2O8YA

Apo irak4 kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
278
Chain Sequence
FHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLLKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASVMSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Crystal structures of the apo and inhibited IRAK4 kinase domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 278
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2o8yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2o8yA01
2YEXA 4E6AA 3WF8A 3OW3A 1URCA 4R3CA 4YLLA 5A6NA 4APPA 2X81A 1FGIA 2VGPA 3QU0A 2G15A 4WUNA 3EN5A 1EH4A 2WTJA 2UZEA 3LIJA 4OT6A 2W9ZB 4OR5A 5FLFA 5HVJA 1M2PA 5BVEA 3IDPA 3TKIA 4DH8A 2BIKB 2PMNX 3FMKA 4JQ7A 3PG3A 4QMVA 5CNNA 3S3IA 2A2AA 4GJ2A 2KULA 5HO8A 3W2PA 3COHA 4TWOA 4BF2A 4BHZA 3P5KA 3KKVA 5KHWA 2J5FA 3VVHA 4BCOA 1ZMWA 2C1AA 3ROCA 4ZMEA 4M69A 5EOBA 2QO2A 5IEVA 3QCQA 1XH4A 1A06A 2OFVA 2QOOA 4Q5EA 3IW5A 3SLSA 3UG1A 5M44A 1MP8A 5AADA 5GJGA 4NKAA 5AFVA 5M4CA 4E5AX 3E63A 2PSQA 4F1MA 4GKHA 4YNEA 2QODA 3I60A 3ERKA 3FKOA 4IAFA 5AV1A 2UVXA 2FO0A 2W1CA 1U4DA 3PJCA 2JAMA 4CQEA 2C3JA 4FTQA 2X2KA 3PTGA 4M68A 1OL7A 2QKRA 4IQ6A 4WBOA 3PVGA 4IE9A 5AM7A 4YJNA 2A27A 3R21A 1V0BA 5CQWA 3FMNA 3TTJA 4FKUA 2ZM1A 5CSXA 4FEWA 4GU9A 4HYUA 2H34A 4NU1A 5J9ZA 4BTFA 1LEWA 3OFMA 2WB8A 4QMPA 1WBTA 4X2FA 4H3PA 3MA6A 4BDKA 3CE3A 4NM3A 4J1RA 4CCUA 3V5WA 4KRCA 4XG6A 4TKSA 4GSBA 2VNYA 3DJ5A 1Q62A 1XO2B 4JBPA 3UZTA 2Y4IB 5L8KA 3BZ3A 3KC3A 1ZMUA 1ZXEA 3CLYA 3OROA 4BCQA 4V04A 2CNQA 5HVKA 4XG2A 3TZ9A 3VHEA 5BPYA 3LQ5A 2RFDA 3BQCA 2XNOA 3ORLA 1T46A 4FV5A 1DM2A 4AZSA 4X6RA 3SRVB 3BPRA 2Z2WA 2WHBA 4F1TA 5C03A 3RPYA 4M15A 3ZM9A 3WZUA 2I40A 2EVAA 3F69A 5FWKK 5H8EA 3C0HA 3OT8A 1Q8TA 3BRBA 1STCE 3FZ1A 4IEBA 5IUIA 4F08A 4RA4A 5IMXA 4M14A 4NWMA 3S00A 4X2GA 3F61A 2QG7A 3U6JA 5HE0A 3Q9WA 5TO8A 4HW7A 4FKTA 1Q41A 4NKSA 4AZTA 3ZZEA 4C38A 4QTEA 5DFPA 4S30A 3UGCA 3ZOSA 3P78A 5BVKA 5GIOE 3F3VA 3MPTA 2XNGA 1J3HA 3R7GA 3V6SA 3NUAA 3IECA 4QMNA 3BKBA 3NNXA 4D2WA 3DBFA 5HIBA 4CFUA 5GZ8A 4I22A 2WMTA 4BBEA 4L3PA 3UJGA 2ESMA 5J7HA 4FGRA 3IW7A 2V7AA 4C4GA 4O7YA 2IZRA 1FMKA 4DTBA 2B0QA 3SKCA 3HAMA 4AXAA 4RIWA 4BDJA 4QTBA 5DOSA 1KWPA 5FEDA 4AQCA 1BYGA 4OBQA 3AD6A 5LARA 4RJ8A 3CEKA 3AD5A 4JQ8A 4TYIA 2ITQA 4UXQA 2OKRA 5J87A 3ULIA 2UUEA 3ZC5A 3ZO3A 1ZRZA 2WU6A 2ZVAA 5HO6A 1G8AA 2ZJWA 4CMTA 2BZJA 2QONA 3FI2A 4B6LA 4DITA 4RIWB 1ZY5A 2IVUA 3OY1A 5KO1A 1OB3A 3GXLA 3BLRA 3I79A 5HCXA 3DDPA 3AG9A 2YISA 4E73A 5DMZA 2RSVA 3QCYA 3GNIB 4G3GA 5KMNA 4ACHA 3F5XA 1ZYLA 2GNIA 5HICA 4YSJA 3ZUUA 4EBVA 3UIBA 1XJDA 4JDKA 4FTMA 5JFSA 2R3RA 4IM0A 4QP6A 3TV6A 3FUPA 3H0YA 2AC3A 3I1AA 4O7WA 3DJ7A 1CDKA 5C9CA 3NDMA 2YZAA 4GW8A 2C5OA 4U8ZA 5IEXA 3O17A 5M08A 3ALOA 4AAAA 3JPVA 3WZDA 4FG7A 3LOKA 3VUHA 1I09A 4LGHA 4IANA 4XV3A 5ETIA 4U5JA 4RQVA 3PXZA 3PWDA 4G31A 4U6RA 1OECA 4I20A 3H9OA 4MWIA 4NH1A 1Q8ZA 3UQGA 3C7QA 1BI7A 3D15A 2HWOA 4Y83A 2UW0A 4WSYA 5L2TA 4DBNA 5IQGA 3Q60A 5HZNA 3LCOA 4NL0A 3NAYA 2OU7A 2PE2A 2UVYA 4D28A 2BZHB 4FZ6A 3CIKA 4BCGA 4F0IA 4X3JA 3U51A 3WYYA 3Q9XA 4BTKA 2ZV7A 4DEAA 4I6FA 5C8KA 3SOAA 4O0TA 2HAKA 4U44A 2NNWB 3R6XA 2F4JA 4PL5A 3Q4ZA 2QHNA 3M1SA 3A4OX 3EWHA 4EH6A 2HW7A 2YABA 4QMTA 4HPUE 5JRSA 1YHWA 3L8XA 3FZSA 5B7VA 3LFBA 2R3QA 5CY3A 4I92A 3ZXZA 2P2HA 4A7CA 2JKOA 3PPKA 3VUGA 3LM5A 5GHVA 4G3EA 3KFAA 4PTGA 4IWPA 2GSFA 4C4JA 1KOAA 5LWMA 2J4ZA 2ONLC 4ZLZA 4EOQA 2YACA 3QZHA 2OF4A 2UZUE 3N4VA 1HCKA 3LCKA 3RNYA 3EQFA 2WEIA 4EH7A 4ERWA 4ANLA 1YXUA 4DCAA 3I6UA 5IQCA 4BB4A 5KMOA 2W0JA 4XS2A 3TJCA 3TNHA 1SYKA 4HVGA 5DIAA 3EYHA 5IA2A 3GCPA 3CQUA 1PXIA 4IWQA 2JDSA 3ELJA 3R9HA 2FB8A 3DJ6A 2RIOA 3AMYA 4YSMA 4CCBA 3NAXA 3QTIA 3R2BA 4I21A 5TE0A 3HECA 5CU3A 4O0UA 3R83A 4FTIA 2G2FA 2PULA 5FEQA 2ITXA 3H3CA 3MVHA 3QCXA 4I24A 1GIJA 5DR9A 3DBEA 1YRPA 2XIZA 4F7NA 4DLIA 3FXXA 2GDOA 2E9PA 3HV5A 5JRQA 1OKZA 1OBDA 5CASA 4FEUA 4RVKA 3TIYA 4RIXA 2DUVA 4KSQA 3IS5A 2XNMA 4YUQA 1U54A 4FV4A 4NUSA 4CG8A 1XH7A 3OCSA 3FV8A 3QX4A 1ZYCA 2IW6A 3GC0A 5CQUA 3OMVA 3QZFA 4C36A 4ENYA 4BN1A 5LXMA 2O64A 2XK6A 4FIIA 4R77A 3HUBA 4RVTA 5EQPA 3FMHA 3AC5A 3UBDA 4A4XA 3KXZA 3ZSHA 3NUSA 3KRRA 5A3XA 5JEBA 1WBVA 4JAIA 4RIXB 5CT7A 5FGKA 3T3VA 1U54B 5K4JA 4D4SA 4FK6A 5BQ0A 4FKGA 2GS2A 3EFLA 4IC8A 3A8XA 4RWLA 4ZTLA 4DAWA 4EOOA 5JFWA 4ORKA 5IQEA 3KMWA 4UV0A 2UZVA 3ZXTA 4PMMA 1OIYA 4O1OA 5EYCA 2SRCA 4AE9A 3COIA 3OXIA 5L8LA 4FE2A 1S9IA 4O7ZA 5AUXA 2X7GA 4E8AA 2H8HA 3MJ2A 4USEA 1LR4A 2VO3A 2CCIA 3OW4A 3ZBFA 3V5TA 2H6DA 3I0QA 3ULZA 4D2VA 4I0SA 3C5UA 4U42A 5HBJA 3LFQA 4TYGA 5KZ0A 1Q5KA 3IDCA 2NP8A 4LMUA 3TI1A 3ZH8A 3OZ6A 4H3BA 4ZZMA 2WQOA 4BI1A 3QTZA 5JKGA 4QP8A 4OBPA 4YJTA 2JLDA 4TW9A 1GOLA 2P3GX 3LQ8A 3QTSA 4FX3A 4KNBA 4YLJA 5E8TA 5E8VA 4C3RA 3A8WA 3RJCA 4YJPA 4ZOGA 4WD5A 1JVPP 4H05A 2VV9A 4OBOA 4OGRA 4R1VA 4FV8A 3N4UA 3PRFA 3KRJA 4FKWA 3TDWA 2G2IA 2QLQA 2OI4X 3HX4A 5HESA 2HOGA 4YJQA 4XG7A 2V5QA 4MBJA 3ZC6A 3IDBA 2R3LA 4MK0A 3KEXA 4DH1A 3OP5A 2OFUA 2WTKC 2XNEA 4UXLA 2CKEA 4CLIA 4CZTA 5EM5A 2GNLA 3TNQB 5CENA 2FSMX 3QRJA 4FIEA 5LJJA 3D2KA 4QQCA 5M09A 4B0GA 1UA2A 3HGKA 3K3IA 