2O8YA

Apo irak4 kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
278
Chain Sequence
FHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLLKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASVMSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Crystal structures of the apo and inhibited IRAK4 kinase domain
rcsb
source organism Homo sapiens
total genus 90
structure length 278
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2o8yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2o8yA01
5EW9A 3IDBA 3KCFA 4FV2A 3ZSHA 5IUIA 2ZM1A 2ITWA 4U44A 5BVFA 5FDXA 3JR1A 2YJRA 4EK4A 2IG7A 4U0IA 4O22A 4TYJA 5M56A 1YOJA 2Q83A 3DOGA 4BR3A 4PDSA 1QMZA 1U5QA 1QL6A 3EWHA 2O3PA 4RWJA 4EUUA 1Q8ZA 3R30A 4IBMA 4D28A 1YI3A 2BPMA 4HNFA 4HYSA 5E1SA 4PQNA 5FM2A 3TL8A 4OUCA 4ZJVA 3BKBA 4FKWA 4X7QA 3HYHA 4Y72A 2C1BA 4YC8A 3R9DA 2YEXA 4M66A 4FEUA 4BFMA 5AEPA 1PXMA 3LMIA 4USEA 2BIKB 4L43A 1QCFA 5CF8A 2VTIA 5CI7A 5E8VA 4EH7A 3FHIA 1PMVA 4QMSA 3IG7A 4XV2A 5AFVA 3CY2A 4WRSA 4UWYA 2WTCA 4XUFA 4XYFA 3HV5A 2HAKA 3BGQA 3QCYA 4E5AX 1XH6A 3OCSA 2UV2A 1QPEA 3A7HA 1PRYA 4HW7A 2J0IA 4L42A 1R1WA 4IZYA 4HCTA 5ICPA 3UO6A 3DFCB 4CKRA 2R0UA 4A4LA 4JX3A 3MJ2A 4C37A 3W8LA 4ZLOA 3SLSA 4FSQA 3VBWA 2J4ZA 2XIYA 5BUEA 3OF0A 2GFSA 3G9NA 4IWPA 1XHAA 1E1XA 5HG7A 3SGCA 1GOLA 3B2TA 3W10A 2GNJA 3IDPA 4O0RA 5AP6A 4G9RA 4ZY4A 4R77A 2OK1A 2AYPA 5ANDA 2PZIA 3R7YA 1YDRE 5A54A 3UC3A 5HCZA 3VF8A 2C5OA 3S00A 4YP8A 1ATPE 3OEZA 3QQUA 3G90X 4FT3A 3D5WA 4TXCA 2WIPA 3EYGA 2XJ1A 4QMLA 4UMQA 2BZHB 5HTBA 4JDIA 3MV5A 4BCJA 5CAPA 1OUKA 4Z55A 3Q3BA 4OTQA 3V8WA 2J0JA 3W32A 2PVJA 3CQEA 2WO6A 1M2QA 1ZWSA 1IAHA 4NM7A 2CNUA 2UZTA 4TL0A 4DF3A 1H0VA 5CVFA 3P7BA 3NX8A 4P5QA 2WMXA 1XR1A 1XQZA 4FT9A 4YC3A 3DU8A 5IDPA 4RQVA 2YFXA 3TWJA 4DFYA 3KFAA 5GINE 2UZVA 5C4KA 3MWUA 4M84A 2WMQA 1PYXA 4EZ5A 3HV4A 3FLNC 5FP5A 4B8LA 3HNGA 1UU9A 2YZLA 3QKMA 2YM8A 3FLQA 3PP1A 3LFDA 5AUTA 4LOQA 3NCGA 3PY0A 5JGBA 4X3JA 2R3NA 3L9PA 2BCJA 3DJ7A 4K77A 4C02A 4UMUA 3VWAA 4OLIA 4FYOA 2GNIA 3MYGA 5HG9A 3VNTA 3DB8A 1FOTA 2BUJA 2OBJA 4DN5A 3BHYA 5DOSA 2HENA 1CKPA 2ZB1A 4FV4A 4IZ7A 5IA1A 3DDQA 5H2UA 1YI6A 3QRJA 3ID6C 5E91A 2B54A 4WA9A 3ZFMA 4I5PA 3FI2A 2IW9A 3RVGA 1J7IA 1UU7A 2JGZA 2YDKA 3HAMA 2QQ7A 2I0EA 4MX9A 5FBOA 2CN8A 3O50A 3BHHA 2VWIA 3EFJA 2QHNA 3AMBA 3FMHA 4IZ5A 4P2KA 3ODYX 1ZYDA 2XB7A 3NNVA 3IW5A 2IVUA 3Q60A 5H8GA 3TN8A 1OL2A 4I5HA 4BGHA 4MWHA 2B53A 2KULA 1URWA 3EQPA 3OBGA 4U5JA 5CS6A 4OTHA 3IGOA 3H9OA 5LXMA 2YACA 5CSHA 5L3AA 4BC6A 2J50A 2B55A 5AV4A 3PA5A 2BKKA 2R3OA 3KK9A 3QTZA 3CY3A 5TO8A 