2O8YA

Apo irak4 kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
278
Chain Sequence
b'FHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLLKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASVMSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Crystal structures of the apo and inhibited IRAK4 kinase domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 278
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2o8yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2o8yA01
2QOOA 3IG7A 4B99A 3NIEA 2X1NA 4O0VA 3F66A 4RJ3A 2WO6A 3BWJA 4PWNA 4C3RA 3NUXA 4FZ7A 4QPMA 4QD6A 5ANJA 3EFJA 2VN9A 4QOXA 3HA6A 4R1VA 3WF9A 3KU2A 3ZZWA 4EH5A 2J5EA 5CEOA 4CZTA 2VTLA 4A7CA 4M97A 3MA6A 3W2CA 4BTFA 2OF4A 3F2NA 4LOPA 4F9CA 2PMOX 4GJ2A 3VUGA 4F1TA 2YITA 2ZDUA 3RK7A 1YXXA 4JS8A 4FOBA 4E73A 4IAYA 2X7OA 3ATTA 3D7TB 3CQUA 4XNEA 1ZYCA 1FMOE 3BLQA 3CS9A 3MYGA 4I5CA 3ULIA 3PA3A 4BCKA 3F82A 4EJNA 2HIWA 3UZPA 4FKUA 5AR2A 4EQMA 2QG7A 4CLIA 3HDMA 4FT0A 5EHOA 4I6QA 5JGAA 4RPVA 4ERWA 2X2MA 2QKWB 3LFQA 4E6CA 2H6DA 5CEPA 2WQOA 2E9OA 3RK5A 4L46A 3BHVA 4G17A 3D7TA 4FR4A 4U6RA 4U97A 4YBJA 3ZO4A 5FWKK 4YJOA 2VTJA 5C8MA 2B52A 3M11A 5JH6A 1REJA 2VD5A 3HV6A 1Q3DA 1QPJA 4J99A 5CF4A 5JGDA 5LVOA 5I5ZA 4I93A 4DEAA 5DE2A 3I7CA 3SW4A 5KHXA 2KULA 3WOWA 4C4GA 5EW3A 4UY9A 3OFMA 3RAIA 1VZOA 2QQ7A 3VVHA 3R7VA 3O51A 3V5QA 2W9FB 1V0OA 4J96A 5KX8A 3BCEA 2NPQA 3CC6A 3QQGA 1NA7A 4D2WA 1G5SA 4KINA 4C57A 2BIKB 4BDBA 4GVJA 4CFMA 3UZTA 3PG1A 4AT3A 1K9AA 3VW8A 5M53A 3NYXA 2LAVA 5C27A 2UW4A 2QR8A 4MXCA 4ZTRA 4E3CA 4XP3A 3FZTA 5ANOA 5AR4A 4XG8A 5FDXA 4FTUA 1ZZ2A 4RLKA 4AOIA 5BVOA 3C13A 3G9NA 1DS5A 3IONA 3BU6A 3S95A 3AXWA 1O6LA 1RW8A 3NNXA 4IACA 4YR8A 2C5NA 3BV2A 2X0GA 4C02A 3PY1A 2XNNA 3OTUA 3AC3A 3IPHA 3QQLA 3E63A 1XR1A 4RX9A 3MN3A 3R8VA 3EQDA 3NNWA 1YOJA 5LMBA 4AUAA 3A61A 2X9EA 2DWBA 5C4KA 4I1ZA 3MBLA 2PVNA 5J8IA 4HPTE 4QMNA 5IQHA 3JUHA 3QWKA 4R7HA 4TTHB 3I7BA 4R5YA 4S34A 5AUWA 4EK4A 4J98A 5AM7A 5L2IA 3COHA 4BDCA 4ZJVA 3C4ZA 4D4VA 4JQEA 4ZMFA 3G90X 4V01A 3QX2A 2GPHA 4O96A 3A7HA 3SG9A 1MRVA 2C6LA 3LXNA 3F5GA 3K54A 3F5UA 1WBVA 1KE5A 4D5HA 1IASA 3CSVA 3HGKA 4IAZA 4JIKA 4ANQA 3FAAA 3C4XA 1H08A 3RP9A 1YXSA 4FODA 3Q96A 5EH0A 2F2UA 2I0EA 2QI8A 4KIOA 5L6WL 4F63A 4FYOA 5EM8A 3KK9A 3TJCA 3ZHPC 4DEGA 3EH9A 2B0QA 3UE4A 3VBQA 1XJDA 3VBYA 4CG8A 2Z2WA 1F0QA 2B7AA 4ONAA 4IX4A 3B8QA 3K3JA 2XYUA 1WZYA 5HO6A 2I0YA 4F0FA 3L1SA 3VIDA 2PZYA 3FUPA 2AUHA 4KRCA 4XLIA 4DAWA 4O7WA 5LVPA 5IA1A 1OITA 3DKGA 3GU6A 1WVXA 5ICPA 3ELJA 3QX4A 4J71A 2IO6A 2X7GA 3MTFA 4HVIA 2C3KA 2CKOA 5GZ8A 4AZTA 5A4TA 3IGOA 5DHJA 5CTPA 5DN3A 4F65A 5D1JA 2F7ZE 4FG9A 1IA9A 4CZYB 1SNUA 2RL5A 3LCKA 2XNGA 4S32A 1JKSA 2YACA 4WRGA 3ZSHA 4F08A 4TRLA 1BI8A 4JIAA 4IWDA 2Z8CA 3TNIA 5AP7A 4DT9A 5HBEA 3SLSA 1BMKA 2J0LA 5JT2A 4O0RA 2BROA 2OF2A 3HV4A 4M7IA 4DGOA 1PYXA 2BZKB 4D1ZA 2C1AA 2W9ZB 3A8WA 3CGFA 3D5WA 4QMQA 3FMKA 5EDRA 3OMVA 2RG6A 3BPRA 3KN6A 3AD5A 4U5JA 3MPMA 3M2WA 5J5TA 4WT6A 2QODA 4NM5A 4QTBA 4QYEA 2W5AA 4A9SA 2DQ7X 4BCIA 4IVBA 5IUHA 3HMNA 2IN6A 2VGPA 2J0MB 4Q9SA 3DAKA 3THBA 2GNGA 3KK8A 3ZRKA 5HU3A 2R3OA 4D0XA 4TNDA 4PDOA 3DXQA 4MBLA 5A3XA 4QPSA 3CQWA 4CZUA 1URCA 1IEPA 4BTMA 4C34A 5HVJA 3KRXA 2PL0A 2VTTA 4L6QA 4YZNA 1GZOA 4KSPA 5ETFA 3CJFA 5EW9A 5EI6A 4UX9A 2XRWA 3ZU7A 4FKWA 3TZ9A 4ZZNA 5HNGA 3V8WA 5CAOA 4AA0A 2UZTA 4TYHB 2GTMA 3VULA 3HUBA 3IW6A 2G1TA 4G6LA 3IKAA 4IW0A 4QMUA 4GW8A 3NLBA 4R3CA 2YFXA 3ODZX 4DEBA 4EOLA 4TYGA 2R64A 4G3GA 3TI1A 5HORA 2W1EA 3BZ3A 2H96A 3DK7A 4M14A 3QXOA 4G9CA 1UA2A 4F09A 4IAKA 4ZSLA 2RIOA 3IW4A 3LQ5A 4L43A 4P2KA 4CMTA 2ETKA 4DG0E 2E9VA 4FV1A 3UO4A 4HOKA 4APCA 5AUTA 4X3FC 4TYHA 4I21A 3M42A 5ETIA 3DB6A 3E8DA 3BWFA 3NRMA 5IQBA 1SVEA 4XG6A 5K4JA 5E92A 4M12A 1A48A 2ESMA 2YIQA 4GT3A 4B8LA 2J0IA 1XH5A 1PF8A 4UMPA 2XZSA 2YWVA 5CLPA 3QRIA 4K11A 4MXAA 2R7BA 1YKRA 1M2RA 4WSQA 2OH0E 3W2QA 4BCMA 2HELA 4QMYA 1Q5KA 3AGLA 3F3ZA 4IIRA 4XYFA 2QOQA 4IZAA 5CT0A 5DR2A 3FLYA 4C4HA 2JDOA 3V8TA 3EZRA 4EH8A 3ZDUA 5L2WA 3PA5A 5I9XA 5ITAA 3COIA 3E88A 3D4QA 2JDRA 3FI3A 5IA5A 3WZKA 1V0PA 3GOKA 5B2LA 2UV2A 3WF7A 4BB4A 4X2NA 4FTLA 2B9IA 3P7CA 3DS6A 3PJ3A 4J8MA 3U6JA 1T46A 3GBZA 3NS9A 5CU3A 1CM8A 4W9XA 5H3QA 3EN9A 3ORIA 1Y6BA 3R8MA 2X4ZA 4AFEA 1W84A 3ANRA 5CNOA 3FL5A 2F9GA 4PTGA 4G16A 4JR3A 5JZNA 4BCOA 3BI6A 2WMVA 4FEWA 3FQHA 3KF7A 3FYKX 5HO8A 5EQPA 1OIQA 3ZCLA 2BVAA 4AZWA 5IISA 2QOCA 3DBDA 2YN8A 4V0GB 1Z57A 2WU6A 1OIUA 4CG9A 2IW6A 3W1FA 4FTCA 4IZ5A 4XV2A 2WIPA 3LQ3A 3BU3A 2YZAA 3PPZA 3QTSA 2OWBA 4F7SA 3BV3A 5FD2A 3R1YA 4XG2A 2GNHA 2VWYA 4JRNA 3MESA 3UVRA 3NAXA 1FOTA 2PVMA 4NSTA 3Q60A 5CEKA 4V0GA 4QP6A 4ZZOA 3DK6A 5HCZA 3BQRA 4ANOA 3SOCA 4KS8A 5KKRC 1R0PA 2OSCA 3FZSA 5JKGA 5HIDA 1LUFA 2Y6OA 1YHVA 5EG3A 5HVYA 5KMOA 3P7AA 1XQZA 4YLKA 3VBXA 5M56A 2UZWE 3K5VA 1JNKA 2WTIA 1OB3A 3FKLA 3P9JA 5IH4A 3WZDA 3D94A 3PFQA 4U8ZA 3AD6A 1B39A 1A06A 3UQCA 4OAVB 3GQLA 4KIKA 4ASXA 4CFUA 4F0IA 3QKLA 4X0MA 3AC2A 3BE9A 3GC9A 4CQEA 2FSOX 3UP7A 4FSQA 5AIKA 3DKCA 3TTJA 1OVEA 3MVLA 4BCQA 3BEGA 5L4QA 3U4WA 4B6LA 4R6VA 5L8KA 3RCDA 4AFJA 2PE0A 2W5HA 2CGXA 