1Q3WA

Gsk-3 beta complexed with alsterpaullone
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
344
Chain Sequence
b'SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 344
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q3wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q3wA01
4DEHA 4X2KA 1Q61A 4KBCA 5CSVA 4NJ3A 2RG6A 5C9CA 1JVPP 3ORPA 5F95A 3WYXA 3ZDUA 3VJOA 3UOLA 1ZMUA 4L7FA 4CEGA 4EZ7A 3QC4A 2NO3A 4IFCA 3TDWA 4UN0C 4AA4A 4FKQA 1NY3A 5FXRA 4GFMA 3MFSA 4QTDA 2F2UA 3V8TA 4C58A 3ZFYA 5DHJA 1WZYA 3QWJA 3M1SA 4DLIA 3BU3A 2R0IA 5IISA 5L8JA 4NZWB 3QTQA 3G5DA 4N70A 4IX3A 3FZSA 5AUTA 3KB7A 2QKRA 4CRSA 3GCQA 2OIBA 3CTQA 3BIZA 3VJNA 3N4TA 5DYJA 4NM3A 3W32A 5GHVA 3E92A 2VTPA 4GCJA 4R3CA 2W9FB 4R3PA 4I5MA 5BVEA 2ITZA 4QP3A 3TWJA 2ITPA 3OD6X 3F7ZA 3V3VA 3W2RA 1GZKA 5AP3A 5KMNA 4IVAA 3U6IA 3POOA 3R7VA 3QQHA 4M0ZA 5F1ZA 3S0OA 2GNJA 2WQOA 3F5GA 4F08A 3EHAA 5HIBA 3FHRA 5DT3A 4FSMA 3GI3A 4YJNA 3VUDA 1KOAA 2PVNA 4DG0E 5E1SA 4OT5A 1ZMWA 2GHMA 3VF9A 5AADA 4Q5EA 4DTKA 2E9UA 3TIYA 2PK9A 4O22A 3RCJA 4CV8A 2HIWA 4J95A 4OBOA 4GV1A 2NNWB 3DU8A 3AMBA 2GCDA 3P7AA 4IACA 4AG8A 3IW7A 1OKYA 1NW1A 1YW2A 4L6QA 5ANOA 4WUNA 4DC2A 2VTJA 4Z3VA 2CLXA 3AD6A 4TRLA 2QO7A 3UZPA 2X8EA 4O91A 2B9JA 3CP9A 4WD5A 2O65A 4XNEA 3RVGA 4PX6A 5EH0A 3R8MA 2WD1A 4P7EA 4RA4A 3VNTA 1R39A 2OZAB 2VWYA 3PY1A 4LGHA 4F9AA 1WBTA 3Q4UA 3E88A 1OVEA 4G1WA 3ZBXA 3R0TA 1DI9A 4U6RA 2IZTA 3I4BA 5L2TA 3MVJA 1GAGA 3H4JA 4RQKA 3TM0A 5ACBC 5L2WA 2QOLA 1FVTA 1OL1A 3DK6A 4EHZA 2CN8A 3RMFA 4A9SA 2PVFA 5AP6A 3TUDA 3FI3A 4FTTA 4M12A 2B53A 4G3GA 3OVVA 4P4CA 4ZP5A 4FKPA 4JDKA 3A7IA 3UGCA 3LE6A 4MXOA 1LP4A 4ALVA 4CG9A 2X4FA 4FVRA 3R6XA 3A7HA 4RFZA 4TNDA 4AE6A 3PY3A 4IAFA 4DFBA 2AC3A 2UW5A 2GS7A 4KIQA 3CQEA 4IIRA 2GNLA 3EYGA 3GBZA 4F0GA 2IVTA 3TNQB 1XBAA 2YIQA 3NCGA 3QU0A 3QUPA 4DLJA 4QMWA 5AP2A 4HGLA 4AW5A 3BWJA 2V55A 4FK3A 3L8XA 1UNLA 3R04A 2YM5A 3CGFA 1MRYA 3FUPA 4MWIA 3A61A 5E8UA 5BVKA 4BTKA 1O6LA 3UOJA 2XKDA 3RPVA 3AC3A 2PMIA 4YJRA 2BRBA 3Q4ZA 4AOTA 2PVLA 2WKMA 2X8DA 5AR8A 1YXUA 4H3PA 2IW9A 2G15A 5A4EA 5EQYA 3D7ZA 4YUQA 3MESA 2WTCA 2CN5A 3TKIA 2QG7A 3Q04A 4NWMA 2YAAA 3FZTA 3QQFA 3IDCA 3QHWA 4W8DA 4O0SA 5D7AA 3WF5A 2FGIA 4ERKA 2WMBA 1JAMA 4O7WA 1Y6BA 2BAKA 3CTJA 2V22A 2DS1A 2Y9QA 3BYSA 3FMMA 3DT1A 4BDDA 2C0IA 2CDZA 2JITA 2UUEA 3GU6A 4QMZA 3QHRA 2QOCA 4FTRA 4UB7A 4TL0A 2PZYA 3Q4TA 3QRJA 4ZIMA 5LVNA 3UNKA 4EKLA 4DEEA 1OL5A 4G6LA 1JSVA 4YU2A 1O6KA 2OBJA 2XS0A 2O0UA 4AZWA 4QP1A 5C8NA 5IEXA 3E87A 4EOIA 4RIWB 4WBBB 2ZM3A 4D4RA 5CANA 5EDRA 4D2WA 3KULB 4J7BA 4BDHA 1Z57A 1W82A 5HCZA 4A07A 3EN5A 1E9HA 3RJCA 5BUJA 5AM6A 3GP0A 4PTEA 3AD5A 4BCOA 3R00A 2OJ9A 5D10A 3N51A 3PA4A 5DIAA 3RAKA 5E90A 4AQCA 4ZS4A 3TUCA 4Y73A 5C8MA 3PSDA 3BGPA 4BHNA 4LYNA 3ZUVA 3VVHA 1IA8A 4A7CA 4CCUA 3RM6A 4RWJA 3S2PA 3IW4A 3OWKA 2HXQA 1Y91A 2J0MB 3QQLA 4EC9A 5L8LA 2JDTA 4I1ZA 3KEXA 3PWDA 4L9IA 4F0IA 3EQFA 5IH6A 3PRIA 4YZ9A 4FNYA 4EYMA 4C62A 4YLJA 5IQBA 2H9VA 3MS9A 5IQDA 3UQFA 4EH8A 2O5KA 2JKOA 3PXFA 3BWFA 3NVMB 2YA9A 3LFAA 3UPZA 1URCA 4YHTA 1JLUE 3PJCA 3C4XA 3ROCA 5EOBA 2QI8A 3R7OA 4AZEA 5CF6A 5I9VA 2B54A 3NUSA 3C7QA 4HYHA 4M66A 3SOCA 4P5QA 4C2VA 4HCUA 3PLSA 4DH8A 2IW8A 3UVPA 5LCJA 3P7BA 5LWNA 2I0EA 4JG6A 2CKQA 4AW0A 1SZMA 3MY5A 4FZDB 4WKQA 5AR2A 4BZOA 4EK8A 3GNIB 4USDA 4QO9A 1H8FA 3CCNA 3EYHA 4AZSA 3D4QA 2WMWA 4OGRA 2EWAA 2XBAA 4I4FA 3F5PA 2B52A 4FC0A 3CJGA 5CU2A 1J3HA 2GNIA 3IECA 3R1NA 3IPHA 5AWMA 3PYYA 2Z02A 4QMOA 2BRHA 4DFYA 2HWOA 3QYZA 3EFWA 5ANDA 4DFNA 2W5HA 2QVSE 2VTTA 2YCSA 2Y0AA 3OHTA 4FTUA 3KL8A 5HO7A 4R3RA 3NYNA 2GFSA 2C3LA 3OXIA 3F3ZA 4J98A 2JKKA 3PXQA 4KB8A 4DEGA 2YIWA 4IB5A 2QD9A 4L7SA 1ZMVA 2OSCA 1Q97A 4UV0A 1J91A 2C0TA 4KAOA 3VIDA 4E7WA 3MW1A 2PUPA 3UE4A 4O84A 3QCXA 3DZOA 4MNEA 2H34A 2PMNX 2OXYA 4X6QC 5A54A 3HEGA 2BHEA 3Q6UA 5J95A 3MFUA 4FZFB 3LLAA 3EQRA 4IZ7A 1OMWA 4I41A 5EDQA 1SMHA 3UC4A 1ZY5A 3IG7A 2YWPA 4JBPA 1ZYDA 3GU7A 5CAUA 4YJSA 4JR3A 3CQWA 3ORXA 4EH7A 2VU3A 3WOWA 1O9UA 3OTUA 4G34A 2W5BA 4NIFB 3OWLA 3QRTA 4I94A 4O21A 2W4JA 1NXKA 3NYOA 5B2KA 4N57A 5H3QA 2BKKA 2B7AA 4NM7A 1U59A 1DS5A 1ZYCA 2EB3A 4Y83A 3VUGA 3DBDA 2J5FA 3FSKA 4O0YA 3LOKA 4LV5A 5J79A 4XG2A 1BI8A 4D2TA 1ZYLA 4KS7A 3HMIA 3LHJA 2UZUE 4EQMA 2BAQA 2GNFA 5TT7A 4C8BA 4F70A 2C6IA 2YCRA 5CEPA 4GVAA 2Z7LA 4YPSA 4EK3A 4LRMA 3LPBA 2ETRA 3SOAA 4ERWA 1IAJA 4FL1A 1AD5A 2P2HA 4I6BA 1ZZLA 3P79A 5E7RA 3ZXTA 4B8MA 4AGDA 3DKGA 1L3RE 1W98A 3E8EA 5CASA 4DT8A 3R8UA 4RVMA 4EZ5A 2BKZA 3BGQA 4F1MA 2J2IB 5HE0A 5ICPA 3KXNA 5CU3A 2QCSA 1V0PA 2PMLX 4CFWA 1QPJA 2DYLA 4FTCA 3VRZA 5LVPA 4MVFA 4O0RA 2P0CA 3NW6A 3QQGA 4AW1A 1VR2A 3BKBA 3CTHA 4V01A 4D0XA 2BAJA 3DAJA 4JJRA 3D5XA 4E4MA 4L46A 5L2SA 3FMLA 4UZDA 4RC2A 5HX6A 1OIUA 5HQ0A 3B8RA 3SXSA 3DTWA 4BDJA 2ESMA 4ACMA 4R77A 3HX4A 5TKDA 2QKWB 4H3BA 5A9UA 3FPMA 5B2LA 4F9BA 4NW5A 1QPEA 2CHLA 2VWUA 3CKXA 4QQJA 5DN3A 5G1XA 5BYYA 3HA6A 4FEXA 5ETAA 3VUKA 5FXSA 4K9YA 2X7OA 4M3QA 1G3NA 4PMMA 2UW4A 3EJ1A 3FLZA 3GT8A 4IAYA 4N4SA 2XKEA 2XNGA 4NT4A 4QRCA 2PHKA 1BKXA 4QPAA 5I9WA 4WG3A 2P3GX 3IGGA 3F7WA 