2X0GA 3E8CA 4CNHA 1SM2A 4GK3A 3SXFA 5CU0A 2R3IA 4M3QA 5F95A 1H01A 2QKRA 5CI6A 1RDQE 3P08A 1XH7A 1KE5A 4N6YA 3DK3A 5GZ8A 4N70A 4BTJA 3AGLA 5CEIA 4RJ8A 4DHFA 1U46A 3EQRA 3GC9A 1O9UA 4D2SA 3D2KA 3NLBA 1H00A 4FTIA 4GIIA 4RJ4A 4D5KA 4FKLA 4MXYA 4DFBA 4IB1A 4RVTA 2OJIA 5HBHA 2YABA 2ZVAA 4O6EA 3ZDIA 4CMOA 3K5VA 4ZTMA 5KCVA 4QMOA 4C3FA 1ZMWA 2PVYA 4GG5A 3AC5A 2XCHA 2JD5A 4IACA 4YHJA 2F7ZE 5DYJA 1RE8A 1Z57A 5AX3A 4K8AA 1GZKA 5HE3A 4FTOA 2BDFA 3CTHA 3GC0A 1PYEA 3PPJA 3HA8A 4PL5A 3QHWA 4YGAA 3TIZA 4BKZA 4DEAA 1U4DA 1H25A 3R7EA 4ALUA 4YURA 4OAVB 3ETAA 4BKYA 5DEYA 2LAVA 3RGFA 2F7XE 5AUYA 1H1QA 3R7OA 4IWQA 4IAAA 3PSDA 3S0OA 2QOFA 4ZTHA 4RT7A 3NPCA 4FX3A 4RWKA 5IZFA 1HCKA 3L8SA 1OKWA 2JLDA 5DLSA 2NNWB 2CLXA 5EM5A 3CTQA 1MRYA 3BYVA 3O7LB 3ZM4A 4QQCA 2R0IA 2X9EA 2IW8A 1OM1A 1IEPA 4DFNA 4RSSA 2R3JA 3KRXA 1KE7A 5DT4A 4O7SA 5C4LA 1H8FA 2UW8A 3MB7A 1J7UA 3C0GA 3I79A 3NSZA 1UVRA 1ZZLA 3QBNA 5LOHA 3OT3A 4YTCA 2X6DA 3D5VA 4ASZA 3ZUTA 4FIGA 5IA2A 3CLYA 2QO9A 3KY2A 4ZS4A 4C33A 3A7FA 5AWMA 5HO6A 1OGUA 2P55A 4IFGA 4KS8A 4V0GA 4E6DA 4DITA 1B6CB 5HX8A 2HW6A 3I0QA 2XCKA 5GIPE 5AP0A 4G34A 3GBZA 3UJGA 3IOPA 3EB0A 2C3JA 3TKUA 4RZWA 3BCEA 2IVTA 4YTHA 5BVOA 4FEWA 3O71A 1BI7A 5AUXA 3HRBA 2IW6A 4FGBA 3IQ7A 2DWBA 3NIZA 4AF3A 5B2LA 5CF4A 4ZSLA 3SRVA 1S9JA 4IB0A 4FVRA 5AAGA 3MDYA 2ONLA 3C0IA 3UO5A 3GCPA 3PZHA 3RKBA 2BMCA 3A61A 2WTWA 4D55A 3DQXA 4NIFB 3FEGA 1DM2A 3DY7A 3BLHA 3ZBFA 5KMIA 4I6QA 4LUEA 3IO7A 4CFWA 5K9IA 3ACJA 4O0XA 3ORMA 3SW4A 4XV9A 3ZTXA 4AOTA 4CGAA 3FUPA 1ZY4A 3OG7A 4XNEA 4CFMA 4R1YA 3KC3A 2CGXA 4BYIA 4HVGA 3D9VA 3OHTA 4ASEA 3BLRA 5DRDA 3PJCA 3CPBA 2W5AA 4F9BA 5CU6A 1H07A 2Q0BA 1KWPA 2ZDUA 4ACHA 4GS6A 2WXVA 4DH8A 4H39A 4BCFA 3LFCA 2RFDA 4FTLA 4N0SA 1Q24A 1Q99A 4UWCA 4WO5A 5AV3A 5C27A 4C4EA 2VWZA 2YIXA 4B7TA 4Y73A 5FEEA 4EHZA 2C3LA 3O2MA 3QTUA 4X2GA 3LFQA 4PDYA 3TACA 2B4SB 3ATSA 4BCMA 4C2WA 2W5BA 3PXQA 3SQQA 3EQHA 5BVWA 3WF6A 4A4XA 2PYWA 4DCAA 3UMWA 5D7AA 3QGYA 3R8MA 4YNEA 4FV1A 5EQYA 3EN9A 3QLFA 2GHLA 4XG3A 4L00A 4YLJA 4LOPA 3UE4A 5CSPA 1IRKA 2ITXA 2BZIB 3PIYA 3ZCLA 2QOQA 4BCKA 1OL1A 3LIJA 2PU8A 2WHBA 3VW6A 5CX9A 5IQAA 2W5HA 4JG6A 1A06A 3VBQA 2FA2A 4QOXA 4CFNA 2H8HA 5ANJA 4GUEA 3QD0A 5KO1A 3NUYA 3AD6A 3A4PA 4TWNA 2V0DA 3L9MA 4FZ6A 4E8AA 5FG8A 4FTUA 5ANIA 5M06A 3BV2A 4ARKA 5HBEA 4ZEGA 2JDVA 4RWIA 2GTNA 1PXNA 2OF2A 4MNEA 4WIHA 3UQFA 2PE2A 4TT7A 3V6RA 1VZOA 4O0TA 2ACXA 3BE9A 3L9LA 4EOJA 3PJ2A 2VUWA 2XZSA 5ETAA 2NRUA 2Y9QA 3NYXA 2XKDA 3LZBA 2Z02A 4IHPA 5HGIA 3DBFA 4C3PA 4ANBA 3Q32A 3C51A 3BYUA 5DR2A 4AZVA 4F7NA 5B7VA 5M4IA 5CANA 