ZYAA 5K0KA 3UO5A 4FV7A 3QU0A 4YNEA 3ORPA 4EOQA 5C8NA 4MH7A 4E4XA 5AR8A 3OXIA 3PWDA 1K3AA 5JRQA 2ONLA 3P4KA 1XR1A 3SRVA 4BKJA 5LQFA 1DAWA 1P2AA 4BZNA 3DK6A 3DKOA 1OI9A 2GQSA 2C5OA 4HYUA 1NXKA 5M4CA 4D4VA 5KZ0A 4A9YA 3W16A 2A1AB 1V1KA 3NSZA 3E7VA 5HOAA 2C5YA 5JQ5A 2H96A 4UZHA 2GNIA 3EQIA 2I6LA 2I0VA 3ZSIA 1YVJA 2WMSA 4RIYB 1J91A 4JLCA 4EH4A 4PNKA 4P5ZA 4FIIA 5L2QA 5HTBA 3R00A 3FJQE 4EH3A 3PIXA 5ANDA 1KUTA 5AV0A 2OJJA 4ZTRA 3VBXA 3TG1A 2FYSA 4RLKA 5F9EA 5DPVA 3R1SA 2E9OA 4YSMA 4ZJIA 1YI3A 3GC0A 4IVDA 4FT9A 4D2RA 1O6LA 2E9NA 3MA3A 4KNBA 4NWMA 4C8BA 4D0WA 4BDHA 2V7AA 1ZYSA 2B1PA 3KMMA 4FTOA 1KSWA 4KB8A 4YR8A 5FLFA 3ZLWA 5F20A 3ITZA 4FTTA 4DGMA 1A06A 3FXWA 1PYXA 1RDQE 1KE5A 3I0OA 1U4DA 4NFMA 4XOYA 4ASDA 4FZDB 4L01A 5ANJA 5TOZA 2CNQA 1TQMA 3R7OA 4NYEA 1G3NA 5JMSA 3H3CA 4RZWA 1U54A 2E2BA 2A27A 3HV3A 4KBAA 3KREA 4GKIA 3UZRA 3QFVA 2JDTA 2HENA 3WOWA 4AUAA 3HYHA 3MTFA 3L8SA 5CF6A 3UNZA 1YOLA 3E3BX 4OTWA 5J9ZA 5K0XA 2C3JA 1MUOA 3F82A 4LRMA 3FKNA 4XBUA 2ITWA 5FXQA 4J1RA 5M55A 5KMLA 5K3YA 3NNWA 5AEPA 4FZAB 5HTCA 4O7NA 3OWKA 4BCOA 1IAHA 1IEPA 2GNLA 3NEWA 4PPCA 4I92A 4K77A 5I0BA 4P90A 2QR7A 4PTEA 3A8WA 3ZO1A 4R1VA 2J7TA 4IM2A 3GVUA 4LM5A 4JJRA 4F6UA 2JDSA 4L00A 1OBGA 4DEBA 4MTAA 2OFUA 1Q99A 4NIFA 5CU6A 5D7AA 5AP6A 5B7VA 2DWBA 4ANSA 4ACDA 4FZ7A 2PUNA 5AUUA 5ITAA 2W96B 4BC6A 3QQFA 4ZSJA 3R71A 2V0DA 4WSQA 4AZEA 2R7IA 3DY7A 3IDCA 2PTKA 2BROA 4PF4A 4FTLA 3RNYA 3KB7A 5AWMA 3GQLA 3CLYA 4JG8A 5JZJA 5A14A 1HCLA 4TXCA 1H27A 2CPKE 3Q4TA 4QPSA 4M68A 1Q5KA 2JFLA 1AQ1A 4CZUA 3TV7A 5AR4A 4I24A 4RQVA 1CMKE 4CZYB 3PP0A 4HGSA 2IW6A 4YBJA 3RP9A 1P4OA 3BQRA 5GHVA 3ULIA 4DT8A 3NYNA 1FOTA 4Y95A 1H28A 4XYFA 1VYZA 5KMMA 3R8UA 3K5UA 2WIHA 4OGRA 3OOMA 3O51A 2YCFA 3CD3A 3EFWA 5HIEA 2ZMDA 4C7TA 4LUEA 4CSVA 5HBJA 4F9CA 4RIWB 4BTMA 1KWPA 2BRMA 3HECA 4DFYA 4DLIA 4XP0A 2GMXA 2VD5A 4ZY5A 3OBJA 3SGCA 3F3VA 3O8UA 3ZEWA 5M4UA 3R8ZA 3D2KA 4W4VA 5G1XA 3I4BA 3GUBA 5E8VA 4CG8A 1URWA 4FTKA 1A48A 4YZMA 3JVSA 3TXOA 2Z7LA 4ZTMA 5EI8A 4IAZA 4DLJA 5M4IA 4B0GA 4GT4A 3CY3A 4G6OA 1P5EA 4EUUA 3ZSGA 4ALVA 1OIRA 3F2NA 3QHRA 2VTJA 3KU2A 1ZOHA 3E8EA 4V0GB 3MFSA 2VWIA 4GG5A 4J96A 5JT2A 5HE0A 4CXAA 3U55A 4W4XA 4F9YA 3GT8A 2PHKA 4I41A 4QMNA 4KSPA 3TIZA 1FBNA 3FMEA 2BZKB 4XRLA 3VS3A 3QUDA 2R3QA 2OZOA 3D5VA 3Q5ZA 4XV1A 2WQNA 5FM2A 4MD7E 5HO6A 1M17A 4FNYA 2QD9A 3FV8A 3OUNB 4I5HA 1PXOA 4IVAA 5L6OA 2Z7SA 4DEEA 1JBPE 1FQ1B 5CT7A 5EW9A 5CAVA 3O96A 5KKRC 2RFSA 4AW5A 2ZB0A 2C3IB 3TACA 2V55A 5A4EA 4IH8A 3LXPA 4AA0A 4CLIA 3LPBA 3CTHA 5EH0A 3A62A 3AD4A 3VIDA 4AGUA 3KCKA 4F9BA 5CAOA 3IPHA 5BVEA 2JIUA 1GIIA 3IKAA 4MXOA 5E8XA 4AA4A 4EH5A 2YN8A 2CNVA 5CI7A 3RZBA 5A46A 4ZLYA 3DA6A 5KKRB 4QTEA 5T3QA 5AUWA 5JGDA 3JR1A 3CY2A 3KA0A 5C9CA 4QMQA 3PSDA 4X6RA 4ZOGA 5ANOA 4E4NA 4X7QA 2NRYA 4RIXB 4L7SA 4EWQA 1CKIA 5J7HA 5KNJA 4I0SA 4DH1A 5IKWA 5A4LA 5C01A 3QRUA 2H8HA 2YA9A 3JVRA 4FV8A 5BVOA 3HV5A 3JXWA 4MD9E 4YLJA 3SVVA 4G3DA 2RKUA 2CGVA 2ITOA 4QP8A 3FZPA 5IISA 4XX9A 5AAEA 3VS5A 5KHWA 3MY0A 3F7ZA 3NYXA 3AGLA 4JQ7A 2CSNA 5CAPA 3UYTA 3MIAA 1M2PA 3C1XA 4IIRA 1PXKA 4IWPA 3Q96A 3HRBA 2VGOA 3PG3A 3ETAA 5DN3A 2UV2A 3P1AA 3LHJA 4LOPA 5IH6A 3ORMA 5IH4A 5IMXA 3MTLA 4DH5A 2W06A 1UNHA 3QQUA 2QURA 4I93A 4F08A 4F70A 4R78A 2X7FA 3W2RA 4WKQA 2W5BA 4K11A 3H9RA 3U4WA 5KBQA 4TNDA 4IC7A 5EYCA 1Q24A 4ERWA 2BUJA 4ITHA 3ZM4A 1X8BA 4H39A 3QALE 2F2UA 2HW7A 4HGLA 4KABA 5D7VA 5HTIA 3AC5A 2OXDA 3HA8A 4IWOA 5C8MA 4AN2A 