1FPUA 2X6EA 3JS2A 5IU2A 3A4PA 1TQMA 3ZYAA 3MPTA 4PPCA 4TYJA 1E1VA 3DAEA 1J1CA 3U6HA 3NNVA 5L6PA 3V04A 2GTMA 4HGTA 2RFNA 4XH6A 3C0GA 5AV0A 4DG2E 2C6TA 2QG5A 3F6XA 4FSZA 5DWRA 2OZOA 5ETIA 3WZDA 3WI6A 4U9AA 5AUVA 2BZIB 3MH1A 2YM3A 3NZ0A 3NWWA 3BHVA 5G6VA 2OGVA 5CSXA 5KZIA 5JMSA 2OICA 4N0SA 5JK3A 2V0DA 2R7IA 2ZOQA 3DDPA 3LJ2A 2EXMA 4GU9A 4JXFA 3R7IA 3F5XA 3ZMMA 3F2NA 4ANBA 4IAIA 3SA0A 3LCDA 4NUSA 1PMEA 4F63A 1KWPA 4DA5A 4D4VA 5EOLA 4FT5A 3P7CA 3ALOA 4TNBA 5IA1A 2VWIA 1AGWA 2CGVA 3KFAA 4U45A 3ZDIA 3NMUF 3LCTA 1WVWA 5KZ0A 5M55A 2YN8A 4DCEA 3L8PA 2WMXA 4EUUA 5AEPA 5AFVA 4O0XA 5E9EA 4BYIA 4EK5A 4ZTNA 4OTIA 4XMOA 3KRLA 2PVHA 4RVLA 4O81A 2RKUA 2XA4A 4K33A 2J0LA 4ZY6A 1JKKA 2IN6A 3OTVA 4O0UA 3WF8A 4YSJA 3GC8A 3L9PA 5CNOA 4M15A 1BX6A 3UTOA 3K2LA 3I79A 3WBLA 4JT3A 1H00A 3EQHA 3G90X 3BE2A 1K9AA 1DM2A 3C4CA 3DY7A 3QGWA 3R02A 3A60A 3R1YA 3LIJA 4I6QA 2CLQA 3VUMA 4D2PA 4MXZA 1IRKA 2C3JA 2FYSA 5JRSA 4HCVA 1QMZA 2GNHA 5D1JA 4XG8A 4D4YA 2HY0A 5LCKA 5KKRB 1FMKA 5EYCA 2J9MA 5KNJA 3C50A 4W4WA 4QMNA 4NFNA 2R3FA 2R3LA 3D0EA 3EKNA 3HDNA 4AGUA 5E8XA 1KE6A 4FOCA 4K2RA 5CQWA 2EB2A 4OTFA 4Z16A 5AUWA 3MV5A 2LAVA 1A48A 2QNJA 3QZGA 4G5JA 4XG4A 4XG7A 3VQUA 2HW7A 3EOCA 5FBOA 5HGIA 4TZRA 3FHIA 5BYZA 3NDMA 4APCA 3BU6A 1I44A 3TNHA 2QOKA 4K8AA 4BCNA 2WTWA 3O96A 3OXTA 3GU4A 3IW5A 1OBGA 2E9VA 2AYPA 3MI9A 1E1XA 3FXXA 4UMUA 2HZIA 3UIUA 3FQEA 5D11A 2R3IA 1OPJA 5AP1A 1XKKA 3ZBFA 5JFSA 1OGUA 1YOJA 4FSNA 5CS6A 5LMKA 4KS8A 4I21A 5HD4A 3G6GA 3OEZA 3QCQA 2C3IB 3GENA 1FINA 4JAJA 1CDKA 5HVYA 3HV5A 1JPAA 1F0QA 1MUOA 2XM8A 3UBDA 2SRCA 3BLRA 3ZZWA 3RP9A 5CEMA 3AMYA 4YHFA 5AR7A 1JNKA 1XH9A 2XF0A 4BKJA 2PVMA 3EFJA 3Q5IA 4XV3A 2ZV9A 4NEUA 5CU4A 4IB0A 2UW8A 2PVKA 3TZ8A 4M97A 4MH7A 5IA4A 4OUCA 4WUAA 4FIGA 3CQUA 4QP9A 1GZ8A 2A1AB 4TW9A 3AT3A 3A4OX 4C4IA 3VRYA 5L2QA 5HICA 1V0OA 1IR3A 1EH4A 4FKOA 4WSQA 3ZEPA 4AACA 3QD0A 4DBXA 4RSSA 2GQRA 3SGCA 4IMYA 3MH0A 4W4YA 4IADA 4R1YA 3FMHA 4ARKA 4PPBA 1U5RA 4I6FA 3FKLA 2UVZA 2OW3A 2QU6A 2UZDA 2J0JA 5FM2A 5EM5A 4XYFA 3VQHA 3D7TA 4UALA 5CXHA 2BRNA 4Z55A 2R64A 4YTFA 3W16A 2GU8A 4BIEA 3FLYA 3BGZA 5CZHA 3I7CA 2F9GA 3ZC5A 2PULA 3NUUA 3HLLA 3WIGA 5AR5A 5JH6A 3Q60A 4M13A 3G15A 3OWJA 5FDXA 4HPUE 4JOAA 4QYFA 3RNYA 5M4FA 4U40A 5EDPA 1SVHA 2ZVAA 5EQPA 3COMA 3HMNA 1QPDA 4HGSA 1SNUA 4WT6A 1YHWA 2F4JA 5HLPA 2IPXA 3SAYA 2E2BA 4X7QA 5CY3A 4FV0A 4YZMA 1J7UA 1UU3A 5IA3A 3HYHA 5DVRA 3SC1A 4GIHA 3CD8A 4HGEA 3FXZA 3NYVA 2ITNA 4FNXA 4K18A 3TV6A 3LQ5A 4KBAA 1GY3A 4B4LA 3A62A 2YITA 4ZY5A 3O8UA 4KIKB 3TG1A 4CVAA 4D55A 1ERKA 2HZ4A 1UVRA 3P9JA 4A4LA 2JFMA 3MN3A 1UV5A 4AX8A 5CEQA 2VGOA 5H2UA 3LFSA 4FIFA 4J53A 4X21A 2O3PA 5GZ9A 2O64A 3LFCA 2PZPA 3GQLA 4DBNA 5D12A 1PMUA 5I4NA 5IUIA 1QPCA 3LCKA 1H27A 4ACCA 3QRKA 3QLFA 4XBRA 4YZDA 3TACA 3SG8A 4OAVB 5CLPA 4DYMA 1PXIA 3AGMA 3BHYA 2W17A 5BQ0A 3MTLA 1OIYA 3Q52A 1U54A 3HUBA 2ZMCA 3EIDA 3R22A 4MWHA 4WOVA 3UO5A 4DFLA 4X2NA 1U46A 4AOJA 3KXXA 4S32A 5KCVA 4CTBA 4DEIA 3RGFA 3DXNA 2ITWA 3UO6A 1WBWA 2UZVA 2PUUA 3JVSA 3HMPA 3NIEA 3QQJA 4MYGA 2Y4IB 2PY3A 2QURA 4O83A 3WZEA 4DINA 4QTCA 4EHGA 1BL6A 3ORNA 2A19B 3M11A 5D41A 4LGDA 3RCDA 5JQ8A 2WXVA 3NIZA 3PVBA 5TO8A 4TYHA 2V62A 1FBNA 5AR3A 5GZAA 2VX0A 1BI7A 4ZMEA 1ZLTA 2VGPA 5KBQA 4IZ5A 3WARA 3DDQA 2GS6A 3JY0A 1OKZA 2BROA 3II5A 4R78A 4QTAA 5EI8A 2PPQA 4CFMA 4E6CA 4FBXA 4F7JA 3PPZA 3E64A 2XIRA 2W5AA 4FKUA 4MKCA 4IC7A 3MGYA 3T8OA 4LOPA 3K54A 4PY1A 1VYWA 4XP3A 4I0RA 4E73A 3F3TA 3PFQA 4FMQA 4PV0A 5BVNA 2C5OA 3LM5A 4AN2A 4GKIA 3OZ6A 4JIAA 3FKNA 3WF9A 2VWBA 4DTAA 2ETMA 1YI3A 3GU8A 4L53A 3ORLA 3O8TA 3QUDA 3QYWA 4ZMFA 1UU7A 3HRFA 3KK8A 2V7AA 2VNYA 5HU9A 1Q8WA 5JFWA 2PU8A 2ITTA 3PPKA 3DLZA 1ZWSA 3MTFA 3LCSA 1VJYA 1STCE 2O63A 1P5EA 3MB6A 1YWRA 3ZO4A 1YXVA 1K2PA 4FKWA 3ORZA 4UX9A 2YAKA 4C4GA 4EL9A 4UXQA 3R9RA 3VBTA 3BQRA 5FEDA 2XK3A 4FTAA 4H36A 5HCYA 5CEIA 3KMWA 3ZFXA 5J9LA 2OFUA 3MVLA 5EM6A 2ZV8A 5HD7A 3P86A 1CM8A 3G9LX 3MFRA 5T68A 2VTIA 3S3IA 4CMTA 4E5BA 5BVOA 4Q9SA 4OT6A 4YNOA 4MTAA 4QQ5A 1PMNA 3PIXA 4U80A 4L43A 1ZY4A 3RM7A 3KRJA 2BILB 2F7EE 4XBUA 3QFVA 3QL8A 1WBVA 4H1JA 1PF8A 3K5VA 1M2QA 3G51A 4X2FA 4RJ4A 1B39A 5DEWA 4CQEA 1J1BA 2BMCA 4HCTA 4D5HA 2BRMA 5CEKA 4EQUA 4USEA 3PA3A 5BPYA 5M4IA 4I0TA 4N6ZA 1H07A 4R5YA 4FKLA 4YURA 4EOJA 5HTIA 3E93A 4FV7A 4FKIA 5A3XA 3VULA 4BKZA 5HTBA 3D14A 2Y7JA 4YHJA 3RPRA 4RJ7A 4RWLA 2XP2A 1NVRA 4H1MA 1VYZA 3QRIA 4EH4A 1CMKE 5IMXA 3LXKA 4JAIA 3DBCA 3PVUA 3KK9A 2XCKA 3BU5A 3FL4A 4NM5A 1JKSA 4RJ3A 4MEDA 4P5ZA 5K0KA 4XRJA 2OJGA 3O0GA 4O2PA 4ZOGA 4CZUA 1SVEA 5ACKA 5A4QA 5CX9A 4FG8A 4FEQA 3ZZEA 2YWVA 2W4KA 3FLQA 1SNXA 5J5TA 2WTKB 2R5TA 4BBMA 4MBJA 4EHVA 4EORA 1R78A 4HVIA 5LMKC 4FKGA 4NK9A 5HLWA 3E8DA 4E5AX 1LPUA 5HBJA 4D9UA 2WTVA 3AXWA 4QMUA 3GCVA 5CT0A 5FBNC 3RHKA 3IGOA 1J7LA 4IM3A 3QTRA 4QMLA 4CFNA 4GYIA 5CVGA 2VX3A 3DZQA 1DI8A 3LW0A 3BEAA 5HG5A 4U97A 4XOZA 3DB6A 3KF7A 3PE1A 3U9CA 4HYSA 2C5XA 4AT4A 5E8YA 4OTWA 3OROA 1OKVA 3ZSGA 1SVGA 4GVJA 3EQPA 3HVCA 2VWWA 1B38A 1ZAOA 2WQNA 4FV9A 2FB8A 5EW9A 5TOZA 4QYEA 3U9NA 3ZOSA 4CXAA 4BKYA 4CKIA 1X8BA 4FV2A 4GT3A 