3UOKA 4HNIA 3L9MA 3SX9A 2R2PA 1RW8A 5LCJA 4AA0A 1Q3DA 3FQSA 3OXTA 3CSVA 3NW5A 1R0PA 4DHFA 3GBZA 3KCKA 1UVRA 3FMDA 1UU7A 4BWKA 4JDIA 2AUHA 4BDEA 3DKCA 3EL7A 4FV2A 4I6BA 4CFNA 4GMYA 1GNGA 2PZRA 2YDIA 3B2TA 3QHRA 4FTNA 5AP7A 4FKSA 5F20A 5FG8A 5FXQA 4CGAA 2X2LA 4U80A 3EQBA 1WCCA 4K33A 5AEPA 5CF6A 4GYIA 4O0RA 4FVRA 3SHEA 5IA3A 2ONLA 1AD5A 3ZM4A 4G2FA 5FXSA 3KB7A 3LKMA 4RFMA 4Y85A 5ETCA 3BYUA 3GB2A 3HDMA 5DT0A 3RPSA 2GNHA 5M06A 4DINA 1WBSA 2G01A 3R1YA 2YAKA 4L9IA 3BEAA 2HY0A 2XYUA 4RA5A 3BE2A 1K9AA 1H08A 3CTJA 2I0EA 2QOKA 3HVCA 3Q52A 4EC9A 4EHZA 3RI1A 2YJSA 5CNOA 4QP9A 2W9FB 4Y72A 3D5UA 3FWQA 4ANMA 4MD7E 4FOCA 4EZ5A 2W06A 1GZKA 2BR1A 3TKHA 4PPBA 4JR7A 4BGGA 1WBPA 2ACXA 2WAJA 1PXJA 2RFSA 2UW6A 4FV9A 5ANGA 5IA5A 1OGUA 2RF9A 3CD8A 2GQSA 4D1SA 1YOJA 2ZAZA 2JFMA 5AP6A 5A4EA 2PZIA 4AOTA 5IQIA 2QOLA 2B54A 3P7BA 3Q4UA 4ZTHA 2WMVA 4P5ZA 1O6LA 3U9NA 2OJGA 2Y6MA 3DB6A 3EQHA 2Y9QA 3CKWA 4AA4A 2A4LA 3HV6A 3BHVA 3MFSA 2BRGA 3IQ7A 4BBFA 4TL0A 3EFJA 4D0WA 4QYYA 4F0FA 4IVDA 4WG3A 3I5ZA 4RX9A 4F9BA 4HVSA 2ZB0A 5ANDA 5C8MA 3TJDA 3P08A 4WOVA 4ANBA 3SA0A 3QBNA 4K6ZA 4RGJA 1ZMVA 2VO7A 5CSHA 4PTCA 4AW0A 1O6KA 5ETFA 2PMOX 4RC2A 2R3FA 1OIQA 3DKFA 2VWZA 1PYXA 3H0ZA 3ENHA 3DPKA 3CPBA 4D2RA 2XRUA 3O96A 2P33A 3WBLA 3PPJA 5EW3A 4CEGA 1KUTA 2R3IA 4HYHA 1OZ1A 4GEOA 4XNEA 4P7EA 4PP7A 3D5XA 2ERZE 2VWYA 4FT3A 2IVVA 4CMOA 1M7QA 4KAOA 1TKIA 3QTQA 1BKXA 2YM6A 3SDJA 4DGGA 3OWKA 2WZJA 4AGDA 5BVDA 3VBTA 1LEZA 1W83A 2R64A 2YIWA 4UZHA 4BR3A 5IQBA 1PF8A 3EH9A 4FV7A 2G2HA 3TKUA 5AUZA 3LLTA 4FTTA 3F3UA 4OTQA 5C1QB 4LYNA 4WNKA 3U4UA 2YN8A 2J0IA 4GU6A 4QP3A 4E26A 2BZIB 4FV6A 1XH6A 4ZMFA 3QRKA 4E6DA 4B8MA 5D12A 3GVUA 3ZUVA 4RVLA 5IH4A 4KD1A 3PY0A 3VF9A 3DGKA 1Y57A 4L52A 2PPQA 1V0OA 2UZNA 2YZLA 1YQJA 2YIXA 4XBRA 5M56A 3ET7A 2CHLA 5D1JA 1OKVA 4O0WA 4PDPA 1E1XA 3A99A 3IKAA 2EU9A 3NUYA 4DTAA 4KBKA 3QKMA 3CC6A 4I1ZA 4RSSA 4MH7A 3ORKA 5M57A 1IAHA 5CZHA 2QOFA 4E5WA 1JKSA 1DAWA 1E9HA 2GS6A 5EDQA 2CLQA 3RKBA 1K2PA 1H1WA 4QT1A 4C57A 2EXCX 4NW5A 3AD4A 2W1DA 1PKGA 5K0KA 3ORXA 4RWIA 4O0VA 1KE6A 3AGMA 4GUBA 3FL4A 2F7ZE 2QKWB 4L8MA 4PMTA 4YC6A 4MD8E 1DS5A 4O27B 4PF4A 1FOTA 4JVGA 5GNKA 3W1FA 1ZLTA 3ZO2A 5I9XA 4EOLA 3QUDA 2X7FA 3JXWA 4UWCA 4CKJA 5B2MA 4NSTA 4AOIA 2WTKB 5DPVA 5CU0A 5CVHA 1MQ4A 3QD4A 4M67A 3QYWA 2NO3A 4NM5A 5HG5A 4IZYA 3NCZA 4FSYA 4YC8A 3SQQA 3MFRA 4O38A 4YPDA 2HCKA 3R9DA 4D2TA 1LUFA 4JOAA 5ANEA 1W84A 3MH0A 3KK9A 3PVUA 1CKIA 1OL2A 4ID7A 4AZWA 3RBWA 4MF0A 4NEUA 3G9LX 4DN5A 5M53A 2YA9A 2W1FA 3ORIA 3P7AA 3JR1A 3BV2A 1R3CA 2QNJA 2WMAA 1QMZA 4ALUA 2C0OA 3HMNA 4WNPA 3UIMA 2JDRA 1TQMA 3L9PA 2PTKA 3R9NA 5AM6A 5GJDA 5E8XA 5FEEA 4QPAA 3VQUA 3QX2A 2XVDA 3OOMA 2UW9A 5G6VA 2WMSA 1ZOHA 2Z8CA 2R7BA 4QMMA 5DR6A 5DH3A 1OKYA 5CSWA 5DRDA 2YCSA 2JDTA 4RX8A 4GK4A 2V22A 2QU6A 3G0EA 3G51A 3RM6A 2P55A 2VWIA 3BI6A 2XEZA 4X3FC 4BDGA 5I9VA 2PY3A 3KXGA 5CF5A 1PMNA 5AAGA 4F6UA 4IAZA 2IVSA 2OJ9A 2WOTA 3ZRLA 1YXVA 2J51A 4ZEGA 1ZARA 4MNEA 3NNWA 4U45A 5AR7A 4EC8A 2VUWA 4QOXA 4W4WA 3OXZA 4FZAB 1Q24A 4L7SA 1XQZA 3R8MA 5F1ZA 3RALA 3EFWA 4ITIA 3HLLA 4M13A 3WIKA 4DLJA 2BDJA 2FSOX 2PVMA 4E4NA 4EL9A 4G6OA 2P0CA 5CS6A 3TZ7A 3UQFA 4CXAA 3A62A 3DU8A 3A7JA 4RG0A 4ZJIA 4ZSAA 2CNUA 4TT7A 4HYSA 4MNEB 2W96B 2F57A 4YBJA 4L45A 4G3CA 4P5QA 4A9YA 4XG8A 4S31A 4GIIA 4MXYA 4MBLA 4WNMA 4FKOA 1JPAA 4ITJA 4L53A 2FSLX 3GCQA 3O2MA 4J97A 4QMXA 5ICPA 4PY1A 3MW1A 1OIRA 3QWJA 3RMFA 1XHAA 2O8YA 3BHYA 1UNHA 2GHGA 1YHVA 5DHJA 3ZFYA 3RCDA 3ANRA 4EWHA 5JZJA 3TEIA 2PUNA 3OCGA 2CN5A 3TL8A 5CEMA 2C3LA 3SG8A 5J79A 1BL7A 2QOCA 4FC0A 4AZEA 4GG7A 1OL1A 4JBOA 5FQDC 2Q0BA 1H07A 4LG4A 3VUDA 1OPJA 4L3LA 3F2RA 2J2IB 1YKRA 3PLSA 3BHUA 3EFKA 3RGFA 3DAKA 2OBJA 2RFEA 3DA6A 2QG5A 3R1SA 5FP6A 5HIEA 1OI9A 3MVJA 4AGWA 4BI2A 3E64A 5A4QA 3S1HA 2GNFA 5I3OA 4YZCA 1ZZLA 5EYDA 4BGHA 4YZ9A 5KNJA 2J5EA 3FC2A 4J7BA 3KF4A 4O7LA 4GKIA 2J7TA 4G1WA 4HOKA 5CEQA 3QQUA 4QMZA 4C4IA 5IA1A 3DLZA 3GI3A 3R01A 4GVJA 2XA4A 2NPQA 4UZDA 4NK9A 1SVEA 3R28A 1M14A 4RWJA 3QQHA 3TCPA 4FA2A 3QCSA 5A14A 4FSZA 3GCUA 4FT5A 4PDSA 4EJ7A 4GK3A 2G9XA 4QPSA 3ZRMA 3LHJA 3CXWA 2XIRA 1OMWA 5C27A 3BE9A 3C4ZA 2WKMA 3VS1A 3JYAA 1PXNA 4JDJA 5FM3A 3RCJA 3PPZA 3VO3A 2X9EA 3FYKX 3CR0A 4DG3E 5JGAA 2R3KA 5ANIA 3VJOA 3A7IA 4FSRA 3ZSIA 2XYNA 2CCHA 4IWDA 3UZPA 3GFWA 3QKKA 4C02A 4NT4A 5BNJA 4HZSA 3VC4A 4YLKA 4IH8A 4YHJA 4FNXA 5DI1A 3ACJA 4YTHA 4L6QA 2CGXA 3LQ3A 3R7UA 5HE1A 4M97A 3VBWA 3LVPA 3VS2A 5BVNA 4G9RA 4IFGA 3QA8A 5C01A 2PMIA 4YJRA 3HKOA 2VWWA 4FZDB 4EORA 3FI8A 3E8DA 5HNGA 5AUTA 4C37A 4G17A 4EOPA 5CF8A 2C68A 3MPMA 2JKKA 4FTUA 3WF5A 4BDCA 1M2RA 2XBAA 3K54A 2Z60A 1U46A 5AUWA 5GZAA 4Q9ZA 1JNKA 3PXRA 5CSVA 1H24A 1UNGA 4U3YA 3MVLA 2X7OA 4BCMA 2IW8A 2RFNA 2CKQA 5LVNA 3ZS5A 5L2SA 3D83A 2XKDA 5L6PA 3F5GA 1F0QA 4BBMA 2ITUA 4MQ2A 2UV2A 2XK9A 4X3FA 1NVRA 2GFSA 5LWNA 5CAUA 2AC5A 3RP9A 4FKQA 2JDVA 4QO9A 4HGLA 5HLNA 4D9UA 4XHKB 1PMVA 3WE8A 4R8QA 4ARKA 3QUPA 2IZUA 2J0JA 4I41A 4H1JA 4YZDA 4ZS0A 4GFMA 2QR7A 2QURA 4TZRA 3UNJA 4DFBA 4RJ3A 3DXNA 3BWFA 4M69B 3WF7A 3FQHA 3PP0A 4EH4A 4IDVA 2QC6A 3CQWA 3D4QA 4X3FB 3FXZA 4EONA 1PXMA 2C0IA 