3PPJA 3EQBA 1MQ4A 4APCA 5LVLA 5IQFA 3VBYA 3E62A 4A4OA 2UVXA 3FXZA 4F65A 2R3LA 2ZOQA 3VUKA 3QCYA 3DZOA 4UB7A 2C3KA 4S33A 3LMGA 2OG8A 4FTAA 4TTHB 3Q5IA 4FF8A 4FK3A 2ZMCA 5EK7A 5IUIA 4GVJA 3R1YA 3UIBA 3GOPA 4RX7A 3BIZA 3I6UA 2BZIB 3P86A 2J50A 4JIKA 2BR1A 1M2QA 1STCE 5DT3A 1YXSA 5HCZA 3VULA 3W10A 3R9RA 3UYSA 3IK3A 3OMVA 2F2CB 1UKIA 3MVJA 4E26A 3TUCA 2A2AA 1KE8A 3WZDA 4FVPA 4BCFA 3PRFA 3S3IA 4MHAA 5CF5A 4Z16A 4BL1A 2O5KA 2X6EA 5DNRA 1H1PA 4AW1A 2UW8A 2BDFA 1E9HA 4OT6A 4F09A 1H8FA 3N51A 3EOCA 1H00A 2X8EA 4PL4A 4PNIA 1REJA 1XH8A 3BZ3A 3C9WA 5EKNA 2J0IA 3EMGA 5E90A 4CKJA 3TZ9A 4AT5A 5IEVA 5IG1A 3MS9A 4MCVA 4TYGA 3ATTA 2VO0A 3MPTA 4IHPA 4XG9A 4AOTA 2RF9A 5I3RA 5JZNA 4QTAA 4IM3A 3T9IA 2YITA 3ODYX 4R8QA 5FTOA 1OL6A 4KS7A 4EK5A 4FKUA 2UW0A 4IX6A 3MA6A 4KD1A 4X21A 3BHYA 1WVXA 3L9NA 3P7CA 2VNWA 4IXPA 2GU8A 2ZAZA 2QNJA 3B8QA 5HNIX 4ITIA 3CGFA 1URCA 4TYIA 4BFMA 4L46A 2YFXA 4L9IA 4W9XA 2HWPA 5HG5A 4M14A 1LUFA 3OWLA 4FEUA 3G15A 5AUYA 4ZSLA 1YXXA 3OW3A 4TL0A 5DA3A 2P33A 3NUPA 5DR2A 3E63A 5FP6A 3OXZA 3TKIA 3TZMA 2WXVA 5CVGA 3ZRMA 3EN9A 4BWXA 4EOLA 3P7BA 1M52A 3MH1A 2JKKA 1B39A 4FTNA 5DR6A 4E6DA 1W0XC 3NIEA 1JQHA 3PPKA 3FHIA 4UYNA 4FEQA 4YZCA 4DGLC 3NX8A 3N9XA 2ITQA 4PPAA 3QTXA 1ZYLA 3CXWA 4FV0A 5CAUA 4HGTA 4EONA 4FYNA 1XWSA 3VW6A 5BUEA 1VEBA 4GFMA 2VTIA 4N57A 3F9NA 2BDWA 2C1AA 3EZVA 2QHMA 5HU9A 1Z5MA 2JIIA 2WMUA 2I40A 3OCSA 4BDBA 2W5HA 3NS9A 5I9YA 3PG1A 4ZJVA 3CKWA 4FG8A 2CGWA 4U43A 3VUHA 2FO0A 2X81A 2BMCA 3W8LA 2YCSA 4JDHA 4AZFA 1R3CA 4EQUA 1FVRA 3GU7A 1LPUA 5AR7A 3F6XA 3TV4A 3W1FA 4OAUC 3ZFMA 5HESA 2FUMA 3ORIA 1OZ1A 3MB6A 4P7EA 5HE3A 2J90A 3HUBA 2PVFA 4BZOA 4PMPA 3G9NA 3QD4A 4EK8A 1CSNA 3KXMA 4YO4A 5BVWA 3FLSA 5AR2A 4IZAA 5HNBA 4BDIA 2X2KA 3EYHA 3SAYA 5AV2A 3GCSA 2JIVA 4QRCA 4NKSA 5HE1A 4QP6A 4HZSA 5AV3A 4YJNA 3K3IA 5J95A 1G5SA 5FP5A 4BWKA 3FXXA 3SDJA 3IOKA 2J6MA 1YOJA 4FIHA 5CT0A 2GPHA 3SG8A 3G5DA 4K18A 3VS4A 4A9RA 5KMJA 4OTQA 4NTTA 1R0EA 3DBFA 3GCVA 4XJ0A 5FXRA 4KIKA 4MXYA 3G51A 2OU7A 1YKRA 4FKGA 3HP5A 4S31A 4ZY6A 3RPYA 3TIYA 1WVWA 4CVAA 2YM5A 3ZEPA 4LI5A 4PMMA 4O6LA 4O21A 3ELJA 3LMIA 3NUUA 1XH6A 4JQ8A 3NAXA 4MK0A 2W1GA 4BDEA 4F1TA 2B9IA 3ZS5A 1OL5A 2X2MA 3BU5A 4U80A 5E4HA 4G9RA 4AGCA 2H9VA 4L44A 1Y6BA 3CD8A 2WMBA 3AT3A 4I0RA 2OJ9A 2W1DA 3A99A 3QQLA 4RC4A 3ZO4A 2ZYBA 4J99A 2GNJA 3DBQA 5CAQA 3KY2A 2W05A 5AAFA 3K54A 3CQUA 3VS2A 3VJOA 5K5XA 2R3RA 4ZTSA 2OZAA 4LRJA 4M8TA 4WNMA 4XLIA 2PVKA 3SX9A 3PXFA 4YBKA 4G34A 4RJ4A 2F7EE 5K4JA 2CNUA 1OL1A 4GG7A 1H26A 3U6HA 2XK6A 5CU3A 5DRBA 4PL3A 4F0GA 2XKDA 3IONA 4DF3A 3RAHA 4GUEA 4V0GA 3C51A 4QOXA 4UXLA 3PY1A 3DB6A 3GCPA 4O7SA 4ZAUA 4JG6A 4F0IA 3BRBA 2CLXA 3EJ1A 4UY9A 5AUVA 4E4MA 2REIA 1NVQA 2W4OA 2WMRA 2XM9A 5HVJA 3FQHA 4A4LA 2NRUA 3H4JA 5AMNA 3IW4A 2GHMA 3MGYA 5AM6A 3LFAA 1BUHA 4NU1A 4YJOA 2ACXA 3I5ZA 2OF4A 2BKKA 1Y8YA 3OCGA 4QMZA 2XBJA 3TJDA 2ITNA 3CC6A 2XS0A 3KFAA 5CEIA 3HKOA 3V6RA 2UZVA 3PYYA 1JKKA 4AOIA 2A4LA 3HDMA 2PZRA 3I0QA 3BU6A 3G6HA 4FL2A 1OL2A 1WFCA 4L3LA 5E92A 3DNEA 4IB3A 4WG4A 3UOJA 4AGWA 4KIQA 3SRVB 3NZ0A 4AACA 4RWIA 2OXXA 5TF9A 2QU6A 3UPZA 4NW5A 3PIYA 3Q32A 1ZWSA 3DJ7A 4NM7A 4R1YA 2P2IA 4KBCA 1PJKA 2IW9A 3C0IA 3LJ2A 3NVMB 4DG2E 4NM5A 2C0IA 3RHXA 4IMYA 4OR5A 3TNPC 4FE2A 2PMOX 3G0FA 3R7IA 3MH3A 5GIPE 3PLAE 3NR9A 4Q9SA 4RBLA 3A7FA 3S0OA 3NUNA 3G0EA 4O7YA 2YIWA 1WBOA 4YO6A 3V3VA 3QF9A 4YSJA 2NO3A 4WT6A 1H0WA 1QPEA 3FMJA 1UU8A 2UZTA 3AT4A 4GW8A 1PKGA 4E20A 