4RJ8A

Egfr kinase (t790m/l858r) with inhibitor compound 8
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
322
structure length
298
Chain Sequence
b'EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEDMDDVVDADEYLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of Selective and Noncovalent Diaminopyrimidine-Based Inhibitors of Epidermal Growth Factor Receptor Containing the T790M Resistance Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 298
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rj8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rj8A01
4BCIA 3A61A 2QODA 4ZSAA 4D0XA 4CQEA 3BBWA 1L8TA 3ALNA 3HMPA 2PVFA 3RK5A 3QTUA 4A4LA 4C37A 3VS1A 4E1ZA 4JX7A 1P4OA 2YDKA 4U97A 5KX8A 1H1RA 5DR2A 4DLIA 2IZRA 3IQ7A 1XH5A 1SNXA 2WEVA 4BZNA 4GYIA 5EM6A 3FPQA 3RCDA 5IU2A 4BDKA 1ZMVA 1J1CA 3C0HA 2QR8A 4FV0A 4IWPA 3NW6A 3PJ8A 1O6YA 4NZWB 2ERKA 4QTAA 2BZKB 3Q9XA 2BILB 1UNGA 3V5JA 4TWOA 2JKOA 4AZVA 2JFLA 2UW6A 3OY1A 4C33A 5HEZA 2X1NA 3B2WA 5D12A 2OF2A 4BDIA 3PDTA 1ZOHA 3A2CA 3I6UA 1YDTE 3UNJA 5J9ZA 3NZ0A 4X6RA 2YEXA 4AZWA 4CFFA 3UO5A 4RJ7A 3FZOA 2XIXA 1MQBA 3FYKX 1ND4A 4ENXA 4ACGA 3ULZA 3QUDA 4O2ZA 4LRKA 4EZ7A 4LOOA 4M0YA 4PWNA 1G8SA 4WNPA 4FL2A 1Q8ZA 4XV3A 1JSTA 2XK8A 5IZFA 2Z8CA 3HMIA 5JRSA 3COKA 2G1TA 4BC6A 1ZYJA 4D2SA 4LI5A 2QOQA 2XKEA 2RF9A 1XH8A 2E9VA 5FDPA 2Y4PA 3O50A 2XK7A 4FKOA 5CY3A 3N4VA 5M08A 1Q8WA 3U51A 4ZZOA 5LVPA 4BBMA 4BFMA 4NFNA 1REKA 4E26A 4GH2A 5FXSA 4GRBA 2C4GA 3C4EA 2GPHA 3MJ1A 2I0VA 4DH1A 3N4TA 1H01A 4XNEA 4F9WA 4HYHA 4DFZE 2V7OA 3U55A 4ZJJA 2QNJA 1JSVA 2ESMA 3UODA 4IWOA 4O22A 5FQDC 4AT4A 1ZLTA 4BCPA 5CXZA 2OIQA 3L9LA 2IVUA 3H0YA 1SZMA 2VTAA 2OZOA 2UZEA 2W1FA 3QCXA 2QLUA 1AQ1A 3DAJA 4P2KA 4YC3A 5JGDA 2WTKC 1P2AA 4F09A 5EYCA 1BL7A 3NX8A 2HENA 4G3CA 4QTBA 3DDQA 2VTJA 3P1AA 2FYSA 3QF9A 2QOIA 5BPYA 5LMBA 4L7SA 4MXAA 4IFGA 3AQVA 4ZSJA 4Q9ZA 4L8MA 2VZ6A 4QMLA 2GS7A 4IBMA 4R1VA 4C3FA 2EB2A 4A9SA 2Z7LA 3WZJA 4DLJA 5BUEA 2XNGA 4IZYA 1OIYA 2F2CB 3O7LD 4GG5A 4CZUA 2CNQA 3RM6A 4PDPA 4O6EA 4GL9A 3PYYA 4AE6A 5G1XA 4X0MA 2NRUA 3QFVA 3P08A 5JGAA 4FE2A 4YJTA 5CSPA 1IASA 5JFWA 2CSNA 3NYVA 4F6WA 2R3FA 4CGAA 3KXHA 4L00A 1QPDA 2I40A 3FJQE 1PXIA 5D7VA 4L3PA 3PP1A 4EHEA 4JG6A 2F9GA 3OVVA 4S32A 2WMAA 2OFUA 4YJOA 1JLUE 2BALA 3UPXA 3C4XA 2ZV2A 3POOA 4D1SA 4FTCA 2HYYA 1J7UA 3SG8A 1YVJA 2YM5A 4XX9A 2X2LA 1JPAA 3HP5A 3BU6A 5BYZA 2CGVA 5DT3A 4YO6A 4I5HA 2CKEA 4J97A 4LFIA 4EKLA 5KHXA 4R78A 3PXRA 4RLLA 4C4JA 2RFEA 3HVCA 5BMSA 3HRCA 4PTGA 3VS0A 4F64A 5A46A 4RQVA 4LOPA 3NUSA 2J51A 4XEYA 3FC2A 3R8VA 4PRJA 3QQFA 4L45A 3QTZA 1XHAA 3L9NA 4WD5A 2PWLA 2JDOA 3E3PA 3OHTA 4FUXA 3SGCA 4FIIA 3LFSA 3QZHA 2OZAA 2X8IA 2R3OA 5BVNA 3IGGA 2YJSA 1R39A 3BE9A 4S34A 4M15A 4RA5A 3FMEA 5C8MA 4AQCA 1LEZA 4MK0A 1JOWB 4MYGA 1FQ1B 5F9EA 3EN9A 4O86A 2XF0A 3I7BA 5K3YA 3V8TA 1Q61A 2XK4A 1BMKA 4EL9A 3LJ0A 5HIEA 1S9JA 4JX3A 1M2PA 3CE3A 2C0TA 4EH7A 5I9WA 4AUAA 2HXLA 5IA4A 3UMXA 2OU7A 5JEBA 4I4EA 4MCVA 2VO6A 4Z16A 4G31A 3CPBA 5AR4A 4FSMA 2GNGA 3R8UA 1ZZ2A 4Y46A 5A14A 3UOJA 2YERA 2IVSA 3LJ1A 4NUSA 5HLPA 3RZBA 4A7CA 3UIXA 1M2QA 3RVGA 1R0PA 4J98A 3GCQA 3ORZA 4KINA 2CCHA 1F5QA 4X2GA 4PPCA 4AG8A 4BBEA 4QQJA 3LQ3A 1XO2B 2V0DA 2ZB1A 4IB5A 4K18A 4NYEA 3IW5A 4FTOA 1CM8A 2R0IA 4R6VA 5FD2A 3TJDA 3MFTA 5HCZA 2RGPA 4RJ8A 3OG7A 3ZXTA 2W1CA 3FE3A 4HGTA 3Q6WA 3QQUA 4R3CA 4KABA 3U54A 3U87A 4ZY5A 5F1ZA 4X7QA 1ZAOA 4YTFA 3PTGA 1Q8YA 3NMUF 3TUBA 4TNBA 2XEYA 3LM5A 4IHPA 4J8MA 2C47A 4C58A 2W9FB 3ZDIA 4DEDA 3HP2A 2WHBA 3OP5A 4ENYA 3EWHA 4XG8A 5IQBA 2QKRA 5FTOA 5HIBA 4ITHA 4IEBA 4H3BA 4D9UA 2CGXA 1JNKA 3OBJA 5K5XA 3LFDA 4GCJA 5HBEA 4EK8A 2C3IB 4X2KA 2R9SA 2GNLA 4J99A 4Y8DA 4DHFA 2R3MA 4PMMA 3M11A 3R9DA 4C0TA 1FVTA 3HDMA 3IDBA 2HWOA 5CEMA 3QTQA 4G6LA 2Y9QA 2UZDA 3F2RA 4O84A 3HAVA 2QU5A 5LMKC 3REPA 4WHZA 1Y6BA 3QL8A 3HAMA 1M52A 3EHAA 3KULA 4XP0A 1WAKA 3FI8A 5AM7A 4FSQA 4WRSA 4XG6A 1DM2A 4QYEA 2JC6A 2OO8X 3TIZA 1B6CB 4F1OA 4BIBA 4RJ6A 4L43A 1AD5A 3KXZA 3VBQA 2J90A 1VEBA 4YNEA 3ZFXA 3EQPA 5EHOA 1K9AA 3C5IA 1ZYSA 4FKPA 2BHEA 5HVJA 2EVAA 3ZC6A 3PE2A 4YJPA 1ERKA 4CV8A 4XV2A 2BKZA 2C0OA 3F61A 4FV9A 5C9CA 4J71A 3ZRMA 4E5BA 4X2JA 4I3ZA 2W99B 2F7EE 2O2UA 2YHVA 5J7HA 3R83A 1BKXA 4RFZA 2OLCA 2WGJA 4XCUA 3THBA 3KA0A 4YP8A 3D2KA 1R78A 2C5NA 3IW6A 3PVBA 1A48A 3ZSGA 1XH7A 3DQXA 3FLQA 4IXPA 3V5LA 3LFCA 5AP4A 4ZTSA 3QUEA 1JWHA 3LAUA 3VN9A 4H1JA 2GS2A 4KKEA 2PZPA 2HCKA 2QOBA 3V04A 5BUIA 2J0LA 4AOTA 2Q0BA 4MXXA 4Q2AA 4IB0A 3U4WA 2CNUA 1NA7A 4EUUA 2QCSA 4CSVA 3IKAA 1CKIA 5JQ5A 2PMOX 2ZM3A 5DEYA 4EOMA 2WAJA 2JIVA 4DT8A 3OW3A 3TCPA 3DQWA 4PQNA 2R0UA 3D0EA 2QO7A 3R1YA 4BDDA 5E7RA 1GOLA 2B53A 2B54A 3MVJA 1OUYA 3VC4A 3WYYA 3COHA 1OL7A 4FV6A 4CG8A 5A4QA 4RZWA 3KRRA 4E6AA 4HVGA 4WSQA 4EOQA 4FNZA 3EIDA 3OEFX 3IGOA 3GVUA 2ZJWA 2UZVA 3PA5A 3DLSA 4GT4A 1H1WA 1XR1A 4IW0A 2HK5A 2R4BA 5LWMA 5KZIA 5HNIX 2WTWA 5CWZA 3O8TA 3V5PA 4JBOA 3VNTA 1Q3DA 3DV3A 3COIA 5E91A 3UOKA 3ENHA 4IZ7A 3HZTA 4JDHA 3VS4A 3F3UA 5E8UA 4EQMA 2PHKA 3E92A 5IEXA 5H3QA 4UN0C 4QYYA 2PVYA 5LOHA 1DAYA 3R1QA 2ZOQA 1ATPE 4O7TA 3F2NA 3QQLA 3ZUTA 3POZA 3CBLA 2AC3A 4YMJA 