4RJ8A

Egfr kinase (t790m/l858r) with inhibitor compound 8
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
322
structure length
298
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Discovery of Selective and Noncovalent Diaminopyrimidine-Based Inhibitors of Epidermal Growth Factor Receptor Containing the T790M Resistance Mutation.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 298
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rj8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rj8A01
1OIRA 4M97A 4O27B 4IB1A 3KREA 2OZOA 4DINA 1OL2A 2ITOA 1DAWA 1OM1A 2W9ZB 2X7FA 3UNJA 3QU0A 4BCHA 3TT0A 2H9VA 4JOAA 5HHWA 4FEQA 1UV5A 4XOZA 3CD3A 3OVVA 5TKDA 4AZTA 4C57A 4HCTA 4UEUA 2H8HA 4EH9A 3BCEA 4D9UA 2PHKA 3LMHA 3MSSA 4DTBA 4P90A 5EW3A 4ASXA 3ZC6A 4X6RA 2OGVA 2JBPA 1OBDA 4ZK5A 4I0SA 5FP5A 4BHZA 2C1BA 2YA9A 1L3RE 3RBWA 3ZU7A 4RWIA 4GT3A 4UV0A 5EM6A 4UMRA 4EWQA 4NJDA 4M69A 4RA5A 2HK5A 4F9CA 2R5TA 2JFMA 5AP4A 2CLQA 3O23A 4HZRA 4NCTC 4DH5A 5B2MA 2OZAA 4CLJA 2A27A 3N4UA 2XMYA 4IM0A 4HYHA 4R7HA 3ZONA 1CDKA 3RNIA 3L8VA 1PMEA 1OL6A 1ZLTA 3HP5A 3KCFA 4NIFB 5J5TA 3PVWA 4YHFA 3R8UA 2PMNX 3RINA 4LG4A 3DDPA 3SXRA 3QXOA 5AP5A 4UWBA 4FTNA 2QO2A 2V7AA 3L8PA 5DMZA 4XLVA 5CANA 3LFEA 3S4QA 4X3FA 3SG9A 4G9CA 4FEVA 4D0WA 3H4JA 4F1TA 4IVCA 4QMWA 4F08A 2VWYA 4CQGA 3OOGA 4DTAA 4GH2A 4XNEA 3FKNA 1DS5A 2XNNA 3ORLA 3LZBA 3WZDA 2ZYBA 3Q52A 5FXRA 3G33A 5AUUA 4QMTA 3LMIA 2BCJA 4EC9A 3R7OA 4GYIA 4LQMA 4IBMA 3GC9A 1OIYA 4BZNA 3QD0A 2XIRA 5HCXA 4V0GB 1MUOA 2WD1A 2E9OA 4FT9A 2CJMA 5DEWA 3GOKA 3LM5A 1K2PA 1OKZA 1SVHA 4C33A 4FZ6A 5IKWA 4L44A 4C36A 3PXQA 5GZ9A 1NVRA 2YLEA 3RHXA 3II5A 3AOXA 4YR8A 2R3RA 3KFAA 5HCZA 1JSVA 2NP8A 4L3LA 3FYJX 5J7HA 1Q99A 2HCKA 3BV2A 2WKMA 3ZSHA 4MBLA 1ZMUA 1TQPA 3KXGA 4J8MA 3ZLXA 1MQBA 4EH2A 2XK8A 3RPSA 2ZJWA 4W4YA 5IF1A 4XG9A 3U4WA 3ZEWA 4AW5A 2QCSA 3FMKA 3NYVA 1O6KA 2HXQA 2PUIA 4A4OA 4RQVA 5EYCA 4U42A 5HTCA 1SVEA 2OI4X 4DBXA 4RJ3A 4D4YA 4JX7A 2I0VA 2PVFA 4IX5A 4U3YA 5HOAA 2J2IB 2F49A 3RAKA 3NMUF 2WIHA 2IZTA 4KIPA 3TI1A 5I9ZA 4QMQA 4I41A 2BKKA 3QA8A 4GV1A 3LXPA 4N6YA 4N70A 4YJPA 4OAUC 4TKSA 1XKKA 5BQ0A 1IASA 2YIYA 2FSOX 2WU7A 3TDVA 4I1ZA 1ZYSA 5H3QA 2OIDA 3AQVA 4RFZA 2XIZA 1SVGA 1H28A 2ITTA 3LM0A 4JG8A 4KAOA 4PPBA 4ZMEA 1PXLA 3FZTA 2GU8A 2YIXA 3DV3A 3CP9A 3JY9A 4KBAA 2R3PA 4YLKA 2WTCA 5CSVA 5AX9A 2Q0NA 2J0IA 3GB2A 3QTUA 3W33A 4EZ5A 1ZOGA 3MJ2A 4BIDA 5HLWA 4CFNA 4L67A 5F1ZA 4Q2AA 4UMPA 5CAUA 4DG3E 5A46A 4TN6A 3POOA 4U6RA 3ZO3A 2C6TA 3R7UA 3SW4A 5EHLA 4MVFA 3T3VA 4FIJA 2DQ7X 4I3ZA 4BGHA 3SVVA 5IQIA 2X39A 3ZRKA 4GFMA 3WE8A 2P2HA 3COHA 4C2VA 3WF8A 3DXNA 3P9JA 4IB5A 4FSWA 1H07A 3R9NA 4YPSA 3DNDA 4FV8A 5CEQA 4HZSA 3TN8A 2JIVA 4I0TA 1JNKA 4BBEA 4HYUA 2OF4A 2ZMCA 5ETIA 2PZYA 5HE3A 3CGOA 5JEBA 2YJSA 4H3QA 3NRMA 5CTPA 3OCSA 3UC4A 2A4LA 5EH0A 4XG4A 3UIUA 3UOKA 4PNIA 2BAQA 2NRUA 3F69A 3FLYA 3P4KA 4U8ZA 4RX5A 4AOTA 5DR2A 2VTOA 4RZVA 3RWPA 4I4FA 2ERKA 3OCGA 1XBCA 2AC5A 3R9HA 4PMTA 2RG6A 5CU4A 1BI8A 3MVMA 1OVEA 5A3XA 5L2TA 2HAKA 3EYGA 5KNJA 4OTDA 3SC1A 3F82A 1NVQA 3KK9A 4JDHA 5AIKA 1OPLA 3E8EA 5TR6A 3VC4A 3DPKA 2I0YA 2OH0E 3TNWA 2ITYA 2ZV2A 3RZFA 2FA2A 3V5WA 3LCDA 1Y8YA 2YZAA 4FG7A 3IKAA 5C1QB 4FEWA 3WF6A 2OW3A 2W0JA 2CSNA 1URWA 4IAAA 2G1TA 3C4EA 3NCGA 2EU9A 4TY1A 3UVRA 3EQRA 4YO6A 4J97A 5BYYA 4HJOA 2XS0A 5L6PA 5ICPA 4EK6A 3IPHA 3DDQA 4OBQA 2RL5A 4R8QA 4RA4A 5CYIA 2QD9A 4BCJA 4AE6A 5AMNA 3G90X 4O21A 2BAJA 2BR1A 5CQUA 5B2LA 4PF4A 5J7BA 3QF9A 2CPKE 4RC2A 4FG8A 4IANA 1M7NA 1WBPA 4RIYB 4ZP5A 4ITIA 2WEIA 3AT4A 2B9IA 4IWDA 4USFA 4BZDA 2CGVA 3PXFA 3UG2A 4Y72A 1I09A 4B8LA 5HTIA 2PY3A 4W4VA 3FWQA 2WMVA 3VUHA 3C7QA 4NKSA 3HMOA 3R73A 4AT4A 4EH6A 1ZAOA 4XP0A 4YU2A 5L8LA 5FLFA 3SX9A 2Y7JA 2XVDA 4BTFA 3EQCA 5BX0A 4BHNA 3EFLA 4FIGA 4E5AX 2CCIA 2DWBA 3CSVA 3U8WA 4D2SA 4WNOA 4RPVA 3AD6A 3QZIA 4J99A 2WQBA 4QRCA 4AGUA 2EUFB 4XG6A 4R78A 4GSBA 4Z7GA 2FUMA 1F5QA 3BU5A 4O96A 4TNDA 5CEIA 2B7AA 5AX3A 4QP9A 3M11A 1CKIA 2DS1A 1O6LA 3JUHA 4FIEA 3ZLYA 3R7VA 4I6HA 3E63A 3OEZA 4ZIMA 3QRIA 3DAKA 2CN8A 1OUKA 4O38A 1A48A 2BRMA 2XKFA 4O0RA 2WTKB 2LGCA 2V0DA 4QP7A 4X6QC 4DFXE 2QI8A 4DFZE 2X9EA 5E8SA 3TCPA 5DG5A 5HZNA 2CMWA 3AD4A 4IZAA 4C3FA 4FSUA 3ELJA 3FLNC 3Q3BA 3ZUUA 4M12A 5I3RA 4U80A 2PVKA 2OZAB 4G2FA 4GYGA 4ZY4A 5E1EA 5AV2A 5FXSA 2WGJA 4LUEA 1STCE 3KULB 2KULA 1Q3WA 4CTBA 4M8TA 4Y95A 3KXMA 4A07A 2UZWE 3FLQA 4G3EA 3LAUA 1DAYA 4PQNA 4X2GA 3BE9A 3NUSA 4YC6A 4M13A 2BRGA 3D9VA 5EFQA 1ZOHA 3DK7A 1U4DA 4WUAA 5AV1A 1OIQA 5IA3A 1U54A 4ANSA 3KKVA 2WMUA 4WBBB 2JDVA 4DFLA 2OO8X 1XH4A 2OXDA 2PVRA 4X3FB 3RJCA 3ULIA 4C34A 3GNIB 4O84A 5FTGA 5LARA 4GUEA 1Q62A 5AR4A 5GNKA 4FA2A 4B4LA 4R3CA 4GVAA 3NNXA 2C3LA 4RJ8A 2XNMA 1ZZLA 3D83A 3OBGA 3KMWA 4OTRA 3B8QA 4WD5A 4WSQA 3GEQA 2XKEA 5C8MA 5BUJA 3D7TA 2BMCA 4BL1A 3E7OA 4ZSLA 4O86A 5CNNA 3TV7A 2IO6A 3DT1A 2GQRA 4DF3A 5HNBA 2XJ2A 2YFXA 4CVAA 4ACCA 1J3HA 3KEXA 2WTWA 4K8AA 2JKKA 3ERKA 3OWLA 3OZ6A 2YM7A 4NEUA 5CQWA 3R9DA 1GNGA 5HVJA 4D1XA 1MQ4A 3HMNA 4B99A 3ZOSA 3ATSA 5FG8A 5CF4A 3ZUVA 4O0TA 5HKMA 2QU5A 3QGYA 4BICA 4P2KA 4MNEA 3UZPA 5L2SA 2PK9A 5EW9A 5HU9A 