4EOJA 4JRNA 3R7EA 4ACHA 5CEOA 2O2UA 4O7ZA 2H6DA 5EQYA 2QOIA 3B8RA 3KN6A 3ZLYA 3PUPA 2FGIA 3KMWA 2IVUA 2ZV2A 3QRJA 3DNDA 1PMNA 4FTRA 3ZM9A 4NM0A 5AIKA 5FM3A 4YTCA 5CASA 1GZ8A 3GC8A 2WO6A 4TYHB 5E91A 3BYVA 4DCEA 4NH1A 3SXFA 1OIYA 2P3GX 1ERKA 4B6LA 3Q3BA 4YZBA 3KRRA 3MY5A 4XNEA 5J87A 4YTIA 2ETMA 2PE2A 3LOKA 3NGAA 3R2YA 4GEOA 4OLIA 4RJ5A 5DLSA 4R3PA 3FC2A 3LFDA 4YPDA 5TO8A 3W2PA 3RPOA 3I6WA 3ZUVA 3R04A 1M7NA 1ZLTA 5KMKA 5HORA 2W1IA 4MQ1A 2E9UA 4HNFA 4G17A 2XIZA 4N6ZA 4KIOA 4FTMA 4IFCA 4WO5A 5FGKA 4BBFA 4N0SA 5H8BA 4DGNA 4EKLA 4IJ9A 3TZ8A 5EW3A 4RVKA 4JOAA 4Y73A 4DCAA 4UMRA 5CVFA 5DEYA 1H25A 2YERA 4C3FA 4JAIA 3VHKA 1ZYCA 3A7HA 3ENHA 4I22A 4FKWA 5A6NA 2R3MA 4EK4A 2ITPA 4XS2A 3QRIA 2VWVA 1V0BA 4TW9A 4X6QC 2VTLA 4O86A 2QOCA 3EYGA 5M56A 4LQMA 3SKCA 4FT7A 3FZRA 2BAQA 3BV2A 4ID7A 2QVSE 3UNJA 1VYWA 4G5JA 3UC3A 4D4RA 4L7FA 1OL7A 3QRKA 5JFVA 5LARA 4RVLA 5LMKA 4YTFA 3BEAA 1PMUA 4YNOA 4CYJA 2RFEA 4GFOA 5J5TA 5EM6A 3E8CA 1FINA 1MRYA 4ASZA 4BCQA 2R0UA 4CYIA 4U6RA 4PPBA 4S32A 4DTBA 3I5NA 5AM7A 3ENMA 2WU6A 2X4FA 3ORZA 2QU5A 3ZRLA 3K3JA 4DN5A 3GNIB 2VWZA 4MVFA 4DFBA 4XLVA 1PMVA 2EUFB 4EJNA 1YW2A 2XK7A 3DKFA 2B9FA 3U9CA 4D5HA 3AOXA 2QOHA 5AAGA 2XRUA 1E1XA 1IRKA 5AP0A 5DYJA 5JEBA 3HA6A 3IW8A 4QYYA 4BR3A 3FI2A 4F7SA 2J0KA 2JLDA 2PWLA 5CU0A 1M14A 3RAKA 4BCIA 2ITZA 4ZTHA 1KE9A 3DB8A 3H30A 4AS0A 5BYZA 3ERKA 3QGWA 2O3PA 4YC6A 3HRFA 4M0YA 4TYJA 1JKLA 3EN5A 3MJ2A 5L8KA 3OZ6A 4QTCA 3VS7A 5IUGA 3CTJA 2C5NA 3W2QA 5JKGA 5I9UA 4OW8A 3WF7A 3WIGA 4EWHA 5BVKA 1CTPE 4FVRA 2XYUA 3OTVA 4H05A 2YCQA 1B38A 4O91A 3Q2MA 2PUUA 4WG5A 5DFPA 4FR4A 2X9EA 3TNQB 5LVNA 3FBVA 5CNNA 4XG2A 3UOHA 1QMZA 3QHWA 4F63A 1AGWA 4FVQA 5AADA 3R9DA 2E9VA 4CLJA 5H8EA 4BF2A 5C26A 2UW7A 3LQ3A 4CFFA 2Z8CA 4Y5QA 4LMUA 4NZWB 3RAIA 4NT4A 3VQUA 3VBTA 4E6QA 1Q3WA 4GT3A 2GNFA 2OSCA 3R30A 4G2FA 1Q61A 3FDNA 4TRLA 2XNBA 4RLLA 4RC3A 4U45A 5CTPA 3FLYA 5B2KA 2LAVA 3WE8A 3HMPA 3FMMA 4TWCA 2YABA 2X7GA 3P79A 4FSMA 1GY3A 4I5CA 3ZLSA 3W32A 3AMYA 1L8TA 2Q0NA 4U42A 4MWHA 4M12A 3EQGA 3TM0A 4M3QA 3ZHPC 3ORKA 4GL9A 5CS6A 3S95A 3W2SA 2YJSA 4CFXA 4E8AA 3FLZA 4TNBA 3LQ8A 2XUUA 4FV4A 3DXQA 3W18A 5JN2A 5EOLA 4X3FA 2RFDA 3C4XA 3L9LA 3T3UA 3LFCA 2IO6A 2H34A 2HXLA 2XK9A 4M13A 4OBQA 4QQ5A 5FEEA 3UZPA 3QQGA 4TWOA 3LXLA 3VBVA 1PXMA 3KCFA 3RKBA 3ZZWA 3LFQA 4A9UA 5C1QB 5ICPA 3CIKA 3NUXA 2HXQA 2ITUA 2YM8A 5IA1A 3QCSA 4DEHA 4Q9ZA 4FX3A 4FYOA 1WBTA 2GHLA 3HDNA 3ZDIA 3V6SA 4C2WA 3C13A 4FBXA 4RJ3A 4FTCA 4HGEA 2QOLA 3QZIA 3AQVA 4HCVA 3IDPA 1CM8A 4YJUA 2R3NA 3IQ7A 4TPTA 4ASEA 5CSPA 3VRZA 4DGGA 5J9LA 3GU8A 4J53A 2B53A 4XRJA 3UVPA 3KEXA 1OBDA 2FB8A 3RJCA 5BYYA 2OICA 3BKBA 1DAYA 3FMDA 2VTOA 2J5EA 3GGFA 4ANBA 4NEUA 4AP7A 4HVHA 4O0VA 4ZSGA 3FMKA 2BRBA 3QWKA 4YJQA 2OLCA 2JKQA 3TCPA 2XIYA 4WOVA 1OMWA 3FPMA 4F99A 4IAFA 5BX0A 3KK9A 2XYNA 4R7BA 4G31A 4KA3A 3EZRA 3H10A 3EH9A 4YLLA 1H0VA 3A8XA 3LE6A 4FKQA 4FNXA 4H3QA 4RVMA 5HKMA 4NJ3A 5LVOA 3DXPA 4DFUA 2J2IB 4OTRA 4IACA 4CG9A 1GZOA 3PXKA 3HRCA 2UW5A 4X2FA 3E7OA 1APME 1U59A 4HOKA 4AT3A 3NW5A 3PPZA 3WYXA 1G8SA 4K9YA 4FKOA 4RVTA 4BB4A 3QGYA 3R6XA 4M69A 4ZY4A 2ITYA 5CXHA 4XBRA 4E7WA 3F66A 3LCDA 3N4VA 2C30A 3TT0A 4D0XA 3NYVA 2C4GA 2VN9A 2G01A 2WQMA 4EOPA 1OUYA 1O6KA 3ZBFA 3QX4A 4JDJA 4XG6A 4BDGA 4XV2A 4UMQA 3P7AA 4HYIA 3MFUA 3QTZA 4XV9A 4B7TA 5T6KA 3VUMA 3ET7A 3S1HA 2YWPA 5M51A 4EZ5A 2PYWA 2G1TA 2WTVA 4R5YA 4AQCA 2Y7JA 4CFVA 4FSUA 4TKSA 4FSRA 3R8PA 4EHZA 5LCJA 2J0LA 3OWJA 