3SXRA 4F64A 5EOLA 4XEYA 3FL5A 3QAME 3PRIA 3GEQA 3R1QA 3R73A 5CTPA 4DGMA 3ZLSA 2C1BA 2YERA 3IPHA 3COKA 4OUCA 4F4PA 1XKKA 3MVMA 2B9JA 4HZRA 4RC4A 2CKOA 4O6EA 3NIEA 4WRSA 3V01A 4PMPA 4GT4A 1TQIA 1BMKA 2PVHA 3OTUA 1YWVA 4UB7A 3TUBA 5EQEA 3TUDA 1KV1A 2UZDA 4OTRA 5DN3A 2BROA 2BDFA 2YLFA 4XG9A 1XR1A 1PW2A 3KXHA 4II5A 4DCEA 4A06A 2Y7JA 2XIKA 4WKQA 2YCQA 2W4JA 3OCBA 4DFUA 2PZYA 1BI8A 4NZWB 3RNIA 2QO7A 2R0IA 5HI2A 2UZLA 1YDTE 3MIAA 5CWZA 4D2SA 2BPMA 5DEYA 2WOUA 2B52A 3PJ8A 4AN9A 5KX8A 5EM6A 4BCPA 2W1EA 3UO6A 5CYIA 4U41A 2PVFA 1H00A 3DB8A 3JVSA 3MY5A 4G16A 3KY2A 5TF9A 3U9CA 4LM5A 5LOHA 1PXPA 1B6CB 3JY9A 3ORZA 4TYJA 5EKNA 1OPLA 3K3JA 1AQ1A 4CRLA 4O86A 2WO6A 4TNDA 5J1WA 3CTQA 4C2WA 5AAFA 4TYHA 1H1RA 3OEFX 2WGJA 3F5PA 5L8JA 4E93A 2JBPA 4ZY4A 5ANKA 2GS7A 4FSNA 4EOIA 1OKWA 4GT5A 3LXLA 5CF4A 3HMPA 3SXSA 2E9UA 3OWPA 3HA6A 2Q83A 4FBXA 3QQGA 4K8AA 1H1SA 5CAQA 5J1VA 3KVXA 4ITHA 5CX9A 3O51A 4TYHB 3RHXA 3POZA 3ZO1A 2OF2A 4YNOA 5HO7A 3UC3A 3NEWA 4AACA 2ITYA 2GU8A 4MHAA 1YWRA 5EW8A 2QHMA 2CNVA 3POOA 5LVPA 1H8FA 3ATTA 4LGGA 4C59A 2XIYA 3Q04A 4QRCA 1Y8YA 5D41A 4AFEA 4OAUC 3D5VA 4E7WA 4NFNA 5F4NA 3BGPA 2IJMA 2XJ0A 4C3PA 4EHEA 2CMWA 3NW7A 5H9BA 4C8BA 3BU5A 3QRTA 3DV3A 3MFUA 2PZ5A 2YLEA 3F9NA 2JD5A 4MXXA 3CY2A 4RIYA 5HD7A 4H1MA 4BKYA 1NY3A 5C4KA 5TKDA 3ZLYA 4BCFA 4QPMA 4EK5A 1WVWA 2ITOA 3IGGA 1KE9A 1Z57A 4FEXA 4MBIA 5JQ8A 2VTQA 3DBQA 3DK3A 2GNGA 2Y0AA 4M8TA 4MAOA 3THBA 3V8WA 4DC2A 5KCVA 2O3PA 3FQEA 3PXQA 4I6QA 5IH5A 2HZ0A 2ZMDA 3LJ2A 3A60A 5IUHA 2VTRA 4S33A 3WYXA 5IUGA 1WZYA 5AV2A 2I0VA 4FNYA 4CFMA 4RIYB 3U6HA 3GQLA 1FMOE 3DLSA 1KSWA 4LFIA 5EDRA 2PVRA 5HORA 3VUTA 3P1AA 4AF3A 3GC7A 3ORNA 2PE0A 4HCUA 4KINA 3CJGA 4GT3A 4J95A 4KKGA 5IH6A 1UWHA 2XRWA 4B99A 4X21A 3AT3A 1MQBA 4UWYA 3UPXA 1YHSA 3N51A 5HTCA 2HZIA 5DGZA 4DGLC 1JAMA 3QRUA 4F65A 4YURA 5AA9A 2VGOA 5EQYA 2HK5A 5FRIA 4CQGA 1R0EA 3MWUA 3CQEA 1FQ1B 3LMGA 2CJMA 1U5RA 5K9IA 3A7FA 5DWRA 3M11A 3UVRA 4CFVA 4QP2A 3E8EA 4BI0A 3DKOA 4W8EA 3F2AA 4RLLA 4O7TA 3I81A 4ZJVA 3PFQA 1QPJA 3HMIA 3LMIA 2XK3A 3R8UA 3SW7A 3HMMA 5EI6A 1ZYSA 3GOPA 1GIHA 4XG3A 4UMPA 3PDTA 3G6GA 2JITA 4FF8A 5GIPE 2PZPA 4FSTA 5E1EA 4FUYA 4ZK5A 3EIDA 2B55A 2RG6A 5BVOA 3UO5A 2QU5A 2OO8X 1O9UA 3I7BA 1K3AA 4JQEA 3U87A 4U79A 4AZFA 3EQGA 4IMYA 1IR3A 4PMSA 3SAYA 3FI3A 4XV1A 2VTLA 1QPDA 3TT0A 3N4TA 4PNIA 1UU9A 4FNZA 1Q4LA 4BGQA 3DY7A 3MV5A 5E4HA 2HXQA 3LFSA 3MSSA 4LL0A 4W4YA 5AR5A 2F2CB 2C6KA 2VTIA 1VYWA 3IGOA 3NYXA 4KRDA 3MH2A 4BZOA 4EK6A 4O83A 1GZOA 2E9VA 3L1SA 4C35A 3FZRA 3V8SA 3IW8A 4C3FA 4HYIA 1U5QA 2XS0A 3HRBA 4XP2A 3B8QA 3LE6A 3ZYAA 4EYJA 5FXRA 3ATSA 4Y95A 3S95A 4FG8A 3GT8A 3RAWA 2R3PA 1VJYA 3EN6A 5H2UA 3NYNA 4HPTE 5IA4A 3RWQA 2G1TA 5EFQA 4B8LA 4FT0A 4M3QA 3QZGA 2OZOA 1M2QA 3LJ0A 4MXOA 3C4WA 3KMMA 1NT2A 2UW7A 4FSWA 4ASZA 4J8MA 4K2RA 4LRKA 4AT3A 3UP7A 4LRJA 2KTYA 3R63A 4IVAA 4IBMA 1IG1A 4QTDA 2Z7LA 1KE5A 4ANNA 4DBXA 3PWYA 4FK3A 2Y4PA 4X2NA 2WMRA 4D4VA 3BIZA 3PLAE 1PY5A 2ZM3A 3Q5ZA 4BICA 2WQEA 3MTLA 2R0UA 2C0TA 2W1GA 5J9YA 4TRLA 2BRNA 4UEUA 2JIUA 4USDA 5IA0A 4CKRA 2VWXA 4HNFA 2QI8A 4ZTSA 4FR4A 5E8YA 4ACGA 3MESA 3EB0A 3L8VA 3DXPA 1BL6A 3VUKA 3GOKA 4IVCA 4BYIA 4CG9A 1BLXA 3TN8A 2R3GA 2W5AA 5JMSA 5JFXA 1FPUA 4L01A 4RT7A 4X2KA 4U43A 5E92A 4EQMA 4F09A 3SG9A 2C6EA 3K5VA 4MD9E 2R3JA 2ZM4A 2R3MA 2VTSA 3HP2A 3VS3A 4KS7A 4AUAA 4FOBA 4MXCA 2QLUA 4FKLA 3R9OA 4IHPA 3HZTA 2C47A 4LQMA 4DH7A 3CY3A 2CGUA 3Q9ZA 4TXCA 2YDKA 3A4PA 5EI2A 3H9RA 4JIAA 1IA9A 1W7HA 2I0YA 3D9VA 1H28A 4BY9E 3CPCA 2IPXA 2XJ2A 4R1YA 4PP9A 1P14A 3VHKA 5E8ZA 3HEGA 5DRBA 5HEZA 3KULA 2YFXA 4BIBA 3VNTA 4EEVA 3Q9YA 2WXVA 2V62A 2XK4A 3W18A 4XLVA 3FDNA 4EOMA 4ZY5A 1GJOA 1APME 1SMHA 3BEGA 3ITZA 3O7LD 5LMAA 4A9RA 3UZRA 4UMRA 4V01A 4V0GA 3WZJA 4C62A 3NYOA 3KULB 4QMUA 4H36A 1O6YA 3IW6A 4JX3A 4YP8A 4D4YA 3FLNC 1YXTA 3G5DA 3HDNA 4JRVA 3UPZA 3PIZA 4FSQA 3RVGA 2B9IA 3KRLA 2X8DA 4FTCA 3UVPA 4IXPA 3WF6A 3Q96A 4YZBA 4IAYA 2BILB 3BU3A 3VS5A 4WA9A 4BHNA 4UX9A 2GMXA 4RBLA 5EYKA 3DT1A 4HJOA 4LMNA 3TACA 4MTAA 2H9VA 4QP1A 3MB6A 2X1NA 2DQ7X 4V0GB 4BCIA 2E9NA 1CM8A 4EJNA 5CANA 4M84A 2JIVA 2Z7RA 4EBWA 3NVMB 3SXFA 3PSCA 4BTMA 2O5KA 3KCFA 3FZTA 3SD0A 3ZFXA 4HCVA 3PZHA 2XBJA 3QYZA 4KABA 4M0YA 3W32A 3I0OA 5E8WA 4DH3A 4NIFA 3I4BA 5AUYA 2W99B 3AGLA 2YM3A 4GUEA 3SV0A 5CZIA 3F3TA 1J1BA 4QMYA 5J7BA 4DFZE 3QQLA 1SNXA 2XCKA 3HMOA 3G6HA 4BWPA 3WI6A 3D7TA 4G3DA 3R8VA 2GTMA 5A6OA 3WF9A 3BX5A 1DI9A 4O81A 5E9EA 4KS8A 4JDHA 2R7IA 4NJDA 3JVRA 4ZXTA 5K0XA 5LVOA 4IAKA 2FYSA 4PL3A 2FSTX 4C4EA 2JKQA 3O8TA 2EWAA 4NIFB 3GCSA 4OTWA 3LFCA 1XBBA 4CVAA 4D2PA 2X9FA 1Q99A 3N9XA 3QD2B 5AP3A 4K11A 3VS4A 5CI7A 4TN6A 5E90A 4C61A 2X8EA 2Y6OA 3HL7A 4BVUA 3PA4A 4OTGA 5AV0A 5AUVA 2RL5A 3G9NA 5K5XA 4C34A 1TVOA 4FV3A 4D58A 5LMBA 3OWLA 2NRUA 3DK7A 3EZRA 3QTUA 3QXPA 3VRZA 4ACMA 4HVDA 1G8SA 3R7VA 5IQDA 2HZ4A 4RIOA 4U9AA 4OAVB 1J7UA 4JLCA 5CU2A 2OGVA 2W1HA 1KOBA 4WNOA 1P2AA 3UE4A 5I9ZA 5IPJA 1Q8UA 4P90A 3VUIA 3TNIA 3KXMA 2E2BA 3Q2MA 4IJ9A 4OTIA 2JEDA 1OUYA 1YI3A 2XNBA 4UMQA 2IVTA 3U55A 4EK3A 3W55A 4ZP5A 3ZMMA 4WUAA 1PYEA 3GQIA 1ZZ2A 3DTCA 4TWNA 3RAHA 2PE1A 