3Q4UA 4N6ZA 3ZS5A 1Y91A 4Z7HA 4FT9A 3TWJA 1UNHA 3DBQA 4O6LA 4UV0A 1NVRA 4NT4A 1OL2A 3WZDA 5CF8A 4O2PA 1XWSA 5J95A 4O21A 2BPMA 3EN7A 4NIFA 3DBEA 5D9HA 2BROA 4QMYA 1URCA 3IG7A 3TV6A 4HVSA 3DS6A 3KN6A 3QALE 3BZ3A 4G6OA 4O1OA 2CCIA 2VTLA 4N4SA 4BBFA 3CQUA 5CU4A 4FTJA 3H9FA 4AGDA 2X4ZA 4EI4A 4MKCA 4A4XA 4BL1A 3CIKA 3G9NA 2X8EA 3R9OA 1KE7A 4FNYA 4Z7GA 5CANA 3HRBA 5IQIA 5HO8A 3V51A 4C8BA 5AP5A 4E4NA 2O3PA 2XJ0A 5K0XA 4TW9A 4EHVA 2ZMDA 4G5JA 3WE4A 5CAQA 4IVDA 1YXSA 2ZM4A 4EH5A 4KWPA 3VW6A 4MQ2A 5KUPA 4FKQA 3VS6A 4G9RA 1O6KA 3NUYA 4MF0A 3W33A 4WNMA 5L4QA 4MHAA 3EKKA 5BMMA 3COMA 4K8AA 1LUFA 4FL1A 1YHSA 4XP2A 5TKDA 2H96A 3MPTA 3VRYA 2Y6OA 2VTMA 4NCTC 2GTNA 2BCJA 2ZM1A 3ZU7A 4FV4A 5CSWA 1APME 1OIUA 4C38A 3BGZA 4O7RA 3P9JA 2X2KA 2C5YA 5CZHA 3MIYA 2WQEA 5DFPA 3R9RA 1FOTA 4D2PA 4ANNA 3QHRA 4CT1A 5DYJA 3WOWA 3VUGA 3TZMA 1WVWA 5KNJA 3O96A 1OM1A 3PPZA 4W9WA 3HMNA 2WQBA 4J53A 4CFVA 5L8JA 2PZRA 2YM4A 3FLSA 4D4VA 3ROCA 4ZTQA 4AZSA 1ZOGA 4AW2A 4NW5A 4NJDA 4LRMA 2O65A 2VRXA 1FVRA 2JD5A 4GYGA 4DE4A 4L46A 4O0RA 3GC0A 1ZWSA 3TM0A 3W2QA 4YLJA 4DITA 2BRHA 1JKTA 1SMHA 3PJ2A 4RC3A 3HA8A 4LOQA 4RWIA 1RQQA 3M1SA 5DT4A 1MQ4A 2ZMCA 1UWJA 4XG4A 3LFNA 1A06A 4IAIA 3LFAA 4WIHA 5C8KA 4PMSA 5FUTA 5I3OA 2VWIA 4IB3A 2BTSA 3BYVA 5T68A 3W8LA 2I0YA 4N70A 4YLLA 3MESA 4MNFA 4EOPA 4GEOA 3HL7A 2FUMA 1UKHA 2FSTX 5DVRA 4M69A 5HTBA 3DTWA 1OUKA 4OBQA 2XJ1A 4EH2A 4FG7A 5HE2A 4EK5A 4WNKA 4RJ3A 4F6SA 2P0CA 2KULA 4FTNA 1IA9A 4UYNA 2VN9A 2QC6A 3QX4A 2X9FA 3QZIA 3R21A 4HPUE 2SRCA 2VWWA 3FQHA 5L8LA 3P78A 4F99A 3DB6A 3R22A 4Z9LA 3HV3A 5KE0A 5CALA 2R64A 4IX3A 4EJNA 4WO5A 3ULIA 5IA2A 2UZBA 3MTLA 3NCGA 4S31A 2P55A 2QOCA 3FKLA 4G3DA 4HCUA 4U43A 3BCEA 2YDJA 1R3CA 1ZY4A 2C5VA 4FVPA 4EWQA 1GZNA 3F7WA 3DXNA 4DEAA 3VRZA 5EYDA 2C6MA 3LJ2A 5BYLA 4K77A 4ANBA 2GDOA 4BDAA 4F63A 2WMUA 4IX5A 4OTQA 2B7AA 1H4LA 4XG2A 2UZTA 3H30A 1ZYLA 1PW2A 2UVXA 4B0GA 3PJ3A 4Q9SA 5J87A 3OMVA 5FXRA 2GHMA 4M13A 4YU2A 3R63A 4AA4A 4AF3A 4DGMA 4L3JA 4P5QA 4QMWA 3ALOA 5KMLA 3WARA 2ETMA 4U79A 5FP5A 1UV5A 3ETAA 2WXVA 4FL3A 4IE9A 2QONA 3P23A 3K3JA 5L3AA 4XH6A 3AD6A 3B2TA 5EM7A 2Q83A 3TTJA 4K2RA 4ASDA 5KBQA 5AAGA 3BLQA 2XNBA 4I5CA 3MVMA 4ZTMA 3FSKA 3TN8A 4IQ6A 3MWUA 5M4FA 1UWHA 1OBDA 3IONA 1WBTA 3QTXA 3F5XA 2EU9A 3S4QA 5AP2A 4AOIA 3KMWA 4FI1A 1Q24A 3MYGA 3PVWA 4ORKA 4C62A 3RWQA 2JDVA 4EQUA 2BVAA 2PZYA 2HXQA 3BEGA 2UW9A 4YZBA 3Q6UA 4RBLA 2YAAA 5AP1A 3LLAA 4CCBA 3QTRA 5K4JA 4KA3A 2UV2A 4FSYA 4KAOA 2ITXA 2PE2A 2PVKA 1DI9A 4FSRA 2J5FA 2QO2A 2XBAA 2WTKB 3NNWA 4FEVA 4WG3A 1RE8A 3FQSA 4IH8A 3NIZA 5JRQA 2Z2WA 5A4TA 5AR5A 4YO4A 4D9TA 2WMSA 2PYWA 4GIHA 4WRGA 4I6FA 4FTRA 4K11A 5EDPA 5H2UA 1UU7A 4IB1A 4BKZA 4DEBA 2GFSA 1XH9A 3A7IA 3GOKA 4EJ7A 3CR0A 3OCSA 4PV0A 5E8ZA 5A4CA 3ZONA 2I7QA 3BELA 3L8PA 3L8VA 2BRGA 3QD0A 1OZ1A 5DRDA 2PULA 3I60A 4OT6A 4M0ZA 2VGOA 4CCUA 4LGHA 4HJOA 4EH9A 4QMUA 4QTEA 2X2MA 3FXXA 4KRDA 5M09A 3NAYA 4YZNA 3PP0A 2W1HA 2XIYA 4GT3A 4M7IA 5LMKA 3JUHA 1XH6A 1YI4A 3HLLA 2RFNA 4H39A 4U81A 5K9IA 1VJYA 3HMOA 2UZNA 5L2IA 4L01A 5D10A 4U3ZA 3Q9YA 2QD9A 4R7IA 4TT7A 1F3MC 1NVSA 4BCOA 2R3QA 3WI6A 3WIGA 4AZEA 3MIAA 2JKKA 2W5BA 3QKMA 3LW0A 4TYEA 4EYMA 5HG7A 5ACKA 3FXWA 2RKUA 3II5A 5CYIA 2ITOA 1H0WA 4OBPA 3S1HA 4C4IA 3W16A 3G0FA 3G33A 3GGFA 4AS0A 2PUPA 4FMQA 1RW8A 3BYUA 3BYSA 1JKSA 4GW8A 5D7AA 4GJ3A 2HY0A 5AEPA 1ZY5A 1OITA 5J1WA 2CKOA 3GEQA 2Y6MA 5EW9A 2YLFA 4APCA 3FY2A 2R3HA 4NTSA 2BAKA 5E9EA 3CJFA 4I1ZA 4GKHA 1FBNA 4V04A 3CSVA 3ZRLA 4O38A 4XBUA 4BYJA 1W8CA 3KL8A 5JFVA 5C4LA 3C50A 4KBKA 2ZVAA 4FZDB 3FMJA 1YXUA 4O0XA 5DOSA 4CG9A 3ATSA 2EB3A 3CJGA 2R3IA 2WOTA 5DGZA 3L9MA 4C4GA 4MBIA 3BKBA 4AGCA 4DCEA 5J1VA 3GQIA 3ZO1A 3E64A 4I6BA 4ALUA 5JFXA 5AP7A 2UW3A 4CMOA 3NUPA 4LMNA 1MUOA 5KMOA 4JQEA 4AN3A 2Q0NA 2VTNA 1H26A 1V0OA 5E8XA 1X8BA 2JKMA 3DZOA 3BHYA 2WTDA 3LXKA 4YJRA 5IQAA 5HI2A 3VBVA 4FZ7A 1PXJA 2XIRA 5AUYA 3GU7A 3KC3A 1H00A 3TUDA 1K3AA 5DNRA 4NM5A 4EZ3A 3R7YA 4HCVA 5KBRA 5AM6A 3HKOA 2GTMA 3KU2A 2VX1A 1JAMA 4DT9A 2P2HA 3D2IA 3SQQA 3DPKA 3NSZA 2ZV9A 2BAJA 2REIA 5LVLA 4ANOA 4B8LA 3Q60A 3PA4A 4C35A 3U4UA 3K2LA 2B9FA 5CT7A 3VBXA 3QXPA 2YCSA 4O7ZA 5IQCA 3EN5A 4O91A 3ZCLA 5T6KA 3BYOA 4IC7A 2UVZA 4KIQA 5BVWA 4F7NA 5HGIA 5FTGA 3UYTA 5CEQA 3SA0A 3PIYA 2P33A 3OUKA 3C9WA 3QYZA 1AGWA 4FTMA 3U9CA 3UP7A 3MA6A 2XJ2A 4ZS0A 2GHLA 3E7OA 5L6WL 3CTJA 1YOLA 3PJ1A 4QQ5A 1STCE 5ANJA 2O0UA 2WMBA 4AN2A 4EC8A 3RCJA 4OAVB 1S9IA 2H34A 5M57A 4ALWA 4RGJA 4UXQA 4W8DA 3PA3A 5E8WA 4QMQA 4FKUA 3PG3A 4CFWA 5E1SA 4QT1A 1PMUA 5CAUA 4FTQA 4HOKA 4D1ZA 2IJMA 2EXCX 3W2OA 4AZTA 3NNVA 5BQ0A 1YXXA 3Q96A 4FK6A 4DTBA 4F0GA 5AUZA 4DGOA 2X39A 4MD8E 2XNNA 3R28A 2XNEA 3PY3A 5HTCA 2XKCA 3MA3A 3V5QA 3DY7A 4KRCA 4DTKA 4TYIA 3SAYA 2HOGA 3L8SA 2C6LA 4LL5A 3ERKA 4OLIA 1CSNA 3KK8A 4QOXA 4GVAA 4YZMA 3PWDA 4M68A 3BX5A 5DG5A 4EONA 3HEGA 5DH3A 2GNHA 4ZTLA 2IG7A 4QMTA 4XLVA 4A9YA 4YPDA 2H8HA 5CU6A 4FZ6A 4MX9A 3SW4A 4YJQA 4BZDA 4JNWA 2V7AA 4Z55A 1GZOA 3FZSA 3VUTA 4XOYA 3C4ZA 3DDPA 4JL9A 3R9HA 4QP3A 3WF8A 4HZSA 4N0SA 2R3KA 4OTPA 5CU0A 4D2TA 3RHKA 3V8WA 3U8WA 1XBAA 1JSUA 3TV7A 4NCTA 5HZNA 4RWLA 4H36A 5DHJA 2C3LA 3UBDA 