2GTNA 4N4SA 3CR0A 3AC8A 2DUVA 2A19B 1U46A 2BAKA 2GCDA 2XIKA 3L8VA 5EYKA 2JDRA 4IAKA 4F64A 4C3RA 2WMWA 3BHUA 5ETCA 2GTMA 4XG8A 3S2PA 3BPRA 3HZTA 3CPBA 2PVYA 4IVCA 4DEAA 3PJ3A 1OKVA 2OBJA 4U3ZA 3JS2A 2DS1A 2XIXA 4RX5A 3RCJA 5CENA 1NA7A 2VTPA 4GFGA 4FKSA 4EHEA 2O8YA 4CTBA 3I1AA 2UVYA 5KZIA 2F9GA 3FKOA 5M53A 3P78A 4AX8A 4EH8A 2AC5A 1E1VA 4X2KA 1OUKA 4QMLA 4EYMA 4C4IA 2G2HA 2XRWA 4R6VA 3WZEA 4MKCA 3BU3A 3WF6A 5IQIA 1ZOEA 1ND4A 3PDTA 2IWIA 3MYGA 3HUCA 1KOAA 5LVPA 3TN8A 2WNTA 2O65A 4K6ZA 4Y85A 4B99A 4BI0A 4USEA 3M11A 4D5KA 5CY3A 1UV5A 1ZY5A 3RTPA 4OTHA 3V8WA 3Q6WA 3RWPA 4FV9A 4H36A 1SM2A 4LGHA 4QMPA 3HV4A 5HG7A 3T9TA 4FV3A 4FG9A 3L1SA 3ROCA 2PULA 4YMJA 3LJ1A 4ZMEA 3MWUA 2HWOA 3RALA 3DLZA 5AJQA 1ZZ2A 4J8NA 5FUTA 3AG9A 1PY5A 2C0TA 2OJGA 3VUTA 2WTKC 3F3WA 4JXFA 3DS6A 5E8YA 5FXSA 5CQWA 3TZ7A 3WZKA 4E3CA 3CQEA 3O8PA 2QOOA 1YDTE 3QTSA 3SLSA 4ANOA 5CF4A 2WD1A 3Q9XA 1HCKA 2B52A 4FMQA 4CRLA 4PP7A 3O23A 3UQFA 2WQEA 2YM6A 4ZZNA 3HV6A 1L3RE 2VWWA 5HBHA 5AA8A 3UG2A 3FZSA 4U97A 3ZCLA 2CJMA 4FKTA 5GNKA 4CMUA 4FTUA 4JIAA 4FIEA 3Q2JA 5EM8A 3ZTXA 3TL8A 3OS3A 4QMMA 1XJDA 3N4TA 3TTJA 2R3HA 1XHAA 4ZMFA 5GZAA 3O71A 2AC3A 3HLLA 4DFZE 4QP9A 4BIBA 3KXZA 4ARKA 3R8LA 1GIJA 4BGQA 3U51A 4IQ6A 4BCNA 4YJVA 3ZZEA 3HMIA 1WCCA 3MB7A 3NMUF 4FIFA 5HGIA 5M07A 3G9LX 3EB0A 2PZIA 5EQEA 4RA4A 2ITVA 4BICA 2IZUA 4BIDA 5EYDA 2IN6A 4V01A 2R3OA 3NCZA 5CANA 2P4IA 1LP4A 2W1HA 1I44A 4IM0A 4UWYA 5CU4A 4FGRA 3LJ0A 5IQCA 3C4CA 4GCJA 4FI1A 1JLUE 3Q4UA 3HP2A 3O50A 4GVAA 4NFNA 4ZK5A 4YU2A 3KXHA 2IPXA 2ZB1A 3RINA 3LM5A 3WI6A 4BCPA 3GU5A 5I9WA 4E6CA 4FKVA 5ANKA 1JWHA 2WEVA 3D83A 4AU8A 4FK6A 3QA8A 4QPMA 1ZZLA 4PDPA 2C6OA 4BHZA 4PMSA 2RL5A 1Y57A 3LFBA 4X3JA 4Z55A 1U5RA 3VS6A 3FYJX 1YI4A 3M1SA 4IVBA 2EB2A 4FUXA 1F5QA 3UIMA 3GP0A 3AGMA 3W8QA 4HZRA 5L6WL 4O84A 2G15A 4U44A 3MJ1A 3KQ7A 3V04A 3UP2A 2R4BA 5CSXA 2YLEA 4B9DA 4J8MA 2NNWB 2UZOA 4E73A 2BVAA 4JDIA 3R9HA 3WARA 2XH5A 4MEDA 4ZIMA 4FG7A 4DH3A 4JG7A 5J8IA 4EOKA 4JVGA 3WIKA 3F88A 1H24A 2OJIA 3EKNA 2VTMA 4GV1A 4L45A 4FKPA 4RJ8A 3GBZA 4DG0E 2GNHA 2GSFA 3R7GA 4NIFB 4EBVA 2HELA 3TEIA 3VF9A 1XH7A 3DBEA 4HNIA 3LFSA 5KE0A 3E93A 4BZDA 4FSQA 3R2BA 5HLWA 4RFYA 2WTKB 1KE7A 4FSWA 2F7ZE 4NCTC 2XKEA 5GJGA 4DEDA 4F9AA 3R63A 2PZYA 4I6QA 4RMZA 3POZA 4WIHA 2XNPA 5I9ZA 3UMXA 2UW4A 4FZ6A 4O1PA 4LV8A 4IZ5A 3S00A 2OH0E 2CCIA 3D2IA 4QQJA 4PQNA 3RNIA 3FKLA 1Q8UA 3QUEA 4EI4A 3NYOA 2YDJA 2YIRA 5DR9A 5M44A 4C4FA 1PF8A 5E9EA 4JBQA 2Z7QA 4M15A 2HIWA 3DAJA 5DBXA 5BQ0A 5IQHA 1WMKA 4NKAA 1H01A 4LFIA 4F9WA 4LOOA 3FC1X 3ORXA 3G2FA 3LM0A 3BYMA 3FZOA 4ZLZA 3WF8A 4O0SA 4CNHA 5KMOA 5BYLA 1IG1A 1V0PA 1SNXA 3MI9A 2OJFE 4FZFB 2CHLA 5TE0A 4FV2A 4BN1A 5A3XA 4BBEA 4QP3A 5K4IA 4KAOA 4YC3A 4EL9A 4BDKA 4FEXA 4RIWA 2WMVA 4RPVA 2JEDA 2XP2A 3IDBA 4LYNA 4F4PA 4HYHA 4MD8E 4JBPA 2VWUA 5AP5A 5JFWA 4E93A 4IZ7A 2Z02A 5I5ZA 4CCBA 4FV5A 4WSYA 3KMUA 3ACJA 4KUJA 5DVRA 3A4PA 2HY81 4M84A 4QT1A 5CYIA 3EHAA 4FKJA 2W9FB 2X39A 4I21A 4QMWA 5L8LA 3F2RA 3ANRA 4J7BA 3E87A 2YDIA 3A60A 4FOBA 4YJTA 4MNEB 5KCVA 3VUDA 2PMIA 2W17A 1W83A 2PK9A 2GFCA 2C6EA 3CGOA 4KS8A 4TY1A 5IQAA 2GHGA 4HCUA 4C57A 3FI4A 4S30A 2O0UA 3UE4A 2JBOA 5FBOA 2CGUA 4KRDA 5F4NA 2R3FA 5DE2A 5HX6A 2IZRA 2XKFA 1ZRZA 2XKCA 3MFRA 4TT7A 4WNOA 3R7YA 4R77A 4DH7A 5M08A 3SA0A 1P4FA 2VTQA 3MN3A 2XMYA 5DRDA 4YHJA 4RQKA 1PYEA 1Q8WA 3HAVA 2WU7A 2X7OA 4CT2A 5CSHA 2WQOA 5IA3A 4O0TA 2YCRA 2VU3A 1F0QA