2CGVA 1R3CA 5L8LA 1Y57A 4WNKA 5HOAA 4FTCA 1W84A 4DLJA 4HGSA 3AT4A 3CTJA 4IMYA 4ERKA 1PXPA 2R3KA 3G51A 3NAYA 4FKOA 4IB5A 4FBXA 1OZ1A 3QXPA 3TNWA 5J7HA 3UNKA 2QLUA 1GIJA 2F9GA 3OD6X 3FYJX 2X4FA 3PTGA 5CASA 3PLSA 3D7TB 5TKDA 1RJBA 1OUYA 3H9RA 3NZ0A 5TOZA 4RFZA 4EZ7A 2BHEA 3TDVA 3LAUA 4ZTSA 1JSTA 3MY0A 3S95A 4PMSA 4I0TA 5IEVA 2W99B 2OH4A 4PPAA 4RGJA 4KKEA 1IR3A 2PTKA 5DR9A 3ZFXA 1PXLA 3CC6A 3R2BA 4N57A 3QX2A 4H36A 3UZTA 1V0PA 1NW1A 3MSSA 3ZO3A 4O7YA 4NKAA 5BUIA 4OT5A 4U40A 4ACGA 3KULA 3QZGA 4RPVA 3ZRMA 4BN1A 3DXQA 2VAGA 1OL5A 4TZRA 3ULZA 4HYIA 4DGNA 2VTHA 4EHEA 4EOLA 4QMQA 5LMBA 5H8BA 3GT8A 4V01A 3GCVA 2ETKA 3P23A 2PVRA 4DCEA 4MXZA 4EOOA 5CAOA 5IA3A 3KEXA 3CBLA 4FEQA 2J9MA 2OICA 1JKKA 3EL7A 4FK3A 4CKJA 4R8QA 4J53A 4W8DA 3CJFA 2BDJA 4W4YA 3C4EA 4OR5A 5GJGA 2PE0A 1WBTA 1OPLA 1XBAA 3K3JA 4NFMA 1FQ1B 4B4LA 3RAWA 4D4SA 2W96B 4PNKA 4G16A 4ASXA 5AUUA 3TTIA 4F9AA 3OCBA 4FV9A 2WZJA 3Q4ZA 4EH4A 5KBRA 2PSQA 2O8YA 2OH0E 5B0XA 4F09A 4QMTA 4IVDA 2Y4PA 4WG3A 4PDPA 3KXZA 4U80A 4YZNA 4FKGA 4CG9A 4W9XA 1UU8A 3FY2A 4LGHA 3VS7A 1Q8WA 3EL8A 3ACKA 3KCKA 4R5YA 1JSVA 4XG4A 4JRNA 3LJ2A 2OWBA 2UW7A 4O2ZA 5TE0A 4CVAA 5HIEA 3V3VA 1Q8YA 5LCKA 4F7JA 3R02A 4HPUE 1NXKA 3COIA 3LM0A 2XH5A 5AMNA 2XJ0A 2QU5A 4CXAA 5FTQA 1NVQA 3NVKI 1W82A 4DA5A 4AUAA 2C1AA 3UPXA 3FAAA 3NNWA 2ZDTA 3QL8A 4PP9A 2X1NA 2PVNA 3I1AA 2QC6A 3LHJA 4IVAA 1OPJA 2ITVA 5DG5A 5BVEA 3R8ZA 4R3CA 4BDEA 3VBXA 4BDIA 3UQCA 1DAWA 1ZZ2A 2CKEA 4GVJA 3BWFA 4KSPA 3R7GA 2XBAA 5DHJA 3ZEWA 2XEYA 3GQLA 3IW6A 3ET7A 2WTDA 4F9WA 1FPUA 1ZMVA 3CD8A 2R3HA 4KIOA 2QVSE 3L8XA 3BYOA 4GYIA 3ZUUA 3W2PA 4KIKB 4PL3A 1OIYA 4YLKA 3GU7A 3NUXA 5KBQA 4GFOA 1EH4A 2WFYA 4MYGA 5CZIA 5A4CA 3HMPA 4C61A 4Y46A 2XNPA 3QD2B 3E8EA 3E64A 4IH8A 4GH2A 1U59A 3KRRA 3VAPA 4Z3VA 5CEPA 3RPSA 2IZSA 4RIYA 4ZXTA 1UA2A 2C5YA 4I6BA 2OLCA 5AP4A 4EH9A 3P4KA 3UZPA 4CV8A 4II5A 3FMLA 5M51A 5K4JA 5E90A 5IU2A 2WD1A 2PZ5A 1VEBA 4H3PA 3O17A 2VV9A 3QA0A 5DVRA 4D9TA 3WYYA 4RC2A 3TJDA 5HLNA 2V62A 2C6KA 3A4OX 4XG6A 4TWCA 1V0BA 4YPDA 4BGQA 4FODA 2CHLA 2X2MA 3IDCA 1M2PA 2H9VA 2VX1A 3BWJA 3SG9A 4AN9A 3PPKA 1OL6A 3LCTA 4FIJA 4QP6A 5ETIA 4D2TA 2XYUA 1P4FA 5I0BA 3I5ZA 1XH8A 1JLUE 2GNGA 3R0TA 3Q5ZA 4AS0A 4CV9A 2GNHA 3FL4A 3P78A 2I0YA 5J9YA 4AGDA 4N6ZA 4OAUC 3BBWA 4RFMA 5IUGA 1CMKE 3RALA 4K1BA 4FSYA 4MAOA 2F49A 2RFNA 2VTSA 3AMAA 4C8BA 5AX9A 5DI1A 3MB6A 4PP7A 2UW3A 4ASDA 4J71A 1Q8TA 1CTPE 4NU1A 4DT8A 2J6MA 3MN3A 5AUVA 4G1WA 4AOIA 1O6LA 2C0IA 2IO6A 4M15A 4AZTA 4CMUA 1E1VA 3VS1A 4BHNA 2UVZA 2ZB0A 4NWMA 4YJSA 4Y85A 2P4IA 4QTDA 3NNUA 3E88A 2BHHA 3U6JA 