2YLEA 3OY3A 4EZ3A 2GNFA 4IDTA 3U54A 4DCAA 2I0HA 3OXTA 4JBOA 2R3IA 4EOPA 3UIMA 3E87A 4LOQA 3RVGA 4F4PA 2YCRA 5HLPA 4KWPA 1XH8A 3OWJA 4JQ7A 1BKXA 4FL1A 2Y8OA 5HD4A 4G3EA 4BDEA 4XG4A 4YJNA 4YU2A 3ZBXA 4R78A 3ZUVA 4CFNA 2WMTA 5CZIA 4USFA 1GJOA 3FPMA 3KXHA 2DYLA 2O8YA 4H36A 3DBQA 3ZSIA 4WA9A 1OL1A 3H9OA 4BVUA 1PXMA 2J7TA 3LVPA 3U4UA 4JG7A 5DI1A 3RAKA 4QMPA 5AR7A 4ZXTA 4IWOA 5M4FA 5GIOE 5CSXA 3BBWA 2IG7A 4KBKA 4CQGA 2HW6A 4U41A 2OBJA 4YMJA 3OBGA 3V04A 3QD3A 5AUZA 3EHAA 3QD2B 4FVRA 2GTNA 2RGPA 2GDOA 4O7SA 5KMMA 1CSNA 3KRJA 2GS6A 4BHZA 4MQ1A 4CTBA 4S31A 3RI1A 1Q41A 4FV4A 4GK2A 5DG5A 4A4OA 4C3PA 2WU7A 1Q99A 1M52A 2CGWA 2ETMA 3HP5A 3IOKA 2GNJA 4GK3A 4UWBA 4NUSA 5M4CA 5CANA 3FMHA 3VS1A 1GZKA 4O6LA 2VTPA 2F57A 2IZRA 3D2IA 3OXIA 4ERKA 5A54A 4ZIMA 4ZY4A 3SGCA 3LFFA 3VS4A 3R9DA 1JKLA 3IS5A 3VUDA 3ZFXA 4C2WA 3TKUA 4AT4A 3AC4A 1WBTA 4IM2A 2YLFA 2GMXA 5IA3A 3UYSA 4K33A 5EI2A 4I94A 1Y6AA 3KC3A 4D1XA 2HW7A 3QTWA 4GVAA 4JNWA 3C5IA 5E8TA 2PMLX 5HE0A 3LZBA 3PDTA 2XJ1A 5E8WA 1R3CA 1RDQE 4QMSA 2EB2A 4ORKA 4FVQA 1SVGA 2IWIA 2GS7A 1U46A 1V1KA 2W5BA 3DCVA 4IMYA 2FSMX 2AC5A 5BUEA 5KHWA 2IPXA 3QL8A 4I5MA 4AACA 2X81A 3SXFA 3CP9A 4IB1A 4MWIA 4NIFB 2XUUA 2HAKA 3E8CA 3IDBA 2HXLA 1XH4A 3R8LA 2QOBA 4U43A 3HECA 1G8AA 1JSTA 1Q8UA 3EB0A 2C6EA 3R7EA 4BDGA 2XK7A 4UYNA 4D2RA 4ENYA 4M67A 1AQ1A 1GY3A 1PY5A 4QNAA 3GVUA 3Q9XA 4QMVA 2JBOA 3KREA 4GK4A 4NIFA 2A4LA 4C36A 3WYYA 3VF9A 4X2GA 3HMMA 3I0OA 4O7YA 2YWPA 1W0XC 3GCUA 4CRLA 3B2TA 1WMKA 4I6HA 3N51A 4YLJA 3DU8A 3I5NA 4N0SA 2CMWA 3QA8A 5AX9A 3ZBFA 1UWJA 4HGEA 4JBVA 3ZS5A 3NIZA 5JQ8A 4HJOA 4ACDA 4HNFA 1Y91A 3EQBA 3ZONA 1LPUA 2WTWA 2BALA 4BDKA 4ZEGA 4EK8A 2XS0A 3CXWA 3E93A 1E1VA 4WUAA 1MRYA 4ASEA 1WBWA 1YOMA 3F6XA 5IUIA 1TQPA 2OIBA 3ZEPA 4FKRA 1DI9A 3QYZA 5M55A 3R21A 2J6MA 3SOAA 1W82A 1V0BA 1Q8ZA 4HYSA 4EH9A 3MFTA 5AUVA 2F7XE 2ITUA 5F1ZA 5DBXA 1UU8A 1XH9A 4Q2AA 4F9WA 4GH2A 5DWRA 5HX6A 3QBNA 5GJDA 5JSMA 1YWRA 5J7HA 3HVCA 4HNIA 2HY81 4OTWA 2CN8A 5IG1A 3LFSA 3W2RA 2HXQA 2ITOA 3D0EA 3QTRA 5AR3A 3LPBA 2DS1A 2XJ2A 3QD4A 4OLIA 4EOIA 5HLNA 1H1PA 3EQFA 5B0XA 1XO2B 3UG2A 3SW7A 3OCBA 3HLLA 4FF8A 1FMKA 4RVLA 4AQCA 4BKJA 4E93A 4MEDA 3LMHA 3PXFA 3UNJA 2V5QA 2BRMA 3KY2A 3FZOA 4XUFA 4RVMA 4TWNA 3RPRA 4CKJA 4ZS4A 4IDVA 1APME 3IW8A 2VTAA 4Z7GA 4BI0A 1GIIA 4LI5A 2V7OA 4ACMA 4RQKA 3FQSA 3ZC6A 3UP2A 5BVEA 1H01A 4IVDA 4IAFA 2R4BA 2WTJA 5HHWA 2EVAA 2PVFA 2W7XA 3F88A 2Q0BA 2QU6A 4FKSA 5BQ0A 5KO1A 2UVXA 3KXGA 2UUEA 1SZMA 5AP4A 2X8DA 4BGQA 5CX9A 3FQEA 3WF8A 2RFEA 3MDYA 1QL6A 5HCXA 3O50A 3TIZA 3DXNA 4YPDA 2XKDA 1OGUA 4OTIA 4QQJA 5CENA 3O71A 1AD5A 1ZXEA 2A1AB 2PK9A 3BU5A 3NSZA 3ZLSA 4DH8A 3EFWA 3TZ7A 4EHGA 5GJGA 2J0KA 4ZLZA 3ZO3A 4ZMEA 2PZRA 3MB7A 4FG7A 1PMVA 2QOIA 3CPCA 4PL5A 1CKIA 1FVTA 3M1SA 5L2QA 3VUKA 4GIHA 5LOHA 5AJQA 2ACXA 2JDTA 4WIHA 4LG4A 4YHJA 4DGMA 2GNIA 2WFYA 4FKPA 4FNZA 4RX5A 3P79A 2HY0A 2OFVA 3EN4A 1FQ1B 2C6MA 4FKQA 4OTQA 3GCSA 4TN6A 4JBQA 4EQCA 3TDVA 3KXZA 3LAUA 2JFMA 4QO9A 5FTGA 3PJ1A 4ZJJA 5LVMA 4N57A 4RWKA 5FXRA 3NYVA 3FI2A 4E6DA 5EOLA 2XM8A 1Q62A 4UMQA 4ZP5A 5HQ0A 1JKTA 3LJ2A 4FTJA 3S1HA 3KF4A 3QQJA 2I1MA 4TL0A 2B9JA 2B53A 3QGWA 4RQVA 4X3FB 3TUDA 2C5XA 5DT3A 5AMNA 4G2FA 3PJ8A 3O7LB 5CF6A 3VUTA 3IK3A 3P0MA 2C69A 2VTMA 4Y5QA 3TIYA 3P78A 5AAEA 4CKRA 3COMA 2W1HA 1OKVA 3ORKA 1Q8YA 1GOLA 4X3FA 2YHVA 4X2FA 3UNZA 2HWOA 3A4OX 5H8BA 3ORMA 4A9RA 2QOKA 5EYDA 3R2YA 3E92A 2Z7QA 3JXWA 2XIKA 4O86A 3TV6A 3LLTA 3NMUF 4U42A 5IQFA 3R9OA 4U3ZA 1WAKA 3MVHA 3ID6C 3C9WA 1KSWA 3FI4A 4L42A 1SMHA 4GT5A 4RWJA 3TNQB 2JC6A 3I4BA 4IQ6A 4ALUA 5BMSA 5ETCA 4WUNA 1CDKA 1NXKA 4GFOA 3QUEA 4MD8E 4JX3A 2W17A 2PPQA 3DFAA 4EBVA 4BGHA 5K4IA 4Q5EA 3U51A 2FUMA 2YM7A 4OTFA 5DIAA 1HCKA 1NY3A 3P1AA 4U44A 5KMJA 4L68A 4HVHA 4ITIA 2G01A 1Y8GA 2O5KA 3R1SA 4IWPA 3VWAA 5HLWA 3TUCA 3V5LA 2HENA 4JDHA 1XHAA 3RWPA 3MPTA 5H8GA 1UKHA 1G3NA 4PDSA 4LM5A 4CFXA 4O7ZA 2IVSA 4Q9ZA 4KUJA 4ZY5A 5FQDC 1OM1A 4LUDA 3O8PA 4TYEA 4ZSAA 3R0TA 3FL4A 3DPKA 3NUSA 2GHMA 3R01A 4U45A 5HKMA 3AMYA 1XBAA 1YXUA 2ETRA 4FSWA 3TZ8A 4DG3E 5H9BA 5JQ5A 3SXSA 3OP5A 4KRDA 5CF8A 3WBLA 2WTKC 5E8SA 5FDPA 3PIXA 1PXKA 4X2KA 4EOJA 4V04A 3C50A 3OCSA 5AAFA 3Q9ZA 2V7AA 5HG7A 3LCOA 4JAJA 5EOBA 3FZRA 4FX3A 2ZM3A 1U5QA 3BX5A 5HE1A 4C4FA 5KKRB 3SV0A 3ZFYA 1CKPA 2R0UA 4JBPA 1X8BA 4IE9A 4IZYA 4JT3A 4LUEA 4EH6A 1MQ4A 4RMZA 2XIRA 3JS2A 3H0ZA 2YJSA 4NCTA 2HWPA 3W18A 3DXPA 4YURA 4Z7HA 4DTBA 1H28A 4CFVA 4CFFA 4FIIA 3D15A 4GFMA 2HCKA 3TXOA 3FMEA 4G5PA 3NUAA 2UZNA 4QP8A 3FXXA 5HOAA 4ANLA 4R7IA 4AZVA 4F1MA 4QTDA 1KUTA 1VJYA 5D11A 2WTDA 4FG8A 4G5JA 4FE2A 3MGYA 5CU6A 2EXEA 4OTGA 5DA3A 3WZUA 3TV4A 4TT7A 3DA6A 1YI4A 3DBEA 1GNGA 2WB8A 3UOLA 3NVKI 3SA0A 4JDKA 4JL9A 2JDSA 3JVSA 3MIYA 1BI7A 3KVWA 4FTAA 1YRPA 3ZLWA 4DTKA 3EQCA 2R2PA 1LEWA 3RZFA 5CT7A 3SG8A 3ROYA 3IECA 4F7JA 1YHWA 2AC3A 4RWLA 3QTZA 4YTFA 1OL6A 3Q4UA 2GQRA 2E9NA 3FDNA 2R3JA 3T9TA 4JDJA 3AD4A 3P08A 3KB7A 1SVHA 4R8QA 2VV9A 5A46A 4GYIA 4ANBA 5CQWA 3QALE 3C7QA 4FIHA 2FB8A 2HK5A 4QPAA 3RAWA 1ZYJA 3PVWA 4YC6A 3H3CA 5HBJA 3QRTA 1FVVA 1E1XA 3I1AA 5JEBA 5L8JA 5GHVA 3NWWA 3N4UA 5IQAA 4MK0A 