chains in the Genus database with same CATH superfamily
4L3JA 3EFJA 2FVDA 4GK2A 2CMWA 4U9AA 4O7WA 3CBLA 5AUXA 3NUYA 3R73A 2PVJA 2WTJA 4WHZA 3DXNA 3FLWA 4I5MA 3QC9A 4F7JA 1QPDA 5EDPA 1W82A 3NPCA 4RIXA 4PUZA 4EZ7A 3TDVA 3B2TA 3FSKA 4QMOA 1YWVA 4L43A 2HZIA 2YWVA 4EK3A 4BTFA 5DH3A 3QCXA 2C6DA 3BELA 4LV5A 2J5FA 4O2PA 5AIRA 4USDA 5DWRA 5I3OA 2YACA 3FZ1A 5E1EA 4AZWA 3L9PA 2X0QA 3PXZA 3PVGA 1OB3A 1MQBA 4X3FC 3MESA 5HVKA 2NYAA 4FIGA 2W4KA 2UUEA 4EK6A 5FEDA 2P2HA 4RX8A 4UV0A 3F3ZA 4EH2A 2KTYA 3W2OA 5DI1A 3E3PA 3E88A 4G3CA 3LZBA 5HE2A 3F5UA 3PXQA 5AX9A 2VX1A 4ACGA 3OOGA 2VWYA 3PJCA 3I7CA 4MBIA 1GAGA 4IW0A 2C5XA 4G9CA 3QQHA 4WUNA 4YZ9A 4ZXTA 3ORNA 5JQ8A 2RG5A 4ZJJA 3RBWA 4AOJA 1H07A 5B2LA 3V8SA 2GQRA 3U6JA 4ZZMA 3IGGA 2WTIA 5HO8A 2CN8A 3OY3A 1UNGA 2XARA 4Z3VA 4F1MA 1ZARA 5M57A 4G3GA 4QMTA 2XB7A 4IAYA 4C62A 3MBLA 4MYGA 4XG4A 4GU9A 3PXRA 3NDMA 3EFLA 5HX8A 5FBNC 3CSVA 2FSOX 1YWNA 2WTCA 3QC4A 4RC2A 2P0CA 4YJSA 4EOSA 4GYIA 5BVNA 5TR6A 1DI9A 5H8GA 3LXKA 3RPVA 5IDPA 2ZFYA 5G6VA 5ACKA 2YAAA 4EKKA 3LKMA 1J7LA 1DS5A 2VWBA 3VC4A 4C4EA 2VO7A 3SOCA 3HVCA 5BUJA 3Q9YA 1BL6A 4D2VA 4RG0A 3AMBA 1R1WA 1JOWB 3FI3A 4TWPA 2B4SB 2C3LA 2PVRA 3EIDA 4EUTA 5L2WA 4M66A 3RM6A 1ZMWA 3A4OX 3GCUA 3DTWA 3OEFX 1JSUA 4MBLA 4QP7A 4K33A 5A9UA 4LGGA 2OI4X 4XG3A 5BMMA 3VUGA 4DDGA 4I6FA 3NLBA 5B2MA 4NW6A 4GJ3A 2C69A 3QL8A 5EDQA 1XH5A 4CZTA 4DAWA 5L3AA 5BPYA 4GIHA 1H1QA 3VHEA 5FD2A 4UZDA 2XEZA 3G90X 4AFJA 3LMHA 4ENYA 1PMEA 4CKRA 1PXJA 4OUCA 4RWJA 5CSVA 5DOSA 3VAPA 2WZJA 4C2VA 2ESMA 1JKTA 3PFQA 4NL0A 3SXSA 2BRHA 4EQCA 3HNGA 3RK5A 2W5AA 3FY2A 1TQPA 2QR8A 4O4CA 4II5A 3RCDA 4CMTA 4D55A 4D2SA 5BVDA 3PIZA 3P23A 1OGYA 4GYGA 1W98A 4H58A 4IWQA 4PMTA 4AGDA 4BDJA 2P55A 2ZV7A 3AC3A 4WG3A 1Y91A 4MXZA 1EH4A 2R3IA 3QBNA 3QZFA 3EQCA 2BRGA 3UDTA 3UPXA 3PVUA 3R21A 5CEKA 3R7UA 3R9NA 3PJ1A 3FWQA 4DBXA 4LL5A 2JFMA 3GU6A 3KRLA 4C4GA 2PU8A 4HCTA 5DG5A 3F5XA 3I7BA 4IB1A 3FL4A 4X0MA 1R78A 3MH2A 1ATPE 4XCUA 5HCYA 4ALWA 5I9XA 2YM3A 4CT1A 5IEYA 2PMLX 4O7LA 2UZLA 5E8SA 4DA5A 4AF3A 3A2CA 3AXWA 3PY0A 1YXTA 3NAYA 2QG5A 2XF0A 5HLPA 4HVDA 5I9VA 1P14A 4DE4A 3GXLA 1O9UA 2X2LA 2R3PA 1H08A 3A7IA 4UXQA 3HL7A 4BVUA 2XJ1A 5LWNA 3U6IA 1M2RA 3FLQA 3SOAA 3JUHA 5KHXA 2VWXA 3TTIA 4HVSA 5EI6A 2Y6MA 5E1SA 5TKDA 4RJ7A 4D1SA 4BKYA 2AYPA 2A0CX 4FL1A 1J1BA 4V05A 1VZOA 2BIYA 4RIYA 2HZNA 1SVEA 3DFAA 4BBMA 4RGJA 2B7AA 2YIYA 4NTSA 4QYGA 4GSBA 3N4UA 5LMAA 4AE6A 2NP8A 5CALA 4C58A 4CD0A 5HLNA 4O7RA 3NWWA 4GH2A 3FUPA 4RRVA 2Y6OA 4AG8A 1GIHA 5ANGA 3KF7A 3H0ZA 4IAIA 5D9HA 3P9JA 3BGQA 4O96A 3R83A 5E8WA 5J5SA 5C4LA 3Q04A 2Y4PA 3SV0A 4ANLA 4BGHA 3Q6UA 4R5SA 5HD4A 3UMWA 3BLQA 4USFA 3OXTA 2B54A 3QKKA 3BWFA 3SD0A 4BTJA 3ORTA 2BHEA 4AN3A 3QWJA 1Y8GA 3W2CA 2XIRA 4QO9A 4BDAA 2EXCX 2VAGA 3BLRA 4Y83A 5FDXA 3UP7A 3LAUA 4FV1A 4IE9A 4CCUA 3E8NA 4HVGA 3DZQA 5HVYA 2I7QA 4KKEA 5IQGA 5CLPA 3F5GA 4FRFA 3BCEA 3DDPA 4YURA 4C34A 4W9WA 5L2TA 4GK3A 2OKRA 3REPA 3ULZA 5IZFA 3TUBA 3KXNA 3RWQA 1SYKA 2J9MA 3KVXA 4JBOA 5CQUA 3T8OA 3BGPA 4EZ3A 2ITTA 2XK8A 2C6LA 3Q9WA 5HNGA 5CEQA 2VX3A 3DU8A 2AUHA 4NJDA 4ZTLA 3SQQA 2YJRA 2YISA 3R1QA 4YTHA 3OHTA 3CPCA 3O2MA 3PZHA 3LLAA 3WYYA 3U54A 4AZVA 3GFEA 4CV9A 4K2RA 4F7LA 4YJPA 1DM2A 1IA9A 3NUSA 5GIOE 2UW3A 2ZDTA 4JT3A 4YP8A 4YHTA 2BFYA 3QA0A 3UZTA 4FODA 1OIUA 2QOBA 1F3MC 4I6HA 4ITJA 4W8EA 4C4HA 4UN0C 3ORLA 3AC4A 4E4LA 4ACCA 3E8DA 5T68A 1YWRA 4I5PA 4H1MA 4JQEA 3BEGA 4G1WA 2B9HA 2BILB 4EBWA 4C38A 3OBGA 2XCKA 2Z7RA 2IZSA 