2JEDA 2PUIA 4YO6A 1T46A 3R71A 5HBJA 3A62A 3DKGA 3II5A 2P2HA 3Q9WA 4BWXA 5A4LA 3R9RA 1NVSA 5JZJA 3O0GA 4EWHA 5FTOA 3NYNA 5EW3A 2VTOA 2JDTA 3KRLA 4M7IA 5IQHA 2KTYA 2O0UA 4DEGA 5CY3A 3ZO2A 3PLAE 4CYJA 4OTFA 4UBAA 2HCKA 5DFPA 4DGMA 3WZEA 2XIRA 2C6TA 2RIOA 3A7JA 3BX5A 5LCJA 1OVEA 3ZXTA 4D9UA 3UO4A 3QUEA 3N9XA 3P7AA 3F3UA 3QZHA 1WVWA 2IJMA 3D5XA 3HP2A 3F9NA 3FC1X 1H1SA 1J3HA 5KNJA 2A0CX 3SVVA 2F4JA 3BU5A 4F64A 4XHKB 3FZOA 5F94A 4ORKA 4QP1A 2WQEA 4BBEA 4JS8A 2ITPA 3HV7A 4ANOA 4MCVA 3UOKA 4BDFA 5JT2A 4FKUA 2HK5A 5HVYA 1YXXA 2J5EA 5DEWA 3IW7A 5GIOE 3QKKA 4G6LA 4O2PA 2PMNX 5JN2A 4OTWA 4KBCA 5AA8A 4TRLA 3ZO4A 5D12A 3BU3A 3DFAA 1JQHA 2OXDA 1UKHA 1O6YA 2HELA 1LP4A 1NA7A 3CR0A 4FTKA 5IUHA 3D83A 2Q0NA 1GZ8A 2XS0A 3MFRA 4ITJA 2QU6A 4MD9E 4RIWA 5HCXA 4AU8A 2XK8A 3UIUA 5HLWA 4KS7A 3TZ9A 4CZYB 2PE1A 4K0YA 3GEQA 3R7VA 4FV6A 2I0VA 2X81A 4FSRA 3G6GA 2QODA 1J91A 3FLSA 3VO3A 4ZP5A 4UMRA 4LYNA 3A8XA 4EJ7A 3ZRKA 3WZJA 2BAKA 3ENHA 1A48A 3RK7A 4EOQA 4B0GA 2E9OA 3JUHA 4O27B 4YJQA 4M14A 4BDAA 4YJTA 3W2OA 5JGAA 5CEOA 4FOBA 2R64A 1OI9A 1FVVA 2H6DA 1MRVA 1X8BA 3EFKA 4FSNA 4D58A 5JZNA 3GNIB 5J79A 2V5QA 3R1YA 4CT1A 3DKFA 2W06A 3NDMA 1PXJA 2GQSA 2X2LA 3PXFA 4O83A 4N4SA 4ID7A 3FZPA 4O1PA 5L2IA 3ZMMA 3RAHA 3KA0A 3VUTA 4QMVA 3OVVA 4ZY5A 5AR3A 2B52A 2OG8A 4GW8A 4RLKA 2AUHA 3S1HA 2E2BA 3OP5A 1WMKA 3L8PA 4D1SA 3KXMA 2Y6OA 2FH9A 4C59A 4O84A 4DG2E 4LMUA 4TWOA 4L44A 1VR2A 3ZHPC 3G6HA 3NR9A 3W2CA 2ZAZA 4L6QA 3E62A 3VBTA 5LMKA 4ZSAA 5BQ0A 3DXNA 1UNLA 2C0TA 2JIIA 3O23A 4Y83A 4GU6A 3GP0A 2PK9A 2PWLA 3KF7A 2PZRA 5EHLA 2OO8X 2CGUA 2HZNA 2J90A 5DR6A 2GQRA 3Q52A 4EOIA 4EEVA 4OW8A 5J1VA 4TYHA 4NM3A 2W4JA 4DGOA 3F3WA 3TCPA 4EOMA 5IDNA 2HZIA 5CT7A 4R1VA 4EH2A 5HO8A 5HNIX 2YWVA 3DJ6A 4F65A 4P7EA 5I3RA 1ZYCA 4HGTA 2WAJA 3FJQE 4FKQA 2DQ7X 5FXSA 1ZARA 4CFFA 1SVGA 3MY5A 4IC7A 1V0OA 5KUPA 3OTVA 2FVDA 4QNYA 4RQKA 4V05A 3QUPA 3R63A 1YXVA 5E8WA 3TUBA 4Z16A 3DBDA 5HICA 3PDTA 1XBCA 5D7VA 3SXSA 5J9ZA 1BX6A 4TYGA 4GUBA 4NT4A 3F69A 3F3VA 1UNHA 2J0MB 3P79A 4LM5A 4K33A 4M0YA 1PMEA 4EL9A 1IA8A 1FVRA 3H10A 1UWJA 3I81A 3LXKA 3PRIA 4JXFA 4RIXB 4IEBA 1W8CA 3I6UA 5F4NA 1LR4A 5A9UA 4AN3A 2Z60A 5DA3A 3RI1A 4FG9A 4FV7A 3D2IA 1WBSA 4C4JA 4HNIA 1IA9A 4LMNA 3HMOA 2W1EA 2VTRA 2OU7A 3D94A 3KKVA 1U54A 4F08A 3UODA 3OCTA 4CFUA 5K0KA 1QPJA 3Q04A 5D41A 5ACKA 3F66A 1AQ1A 2HY0A 3C5UA 4GT5A 2JBPA 3EQGA 4I3ZA 2GQGA 3ROCA 3W2QA 3OXTA 4D0XA 3OWPA 3MESA 1P2AA 3GOKA 4CD0A 4GJ3A 4ANNA 2QOLA 4FZ7A 4W4XA 5J95A 3DXPA 2C68A 2F7EE 3GOPA 5GJDA 2GNLA 3EN4A 2RSVA 1SMHA 5K5NA 5LARA 3MY1A 4BI2A 5CSWA 4E3CA 