1OPJA 4YJVA 4BGGA 3FL4A 2YIXA 2CGUA 5DR6A 5HICA 2AYPA 4ZZNA 2ZV7A 2QU6A 4DH5A 2JFMA 3PIZA 2IWIA 3G5DA 2BUJA 4J95A 5H8EA 3QCQA 1H24A 2C1AA 3UQCA 5C4KA 4E4LA 1T45A 2FSLX 2B1PA 3OOMA 4I23A 4K6ZA 5A4LA 4FIHA 5HLNA 5FBOA 1JBPE 5TR6A 4IZ5A 3Q2JA 2ERZE 3UO4A 3FLWA 2J5EA 4R1YA 2Y4IC 1YWNA 1H28A 2BFXA 2VUWA 4U42A 4YLKA 3GC9A 4PPAA 4TL0A 1OKVA 2X0GA 3BU5A 4UZDA 4ACMA 4HVIA 2R7IA 4IVBA 5JK3A 4M67A 2QOLA 4IVAA 2ITYA 2BKKA 5DMZA 4ZSEA 5ANIA 4DH8A 2VTIA 1UU3A 3FAAA 2XEZA 5GJGA 3RPOA 4ITJA 5IQGA 4MWHA 2F2UA 4LL0A 4OAUC 3KXXA 4BTKA 2RSVA 1OB3A 5M51A 5JT2A 3ZEWA 2WMWA 3D5VA 3ET7A 5HE0A 4RPVA 3U9NA 3JY0A 5CAPA 4AXAA 4O81A 4GK3A 5H9BA 5J79A 3HA6A 4F0IA 3Q9WA 3TV4A 4RQKA 3UO6A 3ZMMA 1BL6A 4CZTA 3KB7A 2V62A 3R7GA 2UZWE 4RT7A 5IA5A 2UVYA 4ID7A 3Q4CA 3SXSA 3NUNA 4S2ZA 5FP6A 3OEZA 4RVKA 3RNYA 1I44A 4DFNA 5KMMA 2QOFA 2F4JA 2WMTA 3EQFA 2R7BA 3CEKA 3FC1X 4DFYA 3GQLA 2OKRA 5ICPA 1FINA 2R3RA 3FWQA 5LARA 2QOHA 2G2HA 2OXYA 4BCHA 4EEVA 4PF4A 5M06A 3KK9A 4CYJA 1KE5A 4CFMA 2RIOA 4XG9A 3GXLA 4HPTE 4AT5A 3WILA 4A9UA 4RA4A 3A8WA 5L2WA 3MPAA 3Q32A 3FUPA 3RJCA 3EFLA 4A9TA 3DOGA 4FKJA 4QMOA 4D4RA 2F57A 4IM0A 4OBOA 1Z9XA 2YIWA 4GJ2A 4XBRA 3I6WA 3C1XA 3EJ1A 3AC8A 5LWNA 4DGGA 3OS3A 4D2WA 4OR5A 2WTCA 3D14A 3ZO3A 2GCDA 4K0YA 5EDQA 4ACHA 3G6GA 2GNFA 3D94A 4JBQA 4I41A 5CAVA 4JLCA 5EG3A 4BIDA 2LAVA 3SHEA 4U7ZA 5FG8A 3CTHA 4XUFA 1QPEA 3AC4A 2CN8A 5HVYA 3BV2A 4PL4A 2XK6A 4MBLA 4BN1A 3O17A 3V5WA 3GCVA 3ZO4A 1YWVA 3FHIA 1NXKA 3PY0A 3L1SA 3UQGA 4EORA 3DBFA 1SVGA 1GAGA 4KNBA 2P4IA 3MBLA 1UKIA 4KSPA 4RIYB 5CZIA 1URWA 3ZBFA 4E6CA 4EYJA 3BLRA 1PXKA 4WUAA 4C7TA 2E2BA 2XNPA 3JVSA 4FT5A 4EBVA 1OL1A 3DA6A 3TKIA 5DR9A 5EI8A 4G34A 2WMXA 3HV4A 4Y73A 3E62A 3AMBA 4R5YA 4FYNA 4GFMA 5IKWA 3LLTA 5AV3A 1WBSA 4RJ4A 4GG7A 3QD2B 5AV2A 4ZTRA 4YTHA 3QKKA 2ITQA 3BIZA 3V5TA 5IEYA 3DLZA 1HCKA 2JEDA 2YAKA 4J8NA 2YLEA 4P90A 4RIXB 4W4VA 3VO3A 4D1XA 4D0WA 4E5AX 3PXYA 4EC9A 4EK6A 4G3FA 3R8MA 1YOMA 3UNZA 3AT3A 3HUBA 3NW7A 4MBJA 3VVHA 4U6RA 3EFWA 3KRWA 3ZXZA 2YCRA 1KUTA 3JR1A 2JBPA 4QP4A 3A99A 4TKSA 5E8TA 4B6LA 3VUMA 4O27B 3FMMA 1OKZA 3MDYA 3KFAA 4FV5A 2J0IA 3PIXA 4PY1A 3QCSA 3T9TA 2WTVA 1M2RA 2WMRA 5M44A 2XBJA 2ITZA 3K54A 3TZ9A 5CU3A 5IUHA 1B38A 2IN6A 3MH1A 4A4OA 2YDIA 4AW1A 2WD1A 4UY9A 4FT0A 4GUEA 4YBKA 4RIOA 1R1WA 2J0JA 2QHMA 3R04A 3ZLXA 4AW0A 2OFVA 2OI4X 3MH2A 4G2FA 4RC4A 1LR4A 3AC1A 3R1NA 1GY3A 1H1QA 1J3HA 1VZOA 2A1AB 4E5WA 5IQEA 4F6UA 4L52A 3QKLA 4RJ5A 2FVDA 3RPVA 5B2MA 5FTQA 4FTLA 4USFA 1WBWA 3O0GA 5K4IA 5TE0A 3KCFA 3EZVA 2ITUA 2JIIA 3HGKA 3FMDA 4B99A 1NW1A 2C30A 3NNUA 4PTEA 3IOKA 4YGAA 5FDXA 1YWRA 3DKCA 4FEUA 2GQRA 2YABA 3PE1A 3GFEA 3RGFA 3E88A 4ZAUA 4U0IA 4JG7A 2J0KA 4NSTA 4C02A 5C26A 1Q5KA 1BI7A 2HWPA 4KIPA 2J6MA 4HVDA 3OT8A 2QG7A 5EYKA 2VNWA 3R02A 4FT3A 3DKFA 3PLAE 4JR7A 4QYGA 5KMJA 4FTIA 1O6LA 2OW3A 3HYHA 1BI8A 3RNIA 5IDNA 4F7SA 3AT4A 2PPQA 3QXOA 3Q9ZA 4MAOA 2BFYA 3EQCA 4IJPA 4DF3A 1KE6A 3NAXA 4FTAA 4O0TA 3MFRA 3K3IA 3EQHA 1RDQE 1UU8A 3BHUA 2YA9A 3O51A 4F65A 4FNWA 4D2RA 1XJDA 4FKIA 2V5QA 3SXRA 1OBGA 5DA3A 1YDRE 5JZNA 4FK3A 2WKMA 4RX5A 3G51A 4HCTA 4U9AA 1OL5A 3CGOA 4BDFA 5I9YA 2PVNA 4JDIA 4DEIA 1R0EA 1BYGA 2W5HA 4IAYA 3E3BX 1FGKA 4NU1A 3TJCA 4C57A 5JMSA 4OTDA 2JDTA 5AUXA 4DEGA 3PSDA 2WQOA 5CEPA 2GQSA 3QHWA 4ERKA 5EOLA 3DZQA 4ZJVA 1GIJA 3CP9A 4BTJA 4MXOA 4EH6A 3DNEA 3W10A 4FX3A 4G16A 4MNEB 4QP1A 3ORIA 4FSTA 4ONAA 2VX3A 3P86A 5ANEA 2C0IA 5HE1A 3UVRA 5JH6A 4IM2A 4U5JA 4ZEGA 2ETKA 3LE6A 3OROA 2BIKB 4C3RA 3BE2A 5EW3A 1PF8A 5A3XA 2YIRA 4OTFA 1YRPA 4FOCA 3EOCA 3DTCA 3WBLA 4JAIA 4PP7A 3LXPA 3DNDA 3ENMA 3QAME 3E87A 5JFSA 1CMKE 4FKTA 5F4NA 2PVJA 5CU2A 3D7TB 5LVMA 5CQUA 2H6DA 2G01A 4RG0A 4WBOA 4FICA 5D11A 4BF2A 3LVPA 3AC3A 3RAHA 3CC6A 3HRFA 3JVRA 4TWCA 5KHWA 5TF9A 4O7NA 5I0BA 2FGIA 2VWVA 3AGMA 4XYFA 1U5QA 4AU8A 4U80A 4UBAA 3Q4ZA 4I24A 4B7TA 1IEPA 3PVGA 4B4LA 4RX7A 3PWYA 5EI6A 4QTDA 4TYJA 3VUKA 3KCKA 4BCMA 3LFQA 1NVQA 1A9UA 5FXQA 3QD3A 4FIFA 4O7WA 1OIRA 3GU4A 5AUVA 4X2NA 3VBTA 4CYIA 3RBWA 4RMZA 2ZDTA 5HOAA 1U5RA 2IO6A 3OW4A 3CXWA 4F9AA 3PLSA 2V55A 4FNXA 2I1MA 4O0VA 4O82A 3S3IA 4H1MA 3F5UA 1SM2A 3CKWA 3FLZA 2OJIA 4QMVA 2ETRA 5AA9A 2QLQA 1TQPA 4J7BA 3MI9A 3RKBA 2W7XA 4ZLYA 3EQDA 1MRYA 5HLWA 3R7OA 3MH0A 4PMTA 3TDWA 2QKWB 2UW5A 1BLXA 4IX6A 4WOVA 2G9XA 4Y95A 4WG4A 2O63A 3DFAA 3UG1A 3F7ZA 4X6QC 2X7OA 1HOWA 3R8ZA 4P7EA 4QQCA 3SC1A 3IPHA 4CFXA 3EFKA 3IDPA 1XQZA 2PVMA 4L68A 1IR3A 4CV9A 1M14A 3QWKA 3DXQA 4DCAA 3IO7A 3WZEA 4I4FA 2JIUA 3F3TA 2VO3A 4HZRA 3K5VA 1KE9A 5HCYA 3ANQA 4HW7A 4AN9A 4XLIA 5FEQA 4D4YA 2ONLC 4O0SA 1M17A 5I4NA 4O7SA 5CEKA 5DLSA 5E8SA 1V1KA 2HZIA 3LCTA 4NL0A 3SRVB 4LQMA 4IFCA 2PUIA 5AP0A 4BHZA 3W8QA 2QOKA 4ZZMA 4BVUA 4L42A 3V6SA 4DGNA 5EK7A 3UVPA 4FA2A 2XYUA 2UZOA 4KKHA 3SD0A 1H25A 4HGSA 3RHXA 2ZYBA 4GK4A 5AAFA 1OVEA 2W17A 3F88A 4RVTA 3BQRA 4W4YA 5JGBA 3C5UA 2B55A 2X6DA 3T9IA 4PNKA 2YACA 3QA0A 2J7TA 2A4LA 1PXOA 3BPRA 3P5KA 4FIEA 4IDTA 5D1JA 2IVVA 2H9VA 5M4CA 5D41A 3EYGA 3QTIA 5BVFA 1PJKA 1XKKA 4EK3A 2WB8A 4GVJA 3RTPA 4BTMA 1KOBA 3R2YA 1SYKA 1Z57A 2XM9A 4R3RA 4YR8A 4G3GA 3T8OA 1VYZA 4FOBA 4XMOA 5M53A 1OGUA 1B39A 2CPKE 