3O0GA 4FGRA 3I1AA 3F3WA 3VN9A 2Y0AA 4FUXA 2OU7A 4O6EA 5CAQA 3R22A 4QMZA 2VTIA 3LIJA 4GFOA 4I21A 5EQPA 2R3FA 5LXMA 3VNTA 4MWIA 3NIZA 4FKWA 3OUNB 2PZ5A 2WMXA 2JDRA 5M07A 3S2PA 2IVSA 2V55A 4IZ5A 3ORMA 2QOLA 3VW6A 4DITA 4E5BA 1F3MC 2W4OA 4IWPA 5GHVA 3P0MA 3PIYA 4I20A 4CGAA 4EK5A 3SW7A 3V8WA 3BGPA 2WMSA 1OL5A 1CKJA 1V0PA 1J91A 4FTIA 1YDSE 5IUHA 2VAGA 3DKCA 3GC7A 3C4FA 4GKHA 3EQHA 4W4WA 1ZYLA 2EVAA 4A9YA 4Y83A 1PYXA 2EB3A 3L9LA 3LCKA 5C9CA 4AU8A 4B9DA 4C35A 5GJGA 3GCQA 4BWXA 2IVVA 4EHGA 3ALNA 5EDPA 4F70A 5LMKC 2ZOQA 4FKSA 5D11A 2OXXA 4GU9A 5EYKA 5AWMA 3VS6A 3H10A 3FXWA 4KIKA 5AR8A 1M2QA 3TNQB 4R6VA 1PMVA 4R3RA 4IW0A 5IH6A 5C01A 4FV2A 1FGIA 2UZOA 2YM8A 5CENA 3PFQA 4X7QA 2VX0A 4FKTA 3V8TA 1QPEA 4H1MA 2UW6A 4O7NA 4YJRA 4UMTA 5K5NA 4ASZA 3LFCA 4EOIA 5JQ5A 4LL0A 5D7VA 3UIXA 4GK3A 3VUIA 4A9TA 1QMZA 4FT3A 5M4FA 1Q41A 4ZZOA 3VS4A 4BDFA 1SNXA 2R7IA 2C47A 5KMNA 3O71A 4RIXB 5AR7A 3NAXA 2RSVA 5EKNA 2PU8A 1JVPP 3F5UA 3FPMA 1OKVA 4J8NA 5M09A 3F7ZA 3UJGA 4M0YA 4RBLA 3CXWA 2Z7SA 5C4LA 4U40A 3BGQA 3Q9ZA 2BFXA 3CS9A 4KABA 4F6SA 3QZGA 5IQDA 4TWPA 2P2IA 2X81A 5AM7A 2CNVA 4ASEA 2CNUA 3GU7A 3EHAA 2B9FA 4QTBA 3BYVA 1U46A 5BPYA 4XUFA 4RVLA 3V5PA 3WI6A 4ENXA 3KN6A 4PL3A 3N9XA 5HO8A 4OTQA 5M08A 3EN9A 4YZMA 5HE2A 5CSPA 1GY3A 4PMSA 1Y91A 1PF8A 2XNOA 1XR1A 3AXWA 2RFEA 3MWUA 3MFSA 4LRJA 4EKKA 2UUEA 3TKUA 3U9NA 2O65A 3VO3A 3QQKA 1H27A 1DI8A 4ZJVA 3SA0A 2IZSA 3C4XA 2JFLA 1MRVA 1M52A 3MA6A 4RMZA 5E90A 3JXWA 4RIWA 5LCJA 3ZM9A 4K1BA 1A06A 3DKGA 5A4TA 3I0QA 3ORTA 4L68A 5A54A 3PPZA 2JC6A 3TACA 2XNPA 4EYMA 2E9VA 4C4EA 5I4NA 2VTHA 2QLQA 3CQWA 4Y8DA 4HGSA 5DT0A 4A9SA 4DG0E 3P78A 4XV1A 5DOSA 3F6XA 4RJ5A 3TJCA 1OKYA 3DOGA 3Q9YA 4P5ZA 1BI7A 5B2KA 3NS9A 1ZXEA 4USEA 3MTFA 3W2RA 2ZDUA 2VWXA 5CS6A 4EZ3A 2C0IA 3JVSA 4LRMA 3PTGA 4CEGA 3RK7A 2GNHA 4NFMA 5AUTA 2P3GX 2HW7A 5E8TA 1KUTA 4CZUA 4JL9A 5KBQA 2O5KA 2J90A 5DYJA 5CZHA 5D41A 4FIIA 5M55A 4ALWA 4R3PA 5AV0A 4M68A 2PVNA 4RX8A 4EH3A 3IDCA 4JBQA 3R83A 3LW0A 3COIA 1YXVA 4MAOA 3PLAE 1YWVA 5IZFA 4EHEA 4DA5A 3LQ3A 1OL7A 3WILA 3BV3A 2BHEA 4F9WA 5CAPA 3DJ5A 2R3JA 4XYFA 5JSMA 4UYAA 3PP0A 4E3CA 4IADA 3BX5A 3C50A 3NUXA 2VWZA 4MXCA 4ALVA 2JDOA 5IG1A 1NA7A 3UYSA 5CSXA 4KB8A 3S00A 4NT4A 1UNHA 4EQMA 3DBQA 3V5QA 4R7BA 3C9WA 3OG7A 1AD5A 4FV7A 5HNIX 2HXLA 3CLYA 3TV4A 5IH5A 5IMXA 3W2QA 5KHWA 3OMVA 5IQAA 3UC3A 3OY1A 3H9OA 1OKWA 4NU1A 2AC3A 5ACBC 5LWNA 4KS8A 2VV9A 2VTMA 2OIQA 1RE8A 3GCVA 4F9BA 4G1WA 4CMTA 2BUJA 4ZTLA 4FX3A 5CWZA 3ORXA 4M67A 4O1OA 3ZH8A 2GHMA 4C61A 3QQLA 3VBYA 2JAVA 1XH6A 5HTBA 3NUNA 3IGGA 2W5HA 5EI6A 4BDGA 3QTQA 3VF9A 4CG9A 4U97A 4AOIA 3R71A 3DXQA 4H05A 3BQRA 3VUKA 5L6WL 4E4LA 4ACGA 4DH7A 2WMAA 4FV9A 4HCVA 3AC4A 5BVEA 3R7EA 4AXAA 3DQXA 3DZOA 5BUIA 2VTAA 3ZO2A 2VTJA 4C3RA 4O91A 4E7WA 4UN0C 2WQOA 1QPJA 3DBDA 3PUPA 3Q9WA 4BI2A 3HAVA 5IPJA 1XBBA 4FK3A 3K54A 2YACA 4IIRA 4NK9A 5HU3A 1PKDA 3CIKA 4X0MA 4YLLA 2BPMA 2RIOA 4A7CA 5JQ8A 3LMGA 1SYKA 2QOBA 3C4ZA 4FV5A 5KMMA 3UZTA 3W8QA 3AGLA 4LOQA 3A7IA 3PG1A 2VGOA 2H96A 3Q04A 4QD6A 1PRYA 1PXOA 4PWNA 4ZXTA 4LMNA 4Y85A 4ZY6A 2YAAA 3PJCA 2O2UA 3W16A 4U79A 1G8SA 2X0GA 3NWWA 5CVFA 3UYTA 4CKJA 3D7TB 2YCQA 5KE0A 5I5ZA 4OLIA 4FKOA 4APCA 3EIDA 5IH4A 4WRGA 2GNLA 2J4ZA 1R3CA 3EKNA 3MFUA 3DKFA 4MK0A 5AUVA 4ACDA 4I23A 4LFIA 4ZS4A 4CMUA 4BGGA 5J9YA 4PTGA 4ZSEA 5AUXA 5C8KA 3K5UA 2I40A 2W1GA 2WOUA 4DGOA 4QO9A 3Q5IA 2GPHA 3TZ8A 4MNEB 3RGFA 4AWIA 5LVOA 2G2FA 2RFNA 4D4SA 3Q6WA 2XRUA 4OTIA 3H9RA 2GQSA 2JITA 3ZBFA 3BWFA 3VS3A 2BHHA 1OBGA 4FV3A 4H3BA 1W83A 4FT7A 4IB3A 1ZRZA 4EWHA 2XCKA 2R2PA 3WYXA 4C59A 2B9HA 2UW3A 2I7QA 2SRCA 2ONLC 4DBNA 2VX1A 4L46A 4BDIA 2FGIA 3OT8A 4N6ZA 2HIWA 4DH3A 3C4CA 5DT3A 2E9UA 4N0SA 5HG5A 3TTJA 3V3VA 5AUYA 4BKZA 2UW8A 2XBAA 3FMJA 3AMYA 3UIMA 3NSZA 3QX4A 4W9XA 3W2CA 5J79A 2C1AA 1CM8A 3MY1A 1Q8YA 3SKCA 4C4HA 2C6IA 3EQFA 2HZNA 3HDMA 2QC6A 3G6HA 5K0KA 2Z2WA 3ZHPC 4QQ5A 2F7ZE 3QC4A 1ZZ2A 3WARA 5HORA 4F0GA 2YDJA 3KCKA 4CZTA 5GIOE 4MEDA 3GENA 3IGOA 4TWOA 3SD0A 4MWHA 3HEGA 4ANNA 4WBOA 4ALUA 5F4NA 4ACHA 3DB6A 1NW1A 3VUTA 1GAGA 3DFAA 2PMLX 2W4JA 2YERA 4KIKB 4CFWA 4I6FA 2I6LA 2XJ0A 4XV3A 3W2PA 5L2IA 4K77A 5GJDA 2HW6A 4RIYA 4RX7A 5JFXA 3RZBA 3LPBA 3R2BA 4RVTA 5E8YA 3V5LA 4HVIA 2OJIA 1Y8GA 5BUEA 2WOTA 2GHGA 3O17A 4G16A 3PY1A 3QCQA 4XH6A 5F20A 3FL5A 5A4LA 3HRFA 1Y6AA 5KO1A 3E5AA 3JY0A 4AF3A 4LI5A 5A9UA 2F9GA 3QRKA 4CLIA 4EOOA 4LGDA 5AA8A 5IU2A 3WZEA 3DAEA 1YOLA 4C4GA 4XEYA 5L2QA 5JN2A 3HP2A 2ZM4A 3QALE 3EWHA 4IJ9A 4YTCA 3F88A 4K0YA 4ARKA 4ANOA 4TYHB 2ZV8A 3ZDUA 5HLPA 2FB8A 3KRJA 4OR5A 4BCFA 3MH3A 4DFBA 1RJBA 3Q2JA 4PRJA 4AFEA 4KA3A 1K9AA 2J5FA 5CU2A 1YXUA 4RVMA 4AW0A 3Q4CA 4D5KA 4MXXA 4FNXA 4NTTA 4QP2A 4KKEA 5DA3A 3OY3A 3MPTA 5EYMA 2BRHA 2JAMA 2X6EA 2JKQA 5HX6A 3RPRA 3PDTA 3DTCA 3MN3A 4QPAA 3BBWA 4O82A 3VJNA 4E73A 2BZHB 2DYLA 4GMYA 5IA4A 3LQ5A 4KUJA 1ZY5A 5AFVA 2C6EA 3H0ZA 3FPQA 1PKGA 4JAJA 4IVAA 1OI9A 4IACA 3ZDIA 1HCKA 2W1DA 5ANDA 4MQ1A 2QQ7A 4AA4A 3ZTXA 2Q0BA 3KULA 1FPUA 4BCPA 1CSNA 3KK8A 4YNOA 4ZSGA 2GFCA 4CCUA 4D2VA 4O81A 4RIWB 5ANIA 3MW1A 3VBWA 4EOJA 1B38A 3QTRA 4D58A 4O1PA 3AMBA 3BWJA 3SXFA 2VU3A 4G6OA 