4GFGA 2Y4IC 4DFYA 4PNKA 4F9YA 4XRJA 4ALWA 3UIXA 3U6HA 1WBPA 2WMRA 5L2SA 3DAJA 4QQTA 4HVDA 4RA4A 4K8AA 3DJ6A 3VHEA 4I6BA 4FSTA 1IAJA 4B4LA 3RCJA 1VYWA 4KS7A 3BHYA 4E26A 3LFAA 3TKIA 4BZDA 3WE8A 2VX0A 4TYIA 3PPKA 4TKSA 3S2PA 4DFNA 2G9XA 5HG9A 3VF8A 4CMOA 2B55A 1VR2A 5CAQA 2XA4A 4N6ZA 3ZO1A 4XOYA 4AGWA 3LHJA 1GZNA 2XNEA 3AGMA 4NWMA 3GU5A 3PSBA 5CSWA 4ACHA 3PPJA 2CGVA 1BL7A 1OKZA 5CI7A 5KBRA 4FTOA 2PVRA 4IFCA 3ZZEA 5DEYA 4C7TA 4GUBA 2C6OA 3MVJA 4WG4A 5LCKA 5EHYA 4CXAA 3R7IA 4C58A 1FVRA 2H8HA 4ITHA 2XCHA 4ZSEA 2ZYBA 3HAMA 1I09A 3FHRA 3VC4A 4X2JA 5IH6A 3GNIB 3UZRA 5E9EA 4PMTA 4DF3A 1S9JA 5IA0A 3A8XA 4YC3A 3SQQA 3OG7A 3ULZA 1YDSE 3A7JA 5C1QB 4FV9A 3K3IA 5ANKA 3BBTB 4AGUA 4AW5A 4K1BA 1QMZA 2YCFA 2P55A 3NNVA 2QD9A 3QTXA 1WVWA 1PW2A 3V5PA 4GYGA 4ZOGA 4NW6A 5HX8A 3VS2A 4EOSA 3TT0A 4EK6A 3F3VA 5A9UA 3TTIA 4O0UA 3OOGA 2JKKA 1JOWB 3HX4A 1Q3WA 3QQUA 3W2OA 5CF5A 3EQRA 3R7GA 4XRLA 3SDJA 5IPJA 4DHFA 4FEUA 1TVOA 2ITZA 4NJDA 4XBRA 4EL9A 4GG7A 3OEFX 3C0IA 2WAJA 1M2PA 4G34A 4I4FA 4CKIA 3ENMA 3MFRA 3O23A 3O0GA 3PY0A 4BWXA 5K5XA 4FGRA 1KE7A 4BCFA 5EKOA 1XKKA 2QVSE 3UODA 3S00A 4G1WA 4BBMA 2ZMDA 3LQ8A 3Q52A 3KKVA 5K3YA 1XBCA 3TWJA 3WZEA 5I3RA 5IMXA 5KMIA 2Y9QA 3ITZA 3QU0A 5G6VA 1YOLA 4WSYA 5A4QA 5IQCA 3QZHA 1S9IA 5M51A 3RJCA 3JY9A 3BKBA 4R3PA 4H58A 2YCSA 4YTIA 3VNTA 1HOWA 1URWA 2R5TA 3QLFA 3RMFA 4E5WA 4IJ9A 4UB7A 5HTIA 1ZOHA 3AQVA 2WELA 5AP5A 4IB0A 3PXKA 1OPJA 2UZEA 4P5QA 3T3VA 4DBXA 3A99A 4YJPA 3ZOSA 2IZUA 2R7IA 3PE1A 1JVPP 5AR5A 4YJQA 5I9VA 3PJ2A 3LM0A 3QF9A 4XG3A 3D5VA 1ZAOA 3VW6A 4TNBA 2WMSA 4LYNA 3ZLYA 1LEZA 4AWIA 1P4OA 2BAKA 4YJVA 1ZLTA 1YHSA 3GT8A 3NDMA 1LP4A 3EYGA 3MWUA 4D0WA 5I9WA 2W1FA 4I0TA 2OICA 2C5VA 4QMWA 4BGGA 4MAOA 4RIOA 3RBWA 4NK9A 3DNEA 5HEZA 4FZDB 4CT1A 1WBNA 2I40A 3Q2JA 4L00A 5EW8A 5EYKA 2QOHA 4QTEA 5BVNA 3OCTA 1DI8A 3D14A 3FBVA 3VJOA 4OUCA 3DFCB 5IA4A 2XNPA 4XCUA 4NL0A 5FG8A 1M17A 3VN9A 4BFMA 1H0WA 3P7BA 1U4DA 3JVRA 3QA0A 4KIQA 2ZV2A 2ZV8A 4TZRA 4NYEA 3OWLA 2WOTA 4Y5HA 3UDBA 4JG6A 3VO3A 4LGDA 2A19B 2CCHA 2WZJA 1BL6A 2QC6A 4YZDA 2CLQA 3F5XA 4OT5A 5HTBA 1JAMA 2P2HA 5CNNA 3FKOA 3I79A 5J87A 2XVDA 4JOAA 3MH1A 1P4FA 3MFSA 3QXPA 3FY2A 4BRXA 5EM5A 5K9IA 1TQIA 2WMBA 1KV1A 2BCJA 3BHTA 1IG1A 4K0YA 2BTSA 4D4SA 4FTTA 3EFLA 4L3JA 4OW8A 4FMQA 1REKA 3RHKA 2V22A 2ZDTA 3G15A 4DFUA 3C0HA 3BQCA 4E20A 4XP0A 3FLSA 1FPUA 5JRSA 3E3BX 3GEQA 2VX1A 4GS6A 4XOZA 3QCSA 5BYYA 2XNBA 4NFNA 2G2HA 4ZK5A 5AIRA 3CKXA 3T9IA 4PMMA 3FWQA 3R73A 4FIJA 3PWYA 4FT9A 2J50A 4QP2A 4YJUA 5AAGA 2BRHA 3E8NA 3R04A 2UZDA 1UNLA 5E91A 4DINA 4NU1A 3LLAA 3N4TA 4LRJA 4QMXA 4X6RA 4GMYA 3TNHA 5JFWA 4FICA 1K2PA 1J91A 3FMMA 1OL7A 3NPCA 4P7EA 4E4LA 4HW7A 3QKMA 5FGKA 5CALA 5HG5A 4KBAA 3FSKA 3PVBA 2VWUA 3HMIA 4YPSA 3I6UA 2B4SB 3ORPA 4RZWA 4UEUA 3RPYA 4BKZA 4DGLC 3OWKA 3QQHA 5GINE 3HNGA 4IADA 4K18A 2R3HA 1H8FA 2WGJA 3EKNA 1UVRA 3NYOA 2O3PA 2A27A 4FV5A 4B7TA 2BKKA 3OWPA 3U87A 2PU8A 2YIRA 3DZOA 3N9XA 4PL4A 2RFSA 3A7FA 5EK7A 3KXNA 4IB5A 2J4ZA 4BTJA 2GCDA 4YTCA 3QTQA 1KE8A 3ATSA 3LE6A 3UIBA 4O0SA 4IAAA 3GC7A 2QO2A 4UV0A 4ZTSA 3PG3A 4EOKA 4CLJA 3RGFA 5KMKA 3R83A 2ZMCA 3FHIA 3B8RA 4W8DA 5E8XA 4DA5A 3BYSA 4NCTC 4RX7A 4HPUE 1FGIA 5CVGA 4ZLOA 1UKIA 3TKHA 5LMKC 2OLCA 4APPA 3LOKA 3E62A 4DN5A 5L8LA 3DY7A 5AWMA 3V5WA 4RVKA 1U59A 4LFIA 1WCCA 2VX3A 3QQFA 4KIKB 2YCQA 4R1YA 2G2IA 3H9FA 4RIWB 4U9AA 4FKGA 1H24A 2PMNX 3R00A 5EYMA 3U9NA 4FT7A 1LR4A 2BZHB 1YDRE 4IB3A 1ZRZA 3QTIA 4GG5A 4IEBA 5FM2A 4AAAA 5E4HA 2JDVA 2B9HA 3O2MA 2C5OA 2FVDA 1P14A 2B1PA 2FSTX 4LMUA 4QNYA 4WNPA 1PXJA 5AA9A 2OIDA 4QP1A 2QU5A 4FKIA 2YZLA 2CKQA 4RIWA 3II5A 4WBOA 3HV7A 2VTOA 4S2ZA 5ETAA 3OW3A 3Q53A 1H00A 2YERA 2ZB1A 3CGOA 2J2IB 3WIKA 4PPBA 4D58A 3TM0A 3V6RA 3LXPA 3E3PA 3GFEA 4FT5A 4IXPA 4FZAB 1KE9A 1ZOEA 3DOGA 4RX8A 2OU7A 3JR1A 2VRXA 3BHUA 5FP5A 4AU8A 4N70A 4U80A 3W16A 5D12A 4DITA 3KRLA 5T6KA 4O0XA 3I0QA 3ZUTA 3FE3A 4YJTA 5K0KA 2WTKB 3P23A 5E8YA 2CNVA 3VAPA 3P5KA 3LCSA 3KA0A 2VTNA 4FYNA 2IW8A 2ONLC 4CNHA 5J9LA 3GU4A 4C4EA 1OBGA 2UZBA 4FK6A 4OTPA 2QOFA 1H25A 2UW7A 3DTCA 3UC4A 4G31A 1ZMVA 4FL3A 5I9YA 5EHLA 1JQHA 3OBJA 2IJMA 5HGIA 4EKKA 2BMCA 2C0IA 3G2FA 2JIUA 3DZQA 5J5SA 2O64A 3OC1A 5K0XA 2ZV7A 5EQYA 4I3ZA 2JKQA 4M66A 2BRGA 3S3IA 2GQSA 5IQIA 5BUJA 4D2TA 2QO7A 3A2CA 4C38A 3HEGA 2Y4PA 4QP3A 1SM2A 5AADA 3AMBA 4JRVA 4BYIA 1CKJA 1SYKA 5EM7A 5LARA 5AV0A 3Q32A 4X7QA 4ASDA 2W05A 5FEEA 5JFXA 1Q24A 2XKFA 3CPBA 3GGFA 3WE4A 4B8MA 4AG8A 1UWHA 4KIPA 1CTPE 2ZM4A 2XKCA 4RFZA 3UO6A 3PSCA 4I20A 5I0BA 4O0TA 4W9WA 1FBNA 4U0IA 2YDIA 3AC1A 3EZVA 1KE6A 4HZSA 4I23A 4O6EA 5E8UA 4EJ7A 3CEKA 4OR5A 5HE2A 3ODYX 3AT3A 3FLQA 2RF9A 4C33A 4CVAA 4JX7A 4F9AA 4L44A 2NP8A 2J51A 4OTDA 1ZYSA 2OI4X 4RC2A 2XH5A 3OD6X 5DFPA 3UO5A 5A6OA 3W55A 1J7IA 3LXKA 3QKKA 5HNBA 3AOXA 4HYHA 4EH3A 3DDPA 1J1BA 2VUWA 2NRUA 3ET7A 1MUOA 4D4RA 3P86A 4KSQA 3V5TA 4EHVA 3AG9A 2NO3A 4BYJA 4C0TA 3KN5A 4GRBA 5FTQA 2OXYA 3HMPA 3E5AA 3LKMA 5AV4A 3MW1A 2Y4IB 3NUPA 4CTCA 4CT2A 4D28A 5K5NA 5KE0A 3ZUUA 5IA2A 2I6LA 5M07A 3BHHA 3UNKA 4Y46A 2VTQA 4RJ8A 1PYEA 4FIGA 2W1GA 1WBSA 3KVXA 3C4FA 2WEIA 3SXRA 4BN1A 2CKPA 4AZSA 