2PSQA 2DQ7X 3HX4A 3Q5IA 4L6QA 3W2PA 3AMYA 4O7VA 3MB7A 4M14A 3FLNC 3MSSA 4OTHA 5HNBA 3R7IA 3TIYA 5IUIA 4D2VA 1WMKA 3FPMA 5FEDA 1J7IA 2J0MB 4II5A 4CZYB 4EKKA 4KIOA 4FKLA 4YZCA 2E9UA 3CQEA 3RK9A 3PPKA 4I20A 5B0XA 5DE2A 3QQGA 3VJOA 2ITWA 3VUHA 2W1DA 2HW7A 1YI6A 5IG1A 4E6DA 4USDA 3SLSA 2YJRA 3WF5A 2HIWA 3N51A 3LCDA 1QMZA 3TEIA 3W2SA 4CMTA 3ZZEA 4DEEA 5KO1A 4PPBA 1OI9A 3HNGA 4O83A 5CASA 4TPTA 4C61A 3QTSA 5C01A 4AOJA 5HIDA 3ORNA 3R01A 4D28A 2OWBA 5LMAA 4CFUA 5EDRA 3Q04A 4DBNA 2W5AA 2PVRA 2X7GA 3NDMA 1V0BA 4M3QA 4BTFA 2YIYA 3W2RA 3ORLA 2Y7JA 4F1TA 4XV9A 1JQHA 3WE8A 4QNYA 3ZEPA 5E8VA 4FF8A 2VTSA 4S33A 4IWDA 4FEWA 3O71A 2RL5A 3CCNA 4DFBA 5A6OA 2YISA 4U8ZA 2UUEA 3UP2A 4BKYA 2P3GX 5DWRA 4P5ZA 2V22A 3GU6A 3QZFA 4AWIA 4Z3VA 3ZFYA 5AUWA 5C1QB 1PKDA 4TRLA 3NVKI 2B52A 4K9YA 4I6QA 4AT3A 2HAKA 2AC5A 3KY2A 3LXLA 3QGYA 1GIHA 4YTIA 1TQMA 4DAWA 3I1AA 3PXKA 4IAAA 1EH4A 1FPUA 3E63A 4FSZA 1OIQA 1J91A 4AX8A 1CKPA 4RIWB 3EYHA 4BICA 5E1EA 1P4FA 2BDWA 3QCYA 3A4PA 4QMZA 4QMMA 3FZ1A 5L8KA 3P79A 5AIRA 4FGBA 3ORXA 3EQIA 4QMSA 5BVDA 4LV5A 3VF8A 3QQKA 1Q3WA 3GI3A 2WOUA 4I21A 3CY2A 5A9UA 1OKYA 3GU5A 3MFSA 2XK9A 3LCSA 5AP3A 3UZRA 3FKOA 2YZAA 3EB0A 3ZO2A 2BRMA 2O64A 1WVYA 4YHFA 3HECA 3C51A 4YPSA 4EOLA 1IG1A 3FZRA 2OF4A 3NVMB 2X9EA 2WTIA 2Z7RA 4NWMA 4BZOA 4BRXA 4CKIA 3LFBA 5L6OA 4GU6A 2VTOA 4JT3A 1PHKA 3TG1A 4BCFA 3TTIA 2A19B 3RAIA 4C36A 1M7QA 4WKQA 5J7BA 3C0IA 5EHLA 3V8SA 1BUHA 3UNKA 1KSWA 1W98A 4AFJA 4ZLZA 2C6OA 2PE0A 3IW8A 4MH7A 4X3FC 2Y4IB 4RLKA 2XK3A 1NY3A 5KMNA 3ZHPC 3S00A 3ZDUA 3F5GA 4APPA 5AP6A 5I9XA 5B2LA 5AV4A 2C3JA 2I0EA 2JDSA 3ORPA 4NK9A 5IDPA 1PRYA 2X6EA 4GMYA 3KN5A 2WO6A 4RZVA 2WNTA 2OBJA 5J5TA 5GINE 4UWBA 3RWPA 2X81A 3DBDA 4DN5A 2BR1A 4FSUA 3H4JA 2Y8OA 3D7ZA 4ZXTA 4ZK5A 1U46A 4F1MA 1Y57A 2X4FA 4JAJA 5M56A 2JBOA 4AFEA 2XNOA 2YN8A 4CRSA 4NW6A 3TKUA 3ZSIA 4BHNA 4FVRA 2JAVA 2J50A 5GHVA 4DYMA 5AUUA 4ZMEA 3TL8A 4UMRA 3WF6A 1E1VA 4ASEA 4DTAA 3PZHA 4G9CA 3EMGA 3Q53A 3LOKA 4W8EA 3RI1A 4FIJA 1BX6A 2ITPA 4C4EA 3O8PA 3OT3A 2YCQA 1YXTA 2ZB0A 4UXLA 4AW5A 4QP8A 3F3WA 4Y85A 4BCGA 4BCQA 1T46A 2W9ZB 4FODA 3DKGA 4JJRA 3W55A 5IMXA 4CNHA 3MV5A 2HY81 4KKGA 4WG5A 2QURA 1WBVA 1W82A 3VBYA 3DJ5A 3F5PA 4CFNA 4QQTA 1UVRA 3G2FA 3AXWA 3GB2A 4FV7A 1W7HA 4NM3A 1WCCA 5KZ0A 4BCKA 3CGFA 1U4DA 3LFFA 3R71A 3EQRA 2GFCA 4XG7A 4EZ5A 2YCFA 1NT2A 3OWLA 3FBVA 3RPRA 4IAFA 1OECA 1YOJA 3F69A 5EM5A 2PMLX 2VWZA 2XYNA 4DFLA 3QRIA 5IA0A 4QYHA 2Z60A 4TYHB 3LPBA 2GQGA 4C3PA 5HESA 3UOHA 4IVCA 3BGQA 2CDZA 4CQGA 4F7JA 4AP7A 4O0WA 4V01A 5IH5A 4EH8A 5KMKA 2ZDUA 3E8CA 3ZH8A 5IUGA 2F49A 3QQHA 3ZLWA 1GNGA 5IPJA 2WELA 4U44A 1W84A 3QRKA 1KV1A 2ACXA 3MVHA 4XRLA 3QGWA 2BZJA 5ANGA 4ZSGA 3VIDA 4EOIA 1PXMA 3BQCA 3CD8A 2DUVA 4V0GB 3ITZA 3JS2A 4Q5EA 5EI2A 3QTWA 3CQWA 5HO7A 2Z7SA 3MH3A 4UWCA 3MPMA 3SV0A 2XVDA 3UC4A 1U59A 4XP3A 3C7QA 3CPCA 3VWAA 2UW8A 4FYOA 1MP8A 3LMIA 1OKWA 5HG9A 4LYNA 4E73A 3NW5A 4FZAB 3PVUA 5A54A 2Y0AA 3OTUA 4O7YA 3QRUA 4QP2A 3KVXA 3R30A 2XCKA 4W4XA 3I0OA 3KMMA 5DI1A 3SOCA 3RMFA 5JN2A 3NGAA 3DK3A 4EOOA 4FR4A 4D58A 1W0XC 1ZMWA 3OTVA 4E8AA 2ITTA 1L3RE 5A6NA 1IA8A 3BWJA 1PXNA 4FUYA 3NIEA 3NS9A 3LCOA 3UZTA 2WPAA 4IWQA 4X2FA 5DPVA 2C68A 3RPYA 3UIMA 5HU3A 1PY5A 4JDJA 5FWKK 3R7UA 3UG2A 3VF9A 3OXIA 5GJFA 1K2PA 4RIYA 3RAWA 5GJDA 3NYNA 3SDJA 5BX0A 5KCVA 3UQFA 1H07A 2FB8A 3F3VA 5E8YA 2PMIA 4RVLA 4RX9A 2B0QA 3UC3A 4ACDA 5B7VA 4E4XA 4MXZA 2DYLA 3FHRA 3MW1A 4FT7A 4G3EA 2A27A 3I5ZA 4Y5HA 5BUJA 1Q4LA 4I93A 2W4JA 2W05A 3ELJA 2UW0A 4Y72A 4ERWA 5C8NA 4O7LA 5HD4A 1Q99A 2OG8A 4ZY4A 2IW6A 3F66A 4MEDA 4USEA 4BGHA 4BDCA 2W4OA 4RIXA 3LM0A 4DH3A 3D5WA 5BNJA 3ODZX 2NP8A 5CTPA 4EH4A 3E7VA 3QQJA 2YM7A 4QPAA 5FEEA 4R8QA 2ITNA 1M7NA 4CLJA 5BVOA 2F7XE 5HG8A 3RZFA 3D4QA 5HQ0A 3C4WA 3KXNA 5IH6A 3U6JA 2GNJA 2OJFE 2YITA 4MVFA 4BDEA 1FVVA 3LHJA 4ACCA 4UZHA 2OIDA 3TACA 1TKIA 2ONLA 3ORKA 1FMOE 3OCGA 5IQFA 5FM2A 3KREA 3OZ6A 3EL8A 1TVOA 4N6YA 5HNGA 5C03A 2HELA 3KXMA 2BDJA 3O2MA 5CNOA 5CF4A 2IW8A 5DIAA 4BWXA 4CT2A 4YHTA 2OSCA 2X7FA 3PUPA 4MD9E 3NUXA 4JRNA 3GC7A 4WSYA 4RFYA 5CSXA 3DJ6A 5I9ZA 3VQUA 4I5MA 3FL5A 2Z7QA 4PX6A 4ZOGA 4M97A 5CI6A 3AC2A 3OOGA 4O0YA 3IK3A 3NWWA 4OTIA 4PDSA 4XS2A 2VTRA 1VR2A 3P7BA 3G0EA 3PXFA 3VUDA 3A62A 3VHKA 4I92A 4I0TA 3G6HA 4FKSA 4A9RA 5HO6A 3EZRA 4FV2A 1XH4A 5E92A 4PTCA 3JPVA 1FMKA 2BDFA 3ACJA 3TNIA 2VO0A 4NEUA 3FSFA 3H0ZA 5CF6A 4QD6A 1IAHA 3F6XA 4RSSA 4DH7A 4UEUA 3FZTA 4QMPA 2VTHA 4BY9E 4L53A 4EQCA 4FEXA 3ODYX 4M8TA 5HCXA 1PXPA 3W1FA 4NKAA 5JZJA 5HKMA 3N4UA 4NM0A 3EQGA 3C0GA 3UE4A 4KBCA 5HE3A 3AMAA 3VQHA 4AGWA 5FBNC 5LCKA 4WBBB 2UW7A 4GS6A 4ZMFA 5LVOA 3TUCA 2YWVA 2CJMA 4EWHA 3NUUA 3ZLYA 4RX8A 4F70A 3BHTA 3MTFA 2JDRA 4ANSA 4RWKA 4JBPA 5EHYA 3WZUA 4E6QA 5IQHA 4KB8A 4MD7E 3PJCA 4OTWA 4HYUA 4MTAA 5CI7A 1TQIA 2UZUE 3FI3A 4UMQA 3TNHA 2IZSA 5LJJA 3I5NA 3SXFA 4YSJA 4GFGA 2E9NA 3EN6A 3VS3A 3Q3BA 1GZ8A 3LXNA 4JG8A 4CXAA 5K5NA 2NO3A 2C6DA 4AE9A 4KS7A 3C13A 3D15A 5AJQA 2RFSA 3G9LX 2FSMX 3EN4A 2XH5A 3GCPA 1KV2A 3Q4TA 4G1WA 4LMUA 2WQMA 1Y8GA 2FH9A 4YJNA 3NYOA 1OMWA 3IW4A 3SKCA 5M4IA 5L6PA 4GT5A 3CKXA 4GU9A 3OFMA 4TNDA 3R00A 3PSBA 5I3RA 4F9YA 