3BGPA 4GV1A 1Y8GA 1GAGA 4EOPA 4FKVA 1KE6A 3D0EA 3P1AA 4A4OA 5E9EA 5TT7A 4RVMA 2LGCA 4UZHA 2YM5A 4FL2A 3UVPA 1DI8A 2GU8A 4U79A 4QTCA 3K2LA 3VS5A 3C1XA 5DRBA 3KU2A 3QRKA 5K5XA 4DT9A 3C4WA 3UBDA 5L2SA 3FZRA 3QXOA 1XJDA 4FTMA 4Y8DA 2HW7A 4QYEA 5JRSA 5CWZA 4S2ZA 4FSWA 3QFVA 2P33A 3E3PA 3I60A 3KRWA 3DAKA 4I0RA 4CQEA 2NPQA 1YXTA 3ANQA 2OGVA 3HUBA 1SVHA 4KD1A 2GTMA 1AGWA 2VTJA 3NS9A 4KWPA 1PKGA 3CEKA 3LCSA 1G8SA 4JBOA 3WZKA 1H1PA 2GSFA 3FZSA 3MH1A 3BU6A 4GL9A 4KKGA 4K2RA 3VN9A 2R9SA 4KRDA 3OT8A 3HMIA 3COKA 2HZ4A 4IX5A 3OCGA 4H1JA 3MPTA 3OOGA 4RC4A 3RM7A 3NW5A 5GHVA 1VYWA 4LOOA 3DDPA 2V55A 5LVLA 2XJ2A 3D4QA 2OZAB 2FGIA 1R78A 4XG9A 4AQCA 4BDHA 2IZRA 4UWBA 3R83A 1FGIA 4Q9ZA 4O0VA 3MVLA 5JRQA 2OFUA 4J52A 4E5WA 3G33A 1JPAA 1YWRA 3GCSA 3TDWA 4FSZA 3A2CA 4PMPA 4ZZMA 3ZLXA 3POOA 2Y4IB 4BICA 1CKIA 3ZC6A 4DTKA 4FTAA 5HG8A 2FUMA 1NT2A 3T9TA 4NJ3A 3VUGA 4KUJA 4DTBA 3LOKA 4PMTA 3TI1A 2UZWE 3NGAA 1OKZA 4KBKA 2NP8A 3MGYA 5E8ZA 4JDJA 3E5AA 4XOYA 4RZVA 3VRYA 1DAYA 4DBXA 2FYSA 3K5UA 4EKLA 4F6WA 3SDJA 4U43A 3GU4A 3QQFA 3A7IA 5CNOA 5HKMA 3WZDA 4DTAA 3FYKX 4MBIA 4UB7A 1RQQA 4F99A 2PUUA 4AFEA 4OTDA 4TTHB 1LPUA 2R5TA 3IW8A 2OJJA 5EDQA 5EW8A 4ZTNA 3Q6UA 3CGOA 3TKIA 3V6SA 2RFEA 4E4XA 4XOZA 3C13A 3NMUF 5EQPA 4U81A 3OROA 1VJYA 3W33A 4D1XA 4CMTA 3QTWA 3LM5A 4EK3A 4EYJA 4G3FA 3HVCA 2XM8A 1R39A 3QTQA 1J1CA 4FF8A 4M69A 4QMPA 5HE0A 4CFXA 3BQRA 2EXEA 3IONA 2HWPA 4YJRA 5H3QA 2XRUA 2ZM4A 4CYIA 2XM9A 4CZUA 5M4FA 4RA4A 5EG3A 4W8EA 3OWLA 4BL1A 3BGZA 4BDKA 3CKXA 3U8WA 5HU3A 2WMSA 2XK9A 5ANGA 5JH6A 3BQCA 1R0EA 4DINA 5FLFA 2R3GA 5HIDA 4ONAA 2F2UA 1JBPE 3KMWA 4DAWA 3PSBA 2CKQA 1DS5A 3C4ZA 4UY9A 4QYYA 4QMZA 3LXLA 4YJOA 3ZC5A 2X8EA 2R3QA 2WU6A 4FTTA 4NM5A 3ZH8A 4XP2A 4LL5A 5EI8A 4CLJA 4IVCA 3ELJA 4EH3A 5CEMA 4MEDA 4G5JA 5HE1A 3R1NA 5JMSA 3IPHA 4JNWA 3MIYA 5FQDC 3RAIA 4U45A 2VWYA 3ORTA 1CDKA 2B1PA 3OS3A 2PZPA 5I9ZA 4DH7A 4BBFA 4NW5A 3KN5A 3QQGA 4G17A 3DS6A 5KMMA 3MW1A 4A7CA 3KL8A 2FB8A 5HG5A 3K54A 4E6CA 2ZYBA 4G2FA 2BAJA 2ITUA 4H3BA 2C3KA 4IQ6A 3M11A 4D5HA 4F9YA 2C6LA 3AC3A 3RTPA 5HNGA 2VWXA 4HCVA 3WILA 4BCOA 4O7LA 3QQJA 2W0JA 5H8EA 3UIXA 1JOWB 5HD7A 5DWRA 2YIRA 4BY9E 4MXXA 3UDBA 3DAJA 4WNOA 3U6HA 2HYYA 4E1ZA 3SA0A 1SYKA 4HPTE 1URCA 2XBJA 3FMDA 1NVRA 3LFSA 3Q9XA 3PFQA 4EONA 4YHFA 5JFXA 4IB3A 4R6VA 4H05A 3KQ7A 2X7OA 3O8TA 5A46A 3RPOA 4HZSA 5EDRA 3AD5A 4DYMA 2O65A 4KINA 4RWLA 4ANMA 2C5VA 3PUPA 3R9NA 1G3NA 2J0KA 3ORKA 1LEZA 1P14A 1KV2A 3UOJA 1SVEA 4R3PA 5IF1A 4FL1A 2A4LA 5C03A 3WYXA 2Z8CA 5A6OA 5M4CA 2V7AA 1REJA 4IE9A 5DNRA 5E4HA 4GKIA 4E7WA 3FWQA 4D2PA 