4NM7A 3D5WA 4IHPA 4BN1A 3G0FA 3ORPA 5FEDA 3BE2A 2VO6A 4RC4A 5GZ8A 4IAYA 1H0WA 3TIZA 4O0UA 4ENYA 3ZRMA 4ERKA 1Z9XA 4MCVA 4Q5HA 5I0BA 5F9EA 3UGCA 4CKIA 4DGMA 3HAMA 5AP1A 2R9SA 3A4PA 5KKRC 5AEPA 4JRNA 3UQGA 3KVWA 3FY0A 1O6YA 4HNIA 4QMXA 5GIPE 2C6OA 3QC9A 4F63A 4E1ZA 3A7FA 1NVSA 1X8BA 3AMAA 3CKWA 3D15A 2HY81 2W9FB 3QTZA 5HCYA 2QODA 5JZJA 2R3MA 3KRWA 4QTEA 3FSFA 5AR2A 4PTEA 1LR4A 3FZSA 3FQEA 4FOCA 3UNKA 3GFWA 2W96B 4G3DA 3UVQA 4UALA 4TPTA 5H8BA 4O7WA 1M17A 3R8MA 2B4SB 4QMLA 2HWPA 3DK3A 3PZHA 2R3OA 2R3QA 2FSTX 4IWOA 3GGFA 5HESA 2A2AA 5DI1A 3A2CA 2X2KA 1KE7A 2HZ4A 5HI2A 4ANBA 3TNPC 3A7HA 2C5NA 2W5BA 2WTKC 4O2PA 4O7SA 2ETRA 3FY2A 3MV5A 4IZYA 3UZRA 1GOLA 2W4KA 3V6SA 5E1SA 2J0LA 4LYNA 2X4FA 3E8CA 4EONA 2JIIA 2W06A 4K11A 4GJ2A 3QGWA 3VS7A 1W0XC 3O2MA 4RG0A 3HRCA 3L9PA 2BDFA 5LJJA 4CZYB 1P2AA 5KUPA 3FLSA 3ZO4A 2CKPA 2J6MA 1TVOA 4GG7A 5CI6A 4BYJA 3BEGA 4K18A 4NWMA 1R0EA 4EI4A 1OECA 3TZ7A 5KMJA 2GS6A 4NUSA 4ANMA 4AZSA 4BF2A 2G2IA 3UP2A 3D5VA 2B9JA 4L9IA 4XG3A 1OZ1A 1OPKA 5GINE 2OJGA 2VGPA 1REKA 1H1QA 3GU8A 3PVUA 3R04A 5HO7A 4O0XA 3FMDA 2XK3A 1LEWA 3R1NA 3S95A 4X3FC 1GZNA 2IJMA 3ID6C 4HVSA 3OWPA 4OTWA 4P7EA 4EOQA 1XO2B 2G01A 4UB7A 5AP3A 5DH3A 1QPDA 1UKIA 4WG3A 3UIBA 4GRBA 1XH9A 5IQCA 4FKJA 4FKPA 2W17A 5I3OA 2XIXA 3RPYA 4Q9SA 4IFCA 1FVRA 4LUDA 4DEGA 5JK3A 3LHJA 4BI0A 3TXOA 2RG5A 4PDSA 2J51A 4ITHA 4BCOA 4RIXA 4IZ7A 3VRYA 4YLJA 1PXMA 1WAKA 2PMIA 3E8NA 1YI6A 4FBXA 4Y5QA 3GBZA 3QKLA 5A6OA 3R7IA 5EDRA 4BBFA 3P1AA 4K33A 2VTQA 4AN3A 2BDWA 3MY5A 5HG7A 3TNHA 5I9UA 4BDKA 4DEAA 4KKHA 3LCSA 4FTLA 1NXKA 4WHZA 3HDNA 4QNAA 4BWKA 3N4VA 4J98A 4QP3A 4E6QA 2WMTA 4LRKA 3THBA 3E93A 4NKAA 3A8XA 5JGDA 3Q96A 4MF0A 2QOIA 3VJOA 1APME 1U59A 3IW6A 4KINA 3EL7A 2P55A 4L01A 5TT7A 5LWMA 3MJ1A 2YCSA 4FKGA 5EI8A 2GQGA 4IB0A 4ZTSA 4EUTA 5CT7A 3KXNA 3AC3A 3P7AA 3NUUA 2XEYA 3QCXA 4FV4A 3BEAA 1GIHA 3FE3A 4GS6A 5HLNA 4IEBA 5H2UA 1ERKA 3QTIA 4BCIA 3COKA 3BU3A 4WUNA 4RLKA 1PY5A 2IW6A 3MH2A 4MXYA 4X2FA 3BLRA 4BIBA 4C37A 4ZY5A 5ANKA 2C6DA 3E64A 4QMNA 4C4FA 2W1FA 4FTTA 2UW4A 3E3PA 2XK4A 4ZJIA 2IG7A 3TZMA 4TW9A 5LVPA 5DNRA 4FKVA 3AD5A 4QTAA 4DGLC 5BYLA 4FIFA 3IDBA 4QPSA 4FI1A 4UXQA 4BR3A 4MF1A 1Q8WA 5HG8A 4FTQA 3R7GA 4FVRA 2WTVA 3RAWA 2ITUA 3FHRA 1YHSA 5L2WA 4BTJA 3PPKA 3NNWA 2ERZE 4FKQA 3I79A 4FSZA 4FT5A 4P4CA 4ZEGA 3BYUA 4NZWB 3FMLA 3I6WA 4ZTQA 4F9AA 4I6BA 5DIAA 2EB2A 3ANQA 3DTWA 4X2NA 2X7OA 4C38A 4I24A 1BLXA 2PVHA 2ITQA 1IR3A 1OPJA 5EKOA 2GMXA 4II5A 4YSJA 2NO3A 3KRXA 3Q2MA 5DR9A 4Z7HA 4F0FA 3FMMA 1B6CB 4F99A 3Q60A 2QOQA 4GIIA 3QUDA 4YJOA 3SLSA 3FZRA 3H9FA 4LL5A 2IZUA 4EBWA 3O51A 4MBIA 4AGDA 2FSMX 3FLWA 5JT2A 5KKRB 4NH1A 5DWRA 1ZWSA 5IEXA 1HOWA 2XIYA 4YTHA 1H4LA 2C4GA 4CV8A 4IH8A 1IEPA 1E1VA 3E87A 3U6IA 4MXZA 3WE4A 2C5YA 4G5PA 3W32A 1IA8A 2J7TA 4AACA 3RHKA 5G1XA 3LJ2A 4J53A 4M66A 4UMUA 3WZJA 4JDIA 3MVLA 3W1FA 4XG8A 1YQJA 4RZWA 2VWBA 4UX9A 4MH7A 4WNKA 1RQQA 4J71A 4F1OA 3FMHA 4BCMA 2UV2A 5G6VA 1Y57A 4I93A 3R8LA 1XBAA 1IAJA 1MP8A 4FV6A 3FXXA 5JGBA 4OTFA 3CCNA 2XNEA 2UZBA 4FKIA 4I4EA 5IQEA 1SNUA 2YABA 4PUZA 4DEDA 4DFYA 1Y6BA 4QQJA 2X2MA 3LCTA 4O7VA 3P08A 3QLFA 5E9EA 3OP5A 2FO0A 4J7BA 5C03A 4O2ZA 3ODZX 1HCLA 2YWVA 4OBPA 4U5JA 2Y4IB 3W18A 2OKRA 5EOLA 3D7ZA 5CEPA 3W55A 3PG3A 4TYEA 3TM0A 4AX8A 5HD4A 3FXZA 3KXHA 4I6QA 2C68A 3QQFA 2OIBA 1BYGA 4JAIA 4TYGA 4ZTNA 4CRLA 3OFMA 4S2ZA 3KC3A 3ZCLA 1ZYJA 4GUBA 4U41A 1VR2A 4CFVA 3TJDA 3DLZA 4BDHA 5CVGA 4ZOGA 4JR3A 5FQDC 2W5AA 5AUZA 4QOXA 3KA0A 2P0CA 2YAKA 4TWNA 1S9JA 5GJFA 1H00A 2R4BA 5DBXA 3SAYA 1K3AA 5K3YA 5M57A 3G6GA 3BYOA 4YZBA 1ZMVA 4JT3A 3WIGA 5M56A 3BGZA 1RDQE 4ZTMA 4AA5A 2OJJA 3P23A 5J9LA 2BRNA 2BVAA 4JIKA 3SQQA 5T68A 4L42A 2AYPA 3CQEA 2YEXA 5TF9A 4ZSAA 4X3JA 3DFCB 3EYHA 4E4XA 1U5RA 3NNUA 4JI9A 3EFWA 3OWJA 5L6OA 3NEWA 4WOVA 1RW8A 1JKKA 3G2FA 4L45A 4B8MA 5DGZA 1QCFA 2X7GA 4KKGA 2JGZA 1URCA 2OWBA 2V62A 1W82A 3RKBA 3QTSA 4UZHA 2W1ZA 5M4IA 2QURA 2WQMA 4AQCA 2GHLA 5IDNA 4FZAB 4CV9A 4FTCA 1ZARA 1OITA 3TWJA 3VUMA 3MS9A 5CXHA 2X9FA 5E8VA 4ANLA 3G9LX 2VD5A 4C8BA 2ETMA 4GK2A 5C26A 5HO6A 3A4OX 3AT3A 2ETKA 4M0ZA 3KB7A 5AUWA 3TKIA 4U81A 1H24A 1SM2A 1YXXA 4I92A 3GI3A 5HE1A 3DNEA 3ZZEA 2R3KA 3QQJA 3MIYA 4NYEA 3OC1A 2E9NA 3BYMA 4JBVA 5EYDA 5LQFA 3DGKA 4PY1A 3PWYA 1Q3DA 3CTQA 4UXLA 4YSMA 4RC3A 5FEEA 3MYGA 4AFJA 5K4IA 3MVJA 5H9BA 4FL3A 4MXAA 5AP6A 4TZRA 1Q97A 4AZVA 4BB4A 3OWKA 3ZFXA 5ACKA 2VNYA 2VWVA 4FVQA 3BBTB 2ZMDA 2R0UA 4EK8A 4G31A 3EN5A 3Q53A 3HVCA 5JGAA 3ROCA 4FZ7A 5FTQA 4HCUA 4FK6A 4I0RA 4BKJA 3UP7A 2OFUA 4ERWA 2V22A 3LQ8A 2PUPA 3VIDA 1JAMA 3QD3A 1FGKA 4QYHA 1BL7A 2PVYA 4WG5A 5I9WA 4YURA 5KMLA 3LLTA 4G3CA 1J7IA 2PMOX 3DBFA 2DUVA 3IW5A 2HZIA 3PRIA 2OLCA 4D4VA 2GNJA 4M84A 4TYHA 4V05A 3FV8A 4AGCA 2YCRA 3FZ1A 2CLXA 3PA3A 4R1VA 1CMKE 1G3NA 2JKOA 3UPXA 4D2RA 3VW8A 1WVWA 2W05A 4JS8A 2ZDTA 3T3UA 4TL0A 3VAPA 2O0UA 4NSTA 4CT2A 2XA4A 3D94A 3G15A 2B1PA 5CXZA 2QR7A 1T45A 3QXPA 4IX4A 5EM7A 5LMAA 1PXKA 4MBJA 5F95A 3BZ3A 4GIHA 5IA1A 2XKDA 5I9VA 2XNBA 2H6DA 3UTOA 3PWDA 2J0MB 5HBHA 2OH4A 2R0IA 4QYEA 3UG1A 2EXMA 4IXPA 5HBEA 4KS7A 3LVPA 1EH4A 4CG8A 4Y73A 2HYYA 5IEVA 4TT7A 3VBTA 2PSQA 