1CDKA 2W1EA 4XUFA 1PHKA 4KINA 2W1CA 4I23A 4S2ZA 4DEGA 4MXAA 4C0TA 3AD6A 3G6GA 3Q60A 1VJYA 2J0MB 3OCBA 3V5QA 3P0MA 4LGDA 5L4QA 1MRVA 3HGKA 5B0XA 5DEWA 4DYMA 2EWAA 4B8LA 3DTCA 4BCKA 4QTBA 3EQHA 2Z60A 4GKHA 3BYOA 1YRPA 2IEWA 3SW7A 3GCQA 4QYFA 2PVLA 1ZXEA 4IANA 2YAKA 4G5PA 3MSSA 5CEPA 2PVMA 4FKIA 1GZNA 4JDKA 3QTQA 3OVVA 5IA4A 1H4LA 4HW7A 4J52A 2JAMA 3JY0A 4L68A 5DGZA 4F6SA 5K5NA 4QP1A 3SHEA 4RX9A 1U5QA 1SNUA 5ETAA 4D2PA 3HEGA 2YIXA 3FAAA 2Y0AA 3VF8A 2BALA 3OG7A 4LRKA 2BPMA 4G3EA 3B2WA 4P4CA 4Y72A 5EKOA 4ORKA 3D5XA 5AR5A 1OKZA 4WA9A 3TWJA 1GJOA 2FSTX 2OIQA 3C4EA 4LMNA 5CX9A 3RI1A 4QMSA 3I81A 1B6CB 4HPTE 3COHA 1XMMA 1WBPA 3PXYA 3IW5A 4G6LA 4IZYA 3FEGA 2ERKA 4YUQA 4RFZA 5BMSA 1IR3A 4L53A 3U4UA 2I0EA 3QX2A 1JPAA 5C03A 4UX9A 4AZTA 3DT1A 4GU6A 4P2KA 3ALNA 2BCJA 3T3VA 4K8AA 3BBTB 3EL8A 2Q0BA 3UVRA 5CXZA 2CKOA 3KRWA 3UOLA 5M06A 3ZSHA 3E5AA 1BYGA 2JC6A 2XNNA 3LFEA 3MIYA 3D9VA 3VWAA 4CV8A 3EQFA 3H9FA 3R9OA 4PWNA 4F6WA 4BDCA 4AW2A 5CEMA 1TQIA 2GFSA 4FICA 3KIOC 3UC4A 4UWBA 2UZBA 2R3JA 4L52A 1XBBA 3MDYA 1AD5A 5D12A 2VO3A 2VTAA 2QHNA 4B8MA 5BVFA 1TZDA 3ANQA 4DITA 3PSCA 2JAVA 3UODA 4EEVA 5A6OA 4A9SA 2PSQA 1OKYA 3PVBA 3WF5A 3V8TA 2UZWE 3ACKA 5GZ8A 4DFNA 1QPJA 4U7ZA 4IX4A 2EU9A 1H1WA 3RZFA 3PJ2A 4JX7A 4O27B 3EL7A 4JRVA 3ZXZA 5F1ZA 1UWJA 3ZO2A 3NRMA 4ZTQA 1NT2A 4EOMA 3VS1A 4FGBA 4WBBB 3D5WA 1G8JA 1Q62A 4R7HA 3I60A 4M0ZA 2VTRA 3K5VA 3O8TA 4IB0A 5D41A 3PA3A 5C4KA 2OFVA 3DJ5A 3GFWA 4O0XA 4K0YA 5A4TA 3UGCA 2PL0A 1PXIA 3C0HA 5IQDA 5HCXA 3UBDA 4J71A 2B55A 5A4CA 1XKKA 4AT4A 3LVPA 1OIQA 1PKDA 1YXUA 3KGAA 4MBJA 4GUBA 4L6QA 3IS5A 4YGAA 5CZIA 4ACMA 2W1ZA 3DK3A 3DK7A 3RK7A 5ETFA 2ZM1A 1FVVA 4Y5HA 3CP9A 3PSBA 2Y9QA 3RHKA 5A54A 4CKIA 3UIUA 1YHSA 3R1NA 4BWPA 4EH9A 3QTIA 3HMNA 4J97A 5HI2A 5DMZA 4KKHA 4BY9E 2XCHA 2QOQA 3OWPA 3PWYA 4FTJA 4O0YA 5IPJA 4OTFA 3ZUTA 4WD5A 3DV3A 3G33A 2WOTA 3E64A 1FGKA 3OTUA 3VN9A 4YZNA 3L9MA 3DDQA 4RZVA 3D0EA 3BLHA 3A61A 3FY0A 4N70A 2XNGA 3QLGA 2Y8OA 3F3TA 4WRSA 3LCSA 5AX3A 5IU2A 2F49A 2YLFA 3PTGA 3DAEA 4M67A 4HYSA 4GJ2A 2J4ZA 3WZJA 5GZ9A 4XH6A 3RVGA 3M42A 4BIEA 1G8AA 4BJJA 3BYUA 2UZNA 3KXGA 4O22A 4QP2A 2OIDA 3TNWA 2C6KA 4ZSAA 3DQWA 1UWHA 4FT5A 1LR4A 5IMEA 5HD7A 3H0YA 4W4YA 4NCTA 4DTKA 3DOGA 2HYYA 5LCKA 4MWIA 3PZEA 1Q3DA 3GOKA 2BIKB 2OIBA 2QC6A 1BI8A 3CTQA 3NW7A 5ACBC 4DFLA 5HQ0A 5FTQA 2IW8A 1NVRA 1UU7A 2GS2A 2X4ZA 2WEIA 2XNOA 3BHTA 4FSYA 5HBEA 2ZV9A 2BRNA 4PL5A 3EQDA 1WBNA 2QO2A 4H1JA 2YM7A 4O4BB 4AZSA 4U79A 1WAKA 3ZUUA 3RM7A 4AN9A 3OW4A 5AP4A 2PUIA 3CCNA 2IZTA 4O81A 2CLQA 1FMOE 3PP1A 4E5BA 1J3HA 3AC1A 5J1WA 5KO1A 4BKZA 3MH0A 4MNFA 4EORA 4H3PA 4AFEA 1JSTA 2ERZE 4I0TA 5KMNA 5KUPA 3UDBA 4K1BA 4CFWA 3Q53A 3QZHA 4UMUA 3LCKA 1J7UA 2WMTA 4BCGA 4L42A 3BYSA 4DHFA 3DCVA 3IO7A 1FVTA 4C61A 2VV9A 3MVHA 3LQ5A 3FYKX 4PP9A 3R8VA 5CF8A 4KRCA 2OXYA 5C8KA 1WZYA 2HY0A 3TKHA 1Z9XA 4V04A 3DJ6A 2XBAA 4IX5A 3C5UA 3F2AA 3FMNA 4Q5HA 2PZ5A 4Y46A 2IVTA 2G2FA 5D11A 5FRIA 1NW1A 1VR2A 2WKMA 3VVHA 3R01A 5L8JA 3COMA 4NK9A 4EJ7A 4PX6A 4ZSEA 3RPRA 2C6MA 3V5LA 4AXAA 2PY3A 4TN6A 3UO4A 2BDJA 5FTGA 1XBAA 3QYZA 5ANIA 4O1OA 5BV3A 2HZ4A 5JGAA 3F5PA 3BHHA 2GS6A 4BDDA 3ODZX 2XA4A 2WELA 1BI7A 5CNOA 4DEIA 2UW6A 4IDVA 4WRGA 4FEVA 3UIXA 3NCGA 5HG9A 4CRSA 2R64A 4DG3E 2CGXA 4GS6A 3KVWA 3IW7A 5E8UA 4R3CA 4F78A 2OW3A 5EHLA 4CFUA 2I0YA 4D4YA 1R39A 4DGOA 4ZZOA 2Q83A 2HAKA 4DBNA 3OUKA 4G16A 1KE6A 3KKVA 4WBOA 2E9PA 3PRIA 4ASXA 4EC8A 4ONAA 3CJGA 2X0OA 3QKLA 