4HYIA 3O2MA 2PWLA 5DT4A 2Q0NA 4RX7A 3RAWA 3NX8A 3FJQE 5LVOA 4QP4A 4EKKA 3H9OA 5AV3A 3TIZA 3F66A 4FT7A 2EU9A 4YJTA 5T3QA 1YOLA 3EFKA 2XEZA 2RIOA 4FTQA 4B99A 3QF9A 4BBEA 2CCIA 1Q99A 4GG5A 4O0TA 3FYJX 3QALE 4JVGA 4X3FC 5DR6A 4LG4A 4PL5A 3PXZA 3QKMA 4K1BA 4ZZMA 3TDVA 4OR5A 3H9RA 5E8ZA 4E6DA 1U5QA 5DA3A 3I5NA 5DR9A 3RKBA 2C3KA 4G9CA 4HPTE 4AXAA 1XR1A 4NW6A 2OF2A 2OJFE 4D4SA 3D5UA 2UW9A 4WG5A 2QODA 5FRIA 4IJPA 3CXWA 2WAJA 4DGLC 4G31A 4F9CA 5DH3A 2CKPA 2ERZE 3OOMA 4O27B 3VBYA 1M7QA 1SYKA 4FVQA 3U55A 1YKRA 3LJ1A 4K77A 3SX9A 4IB3A 3HV7A 5C8KA 2E9OA 4DCAA 3Q2MA 3KN6A 3H0YA 4CTCA 4IDVA 4M69B 1SM2A 4BZDA 3R01A 3ITZA 3MIYA 4JRVA 3U6JA 4LQMA 5KX8A 3LQ3A 4IE9A 2OKRA 2XIXA 4F6SA 3U8WA 2GNGA 5LJJA 3BPRA 2BR1A 4TN6A 4PDYA 4AE9A 3I1AA 3NNWA 4EOPA 5HE2A 2R4BA 2JBPA 2WTDA 2WELA 5KO1A 2HZNA 4Y95A 1UWHA 5BVWA 4BFMA 4JBOA 5E4HA 3UNJA 1UKIA 3FQHA 2UVXA 2JDVA 2XJ0A 4LFIA 3G0EA 4E6QA 3BV3A 1ZZ2A 4HW7A 1OECA 3F3WA 3ZC6A 3WE4A 4JX7A 4I3ZA 4Y46A 3ZS5A 4NJDA 4EWQA 1PKDA 4BCHA 4D1XA 5K4IA 2H8HA 1U4DA 2RFDA 3B2WA 4YJPA 5GIPE 4TPTA 4EC8A 3NAXA 3QQKA 4DGNA 4G2FA 5HTCA 4TYEA 3LAUA 4FV1A 3JUHA 1XH7A 2ZV2A 2UZWE 3O7LD 4APPA 3ZCLA 4FA2A 5I9YA 3DGKA 4MK0A 3KVWA 4B8LA 4AGCA 5M4UA 3S4QA 4FL3A 5FDPA 2WQMA 4JQ8A 5CVFA 4W8EA 4Q5HA 3MH3A 3RPSA 5BYLA 3HAVA 5EG3A 4U5JA 3UYSA 2R3HA 4Q2AA 3ANQA 4A9RA 4E6AA 3AC2A 4DN5A 4WBOA 3A7FA 4ENXA 4O7YA 3KCFA 2W96B 3AT4A 3L8SA 1JBPE 5CYIA 1FVVA 2YDIA 2R3KA 5C01A 1H28A 4GW8A 1PMVA 4ANQA 3S00A 5J1VA 4ORKA 4FIJA 5DEYA 4PNKA 3WIKA 4XS2A 3R8PA 3GCUA 2B9IA 2W1HA 2OG8A 2J51A 4DH5A 4JNWA 4BDIA 2IVVA 3W2OA 1S9IA 2BFXA 4ENYA 4CLJA 4FTNA 3MB7A 3ZO2A 1WCCA 2XUUA 4Y8DA 5DE2A 3ZONA 4CRLA 4DF3A 4U0IA 5AJQA 5CU6A 3QA0A 4BTMA 2VV9A 3IOKA 4MF0A 5LMAA 3CJFA 3EN7A 3OY3A 3Q9ZA 4FKVA 4D2SA 4GL9A 3O17A 3C4WA 3NUNA 4V0GB 2X7FA 4FEUA 3ZUTA 3QC9A 4RA5A 4KUJA 4CKRA 2IZSA 2ZMDA 4U3ZA 4Y72A 3TV7A 2FUMA 4D0WA 1OKWA 4XJ0A 1PXKA 3V5QA 3UG2A 4FSQA 2CGXA 3QTZA 4L8MA 3NS9A 2XVDA 3MJ1A 4F9YA 4ZLYA 4O7TA 4FIHA 4JQ7A 4QPSA 4E20A 4FKTA 4GG7A 5K5XA 1H24A 3G0FA 1G8AA 3EZVA 3ZRMA 4JL9A 4IX5A 5KHWA 2HWPA 4XG9A 4GIIA 4R8QA 2Z60A 4IJ9A 3K5UA 3KN5A 2RL5A 5B0XA 3GCSA 2X4ZA 3PJ8A 4BC6A 5HVKA 2F2CB 4EOSA 4EJ7A 4S31A 3DK7A 1G5SA 1PXJA 2XIKA 3SDJA 4BWKA 4WRGA 1JSTA 1GZNA 3BE9A 3ODZX 3C4ZA 4P2KA 3FEGA 3ID6C 5LWMA 4ZTHA 5DG5A 2ZV7A 2UZBA 3R30A 4FIEA 1CSNA 5AR4A 5TF9A 3R7YA 4D2RA 3R83A 4RZWA 2E9NA 4JDJA 2PTKA 4MBIA 3DNEA 3SRVB 2R3RA 5KE0A 5DMZA 3SVVA 2GDOA 1P4OA 2QLQA 2R3OA 2CJMA 3B8QA 3EQGA 3CPCA 3GVUA 3MVMA 4AP7A 4E26A 1O6YA 2WIHA 3ROYA 4HVDA 3SXRA 4QMPA 3T9TA 5FM3A 2W06A 3FXWA 4LRKA 4TKSA 4ZSEA 2QOIA 2YCFA 5AAEA 1Q8TA 5CU0A 5JZJA 4KSPA 5M56A 2UVYA 3DQWA 3PWYA 2UZLA 3PVGA 5EHOA 3DAKA 4ALWA 3QX4A 4C4EA 4NFMA 5HE1A 1OL7A 4CFFA 1R0EA 4QMXA 4UWYA 4DGGA 3NUXA 1PY5A 4MD8E 3HAMA 1BYGA 3TUBA 4BVUA 4G6OA 2B1PA 1QL6A 3DNDA 4IM2A 5EM8A 5HCXA 2R3JA 1Q24A 1QCFA 4X3FB 3ZM4A 3ZU7A 2WU7A 5LMBA 2QOFA 4PP9A 3TI1A 3D9VA 4DH3A 5B2MA 1HCKA 3HDMA 1CKJA 3ETAA 2VTLA 3P5KA 4YJVA 2QOOA 5DLSA 5FTOA 2OZAA 2BALA 3FC2A 4AA5A 3L8VA 3NRMA 1Q41A 4M84A 3W2QA 4W4VA 3TV4A 4G3FA 3PXYA 1F3MC 1GNGA 2VTMA 4WRSA 2VX1A 2A0CX 4H39A 3N4VA 4FTLA 3ZRKA 2C69A 2OLCA 3RZBA 3HMOA 3FMEA 5CAOA 3DPKA 2WOUA 3D94A 2PVYA 4BF2A 3MSSA 2W1FA 4G3DA 4CMOA 2X1NA 3R28A 2DWBA 5EHLA 5FQDC 3T3UA 4DHFA 4PTGA 3D5WA 3FZOA 3QTSA 3V6RA 4F6WA 4ZAUA 1YOMA 3OWPA 2OO8X 3LKMA 3BHHA 4CD0A 3THBA 2UW3A 3NVKI 5IUHA 3HECA 3KXHA 5IDPA 5CF8A 4GJ2A 4AU8A 5K5NA 2WMVA 2W1DA 4NH1A 1TQPA 3E7VA 2PSQA 2Z8CA 3FLNC 2ITUA 5IMEA 1P4FA 2QHNA 5CI6A 5IA5A 3C0IA 2O8YA 4U44A 4C33A 4G6NA 4U41A 4BCKA 2QOHA 2B55A 2WMSA 4BWXA 2PZIA 4RWIA 2QOQA 4IQ6A 4ASEA 3PLAE 4FZ6A 4GT5A 4YGAA 3UIMA 5E8SA 4PMSA 5AP0A 4J52A 4FK6A 5GJGA 4S30A 3UG1A 1PRYA 3SHEA 1YI6A 4HOKA 2C6LA 2F7ZE 3DKOA 1J7IA 5L3AA 1OIQA 2WEVA 4DT9A 2NPQA 1R3CA 4ACDA 3EFLA 3KC3A 3VBVA 3FC1X 1OZ1A 4RIXB 4M69A 4ZJVA 3SW4A 2CGWA 1YHSA 2XYNA 5A4LA 2W1ZA 4KIOA 4FYNA 1Z5MA 3FPQA 4TWPA 5GINE 5HBHA 1A9UA 2WMUA 3QLGA 4I5HA 1HCLA 2JKQA 2Y6OA 4FGBA 4PQNA 4WO5A 5CVHA 3FKOA 1PXNA 3QQUA 2YIRA 4J71A 3OUNB 3ZXZA 3AT2A 3KCKA 5CQUA 4LI5A 4M68A 3Q53A 1ATPE 4EEVA 4PNIA 3TTJA 1FMOE 4RIYB 4F7SA 3RINA 4D9TA 3DFAA 3EH9A 3NEWA 4PL4A 2R3PA 4Y85A 1FOTA 2R0UA 4HYUA 3BYOA 4RIWA 5HE3A 2V5QA 3VO3A 3PPJA 5F9EA 3KKVA 4V05A 3KF4A 3KULA 5DFPA 5GJDA 5CSWA 4G3CA 3RWPA 3W10A 2QQ7A 2YM8A 3W8QA 1KOBA 2IO6A 3OBJA 5CSHA 5C4KA 3FAAA 3CY3A 3U51A 1W8CA 4QP6A 4WNMA 4C4FA 3QX2A 3DTCA 2YACA 2BRGA 3BI6A 4IWDA 4L01A 4O1PA 4E4LA 2Y6MA 2AUHA 2CNVA 2XNBA 3QTXA 3RK9A 3V5JA 4PP7A 2OH4A 2CGUA 2Z7RA 5JGAA 2ITVA 4Y5HA 4O6EA 1NA7A 3E3PA 4E3CA 4OW8A 3NNXA 1XJDA 4AN3A 4F7NA 3DOGA 2B9FA 3LZBA 5AIRA 3P78A 5AV1A 1UWJA 3VC4A 1IA9A 1A06A 2UW0A 5ANKA 5IUGA 4GKHA 2XK6A 4EZ3A 3DKFA 4BDKA 4CKJA 2BUJA 2YLEA 4GUEA 4PRJA 3VUTA 2ZDUA 5D7VA 3TKUA 3F9NA 4FTJA 2PMOX 4S34A 3RPYA 4BDEA 2KULA 4BCIA 1P2AA 3MIAA 3C5IA 5IQGA 2XKFA 2WMAA 4PMTA 5H8BA 1Q4LA 2ZM4A 2PUNA 3GGFA 4YR8A 5JQ5A 2BTRA 3A7JA 5C1QB 5C26A 3DKCA 1PYXA 5AIKA 2W4OA 4IANA 1FQ1B 3H10A 4EOOA 3UVQA 1F5QA 1IASA 4QYYA 4GEOA 