4G5PA 3AC2A 3QCXA 3DCVA 4MD7E 5KX8A 1PMNA 1OKYA 5CEKA 3FXWA 2A19B 2QOOA 4C2VA 4S32A 1M2RA 2JKQA 2CCIA 2OF4A 4DEEA 1IAJA 4WUAA 1Z5MA 4KNBA 2CKOA 4F70A 3A60A 3FQHA 1OIRA 1OPKA 4WKQA 5EH0A 3D7ZA 3ZZWA 4BDDA 4XLIA 1OMWA 5KMOA 3PWDA 4E4MA 3JVSA 3R00A 4I41A 3I0OA 4GMYA 2EVAA 2WOUA 4IJPA 5IA4A 4FEVA 4O6LA 4ANSA 1GZNA 2IPXA 5BPYA 5C01A 2ZOQA 3HUCA 2ESMA 3Q2MA 1H26A 4FZFB 4IXPA 5HVJA 2P0CA 3TNHA 4WRGA 2XF0A 4AG8A 3BHTA 3L1SA 3A99A 3PSCA 2GCDA 5D10A 3WF5A 2VD5A 2I7QA 4KSQA 2PVKA 3F6XA 3HRCA 4X2KA 2UZBA 4DC2A 4FKRA 2XNNA 2C5XA 1IG1A 2XA4A 4FL3A 5AR8A 3UP2A 2VGPA 3H3CA 3WI6A 2C6EA 4EHVA 1Q62A 5KMNA 1B38A 4NM0A 1Q3DA 4RJ3A 1PXKA 3B8RA 3C4FA 2CPKE 4MVFA 3R7IA 5IPJA 4JT3A 3UC4A 2PUNA 5AM6A 4EQUA 2XUUA 4I6FA 3VUDA 2OKRA 3VW8A 1H24A 4O0SA 5FXRA 4ACMA 3LFEA 5AV2A 3SOAA 1GNGA 3HV3A 4G3GA 3ROYA 5LVNA 3OOMA 4FEXA 2EXMA 4J1RA 2YCQA 2AC3A 2YZAA 4CT2A 5AIKA 4ZOGA 1QPDA 1STCE 4BDJA 4C35A 3VUIA 2CLQA 2OI4X 5F1ZA 3VRZA 5A6NA 2R3RA 3HLLA 2BKZA 3PXZA 3RNYA 5AR2A 3R01A 4RG0A 1OB3A 3LLTA 3QC9A 3UG2A 1NY3A 3JVRA 3QX4A 4TNDA 5GZAA 5BUJA 2EU9A 4IZAA 1CM8A 2CGWA 4C38A 2BALA 2IWIA 5BVKA 3AG9A 3U87A 2YITA 3C9WA 3NCZA 2J0LA 4YBJA 3MJ1A 4XH6A 3HAVA 2G9XA 2E9UA 5KHWA 3QCSA 3ZLSA 4X3FA 3P86A 4JDHA 2Z7SA 3BZ3A 5ANEA 3FXZA 3S4QA 3SV0A 1GIIA 5L8KA 1M17A 4FNYA 3BBTB 3BLQA 5D1JA 3ORPA 2W17A 2PPQA 2HXLA 3D5UA 4D1ZA 2W1FA 2OIDA 4L01A 3G0FA 3CJGA 3HEGA 4Z7HA 4E26A 3EN5A 4FE2A 1Y91A 2IVSA 4ENYA 4YMJA 4O86A 2ONLC 1M7NA 2YM7A 3BEGA 5JGDA 5L4QA 2JAVA 2UZDA 1JKTA 2VTTA 4NKSA 4HVIA 4CCUA 4WHZA 3PY3A 5FRIA 3H0ZA 2H96A 3DK7A 4NFNA 3ZU7A 2EXCX 4NW6A 4FTQA 5IQIA 1OL7A 4A06A 4AW5A 2XNBA 2XIKA 5EQEA 4IANA 3RK5A 3R28A 3OZ6A 2WU7A 5JFVA 2HXQA 3BHVA 3BRBA 3ITZA 4RX9A 4X21A 4ANQA 1KOAA 2ZV8A 4QD6A 4UYNA 5CEQA 5CVHA 3SC1A 4QMNA 5BX0A 3COHA 4IJ9A 3VC4A 4AGUA 4QP2A 4BWPA 3BYMA 3I5NA 4JIAA 3NRMA 3ORXA 2PMLX 2GHMA 4AZFA 5KKRC 1YHWA 3DBEA 4XLVA 4DEDA 2BRHA 2JIUA 3T3VA 2FSOX 3QF9A 1PY5A 4TKSA 4C4IA 1KOBA 4ZMEA 2C5NA 2QLQA 4RVLA 2C6MA 4X2FA 1YXUA 3EJ1A 4D4VA 1KV1A 2G2FA 3QRIA 1YWVA 3FY0A 4FC0A 4JX7A 4RFYA 4WNPA 5T6KA 3QTXA 3EH9A 1AD5A 3OEFX 4S30A 4EOSA 3DV3A 4I0SA 3RWQA 3DJ5A 2IZTA 4C62A 4QMMA 4QTAA 4I4EA 4CG8A 1I09A 5HLPA 4G6OA 1WCCA 4AGCA 5DBXA 5EM6A 4UN0C 2HWOA 1H4LA 3OY3A 4RJ7A 4CTCA 4E73A 5JKGA 3OWJA 4BCGA 1XWSA 4HGLA 4HZRA 3IK3A 4FMQA 2CKPA 2ZJWA 4JG8A 3LPBA 4YBKA 3U4UA 4AT3A 4DH3A 4XG7A 5FTGA 4CTBA 1Y6AA 2VU3A 5E92A 4EK5A 3UNZA 4MBJA 4XBRA 5AR5A 4WD5A 4XRLA 4QYGA 4DFLA 4KIQA 2C4GA 3QZFA 2YAAA 4IX3A 2JKOA 1JVPP 1E9HA 4G3CA 4AT5A 3LKMA 4I5CA 5IMEA 3UIMA 3GB2A 4EH8A 