4C0TA 4YTFA 3NVKI 4FE2A 1PXPA 1PMUA 4FSRA 2PVJA 2ZAZA 4APPA 3BQCA 5C27A 4BC6A 3DAJA 3DS6A 4IVBA 5AP7A 4DEHA 2ZB0A 3Q6UA 3O96A 4D5HA 3ALOA 3F7WA 3BHYA 4L7SA 5A14A 4L3PA 3S3IA 3I60A 1UVRA 4FKLA 4PDOA 4Z9LA 3WOWA 3MGYA 4MD7E 4FV0A 4FTUA 3RK9A 2J0JA 3PYYA 3JS2A 5HE0A 4IJPA 3DXPA 3ODYX 2W7XA 4BDDA 5C4KA 2JLDA 3VQHA 3UQCA 2VWIA 3DCVA 4YJSA 2Y9QA 3A60A 3EL8A 1Q24A 5C8NA 3DLSA 5IQGA 4PDPA 3UO5A 4XG2A 4CFXA 2GCDA 3QFVA 2Q83A 3CY2A 3PVGA 3MB6A 2XK6A 4UWCA 5DN3A 4FTJA 3W2OA 4AN9A 3ZZWA 1S9IA 4F7JA 5HX8A 3BHTA 3KF4A 4QMMA 4J96A 2VO3A 3V5TA 3NUPA 2XRWA 3HMPA 5HQ0A 3P79A 4KD1A 4IC7A 4AZEA 3LFFA 3VUDA 3QYWA 3FI8A 3V6RA 3LXKA 2GFSA 1YI4A 4RRVA 3V01A 2PL0A 4FSQA 4AG8A 3KRRA 5AV4A 3OHTA 2NNWB 2F57A 4BDAA 1OB3A 4YJUA 2HZ0A 4M7IA 2CKEA 2WTIA 3UBDA 3SRVA 3C0GA 5A4EA 3B2TA 4EK4A 3OXZA 1Q5KA 3F2AA 5JRQA 4E8AA 4JVGA 3KQ7A 5KCVA 5J1VA 3SHEA 4BTKA 3NZ0A 4GVJA 2F7EE 4AZWA 3O8PA 4KIOA 4GG5A 4FYNA 3HV3A 1ZMWA 1QPCA 4FMQA 3BYSA 4FSNA 5E91A 2QNJA 2XM9A 4CSVA 4D1SA 5LVMA 3U54A 1WBNA 3IOKA 3OF0A 4U43A 4U45A 4CMOA 4DHFA 3UO6A 1NT2A 4IX3A 5E8XA 5EQEA 3NPCA 3I81A 3ORNA 4A4LA 3F5GA 4FODA 3PVBA 4KIQA 4RIOA 2C30A 5JZNA 3A62A 4C4IA 3CE3A 3O8TA 5CY3A 5L3AA 3ZXTA 4QYYA 1CKPA 3RTPA 3FQSA 4UWYA 4EUUA 2PTKA 2Z60A 3HRBA 2J0KA 5FRIA 4JQ8A 2QKRA 3NUYA 3VHKA 3GVUA 2PE0A 2J9MA 4C58A 2ITPA 4KBCA 2VRXA 1FQ1B 2CDZA 5FTOA 5LCKA 2ACXA 4DH8A 3QD4A 4BGQA 2YM6A 4JR7A 4F0IA 1BKXA 2R3GA 3GCSA 3IONA 3Q4ZA 2QG5A 4ID7A 1OL1A 4QMYA 5ETFA 4D28A 2JKMA 3D2KA 3L8SA 4H36A 2X1NA 4PV0A 1Z5MA 2XB7A 3A8WA 5CF6A 5LVNA 5AP0A 3ZFYA 4G34A 3PXYA 4PPAA 2YM4A 2P33A 2J5EA 3IQ7A 3PLSA 3CQUA 2JD5A 3R8VA 3FYKX 3P7BA 2C3JA 3F2RA 5LVLA 2FSLX 3PJ2A 2VTLA 4EEVA 1PXNA 3K2LA 2YIRA 3AC1A 2XH5A 2WQNA 3AGMA 5FD2A 2X6DA 4MD9E 3F3UA 2XJ1A 3HNGA 4FKUA 2WELA 4AN2A 2BZIB 4GJ3A 5IA5A 4DFUA 3C0IA 1OIUA 1IG1A 2OJ9A 4V04A 2XYNA 3R00A 4KWPA 4RJ4A 5A4QA 2Y6MA 3EN7A 2PE2A 3OT3A 2XCHA 2WB8A 4BCNA 2B53A 5T6KA 3F3VA 3K5VA 4PMMA 3I0OA 4XV9A 4OAVB 2W1CA 1A9UA 4O0VA 2C0OA 5EG3A 3EZVA 3OW4A 4O7RA 3Q32A 2HWOA 5AAEA 1LUFA 3TZ9A 2UW5A 4HOKA 4JIAA 3NYOA 5IQFA 3TDWA 1ZY4A 1H08A 3OCTA 1XQZA 3DJ7A 2IN6A 2O64A 4IAZA 4E6CA 1J7UA 4RT7A 2R3NA 4FNWA 4MKCA 5FBOA 3LFDA 4MQ2A 3VBQA 3DBCA 4CT1A 1KE6A 3KGAA 3NX8A 1JOWB 5AADA 2XKCA 3KY2A 4H1JA 4U3ZA 3VS5A 2OF2A 4JXFA 4HYIA 4CRSA 2CHLA 3NIEA 3GCUA 1R1WA 2X2LA 4WSYA 4DCEA 3FMEA 4LM5A 2CKOA 3LXLA 2RF9A 3QKMA 4FF8A 4EZ7A 3NW7A 5M44A 2ESMA 3RWQA 5AA9A 5BVFA 3UOLA 1P4OA 4D2TA 1XHAA 4YHJA 3DJ6A 5CASA 2O63A 4IWQA 4Z3VA 1WCCA 2QONA 4D9TA 4DC2A 3DA6A 3A7GA 2XIKA 3I6UA 5D10A 2UVXA 3FL4A 3LXNA 3PPJA 3POZA 1FINA 4RJ6A 4XG7A 4YTIA 5CNOA 3G5DA 5ITAA 3ZYAA 1ZYCA 1KV1A 2JDSA 4FTKA 4V01A 3NGAA 4YGAA 5CU3A 1PXJA 1L8TA 1GZ8A 1Q8TA 4E20A 4LOPA 4NCTA 4Y46A 2QU6A 5FDPA 4O7LA 4DN5A 3I7BA 2CGXA 4WG4A 5AP2A 3AC5A 3IW4A 4O7TA 3VBXA 1YRPA 2WMQA 3WIKA 1DI9A 3FI4A 2R3HA 4HPUE 2PULA 3KF7A 2YISA 4PPCA 3MFRA 1H0VA 5DT4A 3PA5A 1PMNA 2UW7A 3EQPA 2BKZA 3PSCA 3NUAA 2C0TA 3OROA 4XBUA 1J1BA 3R21A 4LOOA 3NDMA 2GSFA 3O7LD 3QTXA 3ZLWA 2WPAA 3R8ZA 4L52A 2QR8A 2UZVA 4QNYA 3OTVA 3L9MA 3JVRA 3QCSA 4CTCA 4C2WA 4AE9A 5TE0A 5ETCA 1KOBA 3RAIA 1KOAA 3O50A 3A61A 4GU6A 3ROYA 3OBJA 4K2RA 5JMSA 2RKUA 4HVGA 3MTLA 1VYWA 4DGNA 3MESA 2Z8CA 3UODA 5EM8A 4G3GA 2VNWA 3G51A 4IM3A 4JLCA 4XOYA 5E8ZA 1JLUE 3EFJA 3PSDA 4BY9E 3EB0A 5J9ZA 2YHVA 5BVDA 2PZIA 3QQUA 5DFPA 1VJYA 1P14A 4YP8A 4IFGA 2RFDA 1H01A 1UKHA 2VO0A 2WIPA 4G6NA 4CXAA 3CC6A 4EHZA 3U6HA 2YIWA 2IVTA 2I0HA 4AT5A 2HOGA 5EK7A 2C3IB 4AW2A 4YJQA 4ZTRA 4I22A 1J1CA 3FSKA 3UOHA 5A6NA 3OXIA 3U9CA 2WU6A 1BL6A 3PSBA 2VWWA 3R02A 4EOPA 2GTNA 2YN8A 4RWJA 4FG9A 3Q9XA 5KZIA 1FMOE 5L8KA 4RSSA 3LLAA 3H0YA 4YO4A 3FC1X 2XM8A 3QZHA 5HVKA 5KMOA 3TUBA 2A19B 5DRBA 3HYHA 3VS2A 2QOFA 3G9NA 1YHVA 5FDXA 5B7VA 1YHWA 2J50A 4X21A 1UU7A 4PL5A 4YUQA 3ORZA 3BHHA 4W8EA 2IVUA 2ITWA 4JBOA 5M53A 1M7QA 3B8RA 1R78A 4WKQA 2V7OA 4B0GA 3F5PA 4A4XA 3N4TA 4UZDA 1Z57A 3EQDA 3HA8A 2IW9A 3CD8A 5FWKK 4BCQA 4D2PA 3RP9A 4EH5A 1KSWA 3PIXA 4GKIA 4O6LA 4XV2A 1XH8A 3HA6A 5K4JA 5FBNC 2BZKB 4NJ3A 3EZRA 2C6KA 4CQEA 4CYJA 3GOPA 3Q4TA 4RJ7A 2YM5A 1V1KA 4F1MA 3A7JA 3ZC5A 4DTKA 5T3QA 2H34A 3QAME 4QP1A 4FC0A 3SRVB 4FUYA 3QWJA 4ZMFA 4K6ZA 3EKKA 2WO6A 1M14A 5BVNA 2F4JA 4AZFA 1I44A 2Y4IC 5IUIA 4EOKA 1DM2A 5K0XA 4PDYA 2CGWA 5ANOA 4ZSJA 3FJQE 3RCJA 4R77A 4HVHA 1YWRA 3R7YA 3D5XA 4IM2A 3VBVA 4N57A 4DT9A 5L8JA 5HIBA 3ZBXA 1FOTA 1H1WA 5E92A 5IQHA 2KTYA 4O0WA 5D9HA 2W1IA 4CKRA 4XCUA 4TRLA 2IWIA 4OT6A 3OD6X 3KXXA 3C5IA 5IEYA 1YWNA 3BIZA 4YC8A 2HY0A 3FLZA 3F9NA 4TXCA 3SOCA 3D4QA 4D0XA 5KHXA 4TYIA 3JR1A 1IRKA 2VWUA 1T46A 3WBLA 3PY3A 3L9NA 3EQGA 3UMXA 4BDBA 5CSWA 4O7YA 5HNGA 5M4CA 3KVXA 3ZLSA 3CKXA 3QRTA 3JPVA 2ITXA 3KN5A 2X8IA 3LE6A 4RQKA 2PPQA 1LP4A 5FEQA 2FH9A 2VUWA 4CD0A 4QT1A 4L43A 3CBLA 5E4HA 1H1PA 4ZZMA 5HBJA 4EOLA 5K5XA 2JDTA 1UWHA 1UWJA 1YI3A 3IOPA 4N4SA 4M15A 1UNLA 3O8UA 3VULA 4F7LA 4R5SA 3PXKA 5A4CA 2G15A 2XEZA 5ANJA 1WVXA 2QO7A 4BYIA 4AGWA 5H8EA 4IDTA 4D1ZA 1F0QA 3OXTA 1FVVA 1P5EA 3IS5A 5GZAA 3PJ1A 2EXCX 3COMA 4BDJA 4ORKA 1KWPA 4F64A 3IDPA 2YWPA 2REIA 1TQIA 3T8OA 4ANQA 3ORIA 5J5SA 