4F64A 3GEQA 4W4XA 3S95A 4UY9A 2JC6A 2QONA 3T9IA 3V5LA 3GUBA 3HL7A 2ONLA 4MXXA 5AV2A 1RQQA 2WTIA 2GTNA 3BCEA 4GYGA 5L6WL 2G1TA 2VUWA 4E4NA 3P0MA 1H26A 4I6HA 3OXZA 2P55A 4FUYA 5EM7A 4BWPA 5HG8A 5FEQA 2X2MA 1JSUA 3NUYA 2J0IA 4BDCA 2NP8A 5AP4A 1AQ1A 3Q3BA 2CNQA 3A8XA 4IXPA 3RPOA 4PTCA 2VO7A 3EMGA 4GK2A 3UIBA 2XIZA 4FTKA 5KMOA 4G16A 2FVDA 5FLFA 4J1RA 3FWQA 3MY1A 3VHKA 4II5A 4ACHA 2R9SA 3KMUA 1H08A 4LRJA 3PG1A 4AFJA 3R71A 2X2KA 3GC7A 3UZTA 2VO6A 3COHA 4MBLA 4MCVA 2BDWA 3KRWA 4NIFA 4BCGA 4B6LA 1PW2A 3OW4A 2C30A 5C4LA 3PP0A 5J9YA 2Z7SA 3Q9YA 4RJ5A 4XRLA 3UDBA 4M14A 3P08A 3UOHA 5L2IA 3ALNA 4FNZA 4TWCA 4AN9A 4YLKA 3TTIA 3NUPA 2OXXA 3ZTXA 5JEBA 3V01A 4BIDA 3CGOA 4BGHA 5M57A 2A4LA 5E8WA 3H0ZA 4ZXTA 2JAMA 3ZO1A 4IAKA 2OF4A 3KVXA 3O71A 3AQVA 4S2ZA 3ZLXA 3OBGA 4RX8A 2XB7A 5M06A 1ZOEA 4X0MA 4EH3A 3UC3A 4ANNA 1T45A 4MF1A 4H58A 4QPMA 3SLSA 2WTJA 3EQBA 2CMWA 2XJ2A 3AD4A 4RT7A 4ZSGA 4ANSA 4BICA 4QT1A 4J8MA 4C4JA 3AC5A 2IWIA 3TL8A 4CG8A 3ERKA 3U4WA 2WEIA 4D1SA 4EH5A 3FV8A 1MRUA 3KMMA 4OBQA 3TT0A 2GMXA 3UO4A 3LQ8A 4UWCA 3RBWA 4OTRA 3WF6A 3OCTA 1KUTA 4JLCA 2I0YA 2YM4A 4PUZA 5EW3A 4FSUA 4FKSA 4BCJA 4TWNA 4ID7A 2R2PA 3Q6WA 4DITA 3CEKA 4BRXA 5IA2A 5HNIX 3V5PA 2CSNA 3BLHA 3BBTB 4EOLA 2FSMX 2PVJA 4IC8A 5ITAA 2IZUA 1UNGA 2XJ1A 3RAIA 3OUKA 4PWNA 4U81A 4KABA 5IF1A 3MH2A 5E1EA 3COKA 5EW8A 4E8AA 3G6HA 4XLIA 3PIZA 4G5PA 4U7ZA 2X9FA 4L44A 4LOOA 4EK4A 4JG7A 1GZOA 3VBQA 4RFMA 3R9OA 1YVJA 4FSRA 4FTIA 5CTPA 1DAYA 2DQ7X 5ANIA 3DV3A 1TQIA 4KD1A 1Q8YA 3FZPA 1V1KA 3JXWA 1MP8A 4L3LA 3BX5A 1LEZA 2BDJA 2BIKB 4FSWA 2Y4PA 1M17A 1Q62A 5CALA 3CPBA 5M4CA 4RGJA 5HU3A 4OTQA 2PZ5A 1KV2A 4DEAA 1OIRA 2WMTA 4KSQA 4O7RA 3R1QA 1W0XC 2OFVA 3T3VA 4GFGA 4DH7A 1GOLA 5BMMA 2O2UA 4GMYA 2I1MA 1YDTE 4O7VA 3ZHPC 1GIIA 4L42A 4AZTA 5CXZA 5FP5A 3QBNA 1XO2B 3FY0A 4LMUA 4XUFA 5IG1A 5KBRA 1NVSA 5TR6A 5F94A 3R7EA 3EQDA 2ZJWA 4K6ZA 2JAVA 3F82A 3CSVA 3DLSA 5IA0A 5K3YA 2HENA 4YJUA 5AV4A 5K9IA 4S33A 1T46A 4JI9A 4LOQA 4QYGA 4UZHA 1PXLA 3VS1A 4EQCA 3R1SA 3R73A 1WBOA 4QMTA 2G01A 2JBOA 3HV6A 2QU5A 3UMXA 3ODYX 5BX0A 4FIIA 4UBAA 5LQFA 4A9TA 5BUIA 4R7IA 5M09A 4F1TA 1M2RA 4PL3A 5LOHA 3QZIA 4YZBA 2BIYA 2EXEA 4LL5A 5ANGA 3ZSHA 2YJSA 4RJ6A 3MY0A 3DB8A 4I93A 3OCGA 2XK9A 2YDJA 4RMZA 2VTQA 4FT3A 1YDSE 3GC0A 1XH6A 4FVPA 2JD5A 5E92A 3PVWA 5JT2A 2IVUA 3OCSA 5LVMA 2F57A 5GJFA 4DGMA 4OAUC 4YNEA 3TNPC 4C34A 3E3BX 4C0TA 4RWKA 1UU8A 3BLQA 1OM1A 3SQQA 3HNGA 4AZFA 2PE2A 4AT3A 4CMUA 4O0VA 4AWIA 1FGIA 4YZNA 4CNHA 5L6OA 2WMRA 2B0QA 4M8TA 3ORKA 4TWOA 5E91A 4HZSA 4LM5A 5DGZA 3SG9A 5KMIA 1M14A 3AGLA 5HLNA 3PSBA 3E8NA 2NRYA 4IX4A 2C6MA 2EVAA 3LFEA 1PYEA 2UV2A 3O50A 3EKKA 4J97A 3ORIA 4EOQA 1B6CB 3V8SA 4L45A 5CWZA 3KXGA 1H0VA 3FMKA 4G17A 3BRBA 4DG3E 2LGCA 1Z9XA 3S1HA 3P23A 3PSCA 4BCPA 3Q32A 2FO0A 1PXOA 2RF9A 2WU6A 4ONAA 2VTRA 3E62A 3K3JA 3H3CA 3NR9A 4FX3A 4TYGA 4CSVA 4E93A 2JIUA 3MWUA 1Y57A 3NSZA 5K4JA 4GU6A 4FKRA 3D5VA 3F3VA 4EONA 1YXTA 1S9JA 2HY81 3FYKX 2FSTX 4C3FA 3JY9A 1RW8A 3KQ7A 4QOXA 1CKIA 3D15A 4RC4A 5A46A 1R0PA 1XQZA 3W18A 4F7LA 4RBLA 4I0SA 3EN9A 3QTUA 5T6KA 3R7UA 5A6NA 2PUIA 3R2YA 3QXOA 4KINA 3FLWA 2FA2A 2XNOA 4MNEB 3IQ7A 4KKHA 5FP6A 3H9FA 1ZOHA 1WMKA 3I7BA 5EI6A 3LMHA 3EQCA 1WBSA 2REIA 4C7TA 5A4TA 4UEUA 4FODA 3VS6A 5IPJA 2VTOA 3BELA 5IZFA 4F6UA 4D2VA 2JFLA 5K0XA 2WPAA 4MD7E 1YDRE 5CEOA 1YWNA 3FZ1A 4ZS0A 1KSWA 3D2IA 2ETKA 3QWKA 5ETFA 2QO9A 4CT2A 4ZY4A 2H96A 4NL0A 2B9HA 3E63A 5EYMA 4IVBA 4DFXE 1G8SA 2XBJA 3TKHA 3OY1A 2RG5A 1M2PA 2HXLA 4ITHA 3VBWA 2VO3A 3ZFMA 4JDHA 3A7GA 3DBQA 1PJKA 4JBQA 3LM0A 4OBPA 3E5AA 4JIKA 2J6MA 2X81A 4O1OA 4A06A 5EK7A 2ITYA 5LVLA 3RK5A 2PE0A 3DJ6A 5HX8A 2ONLC 2WB8A 4FV8A 4QD6A 1Y8GA 3OEFX 4QP8A 5F20A 4CFUA 1UKHA 1MRVA 3O23A 2YM6A 4FT9A 4M67A 5FG8A 4YMJA 3VS2A 5EI2A 3NLBA 2VTSA 3PY0A 3QKKA 2YZAA 5J8IA 4YTCA 4ZSAA 4JRNA 5HG7A 3N4UA 2G2IA 3U54A 2QR8A 4LL0A 3PJ1A 4RX9A 2UZEA 4UMRA 5KMLA 4OTGA 2W7XA 2JIVA 4QQCA 3RHXA 1W84A 2JDRA 2W1CA 3D83A 3G33A 4IB1A 3LXNA 4ANLA 4ZEGA 4EI4A 4I5PA 4FR4A 5EYDA 3GFWA 3OT3A 4YSMA 2I0HA 2YFXA 3KRRA 4RRVA 3CKWA 4NTSA 4HVSA 2VAGA 1ZXEA 2OJIA 4L3PA 4TT7A 5ETCA 4RVKA 5GIOE 5I9UA 5IEVA 4WNPA 2GFCA 3IW6A 3MA6A 3KREA 2WOTA 3BEGA 4PDOA 5AAFA 4WG4A 4CZTA 3IONA 4B9DA 2I6LA 4E1ZA 4F1OA 2A2AA 4FG7A 3BBWA 3L9MA 2OWBA 4CYJA 5I9ZA 5CT7A 4HNIA 5H9BA 2WZJA 4O86A 1ZYJA 2X2LA 4KIKA 5IQCA 1XH4A 2BPMA 4CZYB 2W1GA 3PZEA 3Q9WA 4KRDA 4DH1A 3ORTA 4IWPA 3VF8A 3R2BA 4CFVA 1H1QA 2X6DA 4BI1A 2OU7A 2XNNA 3HV4A 4XLVA 5HKMA 4DFZE 3VBXA 5JN2A 3L1SA 3UVRA 5KMJA 2VTNA 3H30A 1YWVA 3IOPA 2ZB0A 4PPAA 1H4LA 3I6WA 5DBXA 2WQEA 4BBFA 2ZAZA 3OF0A 1ZRZA 2XRUA 3QD2B 4Z7GA 4F65A 3RTPA 5FD2A 3TZMA 4MXAA 4A9YA 4RPVA 3ACJA 2FSOX 3KRXA 4JS8A 4KIPA 5DOSA 2J7TA 3MPAA 4BTJA 1APME 2ZYBA 2PYWA 4WNOA 4YBKA 4YC6A 4ANOA 3OFMA 5IQHA 4BYJA 5EKNA 2YCQA 3PTGA 2Q83A 2W05A 1L8TA 5JZNA 4NCTA 3EWHA 4L3JA 2OH0E 4JX3A 3EN6A 4G9RA 1OB3A 2ITOA 4PDSA 5AA9A 1KE9A 3RZFA 4IWQA 4XG3A 3NW7A 4KNBA 4TXCA 5I3RA 3F2AA 5B7VA 3RNIA 5AAGA 2I0VA 3P4KA 4D5KA 3FLSA 4AUAA 2BTSA 2XNEA 4MNFA 2HYYA 3NAYA 3WILA 1KV1A 3ZLWA 4BGQA 3LFDA 