3I6WA 3NYVA 3COMA 4OTPA 4BGGA 2GFCA 3S3IA 4FGRA 4X6QC 2VTLA 4E5BA 4I94A 4DEIA 4IAIA 5AAFA 4O7RA 2VZ6A 2UZOA 3HRFA 2OIBA 3JY9A 5HQ0A 5BYLA 1WVXA 1U5RA 1F0QA 3WBLA 3EZRA 5CU2A 5EM8A 3MFUA 5KMJA 3RCDA 2ZMDA 5CZHA 2PL0A 2BAQA 2IVVA 5LMAA 4M69B 4OTIA 5CALA 2YWPA 4EQCA 3CGFA 4LQMA 4X3FC 5ANOA 5M53A 5A4TA 5JSMA 3C50A 2V22A 4NTTA 5FGKA 4YLLA 4WUNA 4W4WA 5G1XA 2BFYA 4FV5A 1W98A 4QMWA 3PVBA 3GGFA 2VO7A 1FBNA 4O7VA 1BL6A 2RKUA 3ZYAA 5M57A 1OIQA 4O7NA 3DB6A 3PG3A 4F1OA 5M4UA 3FPMA 3E87A 2OSCA 3QD4A 5AP1A 5C8KA 3NUAA 4O7TA 4I92A 3RBWA 5T3QA 3AMYA 4C36A 2J51A 3A8WA 2OIQA 4KRCA 3LLAA 4RA5A 4BCQA 3PXRA 3SW7A 3PVGA 3TIYA 4E6QA 1YWNA 2YDIA 4DBNA 2ZV7A 4ZY6A 3EYHA 4BCPA 4HCUA 4IDVA 2J7TA 2QURA 3NYOA 5HTIA 3WIKA 2HOGA 3F61A 3FBVA 1B39A 1KE9A 2XNGA 3SOCA 4FT0A 4V0GB 3HGKA 5HEZA 3VUMA 4DLIA 3PVUA 4FKPA 4M8TA 4ALWA 3FKLA 1UU3A 4O38A 1SNUA 3G0EA 4KIPA 4FA2A 4ZLZA 4JAIA 3RZFA 4NCTA 3E93A 3EKNA 2JBOA 4FKIA 5AUZA 3UVQA 3QU0A 4X0MA 4RRVA 3NAXA 5CVGA 1GIHA 3ZZEA 4APCA 2BROA 5L2WA 4IFCA 1BL7A 4Q2AA 2BR1A 3SRVB 2RG6A 4PPCA 5BVNA 4R5SA 3E8NA 1WZYA 4JL9A 4L8MA 4ZZNA 4EBWA 4QYFA 4OT6A 5CSVA 5J9LA 5J7BA 3FI3A 3FMJA 5EI6A 4FZAB 4UXQA 2BRGA 4C3RA 3LQ3A 3PE1A 4JBVA 3L8VA 2W1HA 3CS9A 2ERKA 3B2WA 2W1ZA 5EI2A 5BMSA 2BFXA 4EK8A 3P7CA 5JK3A 3ZSGA 5CAUA 1JKLA 4GK2A 3GFEA 2CJMA 4BTFA 5TF9A 5JQ5A 2V7OA 5AAEA 4EOKA 2EB3A 2UW5A 3IKAA 3ATTA 3PVWA 4UALA 4FVPA 1UV5A 2BIYA 3FL5A 2QR7A 3WOWA 5DT0A 3UIBA 3EMGA 3NUPA 5KKRB 4BTMA 2HY81 4CEGA 3HX4A 4CCBA 4ZK5A 5DT3A 1YDSE 1WBWA 4ZSGA 3HZTA 4PDOA 2B0QA 2P3GX 1CSNA 1M14A 1H1WA 1W83A 2YLFA 2YM4A 4M97A 4QMUA 3ZRLA 4AXAA 4BIEA 4QNAA 3ALOA 4QTEA 2CNQA 2FSMX 3OC1A 3QAME 3ZM9A 4XEYA 5C1QB 2W1CA 3KVXA 4FYNA 3TG1A 4JQEA 4FIEA 3WARA 3LCOA 1OITA 5M08A 4MTAA 3R21A 4I20A 5AIRA 4BIBA 3H30A 3N4VA 4GYGA 5LWNA 4LFIA 3FSKA 5C9CA 4HVDA 3S2PA 3LXNA 4QMXA 5FWKK 4KKHA 5AP5A 2EUFB 2BTRA 4DGLC 3LXPA 3ORLA 4CSVA 3AOXA 4FKSA 1BLXA 1XH9A 4YSJA 3AC4A 4TY1A 5I9YA 3KGAA 3R2YA 4K9YA 5ITAA 3LFBA 2BRNA 4FICA 2YA9A 4EI4A 3KB7A 4NZWB 2XKEA 2W4OA 2A2AA 3TV6A 2BZJA 2XKCA 4NIFA 3F5GA 4BYJA 3U54A 3UZRA 4RIOA 4UMPA 2YM3A 3RM6A 2Y8OA 4W9WA 5K3YA 2X8DA 4FOCA 3TKHA 4BWKA 2YISA 3WF7A 2QOCA 4FSMA 4ZLYA 4UZDA 4MNEB 5EHYA 1G5SA 2E9PA 3RPVA 5IQDA 2A27A 4HGEA 5AP7A 3VJNA 2R7BA 3GI3A 5K4IA 4TN6A 2RFSA 1TQMA 5FBNC 2YHVA 3EQCA 5CQUA 5DPVA 4H3QA 4HYHA 3GCUA 2WQNA 4FIFA 3WE8A 1YW2A 3TEIA 3OUNB 4FIIA 5KE0A 3I7BA 4QP9A 5I9XA 2GNFA 1PXOA 2YAKA 4WSYA 3OY1A 2E9VA 1YRPA 3NW6A 5A4QA 2UW6A 2Y7JA 3F5XA 3UVRA 4BI1A 5KMLA 3FMMA 4GU9A 5CF6A 2RGPA 5DE2A 1WBOA 3P9JA 4X3FB 4FIHA 