1IASA 2HK5A 1W8CA 3NNVA 3HMOA 5AV4A 2CN5A 2QOKA 3U87A 3R02A 2EB3A 4L67A 3QQJA 4PRJA 1CKJA 4U41A 4FA2A 3IECA 2G2IA 1JSVA 2KULA 3HV7A 3R22A 4J98A 4BI2A 3UTOA 1OKWA 3WBLA 3Q9ZA 2YDKA 4FTIA 2JKMA 2DYLA 4O4FA 3QQKA 4KIKB 2PE1A 3VUIA 4X2NA 5IEXA 4U0IA 3TJCA 4X2GA 2BFXA 3NVKI 4XHKB 5HG8A 4PTGA 2XNEA 5AP1A 5L2SA 4RIOA 4YZDA 1PXLA 3C4FA 4MXCA 4DHIB 4JNWA 1CKPA 4KBKA 2LGCA 3OF0A 2YM4A 4XOZA 4F0FA 3EN6A 4E5WA 2PZPA 3A7GA 3QD2B 4DC2A 3D94A 3U9NA 4OAVB 5AP7A 3U8WA 3ZRKA 5JSMA 1RW8A 2CDZA 4EH7A 4PY1A 4IEBA 4WUAA 3FMHA 5JGBA 3KRXA 5EOBA 2QI8A 1ZYDA 1WBSA 4PDYA 3COIA 3FPQA 2ZM4A 1BMKA 4A7CA 4AXFA 5BUIA 3OCTA 3P08A 4Z7GA 2V5QA 3IOPA 3QUPA 5IDNA 4KIPA 4X2JA 3UO6A 2C5VA 4QPAA 4XG7A 2OGVA 3ZFYA 3BE9A 4S34A 4XMOA 2Y4IB 2W7XA 2WQBA 3UQCA 5CWZA 1FPUA 1SVHA 4WNKA 1GZKA 2RGPA 3FMLA 3ROYA 3UOKA 5HU3A 3ZH8A 1U54B 3VW8A 3CJFA 2YEXA 4CMOA 5CVHA 5J9YA 2QKRA 4IC8A 3OT3A 5AR3A 4EH6A 3GENA 3OY1A 5K9IA 4W4WA 3QTWA 3IW6A 3NNUA 1H1RA 4QTDA 2F57A 2WB8A 3K2LA 3FZTA 3KRJA 4RJ6A 5DT0A 3BHVA 3DKGA 1OGUA 4D58A 3H9OA 5GINE 1Q8ZA 4NSTA 5DT4A 4FSTA 1W7HA 4QQCA 4GRBA 5E7RA 2IF8A 4BYJA 4UMTA 1IA8A 4O2ZA 4JR3A 4EHGA 4A9TA 1M7QA 4D1XA 3C5IA 4OTPA 3FQEA 4MNEA 3SC1A 3F7WA 3NW6A 5HIDA 2FSMX 2YHVA 3LFFA 3GB2A 4DH8A 4O82A 4D9UA 1OPLA 5M4FA 3TDWA 3QRTA 3TNIA 4YJRA 5IUHA 3F61A 2R3GA 5M09A 4IADA 2J0JA 1XH9A 3D14A 1J1CA 3I79A 4M7IA 3VQHA 1WBVA 5JFSA 2IG7A 2BHHA 1YDSE 2FA2A 3D7ZA 5EYMA 3FL5A 2C1BA 3FLNC 5J7BA 1UNLA 4D9TA 3EFKA 4FIJA 3OFMA 2QODA 5GJDA 2C6TA 2C0OA 5FQDC 3RAWA 4JS8A 4OBOA 4ERKA 2BZHB 4DINA 2V7OA 5J1VA 1V0OA 1OECA 1W2DA 1PXPA 4OTDA 3TNHA 1MP8A 1OVEA 2ITXA 2VTTA 3TV6A 3HAMA 4HPUE 3EN4A 1ZY4A 2IVSA 3ZXTA 3LCOA 4MF1A 3ZDUA 4D4SA 1KOBA 4UMPA 2R9SA 4CTCA 3L8PA 2WMAA 5EQPA 2QONA 5JFXA 3MPMA 4I4FA 1XH4A 4B4LA 4R7IA 4E6AA 5IA0A 3L8XA 3EWHA 2ONLC 3O17A 1OPJA 4AE9A 3II5A 4TYHA 3GQIA 2UW9A 4JX3A 3V5JA 3MV5A 3D7TA 3KULA 3QCQA 1UVRA 4O0RA 2R2PA 3LLTA 4FT3A 4KWPA 3OROA 4QMYA 2PVNA 2WTDA 3UJGA 3R8MA 2VTSA 3D15A 3P5KA 3ZO3A 4QNYA 4RSSA 1MRUA 5IA2A 2X9FA 5D10A 4U8ZA 4RFMA 3NNXA 1XMLA 4R3RA 2XJ0A 5CSWA 3DAKA 4FKRA 3PLSA 2XEYA 2VRXA 4IB5A 3V5TA 4QDVA 3QAME 5L2IA 1LEWA 5HZNA 1BL7A 1NY3A 3R7VA 1YHWA 4I20A 2OH4A 2WMQA 2GDOA 1A9UA 4ZS4A 3DKCA 4W8DA 2QO7A 2V62A 4IDTA 4ZTNA 3GEQA 2CCHA 3MW1A 5I4NA 4DT9A 1SVGA 3HX4A 5LJJA 5LOHA 4U3YA 4GT5A 4D1ZA 3DGKA 4APPA 1Z57A 3FI8A 4FTQA 3BL9A 3C50A 3PA4A 4UYAA 4XEYA 5EHYA 5AV1A 2QG7A 2AEGA 3ID6C 2ZDUA 5AP2A 3BE2A 2VO6A 3ATSA 2JDOA 3EQRA 2W9ZB 4IJPA 4EC9A 4Q2AA 4YLKA 3RMFA 3AC2A 4EHVA 3KXXA 1REKA 2G9XA 2W0JA 2XVDA 2R5TA 5EI2A 4FUYA 5LXMA 4O7TA 1NVSA 3DLSA 2Y4IC 3A7JA 3GC7A 2UVZA 3AT2A 3RGFA 1T46A 2UZUE 5ANEA 3Q4CA 5LMBA 3UNKA 2PPQA 4QMVA 5DHJA 3IG7A 3O0GA 1ZAOA 4J95A 3F3UA 1IAJA 3W0RA 5J79A 2JBPA 3C0GA 2QLUA 2Z2WA 1QCFA 3HMMA 3OD6X 4FOCA 4E5AX 3V5WA 5KBRA 2JGZA 5E8TA 4JBVA 2OWBA 4O7VA 4FNZA 5JH6A 5LVMA 4XP3A 4L3PA 3W33A 2HCKA 1QPCA 2IJMA 3QXOA 2XM8A 3JYAA 1PW2A 2C47A 2BKZA 3D5UA 3COKA 3OC1A 3CEKA 4O38A 4QP4A 3MFTA 4RA5A 4ZEGA 5FDPA 3OEZA 3EQPA 3GC9A 2GS7A 2RSVA 1FMKA 1R0PA 1SZMA 2X1NA 1XBCA 3V51A 4LOQA 4FV6A 4DTAA 2EVAA 4NM3A 2JITA 2ZJWA 1K2PA 3OP5A 2DQ7X 4IAAA 2GNGA 1UKHA 4MAOA 4YPSA 3KN5A 3EN7A 3SXRA 3PVWA 2O64A 5EM5A 3CE3A 3QZGA 4UALA 3VNTA 1J7IA 5C27A 2VNYA 4I6BA 3VS0A 4EYJA 3D4QA 4HJOA 5HIBA 3ZC6A 5EDRA 3RPSA 4C36A 4P5QA 4CEGA 1GOLA 3QYWA 4QQTA 4I6LA 3DQXA 3MVLA 2EXMA 1YXVA 4GMYA 4H3BA 4O0WA 3R28A 4C59A 4FC0A 4KKGA 