1BX6A 2FA2A 5I3OA 5HO7A 3KMUA 4UYAA 4XLVA 3E7VA 3PXYA 3LW0A 4L7FA 4E8AA 4MHAA 1TQMA 5LWNA 3NCGA 4XP2A 4MWHA 5ANEA 3HV3A 5IZFA 3FZ1A 2WXVA 3HP2A 3KGAA 3ERKA 2YAKA 3HYHA 4ITJA 2IVUA 4O1PA 5BVDA 4UBAA 2OJGA 3NCZA 3OS3A 4FSYA 1JBPE 4GT4A 4LMNA 4O21A 5B2MA 4YZ9A 4QP4A 3VUMA 3R7UA 3MY1A 5FEQA 4PMPA 4G9RA 3L9PA 1J7LA 3LM5A 4AOJA 4NM7A 5IH5A 2P0CA 2XK3A 4FI1A 5AV3A 2JIVA 4QMZA 4Y73A 3FSFA 4QMLA 2WMAA 5HG8A 2R9SA 2XBAA 5CWZA 4CCBA 4FUXA 1Z5MA 2EU9A 2C5YA 3C1XA 4IBMA 2W99B 1MQBA 2ZB0A 4XEYA 1H1RA 2PVJA 4MTAA 2GS2A 2KTYA 2GU8A 1PXNA 3QYWA 5JRQA 2CN5A 3NR9A 4I41A 5ANGA 2JITA 3EJ1A 4IM0A 4NW5A 3PVGA 4L01A 4KA3A 5CEMA 3ACKA 3WIGA 4OAUC 4FSMA 5FLFA 3LMIA 2E9UA 4EHEA 4YHFA 2SRCA 4IFGA 1DM2A 1PKGA 4JLCA 3VQHA 5J79A 3I60A 1IR3A 1YXTA 4I5HA 4AXAA 5GNKA 3A7IA 1R0EA 4BI2A 4D2PA 4UZHA 5J1WA 4M13A 4O2PA 4I0SA 4O1OA 2CLXA 3GP0A 3BLRA 4YO6A 3DQXA 2V62A 3SRVB 4BR3A 2JGZA 5LQFA 3PXZA 4FV6A 4FTMA 4FNYA 3G6HA 3IO7A 4WG5A 4A9UA 3Q04A 2E9PA 4IX5A 4FSZA 4DG2E 2RKUA 4TPTA 1NVRA 3GCPA 4D55A 5GIPE 3IW5A 5M57A 4C61A 4C3FA 5EKNA 2C1BA 4DH3A 2BDFA 1QPDA 3D2KA 4GV1A 5CEQA 4QYHA 3TL8A 2XK9A 5KMLA 3SHEA 5EM6A 3SRVA 4E1ZA 2UZUE 4O27B 2XF0A 2GNLA 4AS0A 2CNUA 2ZVAA 4H1MA 4F6UA 4C2VA 5C9CA 4L45A 3W10A 4EUUA 4X21A 5M4UA 1KWPA 5IUGA 4AA4A 4FV3A 1ZOGA 3PLSA 4BIBA 4C4IA 4ZY6A 4M15A 3BYUA 3ZYAA 3ZXZA 5DGZA 4OTHA 3LFNA 3QHRA 3ZRMA 4WNMA 1EH4A 3PZHA 1P2AA 2YIXA 4M68A 2BIYA 3LFDA 4KB8A 3PIYA 4ACCA 4RWIA 3NUUA 4FEQA 1UU3A 2BHEA 5BYZA 2EUFB 2W06A 4QTAA 3DT1A 2PZPA 2QG5A 2PZIA 3QZFA 3GB2A 4EH4A 4R77A 4YUQA 1PXPA 3PY3A 1YDTE 2OG8A 4Y95A 5DT4A 4S33A 3F3UA 4I0RA 4BICA 2VWIA 2YIYA 2OK1A 3ENHA 1OPLA 3V8SA 5F9EA 1G8SA 1M7NA 2WTVA 3N4VA 2CPKE 2C0TA 4ZTMA 4HGTA 2R3RA 3TZMA 4BCGA 3PP0A 4QP7A 3TUBA 2PZ5A 2P4IA 2R3KA 3PXQA 3CJGA 3PJCA 4MNFA 5I4NA 3FEGA 2JIIA 4W4WA 1YXVA 4NTSA 3TNPC 2JAVA 4NKSA 2UW3A 3I6WA 3HRCA 5KMNA 4MXZA 3IDCA 4DH5A 4TWPA 3COKA 3R9RA 4CMUA 3LCTA 4J97A 4Y8DA 3PA4A 2XK6A 3CQEA 5E8ZA 3A7GA 2A2AA 4V05A 3Q4CA 5JFSA 4GJ3A 4DE4A 3EL8A 4A9YA 1OL2A 4AA5A 4H05A 2OZOA 3H10A 4EK3A 4O7TA 4XG9A 2Y0AA 3IGGA 4GEOA 4C37A 4BF2A 3UGCA 4BCPA 4RJ4A 2YJRA 5DEWA 3CTQA 3QRUA 5A6NA 3ALOA 4YGAA 4EC8A 4O2ZA 4YO4A 4EOOA 2C47A 4FTKA 1MP8A 3KMMA 4PDPA 2BKZA 1KOAA 3KRWA 2FH9A 5DVRA 2Z7LA 1KV2A 2W4JA 3H9RA 5JFVA 3MB6A 2G2FA 2WMXA 4IWQA 3MY0A 1OPKA 4ZZMA 5HI2A 3QFVA 4U7ZA 5LWMA 5H8EA 2IZSA 2Z7RA 2WEVA 1H1QA 3MPAA 4IANA 4PNIA 4ZTHA 5LCJA 5DR9A 1ZZLA 2X4FA 3R8PA 4NM0A 5B2KA 2QHNA 3BGPA 3R8UA 5JN2A 3SC1A 5AR8A 3FMNA 5AA8A 3IQ7A 3ETAA 1QPEA 3NZ0A 3UVPA 3O8UA 2R3NA 3OHTA 2UZVA 3KQ7A 1W83A 3IDPA 4BY9E 3ORNA 2RSVA 4MNEB 4Q5HA 4K6ZA 3MVMA 3IOPA 5TT7A 4Y85A 5D9HA 4UALA 2XEYA 4CGAA 2UZOA 3DBCA 4C59A 4EC9A 4CEGA 4Y83A 2OIQA 4OGRA 4PX6A 3C5UA 2REIA 2VO0A 4WBBB 2CJMA 2PTKA 4HCTA 2PVHA 3DKOA 2GQGA 3ZC5A 4TXCA 4AF3A 4QQ5A 1W98A 2ZM1A 3KXMA 4MNEA 2BR1A 1YWVA 2ITPA 3BYOA 2B54A 3D9VA 3TNWA 4YSMA 1E9HA 1ATPE 1ZMWA 1OBDA 4O7LA 2XIXA 2JFLA 3LFEA 4RIYB 3RZBA 3MI9A 3VQUA 4M84A 5CVHA 4E4NA 4HVSA 4UZDA 4YLLA 2BZJA 3CY3A 4WKQA 2XIYA 4I24A 4P4CA 3QZIA 2XM9A 4YJRA 4K77A 5LMKA 4PTCA 4R3RA 2VO7A 2BRBA 4BBEA 3K2LA 4KD1A 2VTIA 3DB8A 3OT8A 4P90A 4PTEA 4F7LA 3G0EA 2CSNA 3MV5A 4RIYA 5FTOA 3ZDIA 3NAYA 3POZA 5CZHA 4ZS0A 3B2WA 1WFCA 1K3AA 2C3IB 2OH4A 3Q4ZA 4RA5A 5A4LA 3SKCA 3QUPA 4AGCA 3ZSGA 3HMOA 3REPA 2X9FA 3V6SA 3O7LD 3UOJA 5DNRA 3LMGA 3WF5A 3MH0A 4TY1A 1DAYA 1OUKA 2F4JA 1NVSA 3GENA 5E1EA 2JKOA 4M69B 3ZLXA 4MXXA 2UW6A 4NJ3A 3TEIA 4MKCA 5G1XA 5LMAA 1H27A 1ND4A 3CD3A 4AGDA 4GU6A 4HCVA 4JG8A 2C30A 5EQEA 3R63A 2VWXA 3HUCA 2XIZA 4LQMA 5DT0A 2ITWA 4DGGA 4RLLA 4ANMA 1ERKA 4KKHA 4IVCA 4YTHA 1TKIA 2C6TA 4L52A 3DGKA 3EQPA 3KCKA 4EZ7A 4LV5A 2PYWA 2OJ9A 3CBLA 1B38A 5IF1A 3BYVA 4M69A 3QHWA 4EHZA 2VZ6A 2QHMA 3VS6A 3O17A 3PRFA 3FC1X 4ACGA 4KKGA 3RINA 3C51A 4BL1A 1OZ1A 3BE2A 3NEWA 4IC7A 2C3JA 2BFXA 2WQBA 4EZ5A 4XS2A 3OXZA 4Y72A 4S30A 3F5PA 4C4JA 2YM8A 2ONLA 1PRYA 1H26A 5H2UA 3CTHA 5J95A 2VWBA 2VNYA 2F49A 3ZEWA 4Z3VA 3F69A 4JAIA 3UTOA 4AZFA 5CI6A 4GU9A 4K9YA 4E7WA 2QLUA 5AV1A 3RAHA 4EUTA 1R39A 2EXMA 3NYNA 4A06A 4BBFA 4CV8A 2PVYA 2RFDA 1OUYA 2YIWA 1OMWA 4L3LA 4QP9A 2CDZA 2XNOA 2V0DA 3BGQA 3CE3A 4AW1A 3R7YA 5HNIX 1PXOA 3D5UA 1W7HA 4OTRA 2A0CX 4FK3A 4XX9A 2ZOQA 4BDIA 3L8PA 5CQUA 5FXSA 4BIEA 3WARA 2X8IA 3F7WA 2QKRA 3F3WA 3KFAA 3R1NA 4PV0A 4BZNA 4E5AX 1OKWA 4AN3A 3F3TA 3ORZA 3DLSA 3VBWA 2RG5A 3ZRLA 5KNJA 2EWAA 2GSFA 4G3DA 2VGOA 2VWZA 1Y8YA 1BYGA 4LL5A 3HZTA 4G3CA 4NH1A 3ROCA 4FIFA 2PUPA 1XH7A 3QUDA 3OZ6A 3LXLA 1ZYLA 2W4KA 3ZXTA 3W8LA 4WHZA 4F99A 3QTUA 4BTKA 3DAEA 2WTCA 3AC8A 4MBIA 1JSVA 5CEIA 3L8SA 5TO8A 4CFWA 4FOCA 5DPVA 4QRCA 3WF6A 3L9MA 4DLIA 5DMZA 5IQGA 3PP1A 2DUVA 3F2AA 4HCUA 4CD0A 4XJ0A 5IKWA 1H1SA 1OL5A 3L9NA 1HCLA 4XV9A 1PMEA 4NFMA 3QRJA 4AOTA 3RKBA 1F5QA 3VHKA 2PMIA 4HYIA 2HZNA 5F4NA 3QD0A 3BEAA 4E6AA 1NW1A 1PKDA 4PL3A 2PSQA 2VWWA 1ZY4A 4BI1A 1L3RE 5A14A 3U55A 2O0UA 2XK4A 3AMAA 3EKKA 3Q6WA 4MCVA 5HTCA 5DYJA 4ANNA 3Q9YA 4RSSA 5ANIA 3FJQE 2F7EE 2YISA 2HOGA 4K2RA 4GCJA 4DEEA 3CD8A 5IDNA 1ZY5A 3OTVA 4I5PA 5CAPA 1YI3A 2UW0A 5AP2A 4B0GA 4DBNA 4GIIA 5EYCA 