4QMSA 4YO4A 3AC4A 3CIKA 4I92A 4NM0A 4XV2A 2P2IA 1OUYA 2IVSA 2VTHA 4GT4A 3ZUUA 3P1AA 4ASDA 5JSMA 5I3OA 5JRQA 5KMKA 3FI8A 3VS5A 3R9NA 2C68A 4BR3A 3C0HA 1WAKA 2FSLX 5CF4A 5LXMA 3PJ3A 4OTDA 3OG7A 5AP7A 1YHVA 2XM9A 3SV0A 4CV9A 3V5WA 4FEWA 1ZOGA 2DUVA 4NKAA 2E9PA 5DNRA 2HELA 2VN9A 2VZ6A 4DTBA 1PXMA 1YI4A 2BCJA 3FY2A 3IK3A 4QP7A 2XRWA 2VD5A 2B4SB 2VRXA 3DCVA 4XHKB 3IO7A 3DA6A 2GQGA 3V5TA 5BVFA 2YABA 2XK8A 4ZK5A 3RI1A 4KKGA 3UYTA 4R1VA 1XWSA 3FDNA 3PXKA 4L68A 2P4IA 3HA8A 4FICA 4ITIA 4QP2A 2YEXA 2XZSA 4YLLA 4UMQA 5EYKA 3K3IA 4ZTRA 4TY1A 3DJ7A 3SKCA 3OCBA 4O7ZA 4KA3A 2PE1A 3UNZA 2PVRA 4NYEA 3F3UA 1OPKA 1WVXA 4IZYA 4JDIA 4KKEA 3BV2A 5M08A 4E4XA 3A2CA 3TZ7A 2YIXA 2QOBA 4EH6A 1Q8UA 4R7BA 3GXLA 5JFXA 2OXDA 4IH8A 3BYMA 1REJA 3DS6A 4FTMA 3EQIA 3CC6A 3FBVA 3BYVA 4C02A 1TKIA 4X3JA 2Z2WA 1BL7A 4O7LA 4C3PA 4XOYA 4XCUA 4XEYA 2GPHA 4HVGA 4RVTA 2G2HA 3ZEWA 5CAQA 5IH4A 2W9ZB 3O8PA 5H8GA 3HRBA 1JWHA 5ANJA 5AP5A 4A4OA 1Y8YA 5KKRC 2XK4A 3C1XA 5HVJA 2XNPA 4BN1A 5A14A 3UQCA 4U79A 4EBWA 1OUKA 1XBBA 2JKMA 2BZKB 4MQ1A 5M51A 2YZLA 3Q4CA 4FUXA 2WMQA 2YHVA 4GRBA 5IKWA 3BHUA 3R8LA 2XK7A 4AA0A 4ZJJA 2IW6A 5FUTA 3NPCA 3F88A 4FYOA 4RLKA 5C27A 4BL1A 3AOXA 3LVPA 4AOIA 4CLIA 1KE5A 2UZNA 3E8CA 4G3EA 3PIYA 4K0YA 2OIQA 2WIPA 3DBFA 2CPKE 2GQSA 5M07A 2BZHB 4XG6A 1LUFA 4C61A 4R5SA 3KXMA 4YBJA 3LFNA 3QTIA 3C5UA 5IEYA 2P33A 4DAWA 3W2PA 5DT0A 3ATTA 2PL0A 2R3MA 4X6RA 3TXOA 3I5ZA 4RX5A 5JGDA 5D9HA 4CYIA 1HOWA 2C0OA 2FH9A 3U87A 5HNBA 4DGOA 4ZJIA 2W1IA 3D7TB 4GH2A 4KRCA 2R3GA 4USFA 2XCHA 1WVYA 2A27A 3FMJA 3HUCA 1RE8A 3MPMA 1XH8A 2WHBA 2WGJA 2C5YA 4O2ZA 3NUAA 4UWBA 2X9EA 4JBVA 4UMPA 3NYXA 2JDOA 5IDNA 3QD4A 3FE3A 1VZOA 3UP2A 3A8WA 4O6LA 4L52A 5F4NA 1YXXA 2CCHA 3KGAA 5LARA 3WZUA 2XMYA 3TN8A 3BZ3A 3QZFA 5J5SA 4RIOA 3UPXA 3IDPA 4O7SA 1UU9A 1PKGA 3GB2A 1LEWA 4PDPA 1M52A 2OJJA 5KMMA 3E7OA 4J8NA 3OT8A 3RWQA 4BIBA 4EOMA 5E8TA 1YRPA 1JKTA 3LFQA 3NW5A 3POZA 2C4GA 4FG9A 3ZO3A 4IX6A 5KUPA 4I23A 2YDKA 3PP1A 5E8VA 3QZHA 3Q5ZA 1TVOA 1BMKA 2VWVA 2XIYA 4DFUA 5CF5A 2OIDA 2EXCX 1REKA 3HMMA 4HNFA 3LFBA 3IDBA 4EH2A 3MA3A 4C3RA 3WYYA 3UQGA 4BY9E 4WNKA 2WNTA 3HRCA 4MD9E 3CR0A 4BDAA 2W1EA 2HK5A 4GFOA 1OL2A 3C13A 4ZTLA 4EBVA 4H3QA 4J96A 1R1WA 3TNWA 5DRBA 2J5EA 5CNNA 3HKOA 1LR4A 5EQEA 2EUFB 4KWPA 4QMYA 1GIJA 4YTIA 4FV5A 4FZ7A 4IAZA 3W1FA 3EZRA 5IQFA 3ZSIA 2W0JA 4NU1A 3CD3A 4IVDA 1BUHA 5DR2A 5TE0A 4B0GA 3ORMA 3M2WA 1U54B 4W9XA 3SD0A 3HP5A 4D1ZA 1Q5KA 2GHLA 3O7LB 3TJCA 4JQEA 4X2GA 3PJ2A 3PXRA 1ND4A 5HOAA 3N9XA 3PDTA 2YIYA 1I09A 5AMNA 2F7XE 1URWA 4JR7A 4LV8A 5C03A 3FSFA 4QQTA 5HO8A 4AGWA 3PA5A 5EKOA 3AC1A 2ZDTA 3UODA 4IZAA 4IM0A 3TJDA 4O38A 4F09A 5HIDA 4ZSJA 5IH5A 4EWHA 1Q8ZA 3GC9A 4ANMA 4ZTMA 3KU2A 4Z7HA 3L9NA 2J4ZA 1NT2A 3R8ZA 4TYHB 4QTEA 4AS0A 3F69A 1XBCA 3CE3A 4ZLZA 3QUEA 4RQVA 5J9ZA 2GSFA 4R6VA 5HZNA 2ERKA 4ASXA 3JYAA 4HVHA 5M53A 4EUTA 5HG9A 3QXPA 3IW8A 4FF8A 3VN9A 3LXPA 4PMPA 4BHZA 3RALA 3GQIA 2QHMA 2XEYA 4UYAA 4I4EA 3W55A 2VO0A 4GUBA 5CZIA 2C47A 4M7IA 5GNKA 4FI1A 3FI4A 3KXZA 4TYIA 3TNIA 4XP2A 1IEPA 3COIA 4I5CA 2HW6A 1PHKA 1VEBA 3QRUA 4I20A 1RJBA 4YP8A 3UMWA 2JIIA 4LMNA 4MQ2A 2X8IA 3VWAA 4D58A 4F4PA 5AA8A 2WO6A 2Y4IC 4RJ8A 2CKOA 2RFEA 2XYUA 2BZJA 1H1RA 1FVRA 4L67A 4QNYA 4NCTC 2IG7A 1ZARA 3DQXA 3LCOA 3ZM9A 3LFFA 3WE8A 4EK6A 5DI1A 4OTHA 1WBPA 5J87A 2AC5A 2C6DA 2QC6A 2QLUA 3CLYA 3OP5A 4NSTA 5FEEA 2C1BA 3I6UA 4CCBA 4FGRA 2UW6A 1JOWB 2YERA 3EN4A 4LUEA 3MJ2A 4GS6A 5HI2A 5JKGA 4ZTSA 2G2FA 3ENMA 4FKJA 2VTAA 4BDFA 3GU5A 2ACXA 4RZVA 4C57A 2ZM1A 4O0WA 3I0QA 4BGGA 3C4FA 4WHZA 4PF4A 2WFYA 1IAHA 5CAVA 1CTPE 4V0GA 3OW3A 4C2WA 3C4EA 1KE8A 4YTHA 4UYNA 1GJOA 4B7TA 5EHYA 5L4QA 2GS2A 5I9XA 4Q9ZA 2J50A 3BQCA 4E5WA 3LMIA 3V51A 2ITQA 4XV1A 5HEZA 2UZTA 4AT5A 2BHHA 1RDQE 3GOPA 4DEBA 3AC8A 3NNUA 2ITXA 4IAAA 4AF3A 4BI0A 4XV9A 2RFSA 4IDTA 3B2TA 1WFCA 1PXPA 3AG9A 3FMNA 3UIXA 1GIHA 1H1WA 3VHEA 3F5UA 3GFEA 4IW0A 4FEVA 1YQJA 3VUHA 3DJ5A 4QYHA 3FL5A 5EFQA 1H01A 4FSYA 3WF7A 1UNHA 2UW7A 1KE7A 4MAOA 1OBDA 3HV3A 1Q3DA 2HAKA 3GOKA 4QTBA 3W8LA 2X0GA 3NCZA 4QMVA 3I81A 3CY2A 2G9XA 4FTOA 2YJRA 4IBMA 3BYUA 4WA9A 4BCQA 5AX3A 3VAPA 3OOGA 3DK3A 4CGAA 3FZRA 3SRVA 3QTWA 4BDGA 1H1PA 3OMVA 3FMDA 4J99A 1Y6AA 5DRDA 3G9NA 3VS3A 1DAWA 2HZ0A 1H1SA 3EB0A 3FQSA 4C35A 4RFYA 4XP0A 5A4CA 1UA2A 4FV6A 4DEDA 2IJMA 3CS9A 3LLTA 4FOBA 5BUEA 2NRUA 3R21A 3RAHA 4QNAA 2C6KA 5J7BA 3HZTA 2J0KA 3VW8A 2XKCA 3C51A 4ACGA 5AUZA 1OITA 4L00A 3ATSA 5HO6A 3ACKA 2C5VA 3AMAA 1BLXA 3VUIA 2ZB1A 3MVHA 4NKSA 1OL6A 2F49A 3ANRA 4LGGA 5CENA 5L8KA 5H8EA 5FXQA 4ZTQA 3EL8A 3WZKA 4ZLOA 2QR7A 3IKAA 4ZZOA 2BFYA 4BI2A 3QKLA 4X3FA 4UXLA 3OC1A 3R63A 4F0FA 4F99A 3ZLYA 4CFXA 1XH5A 4OTPA 2I40A 3MDYA 1OPLA 2BDFA 3V8WA 5IQEA 4P90A 1P14A 2R3QA 3SXFA 2VWXA 3A99A 5CI7A 4R7HA 4GK4A 4EYJA 4H05A 1IG1A 5IQAA 4Y5QA 3EL7A 4N6YA 5HIEA 2YLFA 3MFTA 3VS0A 4FSTA 4D28A 4X2JA 4XX9A 4A9UA 4O96A 5BMSA 4IHPA 3PUPA 2YISA 2JLDA 4FZAB 4C59A 5J1WA 3DXPA 3O51A 2BVAA 2Z7QA 3JPVA 4BB4A 4FT0A 4JG8A 3MYGA 2JDSA 4IFGA 2WTKC 1ZYSA 4IWOA 5BNJA 3TCPA 4ZSLA 4GK3A 4W9WA 4I22A 3R9DA 3REPA 1MQ4A 1NVQA 2JEDA 