5H8BA 2A0CX 3NR9A 2PVHA 1WBNA 2VWXA 2VGPA 3VJNA 4MNEA 3W2CA 5CNNA 4IDVA 2PL0A 5IF1A 3KRJA 5GZ8A 1G8AA 4NTTA 3QD4A 4RWJA 4I6HA 3AD4A 4FKGA 1MRUA 2B4SB 3FY0A 3FZPA 5LVNA 5IH4A 3R2BA 1H0VA 4DA5A 4AACA 5EYMA 5F95A 2WIPA 3MY1A 2VWYA 1ZRZA 3C4FA 3R9NA 3KKVA 2PMNX 2XMYA 1OL6A 1ZOEA 4R5SA 4IADA 3KF7A 4ZIMA 5M55A 2FO0A 1W83A 2YM8A 3P4KA 5AV0A 3FLYA 5FRIA 2EUFB 2CLXA 4LV8A 5CENA 4HVHA 3ZLSA 4R7BA 3D7TA 4ZS4A 1PMNA 3UMWA 4DEHA 3UGCA 3AG9A 3V6RA 3R8LA 5CVGA 5AWMA 3PPJA 5TOZA 4NM7A 4NKSA 2XNMA 2CKQA 5AR8A 4R3PA 4UALA 3GCSA 1IAJA 4I94A 4J1RA 3KF4A 4E3CA 1SVEA 3FXZA 5EOBA 5AR3A 4C2VA 4C2WA 1YI3A 1XBCA 4JS8A 4YHJA 1ZMUA 4ZY6A 4IAKA 2VTPA 3TKHA 4CMUA 1WVXA 3GCUA 3HV7A 3P0MA 4K33A 2RFDA 5GIPE 1KE8A 3QUPA 4X3JA 3NEWA 4ARKA 2VNYA 3UJGA 2PY3A 2Z02A 3ZFMA 4FTTA 5ETFA 2I6LA 2HZNA 1UA2A 3R0TA 5EFQA 3ORTA 4QP9A 1DAWA 4ZLOA 4K1BA 2WTJA 1Y6AA 3Q2MA 2VWBA 4DC2A 3SG9A 3PXQA 2XM8A 5G6VA 4X3FA 3OCTA 4W4WA 4ZSLA 3UYSA 4DG2E 2XKDA 3DB8A 4F9CA 3OY3A 5GNKA 4RFMA 3ZZWA 5EQYA 4HNIA 3QRTA 2QHNA 3GU8A 4EBWA 3A4OX 3P7CA 4ALVA 1J1BA 3ZBXA 3DCVA 1WBOA 2OXXA 1GIIA 2R3JA 4FC0A 2QG5A 4I5PA 4YNOA 4BCJA 2WZJA 3BYMA 3N9XA 4KIKA 4E20A 1J7LA 3RK7A 3FEGA 3MB6A 2IVTA 3Q5ZA 2YZLA 5LCJA 3E8NA 1YDSE 4WUNA 4YBJA 3ORMA 4YJUA 3LMHA 3VS5A 2QR7A 5AFVA 3H9RA 3WF7A 1G5SA 4PDOA 4H05A 4ZJIA 1MRVA 4OT5A 5H8GA 3EKNA 4PL5A 4GUBA 2ITVA 5ETCA 4TZRA 4UMPA 2OIBA 2OICA 2NNWB 3SRVA 2WIHA 2PZIA 4M66A 4AZFA 4JRVA 3OBGA 5BYYA 2C6KA 4QP7A 4BI0A 1ZARA 5CLPA 4WA9A 2DS1A 2BZHB 3LQ8A 3BGPA 3OXTA 4G6NA 3WIKA 1JKKA 3QX2A 3ZRKA 4AAAA 3LZBA 3QU0A 4NH1A 1H1SA 3L8XA 4LUDA 5J5SA 3EL7A 4M84A 4MXCA 5KKRB 4FTKA 4UWYA 2ZAZA 2IPXA 1CDKA 1RJBA 2OZAB 4JI9A 4JR3A 3DBCA 3EQBA 3MFUA 3UIUA 3SOAA 3DU8A 3OF0A 3HV5A 3QLFA 1YHWA 3CLYA 4XOZA 4E93A 4XJ0A 4L9IA 4QMNA 3QLGA 2XRUA 4KS8A 4TYGA 5GZAA 2C3KA 4OW8A 4QPSA 3MVLA 4E7WA 3PFQA 4RC2A 2JKQA 4I22A 3KRXA 4OTRA 4U40A 2W1ZA 2C69A 3R1SA 2PTKA 2W1GA 3O7LB 3BHVA 3I0QA 4UMUA 4HGLA 1U54A 2HW6A 4IM3A 3KXGA 3ZM9A 2R3GA 4KBAA 4UMTA 3I4BA 5B2KA 3OD6X 4U45A 3GFWA 4DG0E 4EK4A 4MF1A 2RG6A 4DINA 5ITAA 4OUCA 4CD0A 3LQ5A 4LUEA 3VBWA 5HX8A 4C4FA 5TT7A 5EW8A 3GP0A 4H3QA 3AT2A 4GKIA 4UYAA 1PMVA 4MWIA 2B9JA 2VO7A 1I09A 1YXVA 4OTGA 3QBNA 4GK2A 2QVSE 3SX9A 3CD3A 3WF9A 5CF5A 1YKRA 2R2PA 1JKLA 3PXZA 4F9BA 5HU9A 3PG1A 2XB7A 3GC8A 4I0RA 2C1BA 4BWKA 4EH3A 5EH0A 2J9MA 2BIYA 4N57A 1UU9A 2OK1A 4L67A 4TY1A 5IISA 1SVHA 1H27A 2NPQA 2OXDA 3RPSA 3UZPA 2XUUA 4F7LA 4IJ9A 4FG8A 2B9HA 3TT0A 5A4EA 3GOPA 4LRJA 2VD5A 3OXZA 3G90X 5DN3A 3ZM4A 2PU8A 3OC1A 5I5ZA 5AX3A 4A07A 4JIAA 4KD1A 3F3ZA 3TNQB 4BR3A 3KEXA 4D5KA 3VAPA 3U6HA 3BLHA 3GNIB 3D5XA 5ANDA 2XA4A 4ASZA 3C4CA 4L44A 4CTCA 4QNAA 5AX9A 1P5EA 3R7VA 4CKJA 2VAGA 2AUHA 3K5UA 4L3LA 4MXYA 5JSMA 2G2IA 3PRIA 4X3FB 4GSBA 4U41A 4PNIA 4CLIA 3EFJA 2PK9A 4PUZA 1Q8UA 3A8XA 3D9VA 3FMKA 4PL3A 2F7ZE 4QP6A 4W9XA 4B8MA 4B9DA 3U6IA 2LGCA 5AR7A 5DBXA 4OGRA 3RP9A 1G3NA 4J96A 2JLDA 1H8FA 2CLQA 3KULB 3CY3A 4Q5HA 4DGLC 2CMWA 2VTTA 4RIWA 1QPJA 3SVVA 3PZEA 2WMVA 3M2WA 4KIKB 3SW7A 5J9LA 4NFMA 4DFXE 3FV8A 3BHHA 4XG3A 4V05A 1HCLA 3UDBA 1F0QA 2OH0E 3VHEA 3IW7A 1ZXEA 5CAOA 2R3LA 5DT0A 3KQ7A 4Y83A 4ANQA 5CS6A 4C59A 1Q62A 2XP2A 1Q97A 1H08A 3GBZA 4JBVA 3R8PA 4KUJA 5ANOA 3DXPA 5AADA 3E8EA 2G15A 4BCNA 3QC4A 4BGQA 2XS0A 2YWPA 1CTPE 3DT1A 4QTCA 3V01A 2VTQA 2FSOX 4IACA 2GNIA 3UOLA 3L9PA 2IZUA 2OJJA 2PZ5A 1P14A 4O1PA 3TXOA 3JXWA 3OWKA 4CEGA 4GFOA 5K0KA 5HBJA 1IRKA 1QPCA 4LG4A 3JYAA 5KMIA 5EKOA 5EM8A 4FKRA 4JXFA 2CHLA 4XHKB 4EHGA 2OJGA 4FG9A 3HUCA 5CSHA 2PE1A 4YJSA 2C5XA 3CTQA 5GZ9A 5HBHA 4YURA 4KSQA 1QCFA 4CTBA 5CEIA 1Q41A 4EOJA 5M4UA 5CX9A 4PDYA 4AGUA 3DAKA 2W0JA 4DG3E 3A7JA 1OPLA 3O8UA 3DGKA 3QWJA 4ASXA 3WYXA 4JDKA 4QPMA 3UVQA 1GJOA 5IEVA 4JQ7A 3RALA 1DI8A 4GV1A 1U54B 2PUUA 1KWPA 1V0PA 3CS9A 2BAQA 3PRFA 3QZGA 4I0SA 5EQPA 3A60A 5LXMA 4BI1A 5M07A 2J2IB 4M12A 3G15A 4FV1A 1GZKA 4F0FA 3E5AA 4D55A 3E93A 3R73A 4FVQA 2BRBA 4IIRA 4D5HA 2NRYA 3H9OA 3FI4A 4BB4A 2JAMA 3ANRA 3GUBA 4TN6A 3ZOSA 4TWNA 5AV1A 5IMEA 1E9HA 5TO8A 3IS5A 2I0HA 2E9OA 5C27A 1LP4A 2O5KA 4PMPA 2QI8A 4O96A 4QYFA 4CRLA 3ATTA 3ZTXA 3AD5A 2EXEA 5KKRC 2ZV8A 4ITIA 4QO9A 3VS7A 1YW2A 4HNFA 2GSFA 5HX6A 4WT6A 5BVEA 3FMHA 2HZ4A 5ETAA 2VWUA 2GHGA 5AMNA 4HYIA 3KMUA 4H58A 2BMCA 3NCZA 2R3PA 2WU6A 1Q8TA 3KGAA 4FKVA 2UW4A 3NYXA 4FSNA 2BHHA 3LCKA 3HDNA 3BI6A 2JITA 3T3VA 5I9VA 3NLBA 1ZZLA 4IZAA 1UNLA 4BI2A 3RM7A 3F9NA 4NIFB 3I81A 3TNPC 4X21A 3FQEA 3FYJX 4C34A 1PKGA 3D83A 2R5TA 2C6IA 4BYIA 5L2TA 4YUQA 4YTCA 5JKGA 4ANLA 2QO9A 4TYHA 4XV1A 4AA5A 2BRNA 3MS9A 3BBTB 4YC6A 2CGWA 2CN5A 5HG5A 3PY1A 2XIKA 3KRLA 4FZFB 1PMEA 4FTUA 3F2AA 3OCBA 4H3PA 2BZIB 2XRWA 3UTOA 1QL6A 4C4HA 3H3CA 1REJA 2XIZA 4BDHA 4G5PA 5GIOE 2QOOA 2BTRA 3FMNA 3TZ8A 2GU8A 3S2PA 3Q52A 2W96B 4O0UA 2PUNA 1LEWA 1PYEA 4JOAA 3P7AA 2YFXA 3MGYA 5AIKA 5I9UA 2GS6A 5HTIA 4IAZA 2XZSA 4V0GA 2DWBA 3BWFA 5HVKA 2KTYA 3PSCA 3OWPA 4XRJA 2CNVA 3A7FA 3QC9A 5E90A 4DBXA 2OH4A 3R6XA 4TXCA 5IQDA 4LM5A 2A2AA 3KVWA 5J8IA 4NJ3A 2IW9A 3TZ7A 3WZKA 2OGVA 1PYXA 2C5OA 3ROYA 5L2QA 3D5UA 4ZP5A 2W06A 4FV8A 4Y5QA 2PVLA 2J4ZA 4TWPA 2EWAA 4FIGA 3V3VA 5IA3A 5HD7A 