2W1CA 4FKOA 3GU7A 3MA3A 3RM7A 3V5JA 5IMEA 4H3QA 4F6WA 4MH7A 5AP6A 2ITTA 3QC4A 2QCSA 5BX0A 3H0YA 4WG3A 4QT1A 3EN5A 4I6FA 3S4QA 3R71A 3MY5A 3DKFA 4FV8A 2R3PA 1PMUA 2IZTA 2UW9A 3EQIA 3GXLA 2VTRA 3HL7A 3HDNA 5ANDA 4QMMA 4MF1A 4CSVA 4FTNA 3IW7A 3RNIA 4MXOA 2CNQA 4FZ6A 3POOA 4F6SA 3RALA 1Q97A 1XBBA 2OO8X 2JD5A 3KEXA 3SAYA 4BWPA 5DH3A 4NEUA 5GZ9A 4EORA 2R3QA 2R3MA 4FKJA 4I92A 4DC2A 4EYJA 5F94A 1UV5A 4AE6A 4C8BA 4EONA 1DAWA 4FTQA 3VS3A 4ZSGA 5AUXA 2E2BA 4J1RA 4RFYA 4O91A 3PE2A 4GUEA 3PRIA 2PHKA 2WD1A 2R3FA 3UC3A 4YSJA 2HZIA 4DFBA 3R7OA 2PUNA 3OW4A 4AZEA 3R30A 2H34A 2BPMA 2J5FA 3FMDA 2ITNA 2HYYA 4L67A 5L6PA 5LVLA 4O82A 4F9BA 4N4SA 3TACA 3DNDA 5B7VA 2VTHA 2WMUA 3QLGA 2OZAB 4DCEA 2CGUA 5M09A 5HD7A 3G51A 5CS6A 2ZJWA 1H0VA 5T3QA 4XG7A 4TWOA 1VEBA 5AV2A 4FEXA 1YVJA 2GFSA 4II5A 5HVKA 4KKEA 2QOLA 3CKWA 4AW2A 3E7OA 3LFCA 4F1OA 4D9UA 3FPQA 4FEVA 3ZTXA 5FUTA 1QPCA 2OXXA 5EI8A 3W8QA 2Z7SA 2ITVA 2GHLA 4PPCA 5T68A 3GCVA 5E1SA 1Y57A 1VYZA 4MVFA 4W4XA 2O65A 2OJIA 5LXMA 3DBFA 1M2QA 3LJ1A 1I44A 2OZAA 2X8EA 4QYYA 4RT7A 3ZO2A 5J1VA 3LFBA 2YDJA 4JR7A 4USDA 3WZJA 5M06A 1O6YA 2YEXA 4XHKB 2YM5A 5J9YA 4C35A 2CKEA 3A62A 3KULB 4XBUA 3F61A 1CMKE 3FV8A 4LRMA 2VU3A 5GZAA 4LOOA 4MXYA 3G0FA 3VS0A 4RJ6A 1JLUE 3BIZA 4FNWA 2QONA 2XK8A 4IAIA 4DEIA 5EDQA 5AUUA 3MIAA 3Q5IA 1Q61A 4ENXA 2EB3A 2WQMA 4MD7E 3OY1A 2OJJA 2ITXA 1ZYDA 2PVLA 4FSNA 4EYMA 5L2TA 1YI6A 5E8VA 1JKKA 3EN6A 5J9ZA 3VBVA 4DTAA 2O2UA 3KULA 2C6IA 3FLNC 3MS9A 4PUZA 5CASA 3ANQA 1RE8A 2PWLA 2YAAA 5HBHA 2P2IA 1O6KA 2R3LA 3RPOA 5CU0A 2R0IA 3F7ZA 2PULA 3C0GA 3OUKA 2J0JA 4EOMA 3RK9A 5E7RA 3OUNB 4CYJA 4YZBA 5CAVA 3VRZA 2VAGA 4PPAA 4AN9A 2J9MA 4BDAA 3EN7A 2B9FA 3FMLA 4L9IA 4W8EA 2BILB 3ALNA 4UMUA 5GJFA 2VO3A 2XRUA 3GU8A 4BCJA 4W4VA 4RGJA 4UWCA 1UU7A 4LRKA 1FINA 3HAVA 2BHHA 4HYUA 5BYLA 4FV7A 4RC4A 4H39A 3VS7A 3QWJA 4J8NA 5M08A 3UQGA 4BCNA 4H3BA 4O84A 5HCYA 5AP1A 4O83A 3DJ7A 3FZPA 4DGNA 3FKNA 4TWCA 3VUIA 5JMSA 3BLHA 5ACBC 3UIUA 3DJ5A 4PRJA 4E6QA 5JK3A 3UYTA 2BDWA 2C6KA 4B9DA 1YWNA 3DTWA 2X6EA 3TV7A 1UNGA 2GFCA 2O63A 4BHNA 3PVUA 4CCUA 3KXXA 4OBPA 2BTRA 3VUHA 4ZAUA 3NUNA 2VWVA 3JY0A 3T3UA 1A9UA 5I9ZA 2PUUA 3DDQA 4O0WA 3L9LA 5KZIA 5TR6A 5IEXA 2EXCX 3Q2MA 3KMWA 3RM6A 3ZFMA 2OXDA 2C3LA 5BMMA 5KUPA 4QYFA 4O81A 3SD0A 3L8VA 5DR6A 4PQNA 4GL9A 2XCKA 4I4EA 4E4MA 4MYGA 3DLZA 4YHTA 4EEVA 4JDIA 1R78A 1IRKA 4FNXA 3EWHA 3KRRA 4QQCA 3R1QA 3PZEA 4XH6A 2WNTA 1BLXA 3TDWA 3QCQA 4PP9A 3JPVA 4FUYA 4KABA 3RHXA 1P5EA 3NVMB 4BIDA 1J7UA 4J7BA 4FTIA 3BRBA 4RBLA 2ZAZA 5IEVA 3R2BA 5IQEA 4DT8A 1Z9XA 4BDHA 5AUYA 3BELA 3H30A 3EQHA 3R22A 2OJFE 2PVKA 4RG0A 5DRDA 1T45A 3OCGA 4IJPA 4ALVA 3DQWA 2WQEA 3QCYA 4IHPA 4RVTA 5AP0A 2C4GA 3UVQA 3D7ZA 4YNEA 3CIKA 3R8ZA 1J3HA 4BWKA 3GOPA 3E8EA 4XV1A 4FKLA 4D5KA 1QCFA 3EQGA 3Q6UA 5C4LA 3AT4A 3TG1A 3PYYA 5KBQA 4AP7A 4WRSA 3R9HA 3MH3A 4QTCA 5BVFA 3ORLA 2FGIA 1PXLA 5D7VA 1GIJA 5F20A 5AX3A 5HIBA 5BVKA 4ZJIA 3W2SA 4BDFA 2YA9A 4DEDA 5L6OA 3EFKA 5M44A 4PY1A 5TOZA 3EIDA 1OIYA 4NM3A 3UOHA 2OFUA 4EH7A 1NVQA 5FRIA 3PLAE 3S0OA 4BZOA 4DFZE 4PMSA 2BUJA 3QAME 4IZ7A 1JPAA 2BAQA 4X6QC 5HICA 3HKOA 5AEPA 1GZ8A 4EH2A 3UMXA 4UMTA 3G9LX 4ASZA 2R3GA 3LJ0A 2I7QA 4NTTA 2H9VA 3QCXA 4O38A 3TN8A 1M7QA 4NKAA 1PJKA 5CU4A 2W1IA 4YJSA 4UMRA 1PHKA 3AT2A 4JQ8A 2Q0NA 4U81A 4EKLA 4H1JA 3E64A 4DFLA 3NW6A 2BAJA 3ACJA 4F70A 2Y6MA 3G6GA 4AW0A 2NNWB 5FM3A 4E5BA 4JVGA 1U5RA 4CV9A 4FV2A 3HRFA 2X39A 3GC8A 4NZWB 5A4EA 4O7NA 1IA8A 3SVVA 4HGLA 4FGBA 2YABA 1FGKA 2YDKA 2WOUA 5BUIA 4J52A 4EOQA 1WBOA 3FXZA 3VJNA 4PDYA 2BRNA 3PWDA 3CTJA 4AN2A 4J53A 3KL8A 4M0YA 2FYSA 4E4XA 4L53A 5BPYA 4L8MA 1PXIA 2XP2A 5TE0A 4G6OA 3OF0A 4HGSA 3LIJA 3TJDA 3UJGA 1B6CB 5C26A 1JWHA 3EMGA 3Q9WA 4FKTA 4ZTQA 2C68A 4U40A 3UPXA 2WPAA 5L3AA 2RFNA 5CXHA 2W1DA 4FA2A 2ERZE 2UZLA 2WQNA 3KCFA 3Q4TA 3SX9A 5FEDA 4ZSJA 2IVVA 3PSDA 2G15A 2YM3A 5LVNA 4W4YA 1YQJA 4RIXB 2X2KA 1H07A 3Q3BA 3FXWA 5C03A 2OKRA 3CR0A 1R1WA 4A4LA 2CCIA 4FV0A 4RZVA 4A9TA 4EWHA 3I5ZA 3NX8A 3MH2A 5CSHA 2HZ4A 4XV3A 3T8OA 4BKYA 1YW2A 1UNHA 2I0VA 3FYJX 3OROA 5FP6A 2IVTA 1GIHA 2CHLA 2NRYA 2XJ0A 3G33A 3K5UA 2V55A 4MF0A 3MTLA 4TW9A 2F2CB 3GC0A 2FSLX 2QLQA 4JJRA 4IM3A 4RIXA 4AE9A 4WOVA 1OECA 5DLSA 2J90A 4IVAA 4OT6A 3O8TA 5CXZA 1WVYA 3C4EA 2X6DA 2ZV9A 3C4CA 3PTGA 3BGZA 4D1SA 4YBKA 4RJ7A 3WILA 2XYNA 3GI3A 2OGVA 2C6DA 3GUBA 3HRBA 4GSBA 4HVGA 5DRBA 2C0OA 2XMYA 5KZ0A 2FO0A 5D10A 3MSSA 3OOMA 5A4CA 3FMJA 4U79A 1F3MC 4Z16A 4YP8A 2JBPA 5CSVA 2XBJA 5EFQA 4D4YA 4OBOA 1XWSA 1Q8WA 5CVFA 3OEZA 2OW3A 5KCVA 3CCNA 1J1CA 3MJ1A 4AT5A 4M8TA 3VBTA 3ZM4A 4G3FA 3U6IA 4FKVA 4NT4A 4YZMA 3QQKA 2W1ZA 1XH6A 3HA8A 2WHBA 4FTRA 5IU2A 3UG1A 4F64A 3AC5A 5TF9A 4LV8A 2BFYA 4RRVA 4DLJA 3NW5A 5C8KA 3U8WA 4KNBA 3FY0A 4F0GA 2Z60A 4IH8A 4O22A 4QMTA 5CYIA 2VNWA 1RJBA 4CYIA 1NT2A 4IC8A 4EI4A 3A4PA 3W33A 5CSPA 4IX6A 3UQFA 2QNJA 5CAUA 2LGCA 4OBQA 3BYMA 3Q5ZA 4RJ5A 5D41A 4FT3A 1PMNA 1STCE 1M14A 2ITQA 4FIEA 3V51A 1RQQA 1OI9A 4DFXE 1KOBA 4JI9A 3QZGA 5HZNA 3FLZA 5JGBA 3R02A 3C4WA 4D9TA 3MFUA 4Z55A 4JXFA 3QRKA 2JKMA 4UXQA 4QYGA 2QR7A 3MJ2A 4IX3A 4WNKA 2ITYA 4EBWA 2UW8A 2GHGA 3HV5A 