3W2CA 4A4XA 4CQGA 3WZJA 5GZ8A 3C9WA 5IQIA 3GCPA 4NTTA 3ZH8A 4DE4A 4EHEA 3QA8A 2YM7A 4ASZA 5CSPA 3ENHA 5JGBA 1FGKA 4FE2A 4U42A 4ITJA 2OI4X 4HJOA 4U8ZA 3CBLA 5CAPA 3I60A 4GJ3A 3QCSA 4YZCA 3V6SA 4C37A 2C6EA 4RLLA 2H6DA 2CNUA 3FI2A 3W2SA 4MXYA 4AAAA 3UOKA 3KY2A 4HZRA 5ANEA 4EJNA 2J90A 5A6OA 5KHXA 4BCFA 4C38A 2VNWA 2C6OA 2W99B 3PRFA 5AUUA 1JQHA 4I24A 3MBLA 1W7HA 4EOKA 4QMMA 4O7NA 3L9LA 3DFCB 3M42A 3W33A 4C36A 4UMTA 3I0OA 2R7BA 3QD3A 3ZLSA 4YJQA 4F9WA 4ALUA 4TTHB 5DPVA 4V04A 4RIXA 1WBNA 3IS5A 1W83A 5M44A 4EH9A 3F2RA 2R3NA 3D2KA 4MX9A 3HP2A 2VWZA 5I0BA 3UP7A 3TZ9A 2C1AA 5BVDA 5AM7A 4YO6A 3HGKA 2UZOA 5JFVA 4WSYA 4K11A 1JKLA 4BDBA 3DXQA 4FL2A 4RC3A 5AUYA 3QGYA 4GSBA 4RIYA 3VW6A 3LMGA 3PZHA 4C4HA 3KA0A 5AUXA 4IEBA 1K3AA 3OS3A 4LUDA 2KTYA 3LXLA 5HBEA 1CKPA 2HCKA 2PZRA 2CKEA 3BHTA 2QO2A 2JGZA 4OLIA 3U4UA 3R8VA 5HORA 4WIHA 5FGKA 2C5NA 5FWKK 4ZZNA 3SW7A 5FTQA 3Q2JA 2Y8OA 5HHWA 1XHAA 4BZNA 3JR1A 4YJOA 1Q3WA 3R7GA 4FNWA 1YXSA 2X7GA 2V7OA 5HESA 4MHAA 4YC8A 3UJGA 5AX9A 3R9HA 4YC3A 2I7QA 4RG0A 4YPDA 5HNGA 3ULZA 3QAME 4CT1A 3ZRLA 1H25A 3UZRA 1MQBA 3Q9XA 4AFEA 1M7NA 4AW2A 1H0WA 3PE2A 2HOGA 4IVCA 4AZVA 2RSVA 3ULIA 2X39A 3ELJA 2OK1A 4U3YA 3VS7A 5FTGA 4KBKA 1V0BA 3RK7A 2XH5A 3JVRA 3F61A 4BCMA 2IZRA 2WQBA 4FV3A 3Q96A 5J7HA 4Z9LA 4BTFA 5I5ZA 4O82A 3NGAA 4MXCA 2XNMA 3TEIA 4QMQA 3DBEA 4M0YA 1OI9A 3PG3A 3ET7A 4U43A 2Q0BA 3G2FA 3LJ0A 3QCYA 2RGPA 3VS4A 4FV4A 2GHGA
chains in the Genus database with same CATH superfamily
4DEHA 4X2KA 1Q61A 4KBCA 5CSVA 4NJ3A 2RG6A 5C9CA 1JVPP 3ORPA 5F95A 3WYXA 3ZDUA 3VJOA 3UOLA 1ZMUA 4L7FA 4CEGA 4EZ7A 3QC4A 2NO3A 4IFCA 3TDWA 4UN0C 4AA4A 4FKQA 1NY3A 5FXRA 4GFMA 3MFSA 4QTDA 2F2UA 3V8TA 4C58A 3ZFYA 5DHJA 3TYKA 1WZYA 3QWJA 3M1SA 4DLIA 3BU3A 2R0IA 5IISA 5L8JA 4NZWB 3QTQA 3G5DA 4N70A 4IX3A 3FZSA 5AUTA 3KB7A 2QKRA 4CRSA 3GCQA 2OIBA 3CTQA 3BIZA 3VJNA 3N4TA 5DYJA 4NM3A 3W32A 5GHVA 3E92A 2VTPA 4GCJA 4R3CA 2W9FB 4R3PA 4I5MA 5BVEA 2ITZA 4QP3A 3TWJA 2ITPA 3OD6X 3F7ZA 3V3VA 3W2RA 1GZKA 5AP3A 5KMNA 4IVAA 3U6IA 3POOA 3R7VA 3QQHA 4M0ZA 5F1ZA 3S0OA 2GNJA 2WQOA 3F5GA 4F08A 3EHAA 5HIBA 3FHRA 5DT3A 4FSMA 3GI3A 4YJNA 3VUDA 1KOAA 2PVNA 4DG0E 5E1SA 4OT5A 1ZMWA 2GHMA 3VF9A 5AADA 4Q5EA 4DTKA 2E9UA 3TIYA 2PK9A 4O22A 3RCJA 4CV8A 2HIWA 4J95A 4OBOA 4GV1A 2NNWB 3DU8A 3AMBA 2GCDA 3P7AA 4IACA 4AG8A 3IW7A 1OKYA 1NW1A 1YW2A 4L6QA 5ANOA 4WUNA 3NFFB 4DC2A 2VTJA 4Z3VA 2CLXA 3AD6A 4TRLA 2QO7A 3UZPA 2X8EA 4O91A 2B9JA 3CP9A 4WD5A 2O65A 4XNEA 3RVGA 4PX6A 5EH0A 3R8MA 2WD1A 4P7EA 4RA4A 3VNTA 1R39A 2OZAB 2VWYA 3PY1A 4LGHA 4F9AA 1WBTA 3Q4UA 3E88A 1OVEA 4G1WA 3ZBXA 3R0TA 1DI9A 4U6RA 2IZTA 3I4BA 5L2TA 3MVJA 1GAGA 3H4JA 4RQKA 3TM0A 5ACBC 5L2WA 2QOLA 1XMLA 1FVTA 1OL1A 3DK6A 4EHZA 2CN8A 3RMFA 4A9SA 2PVFA 5AP6A 3TUDA 3FI3A 4FTTA 4M12A 2B53A 4G3GA 3OVVA 4P4CA 4ZP5A 4FKPA 4JDKA 3A7IA 3UGCA 3LE6A 4MXOA 1LP4A 4ALVA 4CG9A 2X4FA 4FVRA 3R6XA 3A7HA 4RFZA 4TNDA 4AE6A 3PY3A 4IAFA 4DFBA 2AC3A 2UW5A 2GS7A 4KIQA 3CQEA 4IIRA 2GNLA 3EYGA 3GBZA 4F0GA 2IVTA 3TNQB 1XBAA 2YIQA 3NCGA 3QU0A 3QUPA 4DLJA 4QMWA 5AP2A 4HGLA 4AW5A 3BWJA 2V55A 4FK3A 3L8XA 1UNLA 3R04A 2YM5A 3CGFA 1MRYA 3FUPA 4MWIA 3A61A 5E8UA 5BVKA 4BTKA 1O6LA 3UOJA 2XKDA 3RPVA 3AC3A 2PMIA 4YJRA 3W0MA 2BRBA 3Q4ZA 4AOTA 2PVLA 2WKMA 2X8DA 5AR8A 1YXUA 4H3PA 2IW9A 2G15A 5A4EA 5EQYA 3D7ZA 4YUQA 3MESA 2WTCA 2CN5A 3TKIA 2QG7A 3Q04A 4NWMA 2YAAA 3FZTA 3QQFA 3IDCA 3QHWA 4W8DA 4O0SA 5D7AA 3WF5A 2FGIA 4ERKA 2WMBA 1JAMA 4O7WA 1Y6BA 2BAKA 2V22A 2Y9QA 2DS1A 3CTJA 3BYSA 3FMMA 3DT1A 4BDDA 2C0IA 2CDZA 2JITA 2UUEA 3GU6A 4QMZA 3QHRA 2QOCA 4FTRA 4UB7A 4TL0A 2PZYA 3Q4TA 3QRJA 4ZIMA 5LVNA 3UNKA 4EKLA 4DEEA 1OL5A 4G6LA 1JSVA 4YU2A 1O6KA 2OBJA 2XS0A 2O0UA 4AZWA 4QP1A 5C8NA 5IEXA 3E87A 4DDIA 4EOIA 4RIWB 4WBBB 2ZM3A 4D4RA 5CANA 5EDRA 4D2WA 3KULB 4J7BA 4BDHA 1Z57A 1W82A 5HCZA 4A07A 3EN5A 1E9HA 3RJCA 5BUJA 5AM6A 3GP0A 4PTEA 3AD5A 4BCOA 3R00A 2OJ9A 5D10A 3N51A 3PA4A 5DIAA 3RAKA 5E90A 4AQCA 4ZS4A 3TUCA 4Y73A 5C8MA 3PSDA 3BGPA 4BHNA 2XANA 4LYNA 3ZUVA 3VVHA 1IA8A 4A7CA 4CCUA 3RM6A 4RWJA 3S2PA 3IW4A 3OWKA 2HXQA 1Y91A 2J0MB 3QQLA 4EC9A 5L8LA 2JDTA 4I1ZA 3KEXA 3PWDA 4L9IA 4F0IA 3EQFA 5IH6A 3AKKA 3PRIA 4YZ9A 4FNYA 4EYMA 4C62A 4YLJA 5IQBA 2H9VA 3MS9A 5IQDA 3UQFA 4EH8A 2O5KA 2JKOA 3PXFA 3BWFA 3NVMB 2YA9A 3LFAA 3UPZA 1URCA 4YHTA 1JLUE 3PJCA 3C4XA 3ROCA 5EOBA 2QI8A 3R7OA 4AZEA 5CF6A 5I9VA 2B54A 3NUSA 3C7QA 4HYHA 4M66A 3SOCA 4P5QA 4C2VA 4HCUA 3PLSA 4DH8A 2IW8A 3UVPA 5LCJA 3P7BA 5LWNA 2I0EA 4JG6A 2CKQA 4AW0A 1SZMA 3MY5A 4FZDB 4WKQA 5AR2A 4BZOA 4EK8A 3GNIB 4USDA 4QO9A 1H8FA 3CCNA 3EYHA 4AZSA 3D4QA 2WMWA 4OGRA 2EWAA 2XBAA 4I4FA 3F5PA 2B52A 4FC0A 3CJGA 5CU2A 1J3HA 2GNIA 3IECA 3R1NA 3IPHA 5AWMA 3PYYA 2Z02A 4QMOA 2BRHA 4DFYA 2HWOA 3QYZA 3EFWA 5ANDA 4DFNA 2W5HA 2QVSE 2VTTA 2YCSA 2Y0AA 3OHTA 4FTUA 3KL8A 4O4BB 4R3RA 3NYNA 5HO7A 2GFSA 2C3LA 3OXIA 3F3ZA 4J98A 2JKKA 3PXQA 4KB8A 4DEGA 2YIWA 4IB5A 2QD9A 4L7SA 1ZMVA 2OSCA 1Q97A 4UV0A 1J91A 2C0TA 4KAOA 3VIDA 4E7WA 3MW1A 2PUPA 3UE4A 4O84A 3QCXA 3DZOA 4MNEA 2H34A 2PMNX 2OXYA 4X6QC 5A54A 3HEGA 2BHEA 3Q6UA 5J95A 3MFUA 