4F4PA 4F7NA 3LKMA 4MX9A 4DG2E 3OUKA 3F3TA 2Z7QA 4I5HA 4L6QA 3EN4A 2B54A 4FL1A 4DEEA 2ITZA 3QQHA 4RWLA 3SOAA 3VS1A 2YCFA 3F2NA 4OTPA 3RPVA 5K9IA 4OGRA 5EOBA 3P5KA 5FGKA 2QVSE 4H39A 4EQCA 2PUNA 2CN5A 2W1EA 3MDYA 1JSUA 4F6UA 5M06A 2VTNA 2CNQA 3O7LB 2QLUA 1M2PA 3UQFA 2YIQA 3ZFMA 4LGHA 1R0PA 2WXVA 3GU5A 2QHNA 3ZSGA 2Y6OA 1JWHA 2C5VA 2A0CX 3P7CA 4IAKA 5E8WA 1B39A 3SV0A 4HGEA 1YKRA 4HW7A 2GS7A 3GU4A 5IUGA 4I5CA 2G9XA 4QTDA 3MH1A 4JDKA 4DE4A 4XP3A 4GT5A 2EXEA 3RALA 4JRVA 3QRUA 3UO4A 2VTRA 3D0EA 5CX9A 3NNVA 5B0XA 3RNYA 1BUHA 1KE8A 1Q4LA 4XRJA 2WQEA 5BMMA 3ULZA 3DY7A 4L3JA 3MB7A 3AG9A 1JBPE 4Z16A 3QHRA 4WO5A 4AUAA 1E9HA 2GS2A 1SMHA 3VQUA 3NYNA 2WMWA 3HV7A 3OW3A 4KSQA 4Q9ZA 3HGKA 3I4BA 3MI9A 4MYGA 2YJRA 4O0SA 2VTPA 3WYYA 2UZDA 5BMSA 5IA2A 4B6LA 4M14A 4S33A 2PYWA 2C5OA 3CJFA 3WF7A 4FTAA 2W1HA 1WFCA 2X8EA 2ZVAA 2VX3A 4I5PA 2BTRA 2O3PA 2WMBA 4F65A 1WVYA 4RGJA 3E7VA 1P4FA 5BVOA 5CAOA 3IO7A 4IMYA 1H25A 1VEBA 4FR4A 4ONAA 4OUCA 3VF8A 4EORA 3QTWA 2GNGA 1G8AA 3C51A 4MNFA 5E8UA 3U51A 5HIEA 4QMSA 4P5QA 4YNEA 5HG9A 1KV2A 4KBKA 1J7LA 4YZ9A 4AS0A 5F94A 3H30A 4C3PA 1YDTE 2AUHA 5CVHA 2IW8A 4FSYA 3DK6A 4RX9A 3CPCA 4YBJA 4EQUA 2IZRA 1JSTA 3HV5A 3KL8A 3QX2A 2A1AB 4DLIA 4IAFA 5FM3A 3FC2A 3UPZA 4EOSA 1KE5A 1U5QA 3MIAA 3QCYA 2E9PA 3ACJA 4C7TA 4OT5A 3HMIA 4EH4A 2QOCA 4PL4A 2XNGA 5D1JA 4NM3A 1YW2A 4JDJA 4Z55A 4EL9A 3NW5A 4QMUA 1XJDA 5J95A 1E1XA 5TOZA 1WBTA 2XYUA 3NAYA 3CGFA 3CR0A 3VVHA 4BCGA 3DU8A 3C0HA 4RFYA 3GXLA 4YZNA 2BALA 3AT2A 5J1WA 2OXYA 2NRYA 3NR9A 3RPOA 3EH9A 5M4UA 2B0QA 3R2YA 2Z7RA 2YITA 3FMNA 3QBNA 4WNPA 3HKOA 5CZIA 4YC3A 1JKTA 5AR3A 4BDCA 1LEZA 5CF5A 4DEIA 3QL8A 4YJTA 1IA9A 4XBRA 2Y8OA 3V51A 5EQYA 2X8DA 3Q5ZA 4GT4A 1WBOA 2BDJA 4M69B 1H26A 3W8LA 4I5MA 1Q61A 2OG8A 3REPA 4H58A 3BLHA 2ZM3A 5AM6A 2WMRA 3TTIA 4R1YA 1PJKA 3TV6A 5CT0A 5FM2A 4CFFA 5H8GA 3QYZA 4YJNA 2BRBA 1Q8UA 3HUCA 3PJ3A 3LOKA 2YM3A 4YZCA 3S1HA 2PZPA 4WNMA 1WBVA 5TO8A 1YVJA 3RM7A 4BKYA 5LMKA 4J52A 4QYGA 2BROA 4FOBA 4G9RA 3B2WA 4OW8A 3FEGA 1YOMA 5BYZA 4UYNA 4PNKA 4A9UA 4PP9A 2BIKB 2FYSA 4LV5A 4XX9A 4ZJJA 4D55A 3SGCA 1XH5A 3AC8A 5DLSA 4DAWA 4FIHA 5IDPA 5CALA 4HGTA 4RWKA 4QYFA 2UZNA 5CAVA 3NYXA 4BFMA 3QD2B 3D2IA 3LFBA 3S0OA 4S32A 4LV8A 3LCOA 5AAGA 2Z7LA 2ZM1A 3IK3A 4FNYA 1FBNA 1W7HA 1REJA 5J8IA 3FKLA 3ACKA 3VS0A 3ET7A 3TIYA 4GEOA 3M42A 2FVDA 2C69A 3HL7A 4I94A 3HMMA 3MH0A 5KMKA 3LFAA 4MHAA 4YHTA 3TKHA 4DH1A 1ZOEA 2QKWB 3DKOA 2E2BA 4QPMA 3WF5A 3NCZA 3EJ1A 4J95A 2PE1A 2Y4PA 1GZOA 5KMIA 3A99A 2YDKA 3PY0A 4QQCA 3WZKA 4NM0A 4YMJA 4O83A 2UZTA 4AT3A 2WTDA 3HLLA 1FVTA 3CTHA 4EH8A 5FUTA 1MRUA 3RMFA 2QG7A 4E5WA 2PUUA 3TL8A 4FZDB 4QQTA 4E4NA 4NL0A 3R9RA 4F6WA 2JEDA 3BU6A 3FAAA 3MBLA 4S31A 3BI6A 1GZKA 4FKRA 1GIJA 2BFYA 4AAAA 1IAHA 3PRFA 1V0OA 1H1RA 3VWAA 4E26A 4EHVA 3L8XA 3F66A 2JBOA 2Z02A 3ETAA 5E7RA 4KSPA 4XHKB 5BVWA 3BHUA 4CNHA 3E3BX 2UZEA 4ITJA 1YXTA 2EWAA 3HUBA 4OTHA 3HECA 3HZTA 3R0TA 3R30A 3IECA 3GC8A 4EJ7A 3E88A 4LGGA 2CCHA 3EN6A 3FZOA 3GCPA 5ETAA 3E8DA 4FVPA 3TUDA 3IW8A 3IG7A 4C02A 1AQ1A 4F7SA 1GJOA 1OMWA 2ITVA 3EQIA 4JX3A 3UNZA 5LMBA 3U6JA 2GNIA 3KMUA 3UVPA 1CTPE 2C5XA 2VTTA 2QHMA 4IDVA 2P4IA 1WBWA 4KRDA 5KZ0A 4A9RA 4USDA 4QP6A 3BRBA 4AA0A 3MPAA 4HYSA 1TQMA 4IX6A 4BCKA 4UY9A 3SG8A 2R3IA 4AW1A 4FL2A 4JNWA 3ENMA 2YLFA 3FI3A 4JJRA 5AAFA 3H3CA 4BVUA 2QOOA 2VN9A 4O7ZA 3OOMA 2G2HA 4JG6A 4FZFB 2UVYA 4BDEA 1VZOA 1W84A 3K3JA 3UMWA 3KMMA 4EBVA 4IQ6A 2PWLA 1KE9A 4EJNA 3TNIA 1O9UA 4DT8A 4GW8A 1W8CA 2UW9A 5CEMA 4EOMA 3CEKA 1H8FA 3QKKA 1Q8ZA 5EDQA 3R9OA 3M1SA 4F09A 1PHKA 2XF0A 4XMOA 3C4WA 5DVRA 4E93A 5D7AA 1AGWA 3LFSA 2F7XE 3ZSIA 3PXZA 4JQEA 3I5ZA 3WZUA 2WHBA 4BIEA 3M2WA 4LMUA 3KXZA 4PMPA 5KBRA 5KX8A 4L00A 2O8YA 2WEVA 2OJFE 3ORKA 4NIFA 2BTSA 3F5XA 5AR5A 3SXSA 4BBMA 4BWPA 5CLPA 3RAHA 4CFUA 3PE1A 4U44A 2VTSA 3ITZA 2HENA 3C1XA 4L53A 3PIZA 4EKLA 2IPXA 3HX4A 2CKQA 4YPDA 4DFNA 4XRLA 5BVKA 4EYJA 2GNFA 5I9XA 5JFSA 1PXIA 4G6LA 1OGUA 3K3IA 3VUGA 3ZMMA 4QP4A 4KNBA 4BI1A 2R3LA 3W10A 4RVKA 5CF8A 2XK7A 3JYAA 5ANGA 4X2KA 3FQHA 4NM5A 5HICA 4YJVA 1SZMA 2PVLA 3BHVA 4QTCA 3AC2A 4OBOA 3FHIA 4GL9A 1BMKA 4FNZA 4E6DA 3EFKA 2F2CB 1WMKA 3OTUA 4FYOA 4IAIA 4YBKA 3VRZA 5I9YA 5JH6A 3U55A 3QLGA 4BRXA 4CYIA 4ZLOA 5D12A 4V0GA 3R1QA 4WIHA 1FMKA 1GIIA 4FT0A 4OTGA 4W8DA 3ZO1A 4IVDA 1JKLA 3QWKA 4G5JA 4RFMA 5BNJA 3BELA 3GQLA 4WRSA 2B55A 5DRDA 3KRLA 2HELA 2ITNA 3LJ1A 3NLBA 3FUPA 3U87A 2ZV7A 1H1SA 2XUUA 1ATPE 2R7BA 4NFNA 4TWCA 4XLIA 4C4JA 1MRYA 3PA4A 4FSTA 4ZTHA 3VHEA 5IISA 5HVYA 4AOJA 2WNTA 3DBEA 5CU6A 3GFEA 4EC8A 3UE4A 3DZQA 3WF9A 4HGLA 1XH7A 3TUCA 3L1SA 4C62A 1M2RA 2GDOA 2RGPA 2XP2A 3HV6A 2OK1A 2NPQA 3QHWA 3RM6A 3ZUTA 5JKGA 1ND4A 3QA0A 3BLQA 4JQ7A 5DHJA 2V5QA 2PZRA 2UZLA 3NW6A 2R64A 2XK9A 5L4QA 4G3FA 4MTAA 3F61A 3FDNA 4XJ0A 2WAJA 3CPBA 4E6AA 4NTSA 4O0YA 2XBJA 4U9AA 5FXQA 3CTJA 5DEYA 2LAVA 3ZM4A 5JRSA 2OBJA 3MFTA 3PZEA 4FV1A 4J1RA 4QMVA 4D4RA 4DYMA 2ONLA 3QQGA 4DCAA 1QL6A 3LFQA 3OEFX 4S34A 3RVGA 2GTMA 4ACMA 4FICA 4E4MA 3W2SA 2BZJA 5AIRA 3OS3A 2XZSA 1WBSA 4PP7A 3ZS5A 4IE9A 4MD8E 4K9YA 4W9WA 3ENHA 4GCJA 3DB8A 3EQBA 3PP1A 5HGIA 5AV3A 1PW2A 3CY3A 3CJGA 