3ORXA 4DEHA 1SNXA 4BDJA 4R7BA 4USEA 4YZCA 5ACKA 3UMWA 4UWYA 4EWQA 3FLWA 4GKIA 4Z9LA 2PUIA 4A4XA 3RNYA 4X3JA 3ZM9A 3UOKA 3VS5A 4L7SA 4D2SA 4MX9A 3V01A 1U54B 3NUYA 3UPZA 4FSUA 3I81A 4UXLA 3DK3A 3W32A 1IAHA 4WD5A 4GKHA 5IQDA 4XMOA 2XNMA 3TCPA 2WMWA 3QC9A 2VTSA 2W4OA 2BZIB 4KBCA 2P3GX 5AP3A 3V3VA 3W2PA 3PIZA 4N6YA 5C01A 5LJJA 4TYJA 4HZRA 4U3YA 5TKDA 4BDDA 2X2LA 5F95A 4DYMA 3F2RA 5AFVA 5M4IA 4ZLYA 2VO6A 4EK5A 3R6XA 4MD9E 4MBJA 1ZWSA 3U9CA 1OKYA 1BUHA 3EYHA 4LGHA 3RWQA 2W96B 3D5XA 4QMOA 1U54A 5HU9A 1UU9A 4ARKA 2JAMA 5BNJA 2AYPA 2HZ0A 4KAOA 2PE2A 4FBXA 5FBOA 4O7RA 2UVYA 2PE1A 4PP7A 4BCHA 4ZTNA 5J7BA 3LCDA 2UW5A 4I22A 4ZTLA 3G5DA 3VRYA 4RC3A 3FC2A 3OVVA 2Y7JA 4YNOA 3CLYA 5EDPA 3GCQA 1L8TA 2JLDA 4BC6A 4ANSA 3ORTA 4MQ2A 2QO9A 3NNUA 3R9NA 4CRSA 4DH7A 2YM6A 4UN0C 4FSRA 3A60A 3JYAA 1ZARA 2XKEA 2ERKA 3P4KA 5FXQA 4AX8A 2PY3A 5I9UA 3F9NA 1O9UA 3L8XA 4FZFB 2WMQA 3DV3A 4H3PA 1H1WA 2XEZA 4ID7A 4P5ZA 5E90A 2BDJA 2QURA 5JZJA 3PXRA 3GQIA 4O7VA 1MRUA 2UVZA 5HE3A 4F7NA 5HIEA 3H4JA 2JEDA 4RFMA 1W8CA 3GFWA 3RPVA 4J95A 4FC0A 1AGWA 3EOCA 2IW9A 4EQUA 3PUPA 5BVWA 3WYXA 4DH1A 5FBNC 4L3PA 1H4LA 2P33A 4O0YA 3RPSA 3UBDA 2YM4A 3WI6A 2Q83A 2Z02A 3EL7A 4WO5A 4G6NA 1JSUA 5CU2A 5AM6A 1GAGA 3O96A 3NGAA 2WKMA 4FL2A 4WNOA 4PF4A 4C62A 3ZMMA 5IDPA 3FI8A 4M3QA 5D7AA 3RTPA 4M0ZA 4D2VA 4LL0A 3ZH8A 3OT3A 3QGYA 4LGGA 3CY2A 5DOSA 1OIRA 1ZMUA 2W0JA 2WIHA 2X7FA 2XB7A 3D83A 3NW7A 3R28A 4YC8A 4A07A 4FVPA 5IEYA 1Q8TA 1Q4LA 5HESA 4R5SA 5C8NA 5CY3A
chains in the Genus database with same CATH superfamily
2QOOA 3IG7A 4B99A 3NIEA 2X1NA 4O0VA 3F66A 4RJ3A 2WO6A 3BWJA 4PWNA 4C3RA 3NUXA 4FZ7A 4QPMA 4QD6A 5ANJA 3EFJA 2VN9A 4QOXA 3HA6A 4R1VA 3WF9A 3KU2A 3ZZWA 4EH5A 2J5EA 5CEOA 4CZTA 2VTLA 4A7CA 4M97A 3MA6A 3W2CA 4BTFA 2OF4A 3F2NA 4LOPA 1W2CA 2PMOX 4GJ2A 3VUGA 4F1TA 2YITA 2ZDUA 3RK7A 1YXXA 4JS8A 4FOBA 4E73A 4IAYA 2X7OA 3ATTA 3D7TB 3CQUA 4XNEA 1ZYCA 1FMOE 3BLQA 3CS9A 3MYGA 4I5CA 3ULIA 3PA3A 4BCKA 3F82A 4EJNA 2HIWA 3UZPA 4FKUA 5AR2A 4EQMA 2QG7A 4CLIA 3HDMA 4FT0A 5EHOA 4I6QA 5JGAA 4RPVA 4ERWA 2X2MA 2QKWB 3LFQA 4E6CA 2H6DA 5CEPA 2WQOA 3W0NA 2E9OA 3RK5A 4L46A 3BHVA 4G17A 3D7TA 4FR4A 4U6RA 4U97A 4YBJA 3ZO4A 5FWKK 4YJOA 2VTJA 5C8MA 2B52A 3W0MA 3M11A 5JH6A 1REJA 2VD5A 3HV6A 1Q3DA 1QPJA 4J99A 5CF4A 5JGDA 5LVOA 5I5ZA 4I93A 4DEAA 2X0PA 5DE2A 3I7CA 3SW4A 5KHXA 2KULA 3WOWA 4C4GA 5EW3A 4UY9A 3OFMA 3RAIA 1VZOA 2QQ7A 3VVHA 3R7VA 1TFFA 3O51A 3V5QA 2W9FB 1V0OA 4J96A 5KX8A 3BCEA 2NPQA 3CC6A 3QQGA 1NA7A 4D2WA 1G5SA 4KINA 4C57A 2BIKB 4BDBA 4GVJA 4CFMA 3UZTA 3PG1A 4AT3A 1K9AA 3VW8A 5M53A 3NYXA 4AQKA 2LAVA 5C27A 2UW4A 2QR8A 4O4CA 4MXCA 4ZTRA 4E3CA 4XP3A 3FZTA 5ANOA 5AR4A 4XG8A 5FDXA 4FTUA 1ZZ2A 4RLKA 4AOIA 5BVOA 3C13A 3G9NA 1DS5A 3IONA 3BU6A 3S95A 3AXWA 1O6LA 1RW8A 3NNXA 4IACA 4YR8A 2C5NA 3BV2A 2X0GA 4C02A 3PY1A 2XNNA 3OTUA 3AC3A 3IPHA 3QQLA 3E63A 1XR1A 4RX9A 3MN3A 3R8VA 3EQDA 3NNWA 1YOJA 5LMBA 4AUAA 3A61A 2X9EA 2DWBA 5C4KA 4I1ZA 3MBLA 2PVNA 5J8IA 4HPTE 4QMNA 5IQHA 3JUHA 3QWKA 4R7HA 4TTHB 3I7BA 4R5YA 4S34A 5AUWA 4EK4A 4J98A 5AM7A 5L2IA 3TYKA 3COHA 4BDCA 4ZJVA 3C4ZA 4D4VA 4JQEA 4ZMFA 3G90X 4V01A 3QX2A 2GPHA 4O96A 3A7HA 3SG9A 1MRVA 2C6LA 3LXNA 3F5GA 3K54A 3F5UA 1WBVA 1KE5A 4D5HA 1IASA 3AKJA 3HGKA 4IAZA 4JIKA 4ANQA 3CSVA 3FAAA 3C4XA 1H08A 3RP9A 1YXSA 4FODA 3Q96A 5EH0A 2F2UA 2I0EA 2QI8A 4KIOA 5L6WL 4F63A 4FYOA 5EM8A 3KK9A 3TJCA 3ZHPC 4DEGA 3EH9A 2B0QA 3UE4A 3VBQA 1XJDA 3VBYA 4CG8A 2Z2WA 1F0QA 2B7AA 4ONAA 4IX4A 3B8QA 3K3JA 2XYUA 1WZYA 5HO6A 2I0YA 4F0FA 3L1SA 3VIDA 2PZYA 3FUPA 2AUHA 4KRCA 4XLIA 4DAWA 4O7WA 5LVPA 5IA1A 1OITA 3DKGA 3GU6A 1WVXA 5ICPA 3ELJA 3QX4A 4J71A 2IO6A 2X7GA 3MTFA 4HVIA 2C3KA 2CKOA 5GZ8A 4AZTA 5A4TA 3IGOA 5DHJA 5CTPA 5DN3A 4F65A 5D1JA 2F7ZE 4FG9A 1IA9A 4CZYB 1SNUA 2RL5A 3LCKA 2XNGA 4S32A 1JKSA 2YACA 4WRGA 3ZSHA 4F08A 4TRLA 1BI8A 4JIAA 4IWDA 2Z8CA 3TNIA 5AP7A 4DT9A 5HBEA 3SLSA 1BMKA 2J0LA 5JT2A 4O0RA 2BROA 2OF2A 3HV4A 4M7IA 4DGOA 1PYXA 2BZKB 4D1ZA 2C1AA 2W9ZB 3A8WA 3CGFA 3D5WA 4QMQA 3FMKA 5EDRA 3OMVA 2RG6A 3BPRA 3KN6A 3AD5A 4U5JA 3MPMA 3M2WA 5J5TA 4WT6A 2QODA 4NM5A 4QTBA 4QYEA 2W5AA 4A9SA 2DQ7X 4BCIA 4IVBA 5IUHA 3HMNA 2IN6A 2VGPA 2J0MB 4Q9SA 3DAKA 3THBA 2GNGA 3KK8A 3ZRKA 5HU3A 2R3OA 4D0XA 4TNDA 4PDOA 3DXQA 4MBLA 5A3XA 4QPSA 3CQWA 4CZUA 1URCA 1IEPA 4BTMA 4C34A 5HVJA 3KRXA 2PL0A 2VTTA 4L6QA 4YZNA 1GZOA 4KSPA 5ETFA 3CJFA 5EW9A 5EI6A 4UX9A 2XRWA 3ZU7A 4FKWA 3TZ9A 4ZZNA 5HNGA 3V8WA 5CAOA 4AA0A 2UZTA 4TYHB 2GTMA 3VULA 3HUBA 3IW6A 2G1TA 4G6LA 3IKAA 4IW0A 4QMUA 4GW8A 3NLBA 4R3CA 2YFXA 3ODZX 4DEBA 4EOLA 4TYGA 2R64A 4G3GA 3TI1A 5HORA 2W1EA 3BZ3A 2H96A 3DK7A 4M14A 3QXOA 4G9CA 1UA2A 4F09A 4IAKA 4ZSLA 2RIOA 3IW4A 3LQ5A 4L43A 4P2KA 4CMTA 2ETKA 4DG0E 2E9VA 4FV1A 3UO4A 4HOKA 4APCA 5AUTA 4X3FC 4TYHA 4I21A 3M42A 5ETIA 3DB6A 3E8DA 3BWFA 3NRMA 5IQBA 1SVEA 4XG6A 5K4JA 5E92A 4M12A 1A48A 2ESMA 2YIQA 4GT3A 4B8LA 2J0IA 1XH5A 1PF8A 4UMPA 2XZSA 2YWVA 5CLPA 3QRIA 4K11A 4MXAA 2R7BA 1YKRA 1M2RA 4WSQA 2OH0E 3W2QA 4BCMA 2HELA 4QMYA 1Q5KA 3AGLA 3F3ZA 4IIRA 4XYFA 2QOQA 4IZAA 5CT0A 5DR2A 3FLYA 4C4HA 2JDOA 3V8TA 3EZRA 4EH8A 3ZDUA 5L2WA 