4FZFB 3LLAA 3EQRA 4IZ7A 4AXDA 1OMWA 4I41A 5EDQA 1SMHA 3UC4A 1ZY5A 3IG7A 2YWPA 4JBPA 1ZYDA 3GU7A 5CAUA 4YJSA 4JR3A 3CQWA 3ORXA 4EH7A 2VU3A 3WOWA 1O9UA 3OTUA 4G34A 2W5BA 4NIFB 3OWLA 3QRTA 4I94A 4O21A 2W4JA 1NXKA 3NYOA 5B2KA 4N57A 5H3QA 2BKKA 2B7AA 4NM7A 1U59A 1DS5A 1ZYCA 2EB3A 4Y83A 3VUGA 3DBDA 2J5FA 3FSKA 4O0YA 3LOKA 4LV5A 5J79A 4XG2A 1BI8A 4D2TA 1ZYLA 4KS7A 3HMIA 3LHJA 2UZUE 1W2CA 4EQMA 2BAQA 2GNFA 5TT7A 4C8BA 4F70A 2C6IA 2YCRA 5CEPA 4GVAA 2Z7LA 4YPSA 4EK3A 4LRMA 3LPBA 2ETRA 3SOAA 4ERWA 1IAJA 4FL1A 1AD5A 2P2HA 4I6BA 1ZZLA 3P79A 5E7RA 3ZXTA 4B8MA 4AGDA 3DKGA 1L3RE 1W98A 3E8EA 5CASA 4DT8A 3R8UA 3KIOC 4RVMA 4EZ5A 2BKZA 3BGQA 4F1MA 2J2IB 5HE0A 5ICPA 3KXNA 5CU3A 2QCSA 1V0PA 2PMLX 4CFWA 1QPJA 2DYLA 4FTCA 3VRZA 5LVPA 4MVFA 4O0RA 2P0CA 3NW6A 3QQGA 4AW1A 1VR2A 3BKBA 3CTHA 4V01A 4D0XA 2BAJA 3DAJA 4JJRA 3D5XA 4E4MA 4L46A 5L2SA 3FMLA 4UZDA 4RC2A 5HX6A 1OIUA 5HQ0A 3B8RA 3SXSA 3DTWA 4BDJA 2ESMA 4ACMA 4R77A 3HX4A 3W0PA 5TKDA 2QKWB 4H3BA 5A9UA 3FPMA 5B2LA 4F9BA 4NW5A 1QPEA 2CHLA 2VWUA 3CKXA 4QQJA 5DN3A 5G1XA 5BYYA 3HA6A 2NYAA 5ETAA 3VUKA 4FEXA 5FXSA 4K9YA 2A98A 2X7OA 4M3QA 1G3NA 4AXFA 4PMMA 2UW4A 3EJ1A 3FLZA 3GT8A 4IAYA 4N4SA 2XKEA 2XNGA 4NT4A 4QRCA 2PHKA 1BKXA 4QPAA 5I9WA 4WG3A 2P3GX 3IGGA 3F7WA 3UDTA 1FPUA 2X6EA 3JS2A 5IU2A 3A4PA 1TQMA 3ZYAA 3MPTA 4PPCA 4TYJA 1E1VA 3DAEA 1J1CA 3U6HA 3NNVA 5L6PA 3V04A 2GTMA 4HGTA 2RFNA 4XH6A 3C0GA 5AV0A 4DG2E 2C6TA 2QG5A 3F6XA 4FSZA 5DWRA 2OZOA 5ETIA 3WZDA 3WI6A 4U9AA 5AUVA 2BZIB 3MH1A 2YM3A 3NZ0A 3NWWA 3BHVA 5G6VA 2OGVA 5CSXA 5KZIA 5JMSA 2OICA 4N0SA 5JK3A 2V0DA 2R7IA 2ZOQA 3DDPA 3LJ2A 2EXMA 4GU9A 4JXFA 3R7IA 3F5XA 3ZMMA 3F2NA 4ANBA 4IAIA 3SA0A 3LCDA 4NUSA 1PMEA 4F63A 1KWPA 4DA5A 4D4VA 5EOLA 4DHZA 4FT5A 4QDVA 3P7CA 3ALOA 4TNBA 5IA1A 2VWIA 1AGWA 2CGVA 3KFAA 4U45A 3ZDIA 3NMUF 3LCTA 1WVWA 5KZ0A 5M55A 2YN8A 4DCEA 3L8PA 2WMXA 4EUUA 5AEPA 5AFVA 4O0XA 5E9EA 4BYIA 4EK5A 4ZTNA 4OTIA 4XMOA 3KRLA 2PVHA 4RVLA 4O81A 2RKUA 2XA4A 4K33A 2J0LA 4ZY6A 1JKKA 2IN6A 3OTVA 4O0UA 3WF8A 4YSJA 3GC8A 3L9PA 5CNOA 4M15A 1BX6A 3UTOA 3K2LA 3I79A 3WBLA 4JT3A 1H00A 3EQHA 3G90X 3BE2A 1K9AA 1DM2A 3C4CA 3DY7A 3QGWA 3R02A 3A60A 3R1YA 3LIJA 4I6QA 2CLQA 3VUMA 4D2PA 4MXZA 1IRKA 2C3JA 2FYSA 5JRSA 4HCVA 1QMZA 2GNHA 5D1JA 4XG8A 4D4YA 2HY0A 5LCKA 5KKRB 1FMKA 5EYCA 2J9MA 5KNJA 3C50A 4W4WA 4QMNA 4NFNA 2R3FA 2R3LA 3D0EA 3EKNA 3HDNA 4AGUA 5E8XA 1KE6A 4FOCA 4K2RA 5CQWA 2EB2A 4OTFA 4Z16A 5AUWA 3MV5A 2LAVA 1A48A 2QNJA 3QZGA 4G5JA 4XG4A 4XG7A 3VQUA 2HW7A 3EOCA 5FBOA 5HGIA 4TZRA 3BLAA 3FHIA 5BYZA 3NDMA 4APCA 3BU6A 1I44A 3TNHA 2QOKA 4K8AA 4BCNA 2WTWA 3O96A 3OXTA 3GU4A 3IW5A 1OBGA 2E9VA 2AYPA 3MI9A 1E1XA 3FXXA 4UMUA 2HZIA 3UIUA 3FQEA 5D11A 2R3IA 1OPJA 5AP1A 1XKKA 3ZBFA 5JFSA 1OGUA 1YOJA 4FSNA 5CS6A 5LMKA 4KS8A 4I21A 5HD4A 3G6GA 3OEZA 3QCQA 2C3IB 3GENA 1FINA 4JAJA 1CDKA 5HVYA 3HV5A 3BL9A 1JPAA 1F0QA 1MUOA 2XM8A 3UBDA 2SRCA 3BLRA 3ZZWA 3RP9A 5CEMA 3AMYA 4YHFA 5AR7A 1JNKA 1XH9A 2XF0A 4BKJA 2PVMA 3EFJA 3Q5IA 4XV3A 2ZV9A 4NEUA 5CU4A 4IB0A 2UW8A 2PVKA 3TZ8A 4M97A 4MH7A 5IA4A 4OUCA 4WUAA 4FIGA 3CQUA 4QP9A 1GZ8A 2A1AB 4TW9A 3AT3A 3A4OX 4C4IA 3VRYA 5L2QA 5HICA 1V0OA 1IR3A 1EH4A 4FKOA 4WSQA 3ZEPA 4AACA 2X0OA 3QD0A 4BJJB 4DBXA 4RSSA 2GQRA 3SGCA 4IMYA 3MH0A 4W4YA 4IADA 4R1YA 3FMHA 4ARKA 4PPBA 1U5RA 4I6FA 3FKLA 2UVZA 2OW3A 2QU6A 2UZDA 2J0JA 5FM2A 5EM5A 4XYFA 3VQHA 3D7TA 4UALA 5CXHA 2BRNA 4Z55A 2R64A 4YTFA 3W16A 2GU8A 4BIEA 3FLYA 3BGZA 5CZHA 3I7CA 2F9GA 3ZC5A 2PULA 3NUUA 3HLLA 3WIGA 5AR5A 5JH6A 3Q60A 4M13A 3G15A 3OWJA 5FDXA 4HPUE 4JOAA 4QYFA 3RNYA 5M4FA 4U40A 5EDPA 1SVHA 2ZVAA 5EQPA 3COMA 3HMNA 1QPDA 4HGSA 1SNUA 4WT6A 1YHWA 2F4JA 5HLPA 2IPXA 3SAYA 2E2BA 4X7QA 5CY3A 4FV0A 4YZMA 1J7UA 1UU3A 5IA3A 3HYHA 5DVRA 3SC1A 4GIHA 3CD8A 4HGEA 3FXZA 3NYVA 2ITNA 4FNXA 4K18A 3TV6A 3LQ5A 4KBAA 1GY3A 4B4LA 3A62A 2YITA 4ZY5A 3O8UA 4KIKB 3TG1A 4CVAA 4D55A 1ERKA 2HZ4A 1UVRA 3P9JA 4A4LA 2JFMA 3MN3A 1UV5A 4AX8A 5CEQA 2VGOA 5H2UA 3LFSA 4FIFA 4J53A 4X21A 2O3PA 5GZ9A 2O64A 3LFCA 2PZPA 3GQLA 4DBNA 5D12A 1PMUA 5I4NA 5IUIA 1QPCA 3LCKA 1H27A 4ACCA 3QRKA 3QLFA 4XBRA 4YZDA 3TACA 3SG8A 4OAVB 5CLPA 4DYMA 1PXIA 3AGMA 3BHYA 2W17A 5BQ0A 3MTLA 1OIYA 3Q52A 1U54A 3HUBA 2ZMCA 3EIDA 3R22A 4MWHA 4WOVA 3UO5A 4DFLA 4X2NA 1U46A 4AOJA 3KXXA 4S32A 5KCVA 4CTBA 4DEIA 2XAOA 3RGFA 3DXNA 2ITWA 3UO6A 1WBWA 2UZVA 2PUUA 3JVSA 3HMPA 3NIEA 3QQJA 4MYGA 2Y4IB 2PY3A 2QURA 3AKJA 4O83A 3WZEA 4DINA 4QTCA 4EHGA 1BL6A 3ORNA 2A19B 3M11A 5D41A 4LGDA 3RCDA 5JQ8A 2WXVA 3NIZA 3PVBA 5TO8A 4TYHA 2V62A 1FBNA 5AR3A 5GZAA 2VX0A 1BI7A 4ZMEA 1ZLTA 2VGPA 5KBQA 4IZ5A 3WARA 3DDQA 2GS6A 3JY0A 1OKZA 2BROA 3II5A 4R78A 4QTAA 5EI8A 2PPQA 4CFMA 4LDTA 1W2FA 4E6CA 4FBXA 4F7JA 3PPZA 3E64A 2XIRA 2W5AA 4FKUA 4MKCA 4IC7A 3MGYA 3T8OA 4LOPA 3K54A 4PY1A 1VYWA 4XP3A 4I0RA 4E73A 3ML1A 3F3TA 3PFQA 4FMQA 4PV0A 5BVNA 2C5OA 3LM5A 4AN2A 4GKIA 3OZ6A 4JIAA 3FKNA 3WF9A 2VWBA 4DTAA 2ETMA 1YI3A 3GU8A 4L53A 3ORLA 3O8TA 3QUDA 3QYWA 4ZMFA 1UU7A 3HRFA 3KK8A 2V7AA 2VNYA 5HU9A 1Q8WA 5JFWA 2PU8A 2ITTA 3PPKA 3DLZA 1ZWSA 3MTFA 3LCSA 1VJYA 1STCE 2O63A 1P5EA 