3P86A 4HNFA 3F3ZA 3PE2A 4QMPA 1U54B 5ANEA 3ANRA 2CGUA 2JIUA 4YZDA 1BX6A 3D5UA 3ZEPA 4EK3A 2PVMA 1R39A 3GT8A 3UDBA 3PJ8A 1OUYA 4D2WA 3U4UA 3OCBA 4AP7A 5CEOA 1WZYA 3GU6A 5M51A 3G0EA 4BZOA 1PYEA 3TG1A 3HV4A 4EH7A 4GFGA 2WZJA 4DEBA 1NY3A 3C13A 3R6XA 3DQWA 5IQBA 4PTCA 1UNGA 5HD7A 3ZXZA 3GUBA 3UOJA 4FTMA 4O22A 5DPVA 2YZLA 4ZAUA 4NW6A 3R28A 2VO7A 3QRJA 3FKOA 1JPAA 4XP2A 1YXSA 4ZLZA 4HPTE 4FTRA 4UMQA 4JBPA 4DLJA 3LJ0A 4R7IA 4B7TA 2C6MA 1UU3A 4KRCA 3I7CA 4NW5A 4U0IA 3BPRA 5J87A 4QMOA 5CEKA 3N51A 2F2UA 1VYZA 1LPUA 4Q5EA 2VZ6A 5JFWA 4L7FA 4IC8A 4U7ZA 5EHOA 5FP6A 2BIYA 2OFVA 2I0EA 2UVZA 3FI2A 1G5SA 3RCDA 3V04A 4Y5HA 1JKSA 4HVDA 2RFSA 1YDRE 4UBAA 1W98A 3MVHA 5CSHA 4QP8A 3QUPA 1V0BA 4FTOA 4FEUA 2UW0A 4H3PA 4L8MA 4R5YA 1ZYDA 5LOHA 4DGGA 3GP0A 3NVMB 2X4ZA 4TYJA 2UZUE 3T9TA 4S30A 3ZRLA 3TEIA 4A06A 3QUEA 2I1MA 4G17A 3E62A 5IA0A 3R01A 4WA9A 2QOKA 3BKBA 3RI1A 2C6LA 2ZB1A 1UU9A 4M3QA 4FSMA 3PXRA 4TNBA 1JQHA 2ZV9A 3QZFA 3RK5A 4CCBA 3R63A 5EI2A 5EW8A 5AJQA 5HEZA 3IW7A 4MXOA 4BTMA 4CFMA 2B52A 3Q4UA 4FGBA 4PX6A 4ZS0A 3GQIA 3D14A 4XS2A 1UA2A 2OSCA 2BAKA 4GK4A 5JFVA 3MPMA 3SDJA 2W99B 4JG7A 4ZLYA 1UU8A 2OICA 5IMEA 2WFYA 3MY0A 3C5UA 3KU2A 3T9IA 4ZZNA 4ASDA 3R8PA 5CU0A 5HIDA 1XWSA 5EM5A 3GC0A 3V5JA 4RLLA 3V8SA 3MA3A 2QOHA 4FEXA 4W4XA 5DR6A 2QO9A 4TTHB 3ATTA 3LFNA 2WTJA 3E92A 2C3KA 4WT6A 2BILB 5CI7A 4F9YA 3FBVA 3EMGA 1YOJA 3EOCA 1TKIA 5DE2A 3R1YA 3R1SA 2YDIA 5EHYA 3FZPA 4X2JA 3I5NA
chains in the Genus database with same CATH superfamily
1OIRA 4M97A 4O27B 4IB1A 3KREA 2OZOA 4DINA 1OL2A 2ITOA 1DAWA 1OM1A 2W9ZB 2X7FA 3UNJA 3QU0A 4BCHA 3TT0A 2H9VA 4JOAA 5HHWA 4FEQA 1UV5A 4XOZA 3CD3A 3OVVA 5TKDA 4AZTA 4C57A 4HCTA 4UEUA 2H8HA 4EH9A 3BCEA 4D9UA 2PHKA 3LMHA 3MSSA 4DTBA 4P90A 5EW3A 4ASXA 3ZC6A 4X6RA 2OGVA 2JBPA 1OBDA 4ZK5A 4I0SA 5FP5A 4BHZA 2C1BA 2YA9A 1L3RE 3RBWA 3ZU7A 4RWIA 4GT3A 4UV0A 5EM6A 4UMRA 4EWQA 4NJDA 4M69A 4RA5A 2HK5A 4F9CA 2R5TA 2JFMA 5AP4A 2CLQA 3O23A 4HZRA 4NCTC 4DH5A 5B2MA 2OZAA 4CLJA 2A27A 3N4UA 2XMYA 4IM0A 4HYHA 2XALA 4R7HA 3ZONA 3W0RA 1CDKA 3RNIA 3L8VA 1PMEA 1OL6A 1ZLTA 3HP5A 3KCFA 4NIFB 5J5TA 3PVWA 4YHFA 3R8UA 2PMNX 3RINA 4LG4A 3DDPA 3SXRA 3QXOA 5AP5A 4UWBA 4FTNA 2QO2A 2V7AA 3L8PA 5DMZA 4XLVA 5CANA 3LFEA 3S4QA 4X3FA 3SG9A 4G9CA 4FEVA 4D0WA 3H4JA 4F1TA 4IVCA 4QMWA 4F08A 2VWYA 4CQGA 3OOGA 4DTAA 4GH2A 4XNEA 3FKNA 1DS5A 2XNNA 3ORLA 3LZBA 3WZDA 2ZYBA 3Q52A 5FXRA 3G33A 5AUUA 4QMTA 3LMIA 3W0MA 2BCJA 4EC9A 3R7OA 4GYIA 4LQMA 4IBMA 3GC9A 1OIYA 4BZNA 3QD0A 2XIRA 5HCXA 4V0GB 1MUOA 2WD1A 2E9OA 4FT9A 2CJMA 5DEWA 3GOKA 3LM5A 1K2PA 1OKZA 1SVHA 4C33A 4FZ6A 5IKWA 4L44A 4C36A 3PXQA 5GZ9A 1NVRA 2YLEA 3RHXA 3II5A 3AOXA 4YR8A 2R3RA 3KFAA 5HCZA 1JSVA 2NP8A 4L3LA 3FYJX 5J7HA 1Q99A 2HCKA 3BV2A 2WKMA 3ZSHA 4MBLA 1ZMUA 1TQPA 3KXGA 4J8MA 3ZLXA 1MQBA 4EH2A 2XK8A 3RPSA 2ZJWA 4W4YA 5IF1A 4XG9A 3U4WA 3ZEWA 4AW5A 2QCSA 3FMKA 3NYVA 1O6KA 2HXQA 2PUIA 4A4OA 4RQVA 5EYCA 4U42A 5HTCA 1SVEA 2OI4X 4DBXA 4RJ3A 4D4YA 4JX7A 2I0VA 2PVFA 4IX5A 4U3YA 5HOAA 2J2IB 2F49A 3RAKA 3NMUF 2WIHA 2IZTA 4KIPA 3TI1A 5I9ZA 4QMQA 4I41A 2BKKA 3QA8A 4GV1A 3LXPA 4N6YA 4N70A 4YJPA 4OAUC 4TKSA 1XKKA 5BQ0A 1IASA 2YIYA 2FSOX 2WU7A 3TDVA 4I1ZA 1ZYSA 5H3QA 2OIDA 3AQVA 4RFZA 2XIZA 1SVGA 1H28A 2ITTA 3LM0A 4JG8A 4KAOA 4PPBA 4ZMEA 1PXLA 3FZTA 2GU8A 2YIXA 3DV3A 3CP9A 3JY9A 4KBAA 2R3PA 4YLKA 2WTCA 5CSVA 5AX9A 2Q0NA 2J0IA 3GB2A 3QTUA 3W33A 4EZ5A 1ZOGA 3MJ2A 4BIDA 5HLWA 4CFNA 4L67A 5F1ZA 4Q2AA 4UMPA 3NFFB 5CAUA 4DG3E 5A46A 4TN6A 3POOA 4U6RA 3ZO3A 2C6TA 3R7UA 3SW4A 5EHLA 4MVFA 3T3VA 4FIJA 2DQ7X 4I3ZA 4BGHA 3SVVA 5IQIA 2X39A 3ZRKA 4GFMA 3WE8A 2P2HA 3COHA 4C2VA 3WF8A 3DXNA 3P9JA 4IB5A 4FSWA 1H07A 3R9NA 4YPSA 3DNDA 4FV8A 5CEQA 4HZSA 3TN8A 2JIVA 4I0TA 1JNKA 4BBEA 4HYUA 2OF4A 2ZMCA 5ETIA 2PZYA 5HE3A 3CGOA 5JEBA 2YJSA 4H3QA 3NRMA 5CTPA 3OCSA 3UC4A 2A4LA 5EH0A 4XG4A 3UIUA 3UOKA 4PNIA 2BAQA 2NRUA 3F69A 3FLYA 3P4KA 4U8ZA 4RX5A 4AOTA 5DR2A 2VTOA 4RZVA 3RWPA 4I4FA 2ERKA 3OCGA 1XBCA 2AC5A 3R9HA 4PMTA 2RG6A 5CU4A 1BI8A 3MVMA 1OVEA 5A3XA 5L2TA 2HAKA 3EYGA 5KNJA 4OTDA 3SC1A 3F82A 1NVQA 3KK9A 4JDHA 5AIKA 1OPLA 3E8EA 5TR6A 3VC4A 3DPKA 2I0YA 2OH0E 3TNWA 2ZFYA 2ITYA 2ZV2A 3RZFA 2FA2A 3V5WA 3LCDA 1Y8YA 2YZAA 4FG7A 3IKAA 5C1QB 4FEWA 3WF6A 2OW3A 2W0JA 2CSNA 1URWA 4IAAA 2G1TA 3C4EA 3NCGA 2EU9A 4TY1A 3UVRA 3EQRA 4YO6A 4J97A 5BYYA 4HJOA 2XS0A 5L6PA 5ICPA 4EK6A 3IPHA 3DDQA 4OBQA 2RL5A 4R8QA 4RA4A 5CYIA 2QD9A 4BCJA 4AE6A 5AMNA 3G90X 4O21A 2BAJA 2BR1A 5CQUA 5B2LA 4PF4A 5J7BA 3QF9A 2CPKE 4RC2A 4FG8A 4IANA 1M7NA 1WBPA 4RIYB 4ZP5A 4ITIA 2WEIA 3AT4A 2B9IA 4IWDA 4USFA 4BZDA 2CGVA 3PXFA 3UG2A 4Y72A 1I09A 4B8LA 5HTIA 2PY3A 4W4VA 3FWQA 2WMVA 3VUHA 3C7QA 4NKSA 3HMOA 3R73A 4AT4A 4EH6A 1ZAOA 4XP0A 4YU2A 5L8LA 5FLFA 3TYKA 3SX9A 2Y7JA 2XVDA 4BTFA 3EQCA 5BX0A 4BHNA 3EFLA 4FIGA 4E5AX 2CCIA 2DWBA 3CSVA 3U8WA 4D2SA 4WNOA 4RPVA 3AD6A 3QZIA 4J99A 2WQBA 4QRCA 4AGUA 2EUFB 4XG6A 4R78A 4GSBA 4Z7GA 2FUMA 1F5QA 3BU5A 4O96A 4TNDA 5CEIA 2B7AA 5AX3A 4QP9A 3M11A 4QDEA 1CKIA 2DS1A 1O6LA 3JUHA 4FIEA 3ZLYA 3R7VA 4I6HA 3E63A 3OEZA 4ZIMA 3QRIA 3DAKA 2CN8A 1OUKA 4O38A 1A48A 2BRMA 2XKFA 4O0RA 2WTKB 