1JVPP 2WMQA 5IA1A 4A06A 2EXMA 5F20A 4YZ9A 3DAEA 3IOPA 3NPCA 4HYSA 4EHZA 5ACBC 3DK6A 5BVKA 2VU3A 4EOKA 3LMGA 2YM6A 3QYWA 2RG5A 5JQ8A 3BV3A 4YZDA 1YHVA 3I7CA 4DFUA 5FLFA 4BKJA 1XBBA 4D4SA 3FKNA 3A7HA 1Z5MA 1OPKA 3QA8A 4P4CA 4IMYA 3LIJA 3GT8A 5CT0A 5DRBA 5AR2A 5ANKA 3VW8A 2XKFA 3RAKA 3W32A 4E4MA 2UZLA 3BEAA 4RRVA 2YM3A 3BU3A 4PP9A 3BRBA 3S0OA 1WBPA 4ANMA 4IANA 3VS2A 3AC5A 2E9PA 4TTHB 5HHWA 1ZYDA 2VV9A 3F82A 3VUIA 4CVAA 4F08A 4S30A 2W1IA 4M69B 1CKJA 4AA0A 1PXLA 4CKRA 3E8DA 4RVMA 2WEIA 3R7EA 3HMMA 1DS5A 3JY9A 4JQ8A 2R3NA 3UIBA 4EUTA 4MQ1A 2W4KA 3W18A 3I79A 5AUTA 4R77A 4ZTNA 2XCHA 3MY5A 5CXHA 2QQ7A 3MY0A 3M42A 1E1XA 4BWPA 4FGRA 3FDNA 4JIKA 3ZUUA 3IDCA 5T3QA 2OJ9A 4YC8A 5F94A 3NUAA 1FGIA 2WFYA 2GMXA 3DJ7A 5E4HA 5AA8A 3LFEA 4G17A 3T3UA 3ZC5A 2B9IA 1H1PA 1VYWA 3O23A 2YIQA 1O9UA 4FBXA 4GIIA 5CVHA 5FGKA 3ZSHA 4L7FA 3ZUVA 3A7GA 4LGGA 2JGZA 5AAEA 5HORA 3IECA 4QRCA 5J9YA 3QRJA 1WFCA 3NNXA 4EOSA 4UX9A 4HGEA 4WNOA 3AOXA 3B8RA 2C6EA 3DKOA 4JVGA 3TI1A 1YQJA 3VULA 4F4PA 5CQWA 4YSMA 2CKPA 1ZYCA 2P2IA 2G2FA 2HZ0A 2O8YA 3FI2A 4J52A 4R7HA 4UB7A 4ZTHA 4IX4A 3NRMA 4BDJA 3GENA 2WQNA 4LGDA 3TNWA 1WZYA 4FV3A 3HV6A 4BDBA 5CEOA 5EKNA 3LKMA 1LPUA 4FKWA 2FA2A 3OWJA 5CVFA 3RINA 3OUNB 3ZYAA 3EH9A 1SNUA 3DK7A 2W1EA 5EQEA 5DEWA 4IC8A 5CSVA 5LQFA 3S95A 3B8QA 3H10A 3DFCB 2X8DA 4FEQA 5ETIA 1Y8YA 4BIEA 3ACKA 3FMLA 5FM3A 4BDGA 3TDVA 5L2SA 2VX0A 4FSWA 3ID6C 3MN3A 2WU7A 2IZTA 4U3YA 3UPZA 4QMXA 3MJ2A 1KOAA 3AGLA 2C6TA
chains in the Genus database with same CATH superfamily
4BCIA 3A61A 2QODA 4ZSAA 4D0XA 4CQEA 3BBWA 1L8TA 3ALNA 3HMPA 2PVFA 3RK5A 3QTUA 4A4LA 4C37A 3VS1A 4E1ZA 4JX7A 1P4OA 2YDKA 4U97A 5KX8A 1H1RA 5DR2A 4DLIA 2IZRA 3IQ7A 1XH5A 1SNXA 2WEVA 4BZNA 4GYIA 5EM6A 3FPQA 3RCDA 5IU2A 4BDKA 1ZMVA 1J1CA 3C0HA 2QR8A 4FV0A 4IWPA 3NW6A 3PJ8A 1O6YA 4NZWB 2ERKA 4QTAA 2BZKB 3Q9XA 2BILB 1UNGA 3V5JA 4TWOA 2JKOA 4AZVA 2JFLA 2UW6A 3OY1A 4C33A 5HEZA 2X1NA 3B2WA 5D12A 2OF2A 4BDIA 3PDTA 1ZOHA 3A2CA 3I6UA 1YDTE 3UNJA 5J9ZA 3NZ0A 4X6RA 2YEXA 4AZWA 4CFFA 3UO5A 4RJ7A 3FZOA 2XIXA 1MQBA 3FYKX 1ND4A 4ENXA 4ACGA 3ULZA 3QUDA 4O2ZA 4LRKA 4EZ7A 4LOOA 4M0YA 4PWNA 3UDTA 1G8SA 4WNPA 4FL2A 1Q8ZA 4XV3A 1JSTA 2XK8A 5IZFA 2Z8CA 3HMIA 5JRSA 3COKA 2G1TA 4BC6A 1ZYJA 4D2SA 4LI5A 2QOQA 2XKEA 2RF9A 1XH8A 2E9VA 5FDPA 2Y4PA 3O50A 2XK7A 4FKOA 5CY3A 3N4VA 5M08A 1Q8WA 3U51A 4ZZOA 5LVPA 4BBMA 4BFMA 4NFNA 1REKA 4E26A 4GH2A 5FXSA 4GRBA 2C4GA 3C4EA 2GPHA 3MJ1A 2I0VA 4DH1A 3N4TA 1H01A 4XNEA 4F9WA 1TFFA 4HYHA 4DFZE 2V7OA 3U55A 4ZJJA 2QNJA 1JSVA 2ESMA 3UODA 4IWOA 4O22A 5FQDC 4AT4A 1ZLTA 4BCPA 5CXZA 2OIQA 3L9LA 2IVUA 3H0YA 1SZMA 2VTAA 2OZOA 2UZEA 2W1FA 3QCXA 2QLUA 1AQ1A 3DAJA 4P2KA 4YC3A 5JGDA 2WTKC 1P2AA 4F09A 5EYCA 1BL7A 3NX8A 2HENA 4G3CA 4QTBA 3DDQA 2VTJA 3P1AA 2FYSA 4QEBA 1OGYA 3QF9A 2QOIA 5BPYA 5LMBA 4L7SA 4MXAA 4IFGA 3AQVA 4ZSJA 4Q9ZA 4L8MA 2VZ6A 4QMLA 2GS7A 4IBMA 4R1VA 4C3FA 2EB2A 4A9SA 2Z7LA 3WZJA 4DLJA 5BUEA 2XNGA 4IZYA 1OIYA 2F2CB 3O7LD 4GG5A 4CZUA 2CNQA 3RM6A 4PDPA 4O6EA 4GL9A 3PYYA 4AE6A 5G1XA 4X0MA 2NRUA 3QFVA 3P08A 5JGAA 4FE2A 4YJTA 5CSPA 1IASA 5JFWA 2CSNA 3NYVA 4F6WA 2R3FA 4CGAA 3KXHA 4L00A 1QPDA 2I40A 3FJQE 1PXIA 5D7VA 4L3PA 3PP1A 4EHEA 4JG6A 2F9GA 3OVVA 4S32A 2WMAA 2OFUA 4YJOA 1JLUE 2BALA 3UPXA 4FJVA 3C4XA 2ZV2A 3POOA 4D1SA 4FTCA 4DDIA 2HYYA 1J7UA 3SG8A 1YVJA 2YM5A 4XX9A 2X2LA 1JPAA 3HP5A 3BU6A 5BYZA 2CGVA 3W0SA 5DT3A 4YO6A 4O4DA 4I5HA 2CKEA 4J97A 4LFIA 4EKLA 5KHXA 4R78A 3PXRA 4RLLA 4C4JA 2RFEA 3HVCA 5BMSA 3W0MA 3HRCA 4PTGA 3VS0A 4F64A 5A46A 4RQVA 4LOPA 3NUSA 2J51A 4XEYA 3FC2A 3R8VA 4PRJA 3QQFA 4L45A 3QTZA 1XHAA 3L9NA 4WD5A 2PWLA 2JDOA 3E3PA 3OHTA 4FUXA 4F78A 3SGCA 4FIIA 3LFSA 3QZHA 2OZAA 2X8IA 2R3OA 5BVNA 3IGGA 2YJSA 1R39A 3BE9A 4S34A 4M15A 4RA5A 3FMEA 5C8MA 4AQCA 1LEZA 3W0OA 4MK0A 1JOWB 4MYGA 1FQ1B 5F9EA 3EN9A 4O86A 2XF0A 3I7BA 5K3YA 3V8TA 1Q61A 2XK4A 1BMKA 4EL9A 3LJ0A 5HIEA 1S9JA 4JX3A 1M2PA 3CE3A 2C0TA 4EH7A 5I9WA 4AUAA 2HXLA 5IA4A 3UMXA 2A98A 2OU7A 5JEBA 4I4EA 4MCVA 2VO6A 4Z16A 4G31A 3CPBA 5AR4A 4FSMA 2GNGA 3R8UA 1ZZ2A 4Y46A 5A14A 3UOJA 2YERA 2IVSA 3LJ1A 4NUSA 5HLPA 3RZBA 4A7CA 3UIXA 1M2QA 3RVGA 1R0PA 4J98A 3GCQA 3ORZA 4KINA 2CCHA 1F5QA 4X2GA 4PPCA 4AG8A 4BBEA 4QQJA 3LQ3A 1XO2B 2V0DA 2ZB1A 4IB5A 4K18A 4NYEA 3IW5A 4FTOA 1CM8A 2R0IA 4R6VA 5FD2A 3TJDA 3MFTA 5HCZA 2RGPA 4RJ8A 3OG7A 3ZXTA 2W1CA 3FE3A 4HGTA 3Q6WA 3QQUA 4R3CA 4KABA 3U54A 3U87A 4ZY5A 5F1ZA 4X7QA 1ZAOA 4YTFA 3PTGA 1Q8YA 3NMUF 3TUBA 4TNBA 2XEYA 3LM5A 4IHPA 4J8MA 2C47A 4C58A 2W9FB 3ZDIA 4DEDA 3HP2A 2WHBA 3OP5A 4ENYA 3EWHA 4XG8A 5IQBA 2QKRA 5FTOA 5HIBA 4ITHA 4IEBA 4H3BA 4D9UA 2CGXA 1JNKA 3OBJA 5K5XA 3LFDA 4GCJA 5HBEA 4EK8A 2C3IB 4X2KA 2R9SA 2GNLA 4J99A 4Y8DA 4DHFA 2R3MA 4PMMA 3M11A 3R9DA 4C0TA 1FVTA 3HDMA 3IDBA 2HWOA 2XALA 5CEMA 3QTQA 4G6LA 2Y9QA 2UZDA 3F2RA 4O84A 3HAVA 2QU5A 5LMKC 3REPA 4WHZA 1Y6BA 3QL8A 3HAMA 1M52A 3EHAA 3KULA 4XP0A 1WAKA 3FI8A 5AM7A 4FSQA 4WRSA 4XG6A 1DM2A 4QYEA 2JC6A 2OO8X 3TIZA 1B6CB 4F1OA 4BIBA 4RJ6A 4L43A 1AD5A 3KXZA 3VBQA 2J90A 1VEBA 4YNEA 3ZFXA 3EQPA 5EHOA 1K9AA 3C5IA 1ZYSA 4FKPA 4I6LA 2BHEA 5HVJA 2EVAA 3ZC6A 3PE2A 4YJPA 1ERKA 4CV8A 