3PA5A 5I9XA 5ITAA 3COIA 3E88A 3D4QA 2JDRA 3FI3A 5IA5A 3WZKA 1V0PA 3GOKA 5B2LA 2UV2A 3WF7A 4BB4A 4X2NA 4FTLA 2B9IA 3P7CA 3DS6A 3PJ3A 4J8MA 3U6JA 1T46A 3GBZA 3NS9A 5CU3A 1CM8A 4W9XA 5H3QA 3EN9A 3ORIA 1Y6BA 3R8MA 2X4ZA 4AFEA 1W84A 3ANRA 5CNOA 3FL5A 2F9GA 4PTGA 4G16A 4JR3A 5JZNA 4BCOA 3BI6A 2WMVA 2X0QA 4FEWA 3FQHA 3KF7A 3FYKX 5HO8A 5EQPA 1OIQA 3ZCLA 2BVAA 4AZWA 5IISA 2QOCA 3DBDA 2YN8A 4V0GB 1Z57A 2WU6A 1OIUA 4CG9A 2IW6A 3W1FA 4FTCA 4IZ5A 4XV2A 2WIPA 3LQ3A 3BU3A 2YZAA 3W0QA 3PPZA 3QTSA 2OWBA 4F7SA 3BV3A 5FD2A 3R1YA 4XG2A 2GNHA 2VWYA 4JRNA 3MESA 3UVRA 3NAXA 1FOTA 2PVMA 4NSTA 3Q60A 5CEKA 4V0GA 4QP6A 4ZZOA 3DK6A 5HCZA 3BQRA 3TMOA 4ANOA 3SOCA 4KS8A 5KKRC 1R0PA 2OSCA 3FZSA 5JKGA 5HIDA 1LUFA 2Y6OA 1YHVA 5EG3A 5HVYA 5KMOA 3P7AA 1XQZA 4YLKA 3VBXA 5M56A 2UZWE 3K5VA 1JNKA 2WTIA 1OB3A 3FKLA 3P9JA 5IH4A 3WZDA 3D94A 3PFQA 4U8ZA 3AD6A 1B39A 1A06A 3UQCA 4OAVB 3GQLA 4KIKA 4ASXA 4CFUA 4F0IA 3QKLA 4X0MA 3AC2A 3BE9A 4DHZA 3GC9A 4CQEA 2FSOX 3UP7A 4FSQA 5AIKA 3DKCA 3TTJA 1OVEA 3MVLA 4BCQA 3BEGA 5L4QA 3U4WA 4B6LA 4R6VA 5L8KA 3RCDA 4AFJA 2PE0A 2W5HA 2CGXA 2YLEA 3OY3A 4EZ3A 2GNFA 4IDTA 3U54A 4DCAA 2I0HA 3OXTA 4JBOA 2R3IA 4EOPA 3UIMA 3E87A 4LOQA 3RVGA 4F4PA 2YCRA 5HLPA 4KWPA 1XH8A 3OWJA 4JQ7A 1BKXA 4FL1A 2Y8OA 5HD4A 4G3EA 4BDEA 4XG4A 4YJNA 4YU2A 3ZBXA 4R78A 3ZUVA 4CFNA 2WMTA 5CZIA 4USFA 3W0PA 1GJOA 3FPMA 3KXHA 2DYLA 2O8YA 4H36A 3DBQA 3ZSIA 4WA9A 1OL1A 3H9OA 4BVUA 1PXMA 2J7TA 3LVPA 3U4UA 4JG7A 5DI1A 3RAKA 4QMPA 5AR7A 4ZXTA 4IWOA 5M4FA 5GIOE 5CSXA 3BBWA 2IG7A 4KBKA 4CQGA 2HW6A 4U41A 2OBJA 4YMJA 3OBGA 3V04A 3QD3A 5AUZA 3EHAA 3QD2B 4FVRA 2GTNA 2RGPA 2GDOA 4O7SA 5KMMA 1CSNA 3KRJA 2GS6A 4BHZA 4MQ1A 4CTBA 4S31A 3RI1A 1Q41A 4FV4A 4GK2A 5DG5A 4A4OA 4C3PA 2WU7A 1Q99A 1M52A 2CGWA 2ETMA 3HP5A 3IOKA 2GNJA 4GK3A 4UWBA 4NUSA 5M4CA 5CANA 3FMHA 3VS1A 1GZKA 4O6LA 2VTPA 2F57A 2IZRA 3D2IA 3OXIA 4ERKA 5A54A 4ZIMA 4ZY4A 3SGCA 3LFFA 3VS4A 3R9DA 1JKLA 3IS5A 3VUDA 3ZFXA 4C2WA 3TKUA 4AT4A 3AC4A 1WBTA 4IM2A 2YLFA 2GMXA 5IA3A 3UYSA 4K33A 5EI2A 4I94A 1Y6AA 3KC3A 4D1XA 2HW7A 3QTWA 4GVAA 4JNWA 3C5IA 5E8TA 2PMLX 5HE0A 3LZBA 4O4EA 3PDTA 2XJ1A 5E8WA 1R3CA 1RDQE 4QMSA 2AEGA 2EB2A 4ORKA 4FVQA 1SVGA 2IWIA 2GS7A 1U46A 1V1KA 2W5BA 3DCVA 4IMYA 2FSMX 2AC5A 5BUEA 5KHWA 2IPXA 3QL8A 4I5MA 4AACA 2X81A 3SXFA 3CP9A 4IB1A 4MWIA 4NIFB 2XUUA 2HAKA 3E8CA 3IDBA 2HXLA 1XH4A 3R8LA 4BJJB 2QOBA 4U43A 3HECA 1G8AA 1JSTA 1Q8UA 3EB0A 2C6EA 3R7EA 4BDGA 2XK7A 4UYNA 4D2RA 4ENYA 4M67A 1AQ1A 1GY3A 1PY5A 4QNAA 3GVUA 3Q9XA 4QMVA 2JBOA 3KREA 4GK4A 4NIFA 2A4LA 4C36A 3WYYA 3VF9A 4X2GA 3HMMA 3I0OA 4O7YA 2YWPA 1W0XC 3GCUA 4CRLA 4AXDA 3B2TA 1WMKA 4I6HA 3N51A 4YLJA 3DU8A 3I5NA 4N0SA 2CMWA 3QA8A 5AX9A 3ZBFA 1UWJA 4HGEA 4JBVA 3ZS5A 3NIZA 5JQ8A 4HJOA 4ACDA 4HNFA 1Y91A 3EQBA 3ZONA 1LPUA 2WTWA 2BALA 4BDKA 4ZEGA 4EK8A 2XS0A 3CXWA 3E93A 1E1VA 4WUAA 1MRYA 4ASEA 1WBWA 1YOMA 3F6XA 5IUIA 1TQPA 2OIBA 3ZEPA 4FKRA 1DI9A 3QYZA 5M55A 3R21A 2J6MA 3SOAA 1W82A 1V0BA 1Q8ZA 4HYSA 4EH9A 3MFTA 5AUVA 2F7XE 2ITUA 5F1ZA 5DBXA 1UU8A 1XH9A 4Q2AA 4F9WA 4GH2A 5DWRA 5HX6A 3QBNA 5GJDA 5JSMA 1YWRA 5J7HA 3HVCA 4HNIA 2HY81 4OTWA 2CN8A 5IG1A 3LFSA 3W2RA 2HXQA 2ITOA 3D0EA 3QTRA 5AR3A 3LPBA 2DS1A 2XJ2A 3QD4A 1W2DA 4OLIA 4EOIA 5HLNA 1H1PA 3EQFA 5B0XA 1XO2B 3UG2A 3SW7A 3OCBA 3HLLA 4FF8A 1FMKA 4RVLA 4AQCA 4BKJA 4E93A 4MEDA 3LMHA 3PXFA 3UNJA 2V5QA 2BRMA 3KY2A 3FZOA 4XUFA 4RVMA 4TWNA 3RPRA 4CKJA 4ZS4A 4IDVA 1APME 3IW8A 2VTAA 4Z7GA 4BI0A 1GIIA 4LI5A 2V7OA 4ACMA 4RQKA 3FQSA 3ZC6A 3UP2A 5BVEA 1H01A 4IVDA 4IAFA 2R4BA 2WTJA 5HHWA 2EVAA 2PVFA 2W7XA 3F88A 2Q0BA 2QU6A 3W0OA 4FKSA 5BQ0A 5KO1A 2UVXA 3KXGA 2UUEA 1SZMA 5AP4A 2X8DA 4BGQA 5CX9A 3FQEA 3WF8A 2RFEA 3MDYA 1QL6A 5HCXA 3O50A 3TIZA 3DXNA 4YPDA 2XKDA 1OGUA 4OTIA 4QQJA 5CENA 3O71A 1AD5A 1ZXEA 2A1AB 2PK9A 3BU5A 3NSZA 3ZLSA 4DH8A 3EFWA 3TZ7A 4EHGA 3VONA 5GJGA 2J0KA 4ZLZA 3ZO3A 4ZMEA 2PZRA 3MB7A 4FG7A 1PMVA 2QOIA 3CPCA 4PL5A 1CKIA 1FVTA 3M1SA 5L2QA 4F9CA 3VUKA 4GIHA 5LOHA 5AJQA 2ACXA 2JDTA 4WIHA 4LG4A 2XAOA 4YHJA 4DGMA 2GNIA 2WFYA 4FKPA 4FNZA 4RX5A 3P79A 2HY0A 2OFVA 3EN4A 1FQ1B 2C6MA 4FKQA 4OTQA 3GCSA 4TN6A 4JBQA 4EQCA 3TDVA 3KXZA 3LAUA 2JFMA 4QO9A 5FTGA 3PJ1A 4ZJJA 5LVMA 4N57A 4RWKA 5FXRA 3NYVA 3FI2A 4E6DA 5EOLA 2XM8A 1Q62A 4UMQA 4ZP5A 5HQ0A 1JKTA 3LJ2A 4FTJA 3S1HA 3KF4A 3QQJA 2I1MA 4TL0A 2B9JA 2B53A 3QGWA 4RQVA 4X3FB 3TUDA 2C5XA 5DT3A 5AMNA 4G2FA 3PJ8A 3O7LB 5CF6A 3VUTA 3IK3A 3P0MA 2C69A 2VTMA 4Y5QA 3TIYA 3P78A 5AAEA 4CKRA 3COMA 2W1HA 1OKVA 3ORKA 1Q8YA 1GOLA 4X3FA 2YHVA 4X2FA 3UNZA 2HWOA 3A4OX 5H8BA 3ORMA 4A9RA 2QOKA 5EYDA 3R2YA 3E92A 2Z7QA 3JXWA 2XIKA 4O86A 3TV6A 3LLTA 3NMUF 4U42A 5IQFA 3BL9A 3R9OA 4U3ZA 1WAKA 3MVHA 3ID6C 3C9WA 1KSWA 3FI4A 4L42A 1SMHA 4GT5A 4RWJA 3TNQB 2JC6A 3I4BA 4IQ6A 4ALUA 5BMSA 5ETCA 4WUNA 1CDKA 1NXKA 4GFOA 3QUEA 4MD8E 4JX3A 2W17A 2PPQA 3DFAA 4EBVA 4BGHA 5K4IA 4Q5EA 3U51A 2FUMA 2YM7A 4OTFA 5DIAA 1HCKA 1NY3A 3P1AA 4U44A 5KMJA 4L68A 4HVHA 4ITIA 2G01A 1Y8GA 2O5KA 3R1SA 4IWPA 3VWAA 5HLWA 3TUCA 3V5LA 2HENA 4JDHA 1XHAA 3RWPA 3MPTA 5H8GA 1UKHA 1G3NA 4PDSA 4LM5A 4CFXA 4O7ZA 2IVSA 4Q9ZA 4KUJA 4ZY5A 5FQDC 