3W2QA 3EQDA 3B8RA 3KK8A 2O2UA 4F9CA 4ALWA 4YPSA 3E87A 3EKKA 3TNWA 3OOGA 2B9HA 3H4JA 4FVQA 4RLKA 4R3PA 3GP0A 2C3IB 4E6CA 4CFFA 4AGCA 4MCVA 2BUJA 1KE8A 4JXFA 1RE8A 5KMIA 3LXKA 4KUJA 3PUPA 3GFEA 3QGWA 4NTTA 4IAIA 4N6ZA 4PDOA 2EXMA 4LUDA 4IX5A 5BYYA 4D5HA 4AE6A 3TIZA 5AX9A 4FYNA 2W05A 4XBUA 3W2SA 1JSVA 3S0OA 4UYAA 5HBEA 2QQ7A 1PMEA 2J90A 3RZBA 3R7IA 3FY2A 4BDIA 4MVFA 3AC2A 2LAVA 1GIIA 2IO6A 3O8UA 1IASA 4N4SA 4Y73A 5TT7A 1UNLA 5L6WL 1ZOEA 5D11A 2QOBA 3VS7A 4BIEA 3BWJA 1OM1A 3IK3A 3VQHA 5HLWA 4RX5A 1YOLA 3ZEPA 4EH9A 4BKZA 3D0EA 5IF1A 4YZMA 4NYEA 3BYOA 4FYOA 1Y6AA 4I0RA 3UIXA 3IOKA 2IZTA 5HHWA 3TWJA 2V55A 2WFYA 4BIDA 5KMJA 2VTOA 4CD0A 2YIRA 2XK7A 2ZDUA 3W8LA 3NW6A 2LGCA 3LJ1A 5M07A 5AIKA 4S34A 2HWPA 5AP2A 4DG0E 4NW6A 2ZDTA 4BL1A 4G5JA 2P4IA 4GS6A 3NGAA 4F9WA 5CSPA 1NXKA 4A9SA 2OJFE 5BUJA 5CEIA 3CCNA 2A0CX 5E8UA 3V3VA 4O1PA 4X7QA 2GFCA 2OWBA 1VYZA 3NNVA 2EXEA 3PIXA 4J8NA 1XBCA 4KBCA 3TV7A 4ZAUA 4C7TA 5EHYA 4EOKA 5BX0A 2W7XA 3LCTA 3ZLWA 5B2KA 4U40A 3QL8A 4U0IA 2VX0A 4R5SA 3D7ZA 3F5UA 4XG4A 4QYGA 3PJ2A 5M51A 4RPVA 5EM8A 4FL3A 3TNPC 3W16A 1ZAOA 2Z02A 2DWBA 2QO9A 4QQTA 3AT4A 4EKKA 4I5MA 4I5PA 4GVAA 4WT6A 5AMNA 4WBBB 2B7AA 2VTMA 2W1ZA 3OG7A 5L4QA 2J50A 4PV0A 1OL6A 5CEKA 5HX6A 5AV3A 3UYSA 3ODZX 4MXAA 5HLPA 4ANQA 3UIUA 3FC1X 5T3QA 4BZNA 3FMEA 3MGYA 5H3QA 2PU8A 3LLAA 2UZWE 3PVBA 1WVXA 2WU7A 3IW4A 1XWSA 4J52A 4LV8A 2HIWA 4J98A 3C13A 5DE2A 3OY3A 2P2IA 4R5YA 5KE0A 3G15A 3RK7A 4OLIA 3RTPA 2H96A 1P4OA 3OS3A 3UOHA 4EZ7A 4RJ4A 3R8ZA 3LCSA 4JR3A 1REJA 2PYWA 5BMSA 3RPVA 3TTIA 3E5AA 3TG1A 2F2UA 4JIKA 4C4FA 4DFLA 3FKNA 4B9DA 4ASDA 1QPCA 2C30A 4FT9A 5AR8A 2VX1A 4ZLYA 3U6IA 2DYLA 3HAVA 2BDWA 3W10A 1JWHA 2OICA 2QCSA 3PG1A 3BYMA 2WNTA 3A7GA 3UQCA 5HG8A 3DKGA 2Y4IC 3BQRA 2O65A 3UVQA 3DNDA 3FLZA 2C5VA 3R0TA 5D10A 4A4LA 4O0YA 3LFEA 3DDQA 4R7HA 2VNWA 5L2WA 1JSUA 3QC9A 3FBVA 3BLQA 4RJ5A 4BKJA 4AW1A 3R7YA 4JBQA 3V5PA 4W8DA 2OSCA 3IONA 3QXOA 4HGSA 1CKJA 5IKWA 1LPUA 4BC6A 5KMKA 4EHVA 3C4CA 3REPA 4YR8A 5LMKC 3FLWA 3ENMA 3GU6A 3MY0A 1H4LA 4AT4A 4MX9A 2VTJA 4XV2A 2PWLA 3FPQA 3WILA 3A7HA 2QOQA 2VWVA 4E5BA 2VZ6A 4IJPA 5CXHA 4LV5A 5A4CA 3R9RA 1Z5MA 4N6YA 3RINA 3QZIA 3NLBA 3ZUTA 4EOSA 4LOQA 4EYMA 4EQUA 5JZNA 5ITAA 2JGZA 5H8GA 2PUPA 4G6NA 3DTWA 3TZMA 4J71A 3HV3A 4U7ZA 4AG8A 5HKMA 3QTWA 5CAOA 4M0ZA 3ETAA 4XCUA 4D5KA 3VF8A 1MRUA 5ANJA 4FICA 5DT3A 4OW8A 1SVGA 3R00A 4C58A 1CMKE 3PA3A 1VZOA 3VBVA 1PRYA 4XH6A 1KV2A 4U81A 4XP3A 3FSFA 5M55A 3VBQA 4QMLA 2JKMA 4RWKA 1UKIA 4KIOA 4CZUA 1IAJA 2YIQA 1ATPE 3BBTB 3PVWA 2QOHA 5K5NA 4HGTA 5CVGA 3ACKA 1Q8YA 4F9AA 2PUIA 3G2FA 4IACA 2BHHA 5M4UA 3UODA 1REKA 3HRFA 2VTNA 3C4EA 3C5IA 4ZY6A 4O7RA 4KIPA 2PUUA 4AP7A 4YTCA 4GCJA 1KE7A 3BCEA 4M7IA 2BALA 2IW9A 1SZMA 4U97A 2Y8OA 3TZ8A 1QCFA 5BVFA 1ZOGA 4YJUA 3OT3A 3I6WA 3VS0A 1S9JA 3AC4A 4CT1A 4F99A 4RX7A 2OIQA 5EW9A 3GCVA 5LCKA 1NA7A 4FZ7A 4GL9A 4ZJJA 3FAAA 3SOCA 3M2WA 3KF7A 1ZYJA 2UZTA 5J8IA 4JL9A 2GPHA 3K5UA 3GU8A 1Y91A 4R3RA 5DEWA 3ZZWA 3QUEA 4D4RA 3A61A 3JUHA 4O21A 2YM7A 3KU2A 2PVJA 3QRIA 4K77A 3UNZA 4B7TA 3E7VA 2VD5A 2QR8A 3FSKA 4XUFA 4O82A 3LFFA 4QP4A 4Y46A 1H27A 5HCZA 3LAUA 5I9WA 5GINE 4Q5HA 2UVZA 2C4GA 3FEGA 2X4ZA 2IWIA 4IFCA 1DI8A 4Y5HA 3D2IA 4BDAA 1H0VA 4D1XA 4EQCA 3GU5A 3UYTA 5L6OA 3QLFA 3NCGA 4DFNA 2YITA 3W8QA 5IISA 2VRXA 5KMLA 1YVJA 2RKUA 4IAAA 4J99A 3P23A 3HV7A 2A19B 2BVAA 3AC8A 1YOMA 1URWA 5EDPA 2UZBA 3DFAA 4WG4A 1L3RE 2JFLA 4I94A 4YBKA 3SC1A 2PL0A 4BYJA 4X6QC 4FMQA 4L68A 4E1ZA 5IEYA 2WTDA 4E4XA 1CKPA 1DAYA 3DZQA 3QD0A 3FI4A 3GC8A 4QMSA 1SVHA 4NFMA 4CMUA 1OIUA 5T6KA 1OL5A 1A48A 1XH5A 2OZAA 3E3BX 4MWHA 2ZV2A 3QHWA 2WMUA 3O50A 4NJ3A 1WAKA 4N57A 4R6VA 2XP2A 2O0UA 2W4KA 4A07A 4JS8A 4CNHA 3EHAA 3UMXA 5T68A 3GC9A 1J1CA 3PYYA 4G3FA 5I5ZA 5I9UA 4O84A 4CFWA 1M7NA 4DEEA 3LM0A 2EB3A 3DK6A 1B38A 2ETMA 4RJ7A 4C2VA 3SRVA 4YJOA 4W4XA 5EYMA 4XOZA 3E7OA 2OZAB 4CYJA 1PMUA 1Q97A 2UZOA 4XJ0A 4JG6A 3F6XA 1FBNA 4JG8A 2PVNA 3QF9A 4GK2A 4N0SA 3L8PA 3QTRA 3VAPA 5I4NA 5IDNA 5LMKA 4FIFA 2Z7SA 4DF3A 3PJ3A 3GU7A 4D1ZA 3W33A 2CGVA 4AN3A 5FDPA 5IU2A 3DXQA 4IADA 3CGFA 4EK4A 1E1VA 4O7VA 3R22A 4UMTA 5FBNC 4JNWA 4DEIA 5M4IA 3AOXA 2O63A 3MTFA 4I93A 4XX9A 3NZ0A 2HXLA 2BTRA 3EL8A 4FSMA 3PE1A 3OEZA 3QGYA 3T9TA 3FJQE 4KSPA 1PHKA 4CZYB 3P4KA 2BAJA 2X2MA 3ZFMA 5E91A 3VRYA 2WELA 4CTBA 2FVDA 2IZSA 1SNUA 3MS9A 3NUUA 3L9NA 4MQ1A 4C4HA 4E4LA 2Q0NA 3QD3A 5AR2A 3RAKA 3QLGA 4RQKA 4AOJA 5IMEA 4YC3A 3EN9A 1GAGA 2W4OA 3PA5A 1IEPA 4QTAA 5CVFA 1ZY4A 4K9YA 1UKHA 2XMYA 4EI4A 3P79A 2UW8A 5CEPA 2BKZA 1YDRE 3NRMA 4L46A 3V51A 2F49A 4YO4A 2ITNA 3OUNB 4QYHA 3OBGA 1Z9XA 3Q6UA 3B2WA 3WZEA 3JY0A 4L44A 4ZS4A 4O6LA 5CAVA 4YU2A 4JJRA 4OTHA 4XMOA 5AX3A 3V8TA 3ZDUA 5CU6A 4USFA 4RJ6A 2XKCA 4HVIA 5DBXA 2C5XA 2VWUA 1TQPA 3FKLA 1H1PA 3MYGA 3HYHA 3WZKA 4Z55A 3BV3A 3RPOA 3E8NA 4I5HA 4IB3A 3RWPA 3IOPA 2GHMA 2NRYA 3CS9A 3KRXA 4YMJA 2JDOA 5HG9A 3FXWA 3BHTA 4JRNA 2I1MA 4GJ3A 3CJFA 2OW3A 3F88A 4UY9A 2OJIA 2FA2A 3U4WA 4DFXE 5L2IA 2YJRA 2PMLX 3FYJX 2YDJA 3LFDA 3V5QA 1IA8A 5AUUA 1OBGA 3R71A 5K4IA 5HQ0A 4FTLA 3AMBA 2WIHA 5KKRC 2VTAA 3LCDA 4Z9LA 2CN8A 1MRYA 3EJ1A 1IRKA 