2LGCA 2V0DA 4QP7A 4X6QC 4DFXE 2QI8A 4DFZE 2X9EA 5E8SA 3TCPA 5DG5A 5HZNA 2CMWA 3AD4A 4IZAA 4C3FA 4FSUA 3ELJA 3FLNC 3Q3BA 3ZUUA 4M12A 5I3RA 4U80A 2PVKA 2OZAB 4G2FA 4GYGA 4ZY4A 5E1EA 2IEWA 5AV2A 2WGJA 4LUEA 1STCE 3KULB 5FXSA 2KULA 1Q3WA 4CTBA 4M8TA 4Y95A 3KXMA 4A07A 2UZWE 3FLQA 4G3EA 3LAUA 1DAYA 4PQNA 4X2GA 3BE9A 3NUSA 4YC6A 4M13A 2BRGA 3D9VA 5EFQA 1ZOHA 3DK7A 1U4DA 4WUAA 5AV1A 1OIQA 5IA3A 3AKJA 1U54A 4ANSA 3KKVA 2WMUA 4WBBB 2JDVA 4DFLA 2OO8X 1XH4A 2OXDA 2PVRA 4X3FB 3RJCA 3ULIA 4C34A 3GNIB 4O84A 5FTGA 5LARA 4GUEA 1Q62A 5AR4A 5GNKA 4FA2A 4B4LA 4R3CA 4GVAA 3NNXA 2C3LA 4RJ8A 2XNMA 1ZZLA 3D83A 3OBGA 3KMWA 4OTRA 3B8QA 4WD5A 4WSQA 3GEQA 2XKEA 5C8MA 5BUJA 3D7TA 2BMCA 4BL1A 3E7OA 4ZSLA 4O86A 5CNNA 3TV7A 2IO6A 3DT1A 2GQRA 4DF3A 5HNBA 2XJ2A 2YFXA 4CVAA 4ACCA 1J3HA 3KEXA 2WTWA 4K8AA 2JKKA 3ERKA 3OWLA 3OZ6A 2YM7A 4NEUA 5CQWA 3R9DA 1GNGA 5HVJA 4D1XA 1MQ4A 3HMNA 4B99A 3ZOSA 3ATSA 5FG8A 5CF4A 3ZUVA 4O0TA 5HKMA 2QU5A 3QGYA 4BICA 4P2KA 4MNEA 3UZPA 5L2SA 2PK9A 5EW9A 5HU9A 3O0GA 4FGRA 3I1AA 3F3WA 3VN9A 2Y0AA 4FUXA 4O4DA 2OU7A 4O6EA 5CAQA 3R22A 4QMZA 2VTIA 3LIJA 4GFOA 4I21A 5EQPA 2R3FA 5LXMA 3VNTA 4MWIA 3NIZA 4FKWA 3OUNB 2PZ5A 2WMXA 2JDRA 5M07A 2IF8A 4AAYA 3S2PA 2IVSA 2V55A 4IZ5A 3ORMA 2QOLA 3VW6A 4DITA 4E5BA 1F3MC 2W4OA 4IWPA 5GHVA 3P0MA 3PIYA 4I20A 4CGAA 5BV3A 4EK5A 3SW7A 3V8WA 3BGPA 2WMSA 1OL5A 1CKJA 1V0PA 1J91A 4FTIA 1YDSE 5IUHA 2VAGA 3DKCA 3GC7A 3C4FA 4GKHA 3EQHA 4W4WA 1ZYLA 2EVAA 4A9YA 4Y83A 1PYXA 2EB3A 3L9LA 3LCKA 5C9CA 4AU8A 4B9DA 4C35A 5GJGA 3GCQA 4BWXA 2IVVA 4EHGA 3ALNA 5EDPA 4F70A 5LMKC 2ZOQA 4FKSA 5D11A 2OXXA 4GU9A 5EYKA 5AWMA 3VS6A 3H10A 3FXWA 4KIKA 5AR8A 1M2QA 3TNQB 4R6VA 1PMVA 4R3RA 4IW0A 5IH6A 5C01A 4FV2A 1FGIA 2UZOA 2YM8A 5CENA 3PFQA 4X7QA 2VX0A 4FKTA 1OGYA 3V8TA 1QPEA 4H1MA 2UW6A 4O7NA 2XAMA 4YJRA 4UMTA 5K5NA 4ASZA 3LFCA 4EOIA 5JQ5A 4LL0A 5D7VA 3UIXA 4GK3A 3VUIA 4A9TA 1QMZA 4FT3A 5M4FA 1Q41A 4ZZOA 3VS4A 4BDFA 1SNXA 2R7IA 2C47A 5KMNA 3O71A 4RIXB 5AR7A 3NAXA 2RSVA 5EKNA 2PU8A 1JVPP 3F5UA 3FPMA 1OKVA 4J8NA 5M09A 3F7ZA 3UJGA 4M0YA 4RBLA 3CXWA 2Z7SA 5C4LA 4U40A 3BGQA 3Q9ZA 2BFXA 3CS9A 4KABA 4F6SA 3QZGA 5IQDA 4TWPA 2P2IA 2X81A 5AM7A 2CNVA 4ASEA 2CNUA 3GU7A 3EHAA 2B9FA 4QTBA 3BYVA 1U46A 5BPYA 4XUFA 4RVLA 3V5PA 3WI6A 4ENXA 3KN6A 4AXFA 4PL3A 4O4EA 3N9XA 5HO8A 4OTQA 5M08A 3EN9A 4YZMA 5HE2A 5CSPA 1GY3A 4PMSA 1Y91A 1PF8A 2XNOA 1XR1A 3AXWA 2RFEA 3MWUA 3MFSA 4LRJA 4EKKA 2UUEA 3TKUA 3U9NA 2O65A 3VO3A 3QQKA 1H27A 1DI8A 4ZJVA 3SA0A 2IZSA 3C4XA 2JFLA 1MRVA 1M52A 3MA6A 4RMZA 5E90A 4DHIB 3JXWA 4RIWA 5LCJA 3ZM9A 4K1BA 1A06A 3DKGA 2X0PA 3I0QA 3ORTA 4L68A 5A4TA 5A54A 3PPZA 2JC6A 3TACA 2XNPA 4EYMA 2E9VA 4C4EA 5I4NA 2VTHA 2QLQA 3CQWA 4Y8DA 4HGSA 5DT0A 4A9SA 4DG0E 3P78A 4XV1A 5DOSA 3F6XA 4RJ5A 3TJCA 1OKYA 3DOGA 3Q9YA 4P5ZA 1BI7A 5B2KA 3NS9A 1ZXEA 4USEA 3MTFA 3W2RA 2ZDUA 2VWXA 5CS6A 4EZ3A 2C0IA 3JVSA 4LRMA 3PTGA 4CEGA 4MUQA 3RK7A 2GNHA 4NFMA 5AUTA 2P3GX 2HW7A 5E8TA 1KUTA 4CZUA 4JL9A 5KBQA 2O5KA 2J90A 5DYJA 5CZHA 5D41A 4FIIA 5M55A 4ALWA 4R3PA 5AV0A 4M68A 2PVNA 4RX8A 4EH3A 3IDCA 4JBQA 3R83A 3LW0A 3COIA 1YXVA 4MAOA 3PLAE 1YWVA 5IZFA 4EHEA 4DA5A 3LQ3A 1OL7A 3WILA 3BV3A 2BHEA 4F9WA 5CAPA 3DJ5A 2R3JA 4XYFA 5JSMA 4UYAA 3PP0A 4E3CA 4IADA 3BX5A 3C50A 3NUXA 2VWZA 4MXCA 4ALVA 2JDOA 5IG1A 1NA7A 3UYSA 5CSXA 4KB8A 3S00A 4NT4A 1UNHA 4EQMA 3DBQA 3V5QA 4R7BA 3C9WA 3OG7A 1AD5A 4FV7A 5HNIX 2HXLA 3CLYA 3TV4A 5IH5A 5IMXA 3W2QA 5KHWA 3OMVA 5IQAA 3UC3A 3OY1A 3H9OA 1OKWA 4NU1A 2AC3A 5ACBC 5LWNA 4KS8A 2VV9A 2VTMA 2OIQA 1RE8A 3GCVA 4F9BA 4G1WA 4CMTA 2BUJA 3UDZA 4ZTLA 4FX3A 5CWZA 3ORXA 4M67A 4O1OA 3ZH8A 2GHMA 4C61A 3QQLA 3VBYA 2JAVA 1XH6A 5HTBA 3NUNA 3IGGA 2W5HA 5EI6A 4BDGA 3QTQA 3VF9A 4CG9A 4U97A 4AOIA 3R71A 3DXQA 4H05A 3BQRA 3VUKA 5L6WL 4E4LA 4ACGA 4DH7A 2WMAA 4FV9A 4HCVA 3AC4A 5BVEA 3R7EA 4AXAA 3DQXA 3DZOA 5BUIA 2VTAA 3ZO2A 2VTJA 4C3RA 4O91A 4E7WA 4UN0C 2WQOA 1QPJA 3DBDA 3PUPA 3Q9WA 4BI2A 3HAVA 5IPJA 1XBBA 4FK3A 3K54A 2YACA 4IIRA 4NK9A 5HU3A 1PKDA 3CIKA 4X0MA 4YLLA 2BPMA 2RIOA 4A7CA 5JQ8A 3LMGA 1SYKA 2QOBA 3C4ZA 4FV5A 5KMMA 3UZTA 3W8QA 3AGLA 4LOQA 3A7IA 3PG1A 2VGOA 2H96A 3Q04A 4QD6A 1PRYA 1PXOA 4PWNA 4ZXTA 4LMNA 4Y85A 4ZY6A 2YAAA 3PJCA 2O2UA 3W16A 4U79A 1G8SA 2X0GA 3NWWA 5CVFA 3UYTA 4CKJA 3D7TB 2YCQA 5KE0A 5I5ZA 4OLIA 4FKOA 4APCA 3EIDA 5IH4A 4WRGA 2GNLA 2J4ZA 1R3CA 3EKNA 3MFUA 3DKFA 4MK0A 5AUVA 4ACDA 4I23A 4LFIA 4ZS4A 4CMUA 4LDTA 4BGGA 5J9YA 4PTGA 4ZSEA 5AUXA 5C8KA 3K5UA 2I40A 2W1GA 2WOUA 4DGOA 4QO9A 3Q5IA 2GPHA 3TZ8A 4MNEB 3RGFA 4AWIA 5LVOA 2G2FA 2RFNA 4D4SA 3Q6WA 2XRUA 4OTIA 3H9RA 2GQSA 2JITA 3ZBFA 3BWFA 3VS3A 2BHHA 1OBGA 4FV3A 4H3BA 1W83A 4FT7A 4IB3A 1ZRZA 4EWHA 2XCKA 2R2PA 3W0QA 3WYXA 4C59A 2B9HA 2UW3A 2I7QA 2SRCA 2ONLC 4DBNA 2VX1A 4L46A 4BDIA 2FGIA 3OT8A 4N6ZA 2HIWA 4DH3A 3C4CA 5DT3A 2E9UA 4N0SA 5HG5A 3TTJA 3V3VA 5AUYA 4BKZA 2UW8A 2XBAA 3FMJA 3AMYA 3UIMA 3NSZA 3QX4A 4W9XA 3W2CA 5J79A 2C1AA 1CM8A 3MY1A 1Q8YA 3SKCA 4C4HA 2C6IA 3EQFA 2HZNA 3HDMA 2QC6A 3G6HA 5K0KA 2Z2WA 3ZHPC 4QQ5A 2F7ZE 3QC4A 1ZZ2A 3WARA 5HORA 4F0GA 2YDJA 3KCKA 4CZTA 5GIOE 4MEDA 3GENA 3IGOA 4TWOA 3SD0A 4MWHA 3HEGA 