1OM1A 4LUDA 3O8PA 4TYEA 4ZSAA 3R0TA 3FL4A 3DPKA 3NUSA 2GHMA 3R01A 4U45A 5HKMA 3AMYA 1XBAA 2XAMA 1YXUA 2ETRA 4FSWA 3TZ8A 4DG3E 5H9BA 5JQ5A 3SXSA 3OP5A 4KRDA 5CF8A 3WBLA 2WTKC 5E8SA 5FDPA 3PIXA 1PXKA 4X2KA 4EOJA 4V04A 3C50A 3OCSA 5AAFA 3Q9ZA 2V7AA 5HG7A 3LCOA 4JAJA 5EOBA 3FZRA 4FX3A 2ZM3A 1U5QA 3BX5A 5HE1A 4C4FA 5KKRB 3SV0A 3ZFYA 4QDVA 1CKPA 2R0UA 4JBPA 1X8BA 4IE9A 4IZYA 4JT3A 4LUEA 4EH6A 1MQ4A 4RMZA 2XIRA 3JS2A 3H0ZA 2YJSA 4NCTA 2HWPA 3W18A 3DXPA 4YURA 4Z7HA 4DTBA 1H28A 4CFVA 4CFFA 4FIIA 3D15A 4GFMA 2HCKA 3TXOA 3FMEA 4G5PA 2XALA 3NUAA 2UZNA 4QP8A 3FXXA 5HOAA 4ANLA 4R7IA 4AZVA 4F1MA 4QTDA 1KUTA 1VJYA 5D11A 2WTDA 4FG8A 4G5JA 4FE2A 3MGYA 5CU6A 2EXEA 4OTGA 5DA3A 3WZUA 3TV4A 4TT7A 3DA6A 1YI4A 3DBEA 1GNGA 2WB8A 3UOLA 3NVKI 3SA0A 4JDKA 4JL9A 2JDSA 3JVSA 3MIYA 1BI7A 3KVWA 4FTAA 1YRPA 3ZLWA 4DTKA 3EQCA 2R2PA 1LEWA 3RZFA 5CT7A 3SG8A 3ROYA 3IECA 4F7JA 1YHWA 2AC3A 4RWLA 3QTZA 4YTFA 1OL6A 3Q4UA 2GQRA 2E9NA 3FDNA 2R3JA 3T9TA 4JDJA 3AD4A 3P08A 3KB7A 1SVHA 4R8QA 2VV9A 5A46A 4GYIA 4ANBA 5CQWA 3QALE 3C7QA 4FIHA 2FB8A 2HK5A 4QPAA 3RAWA 1ZYJA 3PVWA 4YC6A 3H3CA 5HBJA 3QRTA 1FVVA 1E1XA 3I1AA 5JEBA 5L8JA 5GHVA 3NWWA 3N4UA 5IQAA 4MK0A 4GFGA 2Y4IC 4DFYA 4PNKA 4F9YA 4XRJA 4ALWA 4O4DA 3UIXA 3U6HA 1WBPA 2WMRA 5L2SA 3DAJA 4QQTA 4HVDA 4RA4A 4K8AA 3DJ6A 3VHEA 4I6BA 4FSTA 1IAJA 4B4LA 3RCJA 1VYWA 4KS7A 3BHYA 4E26A 3LFAA 3TKIA 4BZDA 3WE8A 2VX0A 4TYIA 3PPKA 4TKSA 3S2PA 4DFNA 2G9XA 5HG9A 3VF8A 4CMOA 2B55A 1VR2A 5CAQA 2XA4A 4N6ZA 3ZO1A 4XOYA 4AGWA 3LHJA 1GZNA 2XNEA 3AGMA 4NWMA 3GU5A 3PSBA 5CSWA 4ACHA 3PPJA 2CGVA 1BL7A 1OKZA 5CI7A 5KBRA 4FTOA 2PVRA 4IFCA 3ZZEA 5DEYA 4C7TA 4GUBA 2C6OA 3MVJA 4WG4A 5LCKA 5EHYA 4CXAA 3R7IA 4C58A 1FVRA 2H8HA 4ITHA 2XCHA 4ZSEA 2ZYBA 3HAMA 1I09A 3FHRA 3VC4A 4X2JA 2IEWA 3GNIB 5IH6A 5E9EA 4PMTA 3UZRA 1S9JA 4DF3A 5IA0A 3A8XA 4YC3A 3SQQA 3OG7A 3ULZA 1YDSE 3A7JA 5C1QB 4FV9A 3K3IA 5ANKA 3BBTB 4AGUA 4AW5A 4K1BA 1QMZA 2YCFA 2P55A 3NNVA 2QD9A 3QTXA 1WVWA 1PW2A 3V5PA 4GYGA 4ZOGA 4NW6A 5HX8A 3VS2A 4EOSA 3TT0A 4EK6A 3F3VA 5A9UA 3TTIA 4O0UA 3OOGA 2JKKA 1JOWB 3HX4A 1Q3WA 3QQUA 3W2OA 5CF5A 3EQRA 3R7GA 4XRLA 3SDJA 5IPJA 4DHFA 4FEUA 1TVOA 2ITZA 4NJDA 4XBRA 4EL9A 4GG7A 3OEFX 3C0IA 2WAJA 1M2PA 4G34A 4I4FA 4CKIA 3ENMA 3MFRA 3O23A 3O0GA 3PY0A 4BWXA 5K5XA 4FGRA 1KE7A 4BCFA 5EKOA 1XKKA 2QVSE 3UODA 3S00A 4G1WA 4BBMA 2ZMDA 3LQ8A 3Q52A 3KKVA 5K3YA 1XBCA 3TWJA 3WZEA 5I3RA 5IMXA 5KMIA 2Y9QA 3ITZA 3QU0A 5G6VA 1YOLA 4WSYA 5A4QA 4F78A 5IQCA 3QZHA 1S9IA 5M51A 3RJCA 3JY9A 3BKBA 4R3PA 4H58A 2YCSA 4YTIA 3VNTA 1HOWA 1URWA 2R5TA 3QLFA 3RMFA 4E5WA 4IJ9A 4UB7A 5HTIA 1ZOHA 3AQVA 2WELA 5AP5A 4IB0A 3PXKA 1OPJA 2UZEA 4P5QA 3T3VA 4AXFA 4DBXA 3A99A 4YJPA 3ZOSA 2IZUA 2R7IA 3PE1A 1JVPP 5AR5A 4YJQA 5I9VA 3PJ2A 3LM0A 3QF9A 4XG3A 3D5VA 1ZAOA 3VW6A 4TNBA 2WMSA 4LYNA 3ZLYA 1LEZA 4AWIA 1P4OA 2BAKA 4YJVA 1ZLTA 1YHSA 3GT8A 3NDMA 1LP4A 3EYGA 3MWUA 4D0WA 5I9WA 2W1FA 4I0TA 2OICA 2C5VA 4QMWA 4BGGA 4MAOA 4RIOA 3RBWA 4NK9A 3DNEA 5HEZA 4FZDB 4CT1A 1WBNA 2I40A 3Q2JA 4L00A 5EW8A 5EYKA 2QOHA 4QTEA 5BVNA 3OCTA 1DI8A 3D14A 3FBVA 3VJOA 4OUCA 3DFCB 5IA4A 2XNPA 4XCUA 1W2FA 4NL0A 5FG8A 1M17A 3VN9A 4BFMA 1H0WA 3P7BA 1U4DA 3JVRA 3QA0A 4KIQA 2ZV2A 2ZV8A 4TZRA 4NYEA 3OWLA 2WOTA 4Y5HA 3UDBA 4JG6A 3VO3A 4LGDA 2A19B 2CCHA 2WZJA 1BL6A 2QC6A 4YZDA 2CLQA 3F5XA 4OT5A 5HTBA 1JAMA 2P2HA 5CNNA 3FKOA 3I79A 5J87A 2XVDA 4JOAA 3MH1A 1ST0A 1P4FA 3MFSA 3QXPA 3FY2A 4BRXA 5EM5A 5K9IA 1TQIA 2WMBA 1KV1A 2BCJA 3BHTA 1IG1A 4K0YA 2BTSA 4D4SA 4FTTA 3EFLA 4L3JA 4OW8A 4FMQA 1REKA 3RHKA 2V22A 2ZDTA 3G15A 4DFUA 3C0HA 3BQCA 4E20A 4XP0A 3FLSA 1FPUA 5JRSA 3E3BX 3GEQA 2VX1A 4GS6A 3AKLA 4XOZA 3QCSA 5BYYA 2XNBA 4NFNA 2G2HA 4ZK5A 5AIRA 3CKXA 3T9IA 4PMMA 3FWQA 3R73A 4FIJA 3PWYA 4FT9A 2J50A 4QP2A 4YJUA 5AAGA 2BRHA 3E8NA 3R04A 2UZDA 1UNLA 5E91A 4DINA 4NU1A 3LLAA 3N4TA 4LRJA 4QMXA 4X6RA 4GMYA 3TNHA 5JFWA 4FICA 1K2PA 1J91A 3FMMA 1OL7A 3NPCA 4P7EA 4E4LA 4HW7A 3QKMA 5FGKA 5CALA 5HG5A 4KBAA 3FSKA 3PVBA 2VWUA 3HMIA 4YPSA 3I6UA 2B4SB 3ORPA 4RZWA 4UEUA 3RPYA 4BKZA 4DGLC 3OWKA 3QQHA 5GINE 3HNGA 4IADA 4K18A 2R3HA 1H8FA 2WGJA 3EKNA 1UVRA 3NYOA 2O3PA 2A27A 4FV5A 4B7TA 2BKKA 3OWPA 3U87A 2PU8A 2YIRA 3DZOA 3N9XA 4PL4A 2RFSA 3A7FA 5EK7A 3KXNA 4IB5A 2J4ZA 4BTJA 2GCDA 4YTCA 3QTQA 1KE8A 3ATSA 3LE6A 3UIBA 4O0SA 4IAAA 3GC7A 2QO2A 4UV0A 4ZTSA 3PG3A 4EOKA 4CLJA 3RGFA 5KMKA 3R83A 2ZMCA 3FHIA 3B8RA 4W8DA 5E8XA 4DA5A 2XANA 3BYSA 4NCTC 4RX7A 4HPUE 1FGIA 5CVGA 4ZLOA 1UKIA 3TKHA 5LMKC 2OLCA 4MUQA 4APPA 3LOKA 3E62A 4DN5A 5L8LA 3DY7A 5AWMA 3V5WA 4RVKA 1U59A 4LFIA 1WCCA 2VX3A 3QQFA 4KIKB 2YCQA 4R1YA 2G2IA 3H9FA 4RIWB 4U9AA 2IF8A 4FKGA 1H24A 2PMNX 3R00A 5EYMA 3U9NA 4FT7A 1LR4A 2BZHB 1YDRE 4IB3A 1ZRZA 3QTIA 4GG5A 4IEBA 5FM2A 4AAAA 5E4HA 2JDVA 2B9HA 1G8KA 3O2MA 2C5OA 2FVDA 1P14A 2B1PA 2FSTX 4LMUA 4QNYA 4WNPA 1PXJA 5AA9A 2OIDA 4QP1A 2QU5A 4FKIA 2YZLA 2CKQA 4RIWA 3II5A 4WBOA 3HV7A 3PFYA 2VTOA 4S2ZA 5ETAA 3OW3A 3PUFC 3Q53A 1H00A 2YERA 2ZB1A 3CGOA 2J2IB 3WIKA 4PPBA 4D58A 3TM0A 3V6RA 3LXPA 3E3PA 3GFEA 4FT5A 4IXPA 4FZAB 1KE9A 1ZOEA 3DOGA 4RX8A 2OU7A 3JR1A 2VRXA 3BHUA 5FP5A 4AU8A 4N70A