3MB6A 1YWRA 3ZO4A 1YXVA 1K2PA 4FKWA 3ORZA 4UX9A 2YAKA 4C4GA 4EL9A 4UXQA 3R9RA 3VBTA 3BQRA 5FEDA 2XK3A 4FTAA 4H36A 5HCYA 5CEIA 3KMWA 3ZFXA 5J9LA 2OFUA 3MVLA 5EM6A 2ZV8A 5HD7A 3P86A 1CM8A 3G9LX 3MFRA 5T68A 2VTIA 3S3IA 4CMTA 4E5BA 5BVOA 4Q9SA 4OT6A 4YNOA 1OGYA 4MTAA 4O4EA 4QQ5A 1PMNA 3PIXA 2XAMA 4U80A 4L43A 1ZY4A 3RM7A 3KRJA 2BILB 2F7EE 4XBUA 3QFVA 3QL8A 1WBVA 4H1JA 1PF8A 3K5VA 1M2QA 3G51A 4X2FA 4RJ4A 1B39A 5DEWA 4CQEA 1J1BA 2BMCA 4HCTA 4D5HA 2BRMA 5CEKA 4EQUA 4USEA 3PA3A 5BPYA 5M4IA 4I0TA 4N6ZA 1H07A 4R5YA 4FKLA 4YURA 4EOJA 5HTIA 3E93A 4FV7A 4FKIA 5A3XA 3VULA 4BKZA 5HTBA 3D14A 2Y7JA 4YHJA 3RPRA 4RJ7A 4RWLA 2XP2A 1NVRA 4H1MA 1VYZA 3QRIA 4EH4A 1CMKE 5IMXA 3LXKA 4JAIA 3DBCA 3PVUA 3KK9A 2XCKA 3BU5A 3FL4A 4NM5A 1JKSA 4RJ3A 4MEDA 4P5ZA 5K0KA 4XRJA 2OJGA 3O0GA 4O2PA 4ZOGA 4CZUA 1SVEA 5ACKA 5A4QA 5CX9A 4FG8A 4FEQA 3ZZEA 2YWVA 2W4KA 3FLQA 1SNXA 5J5TA 2WTKB 2R5TA 4BBMA 4MBJA 4EHVA 4EORA 1R78A 4HVIA 5LMKC 4FKGA 4NK9A 5HLWA 3E8DA 4E5AX 1LPUA 5HBJA 4D9UA 2WTVA 3AXWA 4QMUA 3GCVA 4MUQA 5CT0A 5FBNC 3RHKA 3IGOA 1J7LA 4IM3A 3QTRA 4QMLA 4CFNA 4GYIA 5CVGA 2VX3A 3DZQA 1DI8A 3LW0A 3BEAA 3W0QA 5HG5A 4U97A 4XOZA 3DB6A 3KF7A 3PE1A 3U9CA 4HYSA 2C5XA 4AT4A 5E8YA 4OTWA 3OROA 1OKVA 3ZSGA 1SVGA 4GVJA 3EQPA 3HVCA 2VWWA 1B38A 1ZAOA 2WQNA 4FV9A 2FB8A 5EW9A 5TOZA 4QYEA 3U9NA 3ZOSA 4CXAA 4BKYA 4CKIA 1X8BA 4FV2A 4GT3A 4HYIA 3O2MA 2PWLA 5DT4A 2Q0NA 4RX7A 3RAWA 3NX8A 3FJQE 5LVOA 4QP4A 4EKKA 3H9OA 5AV3A 3TIZA 3F66A 4FT7A 2EU9A 4YJTA 5T3QA 1YOLA 3EFKA 2XEZA 2RIOA 4FTQA 4B99A 3AKLA 3QF9A 4BBEA 2CCIA 1Q99A 4GG5A 4O0TA 3FYJX 3QALE 4JVGA 4X3FC 5DR6A 4LG4A 4PL5A 3PXZA 3QKMA 4K1BA 4ZZMA 3TDVA 4OR5A 3H9RA 5E8ZA 4E6DA 1U5QA 5DA3A 3I5NA 5DR9A 3RKBA 2C3KA 4G9CA 4HPTE 4AXAA 1XR1A 4NW6A 2OF2A 2OJFE 4D4SA 3D5UA 2UW9A 4WG5A 2QODA 5FRIA 4IJPA 3CXWA 2WAJA 4DGLC 4G31A 4F9CA 5DH3A 2CKPA 2ERZE 3OOMA 4O27B 3VBYA 1M7QA 1SYKA 4FVQA 3U55A 1YKRA 3LJ1A 4K77A 3SX9A 4IB3A 3HV7A 5C8KA 2E9OA 4DCAA 3Q2MA 3KN6A 3H0YA 4CTCA 4IDVA 4M69B 1SM2A 4BZDA 3R01A 3ITZA 3MIYA 4JRVA 3U6JA 4LQMA 5KX8A 3LQ3A 4IE9A 2OKRA 2XIXA 4F6SA 3U8WA 2GNGA 5LJJA 3BPRA 2BR1A 4TN6A 4PDYA 4AE9A 3I1AA 3NNWA 4EOPA 5HE2A 2R4BA 2JBPA 2WTDA 2WELA 5KO1A 2HZNA 4Y95A 1UWHA 5BVWA 4BFMA 4JBOA 5E4HA 3UNJA 1UKIA 3FQHA 2UVXA 2JDVA 2XJ0A 4LFIA 3G0EA 4E6QA 3BV3A 1ZZ2A 4HW7A 1OECA 3F3WA 3ZC6A 3WE4A 4JX7A 4I3ZA 4Y46A 3ZS5A 4NJDA 4EWQA 1PKDA 4BCHA 4D1XA 5K4IA 2H8HA 1U4DA 2RFDA 3B2WA 4YJPA 5GIPE 4TPTA 4EC8A 3NAXA 3QQKA 4DGNA 4G2FA 5HTCA 4TYEA 3LAUA 4FV1A 3JUHA 1XH7A 2ZV2A 2UZWE 3O7LD 4APPA 4AXCA 3ZCLA 4FA2A 5I9YA 3DGKA 4AQKA 4MK0A 3KVWA 4B8LA 4AGCA 5M4UA 3S4QA 4FL3A 5FDPA 2WQMA 4JQ8A 5CVFA 4W8EA 4Q5HA 3MH3A 3RPSA 5BYLA 4O4CA 3HAVA 5EG3A 4DHIB 4U5JA 3UYSA 2R3HA 4Q2AA 3ANQA 4A9RA 4E6AA 3AC2A 4DN5A 4WBOA 3A7FA 4ENXA 4O7YA 3KCFA 2W96B 3AT4A 3L8SA 1JBPE 5CYIA 1FVVA 2YDIA 2R3KA 5C01A 1H28A 4GW8A 1PMVA 4ANQA 3S00A 5J1VA 4ORKA 4FIJA 5DEYA 4PNKA 3WIKA 4XS2A 3R8PA 3GCUA 2B9IA 2W1HA 2OG8A 2J51A 4DH5A 4JNWA 4BDIA 2IVVA 3W2OA 1S9IA 2BFXA 4ENYA 4CLJA 4QEBA 4FTNA 3MB7A 3ZO2A 1WCCA 2XUUA 4Y8DA 5DE2A 3ZONA 4CRLA 4DF3A 4U0IA 5AJQA 5CU6A 3QA0A 4BTMA 2VV9A 3IOKA 4MF0A 5LMAA 3CJFA 3EN7A 3OY3A 3Q9ZA 4FKVA 4D2SA 4GL9A 3O17A 3C4WA 3NUNA 4V0GB 2X7FA 4FEUA 3ZUTA 3QC9A 4RA5A 4KUJA 4CKRA 2IZSA 2ZMDA 4U3ZA 4Y72A 3TV7A 2FUMA 4D0WA 1OKWA 4XJ0A 1PXKA 3V5QA 3UG2A 4FSQA 2CGXA 3QTZA 4L8MA 3NS9A 2XVDA 3MJ1A 4F9YA 4ZLYA 4O7TA 4FIHA 4JQ7A 4QPSA 4E20A 4FKTA 4GG7A 5K5XA 1H24A 3G0FA 1G8AA 3EZVA 3ZRMA 4JL9A 4IX5A 5KHWA 2HWPA 4XG9A 4GIIA 4R8QA 2Z60A 4IJ9A 2X0PA 3K5UA 3KN5A 2RL5A 5B0XA 3GCSA 2X4ZA 3PJ8A 4BC6A 5HVKA 2F2CB 4EOSA 4EJ7A 4S31A 3DK7A 1G5SA 1PXJA 2XIKA 3SDJA 4BWKA 4WRGA 1JSTA 1GZNA 3BE9A 3ODZX 3C4ZA 4P2KA 3FEGA 3ID6C 5LWMA 4ZTHA 5DG5A 2ZV7A 2UZBA 3R30A 4FIEA 1CSNA 5AR4A 5TF9A 3R7YA 4D2RA 3R83A 4RZWA 2E9NA 4JDJA 2PTKA 4MBIA 3DNEA 3SRVB 2R3RA 5KE0A 5DMZA 3SVVA 2GDOA 1P4OA 2QLQA 2R3OA 2CJMA 3B8QA 3EQGA 3CPCA 3GVUA 3MVMA 4AP7A 4E26A 1O6YA 2WIHA 3ROYA 4HVDA 3SXRA 4QMPA 3T9TA 2XALA 5FM3A 2W06A 3FXWA 4LRKA 4TKSA 4ZSEA 2QOIA 2YCFA 5AAEA 1Q8TA 5CU0A 5JZJA 4KSPA 5M56A 2UVYA 3DQWA 3UDSA 3PWYA 2UZLA 3PVGA 5EHOA 3DAKA 4ALWA 3QX4A 4C4EA 4NFMA 5HE1A 1OL7A 4CFFA 1R0EA 4QMXA 4UWYA 4DGGA 3NUXA 1PY5A 1G8KA 4I6LA 4MD8E 4DDGA 3HAMA 1BYGA 3TUBA 4BVUA 4G6OA 2B1PA 1QL6A 3DNDA 4IM2A 5EM8A 5HCXA 2R3JA 1Q24A 1QCFA 4X3FB 3ZM4A 3ZU7A 2WU7A 5LMBA 2QOFA 4PP9A 3TI1A 3D9VA 4DH3A 5B2MA 1HCKA 3HDMA 1CKJA 3ETAA 2VTLA 3P5KA 4YJVA 2QOOA 5DLSA 5FTOA 2OZAA 2BALA 3FC2A 4AA5A 3L8VA 3NRMA 1Q41A 4M84A 3W2QA 4W4VA 3TV4A 4G3FA 3PXYA 1F3MC 1GNGA 2VTMA 4WRSA 2VX1A 2A0CX 4H39A 3N4VA 4FTLA 3W0OA 3ZRKA 2C69A 2OLCA 3RZBA 3HMOA 3FMEA 5CAOA 3DPKA 2WOUA 3D94A 2PVYA 4BF2A 3MSSA 2W1FA 4G3DA 4CMOA 2X1NA 3R28A 2DWBA 5EHLA 5FQDC 3T3UA 4DHFA 4PTGA 3D5WA 3FZOA 3QTSA 3V6RA 4F6WA 4ZAUA 1YOMA 3OWPA 2OO8X 3LKMA 3BHHA 4CD0A 3THBA 2UW3A 3NVKI 5IUHA 3HECA 3KXHA 5IDPA 5CF8A 4GJ2A 4AU8A 5K5NA 2WMVA 2W1DA 4NH1A 1TQPA 3E7VA 2PSQA 2Z8CA 3FLNC 2ITUA 5IMEA 1P4FA 2QHNA 5CI6A 5IA5A 2AQXA 3C0IA 2O8YA 4U44A 4C33A 4G6NA 4U41A