4ANNA 3AKKA 4WBOA 4ALUA 5F4NA 4ACHA 3DB6A 1NW1A 3VUTA 1GAGA 3DFAA 2PMLX 2W4JA 2YERA 4KIKB 4CFWA 4I6FA 2I6LA 2XJ0A 4XV3A 3W2PA 5L2IA 4K77A 5GJDA 2HW6A 4RIYA 4RX7A 5JFXA 3RZBA 3LPBA 3R2BA 4RVTA 5E8YA 3V5LA 4HVIA 2OJIA 1Y8GA 5BUEA 2WOTA 2GHGA 3O17A 4G16A 3PY1A 3QCQA 4XH6A 5F20A 3FL5A 5A4LA 3HRFA 1Y6AA 5KO1A 3E5AA 3JY0A 4AF3A 4LI5A 5A9UA 2F9GA 3QRKA 4CLIA 4EOOA 4LGDA 5AA8A 5IU2A 3WZEA 3VONA 3DAEA 1YOLA 4C4GA 4XEYA 5L2QA 5JN2A 3HP2A 2ZM4A 3QALE 3EWHA 4IJ9A 4YTCA 3F88A 4K0YA 4ARKA 4ANOA 4TYHB 2ZV8A 3ZDUA 5HLPA 2FB8A 3KRJA 4OR5A 4BCFA 3MH3A 4DFBA 1RJBA 3Q2JA 4PRJA 4AFEA 4KA3A 1K9AA 2J5FA 5CU2A 1YXUA 4RVMA 4AW0A 3Q4CA 4D5KA 4MXXA 4FNXA 4NTTA 4QP2A 4KKEA 5DA3A 3OY3A 3MPTA 5EYMA 2BRHA 2JAMA 2X6EA 2JKQA 5HX6A 3RPRA 3PDTA 3DTCA 3MN3A 4QPAA 3BBWA 4O82A 3VJNA 4E73A 2BZHB 2DYLA 4GMYA 5IA4A 3LQ5A 4KUJA 1ZY5A 5AFVA 2C6EA 3H0ZA 3FPQA 1PKGA 4JAJA 4IVAA 1OI9A 4IACA 3ZDIA 1HCKA 2W1DA 5ANDA 4MQ1A 2QQ7A 4AA4A 3ZTXA 2Q0BA 3KULA 1FPUA 4BCPA 1CSNA 3KK8A 4YNOA 4ZSGA 2GFCA 4CCUA 4D2VA 4O81A 4RIWB 5ANIA 3MW1A 3VBWA 4EOJA 1B38A 3QTRA 4D58A 3BLAA 4O1PA 3AMBA 3BWJA 3SXFA 2VU3A 4G6OA 4NM7A 3D5WA 4IHPA 4BN1A 3G0FA 3ORPA 5FEDA 3BE2A 2VO6A 4RC4A 5GZ8A 4IAYA 1H0WA 3TIZA 4O0UA 4ENYA 3ZRMA 4ERKA 1Z9XA 4MCVA 4Q5HA 5I0BA 5F9EA 3UGCA 4CKIA 4DGMA 3HAMA 5AP1A 2R9SA 3A4PA 5KKRC 5AEPA 4JRNA 3UQGA 3KVWA 3FY0A 1O6YA 4HNIA 4QMXA 5GIPE 2C6OA 3QC9A 4F63A 4E1ZA 3A7FA 1NVSA 1X8BA 3AMAA 3CKWA 3D15A 2HY81 2W9FB 3QTZA 5HCYA 2QODA 5JZJA 2R3MA 3KRWA 4QTEA 3FSFA 5AR2A 4PTEA 1LR4A 3FZSA 3FQEA 4FOCA 3UNKA 3GFWA 2W96B 4G3DA 3UVQA 4UALA 4TPTA 5H8BA 4O7WA 1M17A 3R8MA 2B4SB 1TFFA 4QMLA 2HWPA 3DK3A 3PZHA 2R3OA 2R3QA 2FSTX 4IWOA 3GGFA 5HESA 2A2AA 5DI1A 3A2CA 2X2KA 1KE7A 2HZ4A 5HI2A 4ANBA 3TNPC 3A7HA 2C5NA 2W5BA 2WTKC 4O2PA 4O7SA 2ETRA 3FY2A 3MV5A 4IZYA 3UZRA 1GOLA 2W4KA 3V6SA 5E1SA 2J0LA 4LYNA 2X4FA 3E8CA 4EONA 2JIIA 2W06A 4K11A 4GJ2A 3QGWA 3VS7A 1W0XC 3O2MA 4RG0A 3HRCA 3L9PA 2BDFA 5LJJA 4CZYB 1P2AA 5KUPA 3FLSA 3ZO4A 2CKPA 2J6MA 1TVOA 4GG7A 5CI6A 4BYJA 3BEGA 4K18A 4NWMA 1R0EA 4EI4A 1OECA 3TZ7A 5KMJA 2GS6A 4NUSA 4ANMA 4AZSA 4BF2A 4DHZA 2G2IA 3UP2A 3D5VA 2B9JA 4L9IA 4XG3A 1OZ1A 1OPKA 5GINE 2OJGA 2VGPA 1REKA 1H1QA 3GU8A 3PVUA 3R04A 3W0OA 5HO7A 4O0XA 3FMDA 2X0OA 1LEWA 2XK3A 3R1NA 3S95A 4X3FC 1GZNA 2IJMA 3ID6C 4HVSA 3OWPA 4OTWA 4P7EA 4EOQA 1XO2B 2G01A 4UB7A 5AP3A 5DH3A 1QPDA 1UKIA 4WG3A 3UIBA 4GRBA 3UDSA 1XH9A 5IQCA 4FKJA 4FKPA 2W17A 5I3OA 2XIXA 3RPYA 4Q9SA 4IFCA 1FVRA 4LUDA 4DEGA 5JK3A 3LHJA 4BI0A 3TXOA 2RG5A 4PDSA 2J51A 4ITHA 4BCOA 4RIXA 1G8KA 4IZ7A 3VRYA 4YLJA 1PXMA 1WAKA 2PMIA 3E8NA 1YI6A 4FBXA 4Y5QA 3GBZA 3QKLA 5A6OA 3R7IA 5EDRA 4BBFA 3P1AA 4K33A 2VTQA 4AN3A 2BDWA 3MY5A 5HG7A 3TNHA 5I9UA 4BDKA 4DEAA 4KKHA 3LCSA 4FTLA 1NXKA 4WHZA 3HDNA 4QNAA 4BWKA 3N4VA 4J98A 4QP3A 4E6QA 2WMTA 4LRKA 3THBA 3E93A 4NKAA 3A8XA 5JGDA 3Q96A 4MF0A 2QOIA 3VJOA 1APME 1U59A 3IW6A 4KINA 3EL7A 2P55A 4L01A 5TT7A 5LWMA 3MJ1A 2YCSA 4FKGA 5EI8A 2GQGA 4IB0A 4ZTSA 4EUTA 5CT7A 3KXNA 3AC3A 3P7AA 3NUUA 4QEBA 2XEYA 3QCXA 1W2CA 2A98A 3BEAA 1GIHA 3FE3A 4FV4A 4GS6A 5HLNA 4IEBA 5H2UA 1ERKA 3QTIA 4BCIA 3COKA 3BU3A 4WUNA 4RLKA 1PY5A 2IW6A 3MH2A 4MXYA 4X2FA 3BLRA 4BIBA 4C37A 4ZY5A 5ANKA 2C6DA 3E64A 4QMNA 4C4FA 2W1FA 4FTTA 2UW4A 3E3PA 2XK4A 4ZJIA 2IG7A 3TZMA 4TW9A 5LVPA 5DNRA 4FKVA 3AD5A 4QTAA 4DGLC 5BYLA 4FIFA 3IDBA 4QPSA 4FI1A 4UXQA 4BR3A 4MF1A 1Q8WA 5HG8A 4FTQA 3R7GA 4FVRA 2WTVA 3RAWA 2ITUA 3FHRA 1YHSA 5L2WA 4BTJA 3PPKA 3NNWA 2ERZE 4FKQA 3I79A 4FSZA 4FT5A 4P4CA 4ZEGA 3BYUA 4NZWB 3FMLA 3I6WA 4ZTQA 4F9AA 4I6BA 5DIAA 2EB2A 3ANQA 3DTWA 4X2NA 2X7OA 4C38A 4I24A 1BLXA 2PVHA 2ITQA 1IR3A 1OPJA 5EKOA 2GMXA 4II5A 4YSJA 2NO3A 3KRXA 3Q2MA 5DR9A 4Z7HA 4F0FA 3FMMA 1B6CB 4F99A 3Q60A 2QOQA 4GIIA 3QUDA 4YJOA 3SLSA 3FZRA 3H9FA 4LL5A 2IZUA 4EBWA 3O51A 4MBIA 4AGDA 2FSMX 3FLWA 5JT2A 5KKRB 4NH1A 5DWRA 1ZWSA 5IEXA 1HOWA 2XIYA 4YTHA 1H4LA 2C4GA 4CV8A 4IH8A 1IEPA 1E1VA 3E87A 3U6IA 4MXZA 3WE4A 2C5YA 4G5PA 3W32A 1IA8A 2J7TA 4AACA 3RHKA 5G1XA 3LJ2A 4J53A 4M66A 4UMUA 3WZJA 4JDIA 3MVLA 3W1FA 4XG8A 1YQJA 4RZWA 2VWBA 4UX9A 4MH7A 4WNKA 1RQQA 4J71A 4F1OA 3FMHA 3P5JC 4BCMA 2UV2A 5G6VA 1Y57A 4I93A 3R8LA 1XBAA 1IAJA 1MP8A 4FV6A 3FXXA 5JGBA 4OTFA 3CCNA 2XNEA 2UZBA 4FKIA 4I4EA 5IQEA 1SNUA 2YABA 4PUZA 4DEDA 4DFYA 1Y6BA 4QQJA 2X2MA 3LCTA 4O7VA 3P08A 3QLFA 5E9EA 3OP5A 2FO0A 4J7BA 5C03A 4O2ZA 3ODZX 1HCLA 2YWVA 4OBPA 4U5JA 2Y4IB 3W18A 2OKRA 5EOLA 3D7ZA 5CEPA 3W55A 3PG3A 4TYEA 3TM0A 4AX8A 5HD4A 4DDIA 3FXZA 3KXHA 4I6QA 2C68A 1TZDA 3QQFA 2OIBA 1BYGA 4JAIA 4TYGA 4ZTNA 4CRLA 3OFMA 4S2ZA 3KC3A 3ZCLA 1ZYJA 4GUBA 4U41A 1VR2A 4CFVA 3TJDA 3DLZA 4BDHA 5CVGA 4ZOGA 4JR3A 5FQDC 2W5AA 5AUZA 4QOXA 3KA0A 2P0CA 2YAKA 4TWNA 1S9JA 5GJFA 1H00A 2R4BA 5DBXA 3SAYA 1K3AA 5K3YA 5M57A 3G6GA 3BYOA 4YZBA 1ZMVA 4JT3A 3WIGA 5M56A 3BGZA 1RDQE 4ZTMA 4AA5A 2OJJA 3P23A 5J9LA 2BRNA 2BVAA 4JIKA 3SQQA 5T68A 4L42A 2AYPA 3CQEA 2YEXA 5TF9A 4ZSAA 4X3JA 3DFCB 3EYHA 4E4XA 1U5RA 3NNUA 4JI9A 3EFWA 3OWJA 5L6OA 3NEWA 4WOVA 1RW8A 1JKKA 3G2FA 4L45A 4B8MA 4DDGA 5DGZA 1QCFA 2X7GA 4KKGA 2JGZA 1URCA 2OWBA 2V62A 1W82A 3RKBA 3QTSA 4UZHA 2W1ZA