4XV2A 2BKZA 2C0OA 3F61A 4FV9A 5C9CA 4J71A 3ZRMA 4E5BA 4X2JA 4I3ZA 2W99B 2F7EE 2O2UA 2YHVA 5J7HA 3R83A 1BKXA 4RFZA 2OLCA 2WGJA 4XCUA 3THBA 3KA0A 4YP8A 3D2KA 1R78A 2C5NA 3IW6A 3PVBA 1A48A 3ZSGA 1XH7A 3DQXA 3FLQA 4IXPA 3V5LA 3LFCA 5AP4A 4ZTSA 3QUEA 1JWHA 3LAUA 3VN9A 4H1JA 2GS2A 4KKEA 2PZPA 2HCKA 2QOBA 3V04A 5BUIA 2J0LA 4AOTA 2Q0BA 4MXXA 4Q2AA 4IB0A 3U4WA 2CNUA 1NA7A 4EUUA 2QCSA 4CSVA 3IKAA 1CKIA 5JQ5A 2PMOX 2ZM3A 5DEYA 4EOMA 2WAJA 2JIVA 4DT8A 3OW3A 3TCPA 3DQWA 4PQNA 2R0UA 3D0EA 2QO7A 3R1YA 4BDDA 5E7RA 1GOLA 2B53A 2B54A 3MVJA 1OUYA 3VC4A 3WYYA 3COHA 1OL7A 4FV6A 4CG8A 5A4QA 4RZWA 3KRRA 4E6AA 4HVGA 4WSQA 4EOQA 4FNZA 3EIDA 3OEFX 3IGOA 3GVUA 2ZJWA 2UZVA 3PA5A 3DLSA 4GT4A 1H1WA 1XR1A 4IW0A 2HK5A 2R4BA 5LWMA 5KZIA 5HNIX 2WTWA 5CWZA 3O8TA 1TZDA 3V5PA 4JBOA 3VNTA 4AQKA 1Q3DA 3DV3A 3COIA 5E91A 3UOKA 3ENHA 4IZ7A 3HZTA 4JDHA 3VS4A 3F3UA 5E8UA 4EQMA 2PHKA 3E92A 5IEXA 5H3QA 4UN0C 4QYYA 2PVYA 5LOHA 1DAYA 3R1QA 2ZOQA 1ATPE 4O7TA 3F2NA 3QQLA 3ZUTA 3POZA 3CBLA 2AC3A 4YMJA 3Q4UA 4N6ZA 3ZS5A 1Y91A 4Z7HA 4FT9A 3TWJA 1UNHA 3DBQA 4O6LA 4UV0A 1NVRA 3TYKA 4NT4A 1OL2A 3WZDA 5CF8A 3VONA 4O2PA 1XWSA 5J95A 4O21A 2BPMA 3EN7A 4NIFA 3DBEA 3ML1A 5D9HA 2BROA 4QMYA 1URCA 3IG7A 3TV6A 4HVSA 3DS6A 3KN6A 3QALE 3BZ3A 4G6OA 4O1OA 2CCIA 2VTLA 4N4SA 4BBFA 3CQUA 5CU4A 4FTJA 3H9FA 4AGDA 2X4ZA 4EI4A 4MKCA 4A4XA 4BL1A 3CIKA 3G9NA 2X8EA 3R9OA 1KE7A 4FNYA 2AQXA 4Z7GA 5CANA 3HRBA 5IQIA 5HO8A 3V51A 4C8BA 5AP5A 4E4NA 2O3PA 2XJ0A 5K0XA 2XARA 4TW9A 4EHVA 2ZMDA 4G5JA 3WE4A 5CAQA 4IVDA 1YXSA 2ZM4A 4EH5A 4KWPA 3VW6A 4MQ2A 5KUPA 4FKQA 3VS6A 4G9RA 1O6KA 3NUYA 4MF0A 3W33A 4WNMA 5L4QA 4MHAA 3EKKA 5BMMA 3COMA 4K8AA 1LUFA 4FL1A 1YHSA 4XP2A 5TKDA 2H96A 3MPTA 3VRYA 2Y6OA 2VTMA 4NCTC 2GTNA 2BCJA 2ZM1A 3ZU7A 4FV4A 5CSWA 1APME 1OIUA 4C38A 3BGZA 4O7RA 3P9JA 2X2KA 2C5YA 5CZHA 3MIYA 2WQEA 5DFPA 3R9RA 1FOTA 4D2PA 4ANNA 3QHRA 4CT1A 5DYJA 3WOWA 3VUGA 3TZMA 1WVWA 5KNJA 3O96A 2ZFYA 1OM1A 3PPZA 4W9WA 3HMNA 2WQBA 4J53A 4CFVA 5L8JA 2PZRA 2YM4A 3FLSA 4D4VA 3ROCA 4ZTQA 4AZSA 1ZOGA 4AW2A 4NW5A 4NJDA 4LRMA 2O65A 1ST0A 2VRXA 1FVRA 2JD5A 4GYGA 4DE4A 4L46A 4O0RA 3GC0A 1ZWSA 3TM0A 2XANA 3W2QA 4YLJA 4DITA 2BRHA 1JKTA 1SMHA 3PJ2A 4RC3A 3HA8A 4LOQA 4RWIA 1RQQA 3M1SA 5DT4A 1MQ4A 2ZMCA 1UWJA 4XG4A 3LFNA 1A06A 4IAIA 3LFAA 4WIHA 5C8KA 4PMSA 5FUTA 5I3OA 2VWIA 4IB3A 2BTSA 3BYVA 5T68A 3W8LA 2I0YA 4N70A 4YLLA 3MESA 4MNFA 4EOPA 4GEOA 3HL7A 2FUMA 1UKHA 2FSTX 5DVRA 4M69A 5HTBA 3DTWA 1OUKA 4OBQA 2XJ1A 4EH2A 4FG7A 5HE2A 4EK5A 4WNKA 4RJ3A 4F6SA 2P0CA 2KULA 4FTNA 1IA9A 4UYNA 2VN9A 2QC6A 3QX4A 2X9FA 3QZIA 3R21A 4HPUE 2SRCA 2VWWA 3FQHA 5L8LA 3P78A 4F99A 3DB6A 3R22A 4Z9LA 3HV3A 5KE0A 5CALA 2R64A 4IX3A 4EJNA 4WO5A 3ULIA 5IA2A 2UZBA 3MTLA 3NCGA 4S31A 2P55A 2QOCA 3FKLA 4G3DA 4HCUA 4U43A 3BCEA 2YDJA 1R3CA 1ZY4A 2C5VA 4FVPA 4EWQA 1GZNA 3F7WA 3DXNA 4DEAA 3VRZA 5EYDA 2C6MA 3LJ2A 5BYLA 4K77A 4ANBA 2GDOA 4BDAA 4F63A 2WMUA 4IX5A 4OTQA 2B7AA 1H4LA 4XG2A 2UZTA 3H30A 1ZYLA 3W0NA 1PW2A 2UVXA 4B0GA 3PJ3A 4Q9SA 5J87A 4LDTA 3OMVA 5FXRA 2GHMA 4M13A 4YU2A 3R63A 4AA4A 4AF3A 4DGMA 4L3JA 4P5QA 4QMWA 3ALOA 5KMLA 3WARA 2ETMA 4U79A 5FP5A 1UV5A 3ETAA 2WXVA 4FL3A 4IE9A 2QONA 1W2CA 3P23A 3K3JA 5L3AA 4XH6A 3AD6A 3B2TA 5EM7A 2Q83A 3TTJA 4K2RA 4ASDA 5KBQA 5AAGA 3BLQA 2XNBA 4I5CA 3MVMA 4ZTMA 3FSKA 3TN8A 4IQ6A 3MWUA 5M4FA 1UWHA 1OBDA 3IONA 1WBTA 3QTXA 3F5XA 2EU9A 3S4QA 5AP2A 4AOIA 3KMWA 4FI1A 1Q24A 3MYGA 3PVWA 2X0QA 4C62A 4ORKA 3RWQA 2JDVA 4EQUA 2BVAA 2PZYA 2HXQA 3BEGA 2UW9A 4YZBA 3Q6UA 4RBLA 2YAAA 5AP1A 3LLAA 4CCBA 3QTRA 5K4JA 4KA3A 2UV2A 4FSYA 4KAOA 2ITXA 2PE2A 2PVKA 1DI9A 4FSRA 2J5FA 2QO2A 2XBAA 2WTKB 3NNWA 4FEVA 4WG3A 1RE8A 3FQSA 4IH8A 3NIZA 5JRQA 2Z2WA 5A4TA 5AR5A 4YO4A 4D9TA 2WMSA 2PYWA 4GIHA 4WRGA 4I6FA 4FTRA 4K11A 5EDPA 5H2UA 1UU7A 4IB1A 4BKZA 4DEBA 2GFSA 1XH9A 3A7IA 3GOKA 4EJ7A 3CR0A 3OCSA 4PV0A 5E8ZA 5A4CA 3ZONA 2I7QA 3BELA 3L8PA 3L8VA 2BRGA 3QD0A 2XAOA 1XMLA 1OZ1A 5DRDA 2PULA 3I60A 4OT6A 4M0ZA 2VGOA 4CCUA 4LGHA 4HJOA 4EH9A 4QMUA 4QTEA 2X2MA 3FXXA 4KRDA 5M09A 3NAYA 4YZNA 3PP0A 2W1HA 2XIYA 4GT3A 4M7IA 5LMKA 3JUHA 1XH6A 1YI4A 3HLLA 2RFNA 4H39A 4U81A 5K9IA 1VJYA 3HMOA 2UZNA 5L2IA 4L01A 5D10A 4U3ZA 3Q9YA 2QD9A 4R7IA 4TT7A 1F3MC 1NVSA 4BCOA 2R3QA 3WI6A 3WIGA 4AZEA 3MIAA 2JKKA 2W5BA 3QKMA 3LW0A 4TYEA 4EYMA 5HG7A 5ACKA 3FXWA 2RKUA 3II5A 5CYIA 2ITOA 1H0WA 4OBPA 3S1HA 4C4IA 3W16A 3G0FA 3G33A 3GGFA 4AS0A 2PUPA 4FMQA 1RW8A 3BYUA 3BYSA 1JKSA 4GW8A 5D7AA 4GJ3A 3AKLA 2XAMA 2HY0A 5AEPA 1ZY5A 1OITA 5J1WA 2CKOA 3GEQA 2Y6MA 5EW9A 2YLFA 4APCA 3FY2A 2R3HA 4NTSA 2BAKA 5E9EA 3CJFA 4I1ZA 4GKHA 1FBNA 4V04A 3CSVA 3ZRLA 4O38A 4XBUA 4BYJA 1W8CA 3KL8A 5JFVA 5C4LA 3C50A 4KBKA 2ZVAA 4FZDB 3FMJA 1YXUA 4O0XA 5DOSA 4CG9A 3ATSA 2EB3A 3CJGA 2R3IA 2WOTA 5DGZA 3L9MA 4C4GA 4MBIA 3BKBA 4AGCA 4DCEA 5J1VA 3GQIA 3ZO1A 3E64A 4I6BA 4ALUA 5JFXA 5AP7A 2UW3A 4CMOA 3NUPA 4LMNA 1MUOA 5KMOA 4JQEA 4AN3A 2Q0NA 2VTNA 1H26A 1V0OA 5E8XA 1X8BA 2JKMA 3DZOA 3BHYA 2WTDA 3LXKA 4YJRA 5IQAA 5HI2A 3VBVA 4FZ7A 1PXJA 2XIRA 5AUYA 3GU7A 3KC3A 1H00A 3TUDA 1K3AA 5DNRA 4NM5A 4EZ3A 3R7YA 4HCVA 5KBRA 5AM6A 3HKOA 4DDGA 2GTMA 3KU2A 2VX1A 1JAMA 