4FSZA 4O6EA 4OTIA 5BNJA 2BZJA 1UU3A 4FL3A 4AAAA 5HEZA 3W0SA 1BKXA 3BV3A 5FWKK 4BI1A 3C4ZA 1Q8YA 5CU2A 4C37A 2XNMA 1I09A 3ALOA 3KK8A 5H3QA 4D28A 4GIIA 4EOIA 1WVYA 4I4EA 2I0HA 4O0UA 4JI9A 3QD0A 1BX6A 4JAJA 4MF0A 4PDOA 5FEQA 3QKMA 3ZONA 4BCJA 3KL8A 2XK4A 1RJBA 4U5JA 1ZMVA 2X6DA 4MXXA 1UA2A 1OPKA 3PY3A 1HOWA 4ANQA 1DI8A 1YDRE 4UWCA 2BAJA 4AA5A 3MVMA 2EXEA 1TKIA 4LG4A 3BWJA 2JDVA 2ZVAA 3S4QA 4X3FB 4TZRA 4C4JA 5CI6A 4Z7HA 3ZC5A 5JK3A 1RQQA 3DBDA 4FKLA 3O7LD 3V5PA 1XO2B 3CKXA 5TT7A 2VUWA 3WE4A 5AA9A 2WOUA 3BI6A 1Q41A 1QL6A 3DBCA 4Y8DA 2PUPA 2XZSA 2ETRA 4IBMA 2VZ6A 1Q4LA 3FQSA 3POOA 4PV0A 5IF1A 4CQEA 4A4XA 3QTUA 4RWLA 4Z9LA 4EQMA 4LL0A 4QMXA 4UEUA 4N6YA 2X0GA 2R3KA 2VX0A 4I3ZA 4ANNA 2F7XE 2J51A 2OO8X 4CGAA 2O63A 3NIZA 4M97A 2PMNX 5KMIA 2QQ7A 3Q4ZA 5GJFA 2CKPA 4EOOA 4TYEA 2WFYA 3LXNA 2QO9A 5EFQA 5HICA 5EM7A 4BGGA 2WHBA 3QLFA 4O83A 2WAJA 5KX8A 3BQCA 5LMKC 2JKOA 4Q5EA 3TKUA 5CZHA 3VO3A 5A4QA 4LV7A 2BTRA 5IQEA 3Q52A 3R0TA 1FGIA 2OK1A 2JD5A 3LFNA 3QTRA 2NPQA 3LCTA 3PUFC 4XV3A 4AWIA 3BBWA 4WNPA 1GNGA 3DPKA 5H9BA 3UG1A 3NUAA 4ENXA 3FE3A 4FEWA 2QKWB 4RT7A 4BHNA 4OTGA 5LWMA 5H2UA 1ZMUA 3KC3A 2ZV8A 2RG6A 2W4JA 3OT8A 4XP2A 4CFMA 2UZEA 5AFVA 4M69B 2I1MA 5AUTA 4QNAA 4C02A 3THBA 1TVOA 3AD5A 1BLXA 4RWKA 4UBAA 2QLQA 1T45A 5F94A 5EG3A 3F69A 3ZBXA 4D2TA 5L6PA 4F1OA 2CKQA 4BDFA 2B9JA 4FNWA 1Y6AA 3GU4A 4ZP5A 2B0QA 4JL9A 2UZDA 3FHRA 4E1ZA 1OM1A 1YOMA 4KSQA 2QOFA 2VTNA 3FSFA 3LW0A 2ZM3A 4NUSA 2F4JA 1UU9A 3EKKA 1K9AA 2VTHA 4MQ2A 3MY1A 4U81A 1S9IA 4IX3A 3ZFXA 1PRYA 2HOGA 2XK3A 2HW6A 4PTCA 3ZOSA 1ZYJA 2QCSA 2FSLX 3M2WA 3O7LB 3TI1A 4BYIA 1ST4A 3C7QA 4DHJA 4HVIA 3DFCB 4YC8A 3W55A 4DFXE 3WZUA 3ZMMA 3JY9A 2X8DA 1JNKA 1ZOGA 1KV1A 2WPAA 2X8IA 1KV2A 4FT0A 4F7NA 3TYKA 4I1ZA 5IA5A 4ZLOA 3ZU7A 4OBPA 2RFNA 5DIAA 1YHVA 1O6YA 2C68A 4BRXA 2IVVA 3VJNA 3E92A 3KF4A 4C35A 2X0PA 3CS9A 2HZ0A 3D7TB 3KULB 4AW0A 4CFNA 1JVPP 3BX5A 3TUDA 2V22A 4QDEA 1S9JA 2YZLA 4JR7A 3LIJA 5FG8A 1SMHA 2VGPA 3QXPA 1RE8A 4GK4A 2WIPA 1LEZA 1OITA 4C3PA 2PVHA 3PE2A 2W99B 3ZLXA 1XQZA 4CQGA 2OZAB 2XJ2A 3PA5A 2YIQA 5HO7A 3BGZA 5AP3A 4A06A 2WTWA 1YI6A 2WMXA 1WBWA 4OT5A 2R7BA 4QYEA 4ALUA 5EW8A 3WILA 4BCMA 3VBQA 1W84A 2WGJA 3C4WA 3PJ8A 3CQWA 5AUZA 3JPVA 4QD6A 5EHOA 4QMUA 1JAMA 3QD3A 4BTKA 5HHWA 2SRCA 5IQBA 5ETIA 4FSNA 2GQGA 4L8MA 5JRSA 4ZS0A 3RK9A 4QYHA 4ANMA 3IGOA 1Q97A 5E8ZA 5IH5A 2FH9A 2W1FA 3MPAA 3VRYA 2RIOA 2BTSA 4I94A 4YHFA 3UDSA 4TWNA 1PXNA 2C6IA 2YZAA 2OF2A 3AMAA 3SW4A 4G6NA 3UVQA 4MX9A 1YQJA 2R0IA 4G3FA 3UQGA 3WF9A 3SG9A 2CKEA 1Q8TA 4BCHA 2ETKA 3V01A 4C33A 4LUDA 2PE0A 4IWDA 5F95A 1JKSA 4D2WA 4A07A 1H1SA 3VBWA 3GI3A 3PE1A 4IFGA 5D1JA 4PDSA 4U40A 3ZYAA 5K0KA 3UO5A 4FV7A 3QU0A 4YNEA 3ORPA 4EOQA 5C8NA 4AAYA 4MH7A 4E4XA 1VLRA 5AR8A 3OXIA 3PWDA 1K3AA 5JRQA 2ONLA 3P4KA 1XR1A 3SRVA 4BKJA 5LQFA 1DAWA 1P2AA 4BZNA 3DK6A 3DKOA 1OI9A 2GQSA 2C5OA 4HYUA 1NXKA 5M4CA 4D4VA 5KZ0A 4A9YA 3W16A 2A1AB 1V1KA 3NSZA 3E7VA 5HOAA 2C5YA 5JQ5A 2H96A 4UZHA 2GNIA 3EQIA 2I6LA 2I0VA 3ZSIA 2XAMA 1YVJA 2WMSA 4RIYB 1J91A 4JLCA 4EH4A 4PNKA 4P5ZA 4FIIA 5L2QA 5HTBA 3R00A 3FJQE 4EH3A 3PIXA 5ANDA 1KUTA 5AV0A 2OJJA 4ZTRA 3VBXA 3TG1A 2FYSA 4RLKA 5F9EA 5DPVA 3R1SA 2E9OA 4YSMA 4ZJIA 1YI3A 3GC0A 4IVDA 4FT9A 4D2RA 1O6LA 2E9NA 3MA3A 4KNBA 4NWMA 4C8BA 4D0WA 4BDHA 2V7AA 1ZYSA 2B1PA 3KMMA 4FTOA 1KSWA 4KB8A 4YR8A 5FLFA 3ZLWA 5F20A 3ITZA 4FTTA 4DGMA 1A06A 3FXWA 1PYXA 1RDQE 1KE5A 3I0OA 1U4DA 4NFMA 4XOYA 4ASDA 4FZDB 4L01A