4I4FA 5F94A 2XF0A 2OH4A 2OIBA 2ZOQA 5DR2A 3QTXA 3EKNA 5G1XA 4F6WA 5HU9A 3UOJA 4L42A 4QQ5A 3BELA 2X8IA 3V5LA 3C51A 5LQFA 5CT0A 2BFXA 3PY3A 3NR9A 4AW2A 5LVMA 5M4FA 5J9LA 4CLJA 2ETRA 3H30A 1W98A 4FKJA 3R8PA 3MFTA 2R3HA 3MBLA 3OHTA 4CV8A 2HW6A 5FP5A 5HIDA 4EHGA 3UNKA 5JFVA 3C0GA 4FUXA 3LPBA 4OTFA 4GFGA 3H10A 4IZAA 1P4FA 2ZV8A 5D7AA 4IZ7A 2X4FA 4FGBA 2WQMA 4XOYA 1FINA 1V1KA 3IO7A 1ND4A 5L3AA 2VTHA 4WG5A 4V05A 4RFYA 4ZTQA 4YHFA 5IQAA 3EQRA 4FT7A 4YTFA 1H26A 3ORPA 5HVYA 4ZTNA 3WIGA 2YCFA 4TNBA 4BCNA 3AT2A 4MEDA 4JG7A 3MB7A 4GYGA 3O8PA 3FHRA 3I7CA 3TUCA 1I44A 2WTVA 2RG5A 2WTWA 4ZSGA 4FI1A 2C6TA 2VX3A 2W17A 2XM9A 3FZPA 2HZNA 2R5TA 1ZWSA 3C9WA 3RAIA 4H58A 4BCJA 1VR2A 3F7ZA 4BRXA 4F63A 3VN9A 2FH9A 1WBWA 4OTDA 2GNJA 4BCKA 4ZZNA 4PPCA 5A4LA 2XH5A 3P7CA 2QD9A 2XUUA 3PJ1A 5EH0A 2I0HA 5HTBA 5IDPA 4DE4A 4I6HA 1H0WA 4Q2AA 5JSMA 2VN9A 4TTHB 2BFYA 4I3ZA 5EHOA 2C6OA 3WOWA 5I9YA 3LXNA 4PTEA 1SM2A 4UN0C 5BVWA 5TR6A 5KUPA 2VTTA 3KVWA 3NX8A 2PHKA 3O71A 3Q32A 4DTKA 4N70A 4YJSA 3F2NA 2IG7A 3QQKA 5HBHA 3TV4A 3F66A 5L2QA 5IQFA 3LFNA 2WQNA 1CSNA 5AV4A 4C0TA 1YDSE 2V7OA 4IZ5A 5BYLA 4A4OA 2GHLA 3ORTA 3W2RA 4CFXA 1T45A 3LW0A 3LMHA 4PQNA 1Y6BA 4DT9A 5DVRA 3P9JA 4NCTC 4D55A 3PSDA 4EZ3A 3EN7A 4QNYA 4CV9A 1J91A 5BUEA 1MUOA 3S2PA 3KN5A 3KQ7A 2DS1A 4AGUA 2X39A 2YWVA 3T3UA 5TOZA 4XLIA 3S4QA 3AC3A 1J7LA 4ACDA 2WTCA 5DLSA 5JQ5A 2XB7A 2OXXA 3DCVA 1F3MC 1M17A 4IB0A 3NYVA 5FTOA 3ZTXA 3UC4A 1Q61A 2WMXA 3EN4A 4AA5A 4IM2A 4RRVA 3PXYA 3V5JA 3ZEWA 5A54A 3ID6C 1RDQE 2XKEA 4L3JA 4P4CA 4F1OA 4F9YA 2YM5A 2OXDA 3DAJA 2BMCA 3QQFA 4MF1A 2WTIA 3BHHA 3MIYA 4AFJA 1L8TA 3G90X 4BCHA 5A9UA 2HY81 3ZHPC 4JBVA 4YJVA 4EUUA 3NUXA 2C3KA 3HP5A 2YWPA 4FKVA 3LFAA 4FL2A 4DGOA 3O23A 2CGWA 2JBOA 2CDZA 2VWBA 3ANQA 2WD1A 3GENA 3JS2A 1OITA 4UALA 2J6MA 3ZBXA 5F9EA 4Z7GA 3ORMA 3RK5A 3ZLXA 3SW4A 3KN6A 4DEHA 1BX6A 4IX3A 3C4XA 1LP4A 2HENA 2VAGA 5D9HA 1Q8WA 2XIXA 3ODYX 3D5WA 3ZU7A 4QMOA 1UWJA 2C5NA 5AR3A 4EH3A 3NMUF 5HCYA 3R1NA 3VULA 4FTJA 4I0TA 3VW6A 4ANOA 4CYIA 1B39A 5C8NA 4FZFB 4KKEA 1XH8A 1NW1A 3EZVA 3L8SA 3PP1A 3NSZA 4FTKA 4FTOA 4KA3A 2JC6A 2OH0E 4FODA 5HTIA 4ENXA 5KKRB 5C4LA 4JI9A 4M66A 4KWPA 5DNRA 3VIDA 4X0MA 3E88A 4EK8A 1YXXA 4S32A 4EH2A 4AU8A 1A9UA 4IM3A 5JH6A 3SGCA 2BRHA 2W5HA 4MXZA 3MPAA 4LL5A 4FNWA 4KKHA 5JK3A 3U8WA 3A2CA 4YGAA 3NPCA 3E62A 4GH2A 4FTAA 5KBRA 3EQCA 1JBPE 3Q5IA 1UV5A 1PJKA 3RHKA 4BDDA 4ERKA 1ZYDA 3BGQA 3EYGA 4U3ZA 3H9FA 1JKKA 3C4FA 1JKLA 2R3NA 4YTIA 2YHVA 2OG8A 5E8SA 4EKLA 2C6DA 4JT3A 4D9TA 4KIKA 1NVQA 4YZNA 5CU4A 4ZSLA 3NVKI 4Z16A 4L43A 2CPKE 4BDBA 2W5BA 2YM4A 2EUFB 1F5QA 3O7LB 3HUCA 4JAJA 3PE2A 3PXFA 4FTRA 4FIHA 4TPTA 4APCA 2X6DA 5I0BA 3HRCA 3QA0A 3Q53A 2XJ1A 3D94A 3NIZA 2ZB1A 4TY1A 4OT5A 3O0GA 1BUHA 4KIKB 3D14A 1YW2A 2I6LA 1GZNA 1GY3A 3CKXA 5DYJA 4L7FA 5FD2A 3D7TB 3E93A 2B4SB 5DT4A 4FIGA 3GU4A 2WEVA 1M52A 1WVYA 2BAKA 4C33A 5ACBC 1YI6A 4QMWA 3P0MA 1JQHA 3OUKA 1W8CA 2C5YA 3KL8A 4NM7A 3UMWA 2E9OA 3V04A 4AWIA 4E6QA 2XNNA 1OVEA 3HNGA 5JN2A 5JT2A 1AGWA 1H01A 1JSTA 2PK9A 3ZCLA 4GV1A 3C1XA 5I3RA 2F7EE 2BTSA 3UG2A 4HCTA 3OD6X 5AA8A 4IX6A 4NTSA 2IN6A 5AWMA 2ZMCA 5A4TA 4DA5A 4NCTA 1PXOA 4Z7HA 3FPMA 3NWWA 2AYPA 5BUIA 5FTGA 1U59A 4WIHA 4AZVA 1HOWA 4J96A 3EOCA 4QYFA 4EH8A 5LVLA 5K3YA 4HVHA 2XCHA 3E3PA 4L67A 3DBDA 2ITTA 2R9SA 4DEDA 2A1AB 3EMGA 4IIRA 3NUPA 3AC1A 1QPEA 4G9CA 4RZWA 3FLSA 3G33A 3KRWA 5GJFA 4O7NA 4LOOA 2F9GA 3VBXA 4G5PA 4QD6A 4TWCA 2V0DA 4MKCA 3SVVA 3E92A 5GZ9A 4BFMA 4CT2A 4XRLA 4DFYA 3MH1A 4F70A 1FVRA 2ZV9A 3KA0A 3LZBA 4Q9SA 5J5TA 3FMJA 2CLXA 4F6SA 4FEVA 3QQJA 1V0PA 2UW3A 5KMMA 4AS0A 4PDYA 2ZYBA 3TDVA 4PPAA 2ITWA 4P2KA 4ZSJA 1WMKA 1WBOA 3FLQA 5BMMA 3RK9A 4FKRA 4LOPA 3PIYA 4E3CA 4O22A 1Q3WA 3HA8A 4F7JA 2BKKA 4FL1A 4GFOA 3TM0A 4F7LA 5C26A 2X0GA 4IB1A 4EWQA 1XBAA 1YXSA 2XKFA 4RFZA 5HX8A 3AMAA 2YAAA 3CP9A 1CTPE 2PVYA 3F3ZA 4XV9A 4LUEA 2VTPA 2J0MB 3NNUA 3UO4A 4DYMA 2C6MA 4I23A 3FY0A 3R7OA 5HGIA 4ONAA 3KXXA 5HNBA 1FGKA 4QQJA 1VEBA 5EG3A 5CEOA 1QL6A 3MY1A 3Q4TA 3HV4A 4LI5A 1RQQA 4AW5A 5IQHA 2VO0A 2VU3A 3OCTA 1X8BA 5FDXA 4UYNA 4ASEA 1G3NA 2XNPA 2BZKB 2FGIA 4K18A 3OF0A 4O7SA 4ZIMA 3NUNA 3R02A 3R30A 1RJBA 4BTJA 3CD3A 2CSNA 3ZSGA 4E4MA 4QTCA 3Q4CA 3AQVA 5FM2A 3I5NA 2BIYA 3FMMA 3DQXA 4ANSA 4G6LA 4M12A 3FLYA 3KXNA 4WHZA 4R78A 3UTOA 4GIHA 3T8OA 2WQBA 4ZZOA 4PL4A 4KIQA 4B4LA 4Z3VA 1JOWB 4J53A 5H8BA 3W2CA 5HU3A 2ITPA 5DA3A 4ACCA 2PVLA 2YCRA 2EB2A 4I4EA 3T9IA 2VO6A 4WSQA 4BDFA 2BRBA 3FMLA 5CXZA 3PSBA 5AIRA 3RPRA 4ALVA 4G34A 5ANOA 4ZLOA 2C6IA 3OVVA 4FSUA 4K1BA 3BLHA 4O0XA 3DAEA 3PY1A 4ZTMA 1P5EA 5DG5A 1W82A 4EUTA 2XZSA 5HE3A 3FZOA 2ETKA 3E8CA 3Q6WA 4MNFA 4Y5QA 4GG5A 4PWNA 4BDHA 4DH5A 1YI4A 3QFVA 5IZFA 1R78A 3AXWA 4I5CA 5AP1A 4NM0A 4YHTA 4UWBA 4EH5A 1J7IA 3L9LA 4ZSEA 4A9TA 4W9WA 4YO6A 5CLPA 2GCDA 2W1IA 3C50A 5ETAA 4A9UA 4DT8A 2BAQA 5CAPA 2JIIA 1PXLA 2I7QA 3PZEA 5F95A 2B9FA 1YWNA 3BYVA 3KGAA 4IB5A 5E7RA 4CKIA 3C0IA 4FVPA 3CGOA 4KBAA 4FV1A 4OTPA 5HD4A 4EOJA 3CBLA 4FV0A 2YIYA 4AT5A 2C69A 3F7WA 4IDTA 1MRVA 2REIA 4O0SA 3RM7A 3W2OA 5EK7A 4TWPA 4WRGA 4X2JA 3MJ1A 3EQIA 3OBJA 4DGNA 4E20A 2WMBA 2GQGA 