4DT9A 2P2HA 3D2IA 3SQQA 3DPKA 3NSZA 2ZV9A 2BAJA 2REIA 5LVLA 4ANOA 4B8LA 3Q60A 3PA4A 4C35A 3U4UA 3K2LA 2B9FA 5CT7A 3VBXA 3QXPA 2YCSA 4O7ZA 5IQCA 3EN5A 4O91A 3ZCLA 5T6KA 3BYOA 4IC7A 2UVZA 4KIQA 5BVWA 4F7NA 5HGIA 5FTGA 3UYTA 5CEQA 3SA0A 3PIYA 2P33A 3OUKA 3C9WA 3QYZA 1AGWA 4FTMA 3U9CA 3UP7A 3MA6A 2XJ2A 4ZS0A 2GHLA 3E7OA 5L6WL 3CTJA 1YOLA 3PJ1A 4QQ5A 1STCE 5ANJA 2O0UA 2WMBA 4AN2A 4EC8A 3RCJA 4OAVB 1S9IA 2H34A 5M57A 4ALWA 4RGJA 4UXQA 4W8DA 3PA3A 5E8WA 4QMQA 4FKUA 3PG3A 4CFWA 5E1SA 4QT1A 1PMUA 5CAUA 4FTQA 4HOKA 4D1ZA 2IJMA 2EXCX 3W2OA 4AZTA 3NNVA 5BQ0A 1YXXA 3Q96A 4FK6A 4DTBA 4F0GA 5AUZA 4DGOA 2X39A 4MD8E 2XNNA 3R28A 2XNEA 3PY3A 5HTCA 2XKCA 3MA3A 3V5QA 3DY7A 4KRCA 4O4CA 4DTKA 4TYIA 3SAYA 2HOGA 3L8SA 2C6LA 4LL5A 3ERKA 4OLIA 1CSNA 3KK8A 4QOXA 4GVAA 4YZMA 3PWDA 4M68A 3BX5A 5DG5A 4EONA 3HEGA 5DH3A 2GNHA 4ZTLA 2IG7A 4QMTA 4XLVA 4A9YA 4YPDA 2H8HA 5CU6A 4FZ6A 4MX9A 3SW4A 4YJQA 4BZDA 4JNWA 2V7AA 4Z55A 1GZOA 3FZSA 3VUTA 4XOYA 3C4ZA 3DDPA 4JL9A 3R9HA 4QP3A 3WF8A 4HZSA 4N0SA 2R3KA 4OTPA 5CU0A 4D2TA 3RHKA 3V8WA 3U8WA 1XBAA 1JSUA 3TV7A 4NCTA 5HZNA 4RWLA 4H36A 5DHJA 2C3LA 3UBDA 1OPJA 4YJVA 4BGGA 3FL4A 2YIXA 2CGUA 5DR6A 5HICA 4AXFA 2AYPA 4ZZNA 2ZV7A 2QU6A 4DH5A 2JFMA 3PIZA 2IWIA 3G5DA 2BUJA 4J95A 5H8EA 3QCQA 1H24A 2C1AA 3UQCA 5C4KA 4E4LA 1T45A 2FSLX 2B1PA 3OOMA 4I23A 4K6ZA 5A4LA 4FIHA 5HLNA 5FBOA 1JBPE 5TR6A 1G8JA 4IZ5A 3Q2JA 2ERZE 3UO4A 3FLWA 2J5EA 4R1YA 2Y4IC 1YWNA 1H28A 2BFXA 2VUWA 4U42A 4YLKA 3GC9A 4PPAA 4TL0A 1OKVA 2X0GA 3BU5A 4UZDA 4ACMA 4HVIA 2R7IA 4IVBA 5JK3A 4M67A 2QOLA 4IVAA 2ITYA 2BKKA 5DMZA 4ZSEA 5ANIA 4DH8A 2VTIA 1UU3A 3FAAA 2XEZA 5GJGA 3RPOA 4ITJA 5IQGA 4MWHA 2F2UA 4LL0A 4OAUC 3KXXA 4BTKA 2RSVA 3W0QA 1OB3A 5M51A 5JT2A 3ZEWA 2WMWA 3D5VA 3ET7A 5HE0A 4RPVA 3U9NA 3JY0A 5CAPA 4AXAA 4O81A 4GK3A 5H9BA 5J79A 3HA6A 4F0IA 3Q9WA 3TV4A 4RQKA 3UO6A 3ZMMA 1BL6A 4CZTA 3KB7A 2V62A 3R7GA 2UZWE 4RT7A 5IA5A 2UVYA 4ID7A 3Q4CA 3SXSA 3NUNA 4S2ZA 5FP6A 3OEZA 4RVKA 3RNYA 1I44A 4DFNA 5KMMA 2QOFA 2F4JA 2WMTA 3EQFA 2R7BA 3CEKA 3FC1X 4DFYA 3GQLA 2OKRA 5ICPA 1FINA 2R3RA 3FWQA 5LARA 2QOHA 2G2HA 2OXYA 4BCHA 4EEVA 4PF4A 5M06A 3KK9A 4CYJA 1KE5A 4CFMA 2RIOA 4XG9A 3GXLA 4HPTE 4AT5A 3WILA 4A9UA 4RA4A 3A8WA 5L2WA 3MPAA 3Q32A 3FUPA 3RJCA 3EFLA 4A9TA 3DOGA 4FKJA 4QMOA 4D4RA 2F57A 4IM0A 4OBOA 1G8KA 1Z9XA 2YIWA 4GJ2A 4XBRA 3I6WA 3C1XA 3EJ1A 3AC8A 5LWNA 4DGGA 3OS3A 4D2WA 4OR5A 2WTCA 3D14A 3ZO3A 2GCDA 4K0YA 5EDQA 4ACHA 3G6GA 2GNFA 3D94A 4JBQA 4I41A 5CAVA 4JLCA 5EG3A 4BIDA 2LAVA 3SHEA 4U7ZA 5FG8A 3CTHA 4XUFA 1QPEA 3AC4A 2CN8A 5HVYA 3BV2A 4PL4A 2XK6A 4MBLA 4BN1A 3O17A 3V5WA 3GCVA 3ZO4A 1YWVA 3FHIA 1NXKA 3PY0A 3L1SA 3UQGA 4EORA 3DBFA 1SVGA 1GAGA 4KNBA 2P4IA 3MBLA 1UKIA 4KSPA 4RIYB 5CZIA 1URWA 3ZBFA 4E6CA 4EYJA 3BLRA 1PXKA 4WUAA 4C7TA 2E2BA 2XNPA 3JVSA 4FT5A 4EBVA 1OL1A 3DA6A 3TKIA 5DR9A 5EI8A 4G34A 2WMXA 3HV4A 4Y73A 3E62A 3AMBA 4R5YA 4FYNA 4GFMA 5IKWA 3LLTA 5AV3A 1WBSA 4RJ4A 4GG7A 3QD2B 5AV2A 4ZTRA 4YTHA 3QKKA 2ITQA 3BIZA 3V5TA 5IEYA 3DLZA 1HCKA 2JEDA 2YAKA 4J8NA 2YLEA 4P90A 4RIXB 4W4VA 3VO3A 4D1XA 4D0WA 4E5AX 3PXYA 4QDEA 4EC9A 4EK6A 4G3FA 3R8MA 1YOMA 4BJJB 3UNZA 3AT3A 3HUBA 3NW7A 4MBJA 3VVHA 4U6RA 3EFWA 3KRWA 3ZXZA 2YCRA 1KUTA 3JR1A 2JBPA 2NYAA 4QP4A 3A99A 4TKSA 5E8TA 4B6LA 3VUMA 4O27B 3FMMA 1OKZA 3MDYA 3KFAA 4FV5A 2J0IA 3PIXA 4PY1A 3QCSA 3T9TA 2WTVA 1M2RA 2WMRA 5M44A 2XBJA 2ITZA 3K54A 3TZ9A 5CU3A 5IUHA 1B38A 2IN6A 3AKJA 3MH1A 4A4OA 2YDIA 4AW1A 2WD1A 4UY9A 4FT0A 4GUEA 4YBKA 4RIOA 1R1WA 2J0JA 2QHMA 3R04A 3ZLXA 4AW0A 2OFVA 2OI4X 3MH2A 4G2FA 4RC4A 1LR4A 3AC1A 3R1NA 1GY3A 1H1QA 1J3HA 1VZOA 2A1AB 4O4EA 4E5WA 5IQEA 4F6UA 4L52A 3QKLA 4RJ5A 2FVDA 3RPVA 5B2MA 5FTQA 4FTLA 4USFA 1WBWA 3O0GA 5K4IA 5TE0A 3KCFA 3EZVA 2ITUA 2JIIA 3HGKA 3FMDA 4B99A 1NW1A 2C30A 3NNUA 4PTEA 3IOKA 4YGAA 5FDXA 1YWRA 3DKCA 4FEUA 2GQRA 2YABA 3PE1A 3GFEA 3RGFA 3E88A 4ZAUA 4U0IA 4JG7A 2J0KA 4NSTA 4C02A 5C26A 1Q5KA 1BI7A 2HWPA 4KIPA 2J6MA 4HVDA 3OT8A 2QG7A 5EYKA 2VNWA 3R02A 4FT3A 3DKFA 3PLAE 4JR7A 4QYGA 5KMJA 4FTIA 1O6LA 2OW3A 3HYHA 1BI8A 3RNIA 5IDNA 4F7SA 3AT4A 2PPQA 3QXOA 3Q9ZA 4MAOA 2BFYA 3EQCA 4IJPA 4DF3A 1KE6A 3NAXA 4FTAA 4O0TA 3MFRA 3K3IA 3EQHA 1RDQE 1UU8A 3BHUA 2YA9A 3O51A 3W0RA 4F65A 4FNWA 4D2RA 1XJDA 4FKIA 2V5QA 3SXRA 1OBGA 5DA3A 1YDRE 5JZNA 4FK3A 2WKMA 4RX5A 3G51A 4HCTA 4U9AA 1OL5A 3CGOA 4BDFA 5I9YA 2PVNA 4JDIA 4DEIA 1R0EA 1BYGA 2W5HA 4IAYA 3E3BX 1FGKA 4NU1A 3TJCA 4C57A 5JMSA 4OTDA 2JDTA 5AUXA 4DEGA 3PSDA 2WQOA 5CEPA 2GQSA 3QHWA 4ERKA 5EOLA 3DZQA 4ZJVA 1GIJA 3CP9A 4BTJA 4MXOA 4EH6A 3DNEA 3W10A 4FX3A 4G16A 4MNEB 4QP1A 3ORIA 4FSTA 4ONAA 2VX3A 3P86A 5ANEA 2C0IA 5HE1A 3UVRA 5JH6A 4IM2A 4U5JA 4ZEGA 2ETKA 3LE6A 3OROA 3UDZA 2BIKB 4C3RA 3BE2A 5EW3A 1PF8A 5A3XA 2YIRA 4OTFA 1YRPA 4FOCA 3EOCA 3DTCA 3WBLA 4JAIA 4PP7A 3LXPA 3DNDA 3ENMA 3QAME 3E87A 5JFSA 1CMKE 4FKTA 5F4NA 2PVJA 5CU2A 3D7TB 5LVMA 5CQUA 2H6DA 2G01A 4RG0A 4WBOA 4FICA 5D11A 4BF2A 3LVPA 3AC3A 3RAHA 3CC6A 3HRFA 3JVRA 4TWCA 5KHWA 5TF9A 4O7NA 5I0BA 2FGIA 2VWVA 3AGMA 4XYFA 1U5QA 4AU8A 4U80A 4UBAA 3Q4ZA 4I24A 4B7TA 1IEPA 3PVGA 4B4LA 4RX7A 3PWYA 5EI6A 4QTDA 4TYJA 3VUKA 3KCKA 4BCMA