4H3QA 5AR4A 2OLCA 3PXKA 1OUKA 4RVMA 3ZDIA 3DBCA 2UW5A 5KHXA 4IC7A 5JGBA 3ALNA 3QKLA 5IG1A 5JGDA 4PX6A 5FUTA 2B53A 4XYFA 1JKTA 2J0KA 2XEYA 4H39A 4DEGA 2JAVA 1HCLA 4XP0A 4ZTRA 1ERKA 3BYSA 5E1SA 3F3WA 3LXPA 5EKOA 5EM7A 3VS6A 4FEQA 2OXYA 4RMZA 5D7VA 2WMQA 2HELA 2X6EA 3QWKA 2ERKA 5FTQA 2UW4A 3DNEA 2XM8A 4O96A 5CI6A 5FBOA 3WARA 4CTCA 5AAEA 1G5SA 5HNIX 3P86A 3F82A 4FKPA 4IW0A 2OJJA 4UBAA 5HE2A 2B1PA 4L00A 4CSVA 2F7XE 4IX4A 4F7SA 2WPAA 3DS6A 4FIJA 4LRMA 2BRMA 4KB8A 5A46A 4PRJA 4ASXA 4QNAA 4RC3A 4MYGA 4QMQA 3M42A 5KBQA 3CTHA 4PNKA 3ZO4A 3U54A 1JLUE 2ITZA 1H25A 4F0GA 2QVSE 4QYEA 3MDYA 2FUMA 2WMWA 3DZOA 3MH3A 3VUMA 4TYEA 3RZFA 2J9MA 3DQWA 2GTNA 3KREA 3QALE 3BU6A 3MA3A 3II5A 4XRJA 3ZRKA 3Q3BA 4AN2A 2Z7QA 2BHEA 1FVVA 4PUZA 1W0XC 3R8LA 4K0YA 4DEBA 3VW8A 4FKIA 1WFCA 1PKDA 3FHIA 1FVTA 3UOLA 1GZ8A 3DOGA 5J5SA 5AJQA 5AP4A 2WIPA 5HG7A 3VJNA 2ITVA 3COMA 3R04A 4W4VA 5J95A 4O91A 3DFCB 3OWJA 1OPKA 3FE3A 3G0FA 1UU3A 3VWAA 4JX7A 2OK1A 4WO5A 3BBWA 3ZONA 3NS9A 3OC1A 4R7BA 5EHLA 3GUBA 2QOIA 4AX8A 2BCJA 3Q2JA 2XK8A 5BYZA 4O2PA 1R39A 3R7EA 2OIDA 3K2LA 4BWXA 4DG2E 4RZVA 5ACKA 2RGPA 5AP5A 3IG7A 4FG9A 3QC4A 4CRSA 4HGEA 1WBNA 1H1QA 4Y8DA 5KZIA 3KMUA 3UDBA 4GRBA 2C6LA 2GQRA 2CKPA 1R1WA 5HOAA 3VBYA 5CALA 1UU8A 1XH9A 3MN3A 3WE4A 1PXKA 3UP2A 5AP0A 2PVKA 4IVBA 4W9XA 5EI8A 2J0LA 4D0XA 4QP7A 4BZDA 1NVSA 1Y8GA 3EQPA 3OTVA 2R3OA 4IWOA 2HYYA 5B0XA 4UMUA 3ROYA 5B2LA 4LGDA 4S2ZA 2R4BA 2YM8A 3V6RA 4R7IA 3BGZA 3GGFA 3R2YA 4O2ZA 3MI9A 3TXOA
chains in the Genus database with same CATH superfamily
2YEXA 4E6AA 3WF8A 3OW3A 1URCA 4R3CA 4YLLA 5A6NA 4APPA 2X81A 1FGIA 2VGPA 3QU0A 4LDTA 2G15A 4WUNA 3EN5A 1EH4A 2WTJA 2UZEA 3LIJA 4OT6A 2W9ZB 4OR5A 5FLFA 5HVJA 1M2PA 5BVEA 3IDPA 3TKIA 4DH8A 2BIKB 2PMNX 3FMKA 4JQ7A 3PG3A 4QMVA 5CNNA 3S3IA 2A2AA 4GJ2A 2KULA 5HO8A 3W2PA 3COHA 4TWOA 4BF2A 4BHZA 3P5KA 3KKVA 5KHWA 2J5FA 3VVHA 4BCOA 1ZMWA 2C1AA 3ROCA 4ZMEA 4M69A 5EOBA 2QO2A 5IEVA 3QCQA 1XH4A 1A06A 2OFVA 2QOOA 4Q5EA 3IW5A 3SLSA 3UG1A 5M44A 1MP8A 5AADA 5GJGA 4NKAA 5AFVA 5M4CA 4E5AX 3E63A 2PSQA 4F1MA 4GKHA 4YNEA 2QODA 3I60A 3ERKA 3FKOA 4IAFA 5AV1A 2UVXA 2FO0A 2W1CA 1U4DA 3PJCA 2JAMA 4CQEA 2C3JA 4FTQA 2X2KA 3PTGA 4M68A 1OL7A 2QKRA 4IQ6A 4WBOA 3PVGA 4IE9A 5AM7A 4YJNA 2A27A 3R21A 1V0BA 5CQWA 3FMNA 3TTJA 4FKUA 2ZM1A 5CSXA 4FEWA 4GU9A 4HYUA 2H34A 4NU1A 5J9ZA 4BTFA 1LEWA 3OFMA 2WB8A 4QMPA 1WBTA 4X2FA 4H3PA 3MA6A 4BDKA 3CE3A 4NM3A 4J1RA 4CCUA 3V5WA 4KRCA 4XG6A 4TKSA 4GSBA 2VNYA 3DJ5A 1Q62A 1XO2B 4JBPA 3UZTA 2Y4IB 5L8KA 3BZ3A 2IF8A 3KC3A 1ZMUA 1ZXEA 3CLYA 3OROA 4BCQA 4V04A 2CNQA 5HVKA 4XG2A 3TZ9A 3VHEA 1VLRA 5BPYA 3LQ5A 2RFDA 3BQCA 2XNOA 3ORLA 1T46A 4FV5A 1DM2A 4AZSA 4X6RA 3SRVB 3BPRA 2Z2WA 2WHBA 4F1TA 5C03A 3RPYA 4M15A 3ZM9A 3WZUA 2I40A 2EVAA 3F69A 5FWKK 5H8EA 3C0HA 3W0MA 3OT8A 1Q8TA 3BRBA 1STCE 3FZ1A 4IEBA 5IUIA 4F08A 4RA4A 5IMXA 4M14A 4NWMA 3S00A 4X2GA 3F61A 2QG7A 3U6JA 5HE0A 3Q9WA 5TO8A 4HW7A 4FKTA 1Q41A 4NKSA 4AZTA 3ZZEA 4C38A 4QTEA 5DFPA 4S30A 3UGCA 3ZOSA 3P78A 5BVKA 5GIOE 3F3VA 3MPTA 2XNGA 1J3HA 3R7GA 3V6SA 3NUAA 3IECA 4QMNA 3BKBA 3NNXA 4D2WA 3DBFA 5HIBA 4CFUA 5GZ8A 4I22A 2WMTA 4BBEA 4L3PA 3UJGA 2ESMA 5J7HA 4FGRA 3IW7A 2V7AA 4C4GA 4O7YA 2IZRA 1FMKA 4DTBA 2B0QA 3TMOA 3SKCA 3HAMA 4AXAA 4RIWA 4BDJA 4QTBA 5DOSA 1KWPA 5FEDA 4AQCA 1BYGA 4OBQA 3AD6A 5LARA 4RJ8A 4O4BB 3CEKA 3AD5A 4JQ8A 4TYIA 2ITQA 4UXQA 2OKRA 5J87A 3ULIA 2UUEA 3ZC5A 3ZO3A 1ZRZA 2WU6A 2ZVAA 5HO6A 1G8AA 2ZJWA 4CMTA 2BZJA 2QONA 3FI2A 4B6LA 4DITA 4RIWB 1ZY5A 2IVUA 3OY1A 5KO1A 1OB3A 3GXLA 3BLRA 3I79A 5HCXA 3DDPA 3AG9A 2YISA 4E73A 5DMZA 2RSVA 3QCYA 3GNIB 4G3GA 5KMNA 4ACHA 3F5XA 1ZYLA 2GNIA 5HICA 4YSJA 3ZUUA 4EBVA 3UIBA 1XJDA 4JDKA 4FTMA 5JFSA 2R3RA 4IM0A 4QP6A 3TV6A 3FUPA 3H0YA 2AC3A 3I1AA 4O7WA 3DJ7A 1CDKA 5C9CA 3NDMA 2YZAA 4GW8A 2C5OA 4U8ZA 5IEXA 3O17A 5M08A 3ALOA 4AAAA 3JPVA 3WZDA 4FG7A 3LOKA 3VUHA 1I09A 4LGHA 4IANA 4XV3A 5ETIA 4U5JA 4RQVA 3PXZA 3PWDA 4G31A 4U6RA 1OECA 4I20A 3H9OA 4MWIA 4NH1A 1Q8ZA 3UQGA 3C7QA 1BI7A 3D15A 2HWOA 4Y83A 2UW0A 4WSYA 5L2TA 4DBNA 5IQGA 3Q60A 5HZNA 3LCOA 4NL0A 3NAYA 2OU7A 2PE2A 2UVYA 4D28A 2BZHB 4FZ6A 4O4CA 3CIKA 4BCGA 4F0IA 4X3JA 3U51A 3WYYA 3Q9XA 4BTKA 2ZV7A 4DEAA 4I6FA 5C8KA 3SOAA 4O0TA 2HAKA 4U44A 2NNWB 3R6XA 2F4JA 4PL5A 3Q4ZA 2QHNA 3M1SA 3A4OX 3EWHA 4EH6A 2HW7A 2YABA 4QMTA 4HPUE 5JRSA 1YHWA 3L8XA 3FZSA 5B7VA 3LFBA 2R3QA 5CY3A 4I92A 3ZXZA 2P2HA 4A7CA 2JKOA 3PPKA 3VUGA 3LM5A 5GHVA 4G3EA 3KFAA 4PTGA 4IWPA 2GSFA 4C4JA 1KOAA 5LWMA 2J4ZA 2ONLC 4ZLZA 4EOQA 2YACA 3QZHA 2OF4A 2UZUE 3N4VA 1HCKA 3LCKA 3RNYA 3EQFA 2WEIA 4EH7A 4ERWA 4ANLA 1YXUA 4DCAA 3I6UA 5IQCA 4BB4A 5KMOA 3W0OA 2W0JA 4XS2A 3TJCA 3TNHA 1SYKA 4HVGA 5DIAA 3EYHA 5IA2A 3GCPA 3CQUA 1PXIA 4IWQA 2JDSA 3ELJA 3R9HA 2FB8A 3DJ6A 2RIOA 3AMYA 4YSMA 4CCBA 3NAXA 3QTIA 3R2BA 4I21A 5TE0A 3HECA 5CU3A 4O0UA 3R83A 4FTIA 2G2FA 2PULA 5FEQA 2ITXA 3H3CA 3MVHA 3QCXA 4I24A 1GIJA 5DR9A 3DBEA 1YRPA 2XIZA 4F7NA 4DLIA 3FXXA 2GDOA 2E9PA 3HV5A 5JRQA 1OKZA 1OBDA 5CASA 4FEUA 4RVKA 3TIYA 4RIXA 2DUVA 4KSQA 4DDIA 3IS5A 2XNMA 4YUQA 1U54A 4FV4A 4NUSA 4CG8A 1XH7A 3OCSA 3FV8A 3QX4A 1ZYCA 2IW6A 3GC0A 5CQUA 3OMVA 3QZFA 4C36A 4ENYA 4BN1A 5LXMA 2O64A 2XK6A 4FIIA 4R77A 3HUBA 4RVTA 5EQPA 3FMHA 3AC5A 3UBDA 4A4XA 3KXZA 3ZSHA 3NUSA 3KRRA 5A3XA 5JEBA 1WBVA 4JAIA 4RIXB 5CT7A 5FGKA 3T3VA 1U54B 5K4JA 4D4SA 4FK6A 5BQ0A 4FKGA 2GS2A 3EFLA 4IC8A 3A8XA 4RWLA 4ZTLA 4DAWA 4EOOA 5JFWA 4ORKA 5IQEA 3KMWA 4UV0A 2UZVA 3ZXTA 4PMMA 1OIYA 4O1OA 5EYCA 2SRCA 4AE9A 3COIA 3OXIA 5L8LA 4FE2A 1S9IA 4O7ZA 3UDSA 5AUXA 2X7GA 2A98A 2H8HA 3MJ2A 4E8AA 1LR4A 2VO3A 4USEA 2CCIA 3OW4A 3ZBFA 3V5TA 2H6DA 3I0QA 3ULZA 4D2VA 4I0SA 3C5UA 4U42A 5HBJA 3LFQA 4TYGA 5KZ0A 1Q5KA 3IDCA 2NP8A 4LMUA 3TI1A 3ZH8A 3OZ6A 4H3BA 4ZZMA 2WQOA 4BI1A 3QTZA 5JKGA 4QP8A 4OBPA 4YJTA 2JLDA 4TW9A 1GOLA 2P3GX 3LQ8A 3QTSA 4FX3A 4KNBA 4YLJA 5E8TA 5E8VA 4C3RA 3A8WA 3RJCA 4YJPA 4ZOGA 4WD5A 1JVPP 4H05A 2VV9A 4OBOA 4OGRA 4R1VA 4FV8A 3N4UA 3PRFA 3KRJA 4FKWA 3TDWA 2G2IA 2QLQA 2OI4X 3HX4A 5HESA 2HOGA 4YJQA 4XG7A 2V5QA 4MBJA 3ZC6A 3IDBA 2R3LA 4MK0A 3KEXA 4DH1A 3OP5A 2OFUA 2WTKC 2XNEA 4UXLA 2CKEA 4CLIA 4CZTA 5EM5A 2GNLA 3TNQB 5CENA 2FSMX 3QRJA 4FIEA 5LJJA 3D2KA 4QQCA 5M09A 4B0GA 1UA2A 3HGKA 3K3IA 3UOKA 4HNIA 3L9MA 3SX9A 2R2PA 1RW8A 5LCJA 4AA0A 1Q3DA 3FQSA 3OXTA 3CSVA 3NW5A 1R0PA 4DHFA 3GBZA 3KCKA 1UVRA 3FMDA 1UU7A 4BWKA 4JDIA 2AUHA 4BDEA 3DKCA 3EL7A 4FV2A 4I6BA 4CFNA 4GMYA 1GNGA 2PZRA 2YDIA 3B2TA 3QHRA 4FTNA 5AP7A 4FKSA 5F20A 5FG8A 5FXQA 4CGAA 2X2LA 4U80A 3EQBA 1WCCA 4K33A 5AEPA 5CF6A 4GYIA 4O0RA 4FVRA 3SHEA 5IA3A 2ONLA 1AD5A 3ZM4A 4G2FA 5FXSA 3KB7A 3LKMA 4RFMA 4Y85A 5ETCA 3BYUA 3GB2A 3HDMA 5DT0A 3RPSA 2GNHA 5M06A 4DINA 1WBSA 2G01A 3R1YA 2YAKA 4L9IA 3BEAA 2HY0A 2XYUA 4RA5A 3BE2A 1K9AA 1H08A 2I0EA 2QOKA 3CTJA 3HVCA 3Q52A 4EC9A 4EHZA 3RI1A 2YJSA 4QEBA 5CNOA 4QP9A 2W9FB 4Y72A 3D5UA 3FWQA 4ANMA 4MD7E 4FOCA 4EZ5A 2W06A 1GZKA 2BR1A 3TKHA 4PPBA 4JR7A 4BGGA 1WBPA 2ACXA 2WAJA 1PXJA 2RFSA 2UW6A 4FV9A 5ANGA 5IA5A 1OGUA 2RF9A 3CD8A 2GQSA 4D1SA 1YOJA 2ZAZA 2JFMA 5AP6A 5A4EA 2PZIA 4AOTA 5IQIA 2QOLA 2B54A 3P7BA 3Q4UA 4ZTHA 2WMVA 4P5ZA 1O6LA 3U9NA 2OJGA 2Y6MA 3DB6A 3EQHA 2Y9QA 3CKWA 4AA4A 2A4LA 3HV6A 3BHVA 3MFSA 2BRGA 3IQ7A 4BBFA 4TL0A 3EFJA 4D0WA 4QYYA 4F0FA 4IVDA 4WG3A 3I5ZA 4RX9A 4F9BA 4HVSA 2ZB0A 5ANDA 5C8MA 3TJDA 3P08A 4WOVA 4ANBA 3SA0A 3QBNA 4K6ZA 4RGJA 1ZMVA 2VO7A 5CSHA 4PTCA 4AW0A 1O6KA 5ETFA 2PMOX 4RC2A 2R3FA 1OIQA 3DKFA 2VWZA 1PYXA 3H0ZA 3ENHA 3DPKA 3CPBA 4D2RA 2XRUA 3O96A 2P33A 3WBLA 3PPJA 5EW3A 4CEGA 4AQKA 1KUTA 2R3IA 4HYHA 1OZ1A 4GEOA 4XNEA 4P7EA 4PP7A 3D5XA 2ERZE 2VWYA 4FT3A 2IVVA 4CMOA 1M7QA 4KAOA 1TKIA 3QTQA 1BKXA 2YM6A 3SDJA 4DGGA 3OWKA 2WZJA 4AGDA 5BVDA 3VBTA 1LEZA 1W83A 2R64A 2YIWA 4UZHA 2XAOA 5IQBA 4BR3A 1PF8A 3EH9A 4FV7A 2G2HA 3TKUA 5AUZA 3LLTA 4FTTA 3F3UA 4OTQA 5C1QB 2XANA 4LYNA 4WNKA 3U4UA 2YN8A 2J0IA 4GU6A 4QP3A 4E26A 2BZIB 4FV6A 1XH6A 4ZMFA 3QRKA 4E6DA 4B8MA 5D12A 3GVUA 3ZUVA 4RVLA 5IH4A 4KD1A 3PY0A 3VF9A 3DGKA 1Y57A 4L52A 2PPQA 1V0OA 2UZNA 2YZLA 1YQJA 2XALA 2YIXA 4XBRA 5M56A 3ET7A 2CHLA 5D1JA 1OKVA 4O0WA 4PDPA 1E1XA 3A99A 3IKAA 2EU9A 3NUYA 4DTAA 4KBKA 3QKMA 3CC6A 4I1ZA 4RSSA 4MH7A 3ORKA 5M57A 1IAHA 5CZHA 2QOFA 4E5WA 1JKSA 1DAWA 2GS6A 1E9HA 5EDQA 2CLQA 3RKBA 1K2PA 1H1WA 4QT1A 4C57A 2EXCX 4NW5A 3AD4A 2W1DA 1PKGA 5K0KA 3ORXA 4RWIA 4O0VA 1KE6A 3AGMA 4GUBA 3FL4A 2F7ZE 2QKWB 4L8MA 4PMTA 4YC6A 4MD8E 1DS5A 4O27B 4PF4A 1FOTA 4JVGA 5GNKA 3W1FA 1ZLTA 3ZO2A 5I9XA 4EOLA 3QUDA 3AKLA 2X7FA 3JXWA 4UWCA 4CKJA 5B2MA 4NSTA 4AOIA 2WTKB 5DPVA 5CU0A 5CVHA 1MQ4A 3QD4A 4M67A 3QYWA 2NO3A 4NM5A 5HG5A 4IZYA 3NCZA 4FSYA 4YC8A 3SQQA 3MFRA 4O38A 4YPDA 2HCKA 3R9DA 4D2TA 1LUFA 4JOAA 5ANEA 1W84A 3MH0A 3KK9A 3PVUA 1CKIA 1OL2A 4ID7A 4AZWA 3RBWA 4MF0A 4NEUA 3G9LX 4DN5A 5M53A 2YA9A 2W1FA 3ORIA 3P7AA 3JR1A 3BV2A 1R3CA 2QNJA 4MUQA 2WMAA 1QMZA 4ALUA 2C0OA 3HMNA 4WNPA 3UIMA 2JDRA 1TQMA 3L9PA 2PTKA 3R9NA 5AM6A 5GJDA 5E8XA 5FEEA 4QPAA 3VQUA 3QX2A 2XVDA 3OOMA 2UW9A 5G6VA 2WMSA 1ZOHA 2Z8CA 4AAYA 2R7BA 4QMMA 5DR6A 5DH3A 1OKYA 5CSWA 5DRDA 2YCSA 2JDTA 4RX8A 4GK4A 2V22A 2QU6A 3G0EA 3G51A 3RM6A 2P55A 2VWIA 3BI6A 2XEZA 4X3FC 4BDGA 5I9VA 2PY3A 3KXGA 5CF5A 1PMNA 5AAGA 4F6UA 4IAZA 2IVSA 2OJ9A 2WOTA 3ZRLA 1YXVA 2AQXA 2J51A 1ZARA 4MNEA 3NNWA 4U45A 5AR7A 4ZEGA 4EC8A 2VUWA 4QOXA 4W4WA 3OXZA 4FZAB 1Q24A 4L7SA 1XQZA 3R8MA 5F1ZA 3RALA 3EFWA 4ITIA 3HLLA 4M13A 3WIKA 4DLJA 2BDJA 2FSOX 2PVMA 4E4NA 4EL9A 4G6OA 2P0CA 5CS6A 3TZ7A 3UQFA 4CXAA 3A62A 3DU8A 3A7JA 4RG0A 4ZJIA 4ZSAA 2CNUA 4TT7A 4HYSA 4MNEB 2W96B 2F57A 4YBJA 4L45A 4G3CA 4P5QA 4A9YA 4XG8A 4S31A 4GIIA 4MXYA 4MBLA 4WNMA 4FKOA 1JPAA 4ITJA 4L53A 2FSLX 3GCQA 3O2MA 4J97A 4QMXA 5ICPA 4PY1A 3MW1A 1OIRA 3QWJA 3RMFA 1XHAA 2O8YA 3BHYA 1UNHA 2GHGA 1YHVA 5DHJA 3ZFYA 3RCDA 3ANRA 4EWHA 5JZJA 3TEIA 2PUNA 3OCGA 2CN5A 3TL8A 5CEMA 2C3LA 3SG8A 5J79A 1BL7A 2QOCA 4FC0A 4AZEA 4GG7A 1OL1A 4JBOA 5FQDC 2Q0BA 1H07A 4LG4A 3VUDA 1OPJA 4L3LA 3F2RA 2J2IB 1YKRA 3PLSA 3BHUA 3EFKA 3RGFA 3DAKA 2OBJA 2RFEA 3DA6A 2QG5A 3R1SA 5FP6A 5HIEA 1OI9A 3MVJA 4AGWA 4BI2A 3E64A 5A4QA 3S1HA 2GNFA 5I3OA 4YZCA 1ZZLA 5EYDA 4BGHA 4YZ9A 5KNJA 2J5EA 3FC2A 4J7BA 3KF4A 4O7LA 4GKIA 2J7TA 4G1WA 4HOKA 5CEQA 3QQUA 4QMZA 4C4IA 5IA1A 3DLZA 3GI3A 3R01A 3VONA 4GVJA 2XA4A 2NPQA 4UZDA 4NK9A 1SVEA 3R28A 1M14A 4RWJA 3QQHA 3TCPA 4FA2A 3QCSA 5A14A 4FSZA 2XAMA 3GCUA 4FT5A 4PDSA 4EJ7A 4GK3A 2G9XA 4QPSA 3ZRMA 3LHJA 3CXWA 2XIRA 1OMWA 5C27A 3BE9A 3C4ZA 2WKMA 3VS1A 3JYAA 1PXNA 4JDJA 5FM3A 3RCJA 3PPZA 3VO3A 2X9EA 3FYKX 3CR0A 4DG3E 5JGAA 4DHIB 2R3KA 5ANIA 3VJOA 3A7IA 4FSRA 3ZSIA 2XYNA 2CCHA 4IWDA 3UZPA 3GFWA 3QKKA 4C02A 4NT4A 5BNJA 4HZSA 3VC4A 4YLKA 4IH8A 4YHJA 4FNXA 5DI1A 3ACJA 4YTHA 4L6QA 2CGXA 3LQ3A 3R7UA 5HE1A 4M97A 3VBWA 3LVPA 3VS2A 5BVNA 4G9RA 4IFGA 3QA8A 5C01A 2PMIA 4YJRA 3HKOA 2VWWA 4FZDB 4EORA 3FI8A 3E8DA 5HNGA 5AUTA 4C37A 4G17A 4EOPA 5CF8A 2C68A 3MPMA 2JKKA 4FTUA 3WF5A 4BDCA 1M2RA 2XBAA 3BL9A 3AKKA 3AKJA 3K54A 2Z60A 1U46A 5AUWA 5GZAA 4Q9ZA 1JNKA 3PXRA 5CSVA 1H24A 1UNGA 4U3YA 3MVLA 2X7OA 4BCMA 2IW8A 2RFNA 2CKQA 5LVNA 3ZS5A 5L2SA 3D83A 2XKDA 5L6PA 3F5GA 1F0QA 4BBMA 2ITUA 4MQ2A 2UV2A 2XK9A 4X3FA 1NVRA 2GFSA 5LWNA 5CAUA 2AC5A 3RP9A 4FKQA 2JDVA 4QO9A 4HGLA 5HLNA 4D9UA 4XHKB 1PMVA 3WE8A 4R8QA 4ARKA 3QUPA 2IZUA 2J0JA 4I41A 4H1JA 4YZDA 4ZS0A 4GFMA 2QR7A 2QURA 4TZRA 3UNJA 4DFBA 4RJ3A 3DXNA 3BWFA 4M69B 3WF7A 3FQHA 3PP0A 4EH4A 4IDVA 2QC6A 3CQWA 3D4QA 4X3FB 3FXZA 4EONA 1PXMA 2C0IA 3SXRA 4F64A 5EOLA 3W0QA 4XEYA 4O4DA 3FL5A 3QAME 3PRIA 3GEQA 3R1QA 3R73A 5CTPA 4DGMA 3ZLSA 2C1BA 2YERA 3IPHA 3COKA 4OUCA 4F4PA 1XKKA 3MVMA 2B9JA 4HZRA 4RC4A 2CKOA 4O6EA 3NIEA 4WRSA 3V01A 4PMPA 4GT4A 1TQIA 1BMKA 2PVHA 3OTUA 1YWVA 4UB7A 3TUBA 5EQEA 3TUDA 1KV1A 2UZDA 4OTRA 5DN3A 2BROA 2BDFA 2YLFA 4XG9A 1XR1A 1PW2A 3KXHA 4II5A 4DCEA 4A06A 2Y7JA 2XIKA 4WKQA 2YCQA 2W4JA 3OCBA 4DFUA 2PZYA 1BI8A 4NZWB 3RNIA 2QO7A 2R0IA 5HI2A 2UZLA 1YDTE 3MIAA 5CWZA 4D2SA 2BPMA 5DEYA 2WOUA 2B52A 3PJ8A 4AN9A 5KX8A 5EM6A 4BCPA 2W1EA 3UO6A 5CYIA 4U41A 2PVFA 1H00A 3DB8A 3JVSA 3MY5A 4G16A 3KY2A 5TF9A 3U9CA 4LM5A 5LOHA 1PXPA 1B6CB 3JY9A 3ORZA 4TYJA 5EKNA 1OPLA 3K3JA 1AQ1A 4CRLA 4O86A 2WO6A 4TNDA 5J1WA 3CTQA 4C2WA 5AAFA 4TYHA 1H1RA 3OEFX 2WGJA 3F5PA 5L8JA 4E93A 2JBPA 4ZY4A 5ANKA 2GS7A 4FSNA 4EOIA 1OKWA 4GT5A 3LXLA 5CF4A 3HMPA 3SXSA 2E9UA 3OWPA 3HA6A 2Q83A 4FBXA 3QQGA 4K8AA 1H1SA 5CAQA 5J1VA 3KVXA 4ITHA 5CX9A 3O51A 4TYHB 3RHXA 3POZA 3ZO1A 2OF2A 4YNOA 5HO7A 3UC3A 3NEWA 4AACA 2ITYA 2GU8A 4MHAA 1YWRA 5EW8A 2QHMA 2CNVA 3POOA 5LVPA 1H8FA 3ATTA 4LGGA 4C59A 2XIYA 3Q04A 4QRCA 1Y8YA 5D41A 4AFEA 4OAUC 3D5VA 4E7WA 4NFNA 5F4NA 3BGPA 2IJMA 2XJ0A 4C3PA 4EHEA 2CMWA 3NW7A 5H9BA 4C8BA 3BU5A 3QRTA 3DV3A 3MFUA 2PZ5A 2YLEA 3F9NA 2JD5A 4MXXA 3CY2A 4RIYA 5HD7A 4H1MA 4BKYA 1NY3A 5C4KA 5TKDA 3ZLYA 4BCFA 4QPMA 4EK5A 1WVWA 2ITOA 3IGGA 1KE9A 1Z57A 4FEXA 4MBIA 5JQ8A 2VTQA 3DBQA 3DK3A 2GNGA 2Y0AA 4M8TA 4MAOA 3THBA 3V8WA 4DC2A 5KCVA 2O3PA 3FQEA 3PXQA 4I6QA 5IH5A 2HZ0A 2ZMDA 3LJ2A 3A60A 5IUHA 2VTRA 4S33A 3WYXA 5IUGA 1WZYA 5AV2A 2I0VA 4FNYA 4CFMA 4RIYB 3U6HA 3GQLA 1FMOE 3DLSA 1KSWA 4LFIA 5EDRA 2PVRA 5HORA 3VUTA 3P1AA 4AF3A 3GC7A 3ORNA 2PE0A 4HCUA 4KINA 3CJGA 4GT3A 4J95A 4KKGA 5IH6A 1UWHA 2XRWA 4B99A 4X21A 3AT3A 1MQBA 4UWYA 3UPXA 1YHSA 3N51A 4AXFA 5HTCA 2HZIA 5DGZA 4DGLC 1JAMA 3QRUA 4F65A 4YURA 5AA9A 2VGOA 5EQYA 2HK5A 5FRIA 4CQGA 1R0EA 3MWUA 3CQEA 1FQ1B 3LMGA 2CJMA 1U5RA 5K9IA 3A7FA 5DWRA 3M11A 3UVRA 4CFVA 4QP2A 3E8EA 4BI0A 3DKOA 4W8EA 3F2AA 4RLLA 4O7TA 3I81A 4ZJVA 3PFQA 1QPJA 3HMIA 3LMIA 2XK3A 3R8UA 3SW7A 3HMMA 5EI6A 3NFFB 1ZYSA 3GOPA 1GIHA 4XG3A 4UMPA 3PDTA 3G6GA 2JITA 4FF8A 5GIPE 2PZPA 4FSTA 5E1EA 4FUYA 4ZK5A 3EIDA 2B55A 2RG6A 5BVOA 3UO5A 2QU5A 2OO8X 1O9UA 3I7BA 1K3AA 4JQEA 3U87A 4U79A 4AZFA 3EQGA 4IMYA 1IR3A 4PMSA 3SAYA 3FI3A 4XV1A 2VTLA 1QPDA 3TT0A 3N4TA 4PNIA 1UU9A 4FNZA 1Q4LA 4BGQA 3DY7A 3MV5A 5E4HA 2HXQA 3LFSA 3MSSA 4LL0A 4W4YA 5AR5A 2F2CB 2C6KA 2VTIA 1VYWA 3IGOA 3NYXA 4KRDA 3MH2A 4BZOA 4EK6A 4O83A 1GZOA 2E9VA 3L1SA 4C35A 3FZRA 3V8SA 3IW8A 4C3FA 4HYIA 1U5QA 2XS0A 3HRBA 4XP2A 3B8QA 3LE6A 3ZYAA 4EYJA 5FXRA 3ATSA 4Y95A 3S95A 4FG8A 3GT8A 3RAWA 2R3PA 1VJYA 3EN6A 5H2UA 3NYNA 4HPTE 5IA4A 3RWQA 2G1TA 5EFQA 4B8LA 4FT0A 4M3QA 3QZGA 2OZOA 1M2QA 3LJ0A 4MXOA 3C4WA 3KMMA 1NT2A 2UW7A 4FSWA 4ASZA 4J8MA 4K2RA 4LRKA 3BL7A 4F78A 4AT3A 3UP7A 4LRJA 2KTYA 3R63A 4IVAA 4IBMA 1IG1A 4QTDA 2Z7LA 1KE5A 4ANNA 4DBXA 3PWYA 4FK3A 2Y4PA 4X2NA 2WMRA 4D4VA 3BIZA 3PLAE 1PY5A 2ZM3A 3Q5ZA 4BICA 2WQEA 3MTLA 2R0UA 2C0TA 2W1GA 5J9YA 4TRLA 2BRNA 4UEUA 2JIUA 4USDA 5IA0A 4CKRA 2VWXA 4HNFA 2QI8A 4ZTSA 4FR4A 5E8YA 4ACGA 3MESA 3EB0A 3L8VA 3DXPA 1BL6A 3VUKA 3GOKA 4IVCA 4BYIA 4CG9A 1BLXA 3TN8A 2R3GA 2W5AA 5JMSA 5JFXA 1FPUA 4L01A 4RT7A 4X2KA 4U43A 5E92A 4EQMA 4F09A 3SG9A 2C6EA 3K5VA 4MD9E 2R3JA 2ZM4A 2R3MA 2VTSA 3HP2A 3VS3A 4KS7A 4AUAA 4FOBA 4MXCA 2QLUA 4FKLA 3R9OA 4IHPA 3HZTA 2C47A 4LQMA 3TYKA 4DH7A 3CY3A 2CGUA 3Q9ZA 4TXCA 2YDKA 3A4PA 5EI2A 3H9RA 4JIAA 1IA9A 1W7HA 2I0YA 3D9VA 1H28A 4BY9E 3CPCA 2IPXA 2XJ2A 4R1YA 4PP9A 1P14A 3VHKA 5E8ZA 3HEGA 5DRBA 5HEZA 3KULA 2YFXA 4BIBA 3VNTA 4EEVA 3Q9YA 2WXVA 2V62A 2XK4A 3W18A 4XLVA 3FDNA 4EOMA 4ZY5A 1GJOA 1APME 1SMHA 4O4FA 3BEGA 3ITZA 3O7LD 5LMAA 4A9RA 3UZRA 4UMRA 4V01A 4V0GA 3WZJA 4C62A 3NYOA 3KULB 4QMUA 4H36A 1O6YA 3IW6A 4JX3A 4YP8A 4D4YA 3FLNC 1YXTA 3G5DA 3HDNA 4JRVA 3UPZA 3PIZA