3VUHA 3U55A 3PA3A 1PMUA 4ZJJA 4PF4A 4R78A 5IQEA 3FLWA 4HOKA 3V04A 3VJOA 4BB4A 4DEHA 3V5WA 1YI4A 5DH3A 3EQDA 4BDGA 2BRMA 1KE8A 2QOKA 3JPVA 4FI1A 4O82A 3V8SA 4AA5A 2JITA 3PA4A 4LGGA 4Y5QA 4F0IA 1YOLA 5ANKA 2P2IA 2X7FA 3CCNA 2W1IA 4L53A 4XP0A 5HD4A 2G15A 4U6RA 4YO4A 4I4FA 4UMTA 5AV0A 5L8JA 1IASA 5T68A 3KULB 5HORA 4IDTA 4M13A 3OXZA 1OIUA 3G5DA 2JIVA 2VTNA 3QKLA 4I1ZA 3THBA 4L3PA 3AC1A 2DYLA 3F7ZA 5BNJA 5AM7A 3Q5IA 1K2PA 4LV5A 4V04A 5AJQA 4APPA 1JSUA 2QOHA 1Y8YA 3ZUVA 3QD3A 4F6UA 4ZSEA 2FO0A 3FPQA 3TXOA 1V1KA 2C3IB 2R4BA 3AT3A 5EYKA 2WTIA 2W1GA 4LRKA 5CYIA 3FDNA 2Y0AA 4JLCA 3BPRA 4QP3A 4XP3A 2HIWA 5FEQA 4TWPA 4JQ8A 3DPKA 3GU8A 4AFJA 4KABA 4CFVA 1UKIA 4G3EA 3KXXA 3SX9A 4RJ6A 3Q9ZA 2QOBA 2G01A 3QALE 3VQHA 4K11A 3VS4A 4EC9A 1RW8A 4NL0A 2HZ0A 4OTGA 3M42A 4PTGA 4S33A 4ZTQA 5DGZA 2GPHA 3VQUA 3ZONA 4L68A 3FKNA 5BYZA 1LEWA 4BVUA 2WIHA 3ZBXA 3HDNA 3D7TA 4AT4A 4QQTA 5IQBA 4G31A 3E92A 4KBAA 4XMOA 4J96A 3VULA 2YLEA 2QKWB 3UPZA 4MXAA 3UYTA 2Y6MA 3D15A 4USDA 4K6ZA 4MQ1A 5CU4A 5CT0A 4GJ2A 2ITYA 5AV1A 3IECA 3VS2A 4MWIA 4Z7GA 4YTFA 4JOAA 4FZDB 5FUTA 4O1OA 5M55A 1ZY5A 1GJOA 4JBQA 1TQIA 3O7LD 2ZV9A 2YJSA 4FT5A 4XCUA 5AR4A 1XKKA 2B9JA 4LV8A 2GHGA 1L3RE 2O63A 5HVKA 5I4NA 3PIZA 5E1EA 5FD2A 1BUHA 3DT1A 4LI5A 3BV3A 4L3JA 5E8TA 2WMAA 1H08A 5B2KA 3U4WA 5EM7A 4DFUA 2JFMA 3GVUA 4WG4A 3TNPC 3TUCA 3NWWA 4M68A 4PY1A 4RIYB 4G9CA 4U41A 4EUTA 2R7IA 5L2TA 5L2QA 1Q4LA 1ZOGA 4JAJA 1GZOA 4M67A 2WPAA 2R3FA 3F2NA 3QWJA 5BMMA 2WTKC 3F5UA 5CU3A 5LMKC 2QG7A 2C69A 2YCSA 3D14A 3RHKA 4FKJA 4C0TA 4I5MA 3POZA 2EB2A 1WBNA 4FUXA 2YCRA 4F1MA 3EIDA 4MXOA 4HJOA 4U9AA 4YR8A 3UYSA 4HYUA 5TR6A 2XIXA 3MFSA 4JR3A 4EORA 4M12A 4G6NA 4Q5EA 3QC4A 1Q8UA 3LFNA 4A9YA 1I44A 1Q5KA 4I21A 4IM2A 4UYAA 2A1AB 4MF0A 4IWDA 4WBBB 4YNOA 5KZ0A 4M0ZA 2GMXA 4I22A 3MPMA 4S34A 4WT6A 4DG0E 3JY0A 5D9HA 3GENA 3QTSA 4QPSA 1F5QA 2VO0A 3GUBA 2IN6A 5ETCA 5AUWA 1FGKA 1ZOEA 3OUKA 5E8UA 2QCSA 4GT3A 4R7HA 4WSQA 4XBUA 1APME 2VX3A 3V5TA 1K9AA 2DUVA 3N51A 2PVFA 2WELA 3GXLA 1H27A 4QP4A 5IG1A 3CE3A 3FMNA 4C4GA 1Q41A 2VTQA 2VNYA 4IAFA 2ITQA 3JS2A 2WKMA 4BCHA 5I3OA 1A9UA 3EN7A 4FVQA 3EN6A 4IAYA 3OWKA 4XS2A 3T8OA 2YIWA 2VTMA 4C4HA 3RCJA 5IMXA 5IQGA 3W18A 1YDTE 3BE2A 4PPBA 3FQEA 1BI8A 3EQIA 4GK4A 4KIKA 1H28A 4Z9LA 4DFZE 3DLZA 2OFVA 3ZSIA 3VBVA 4J7BA 4ZSJA 2QO2A 3TNIA 3VVHA 1ZXEA 5I5ZA 1ZOHA 3EKKA 3BI6A 1XBBA 1MRUA 3F5PA 4EYMA 4YHTA 5IEXA 3IW4A 4L46A 3FE3A 3PE2A 3R8VA 5CAQA 4QT1A 3PXYA 4MNFA 4MH7A 5EDPA 2G1TA 4IM0A 4C7TA 3EZVA 3HECA 3MVJA 4O21A 4B9DA 4BCNA 2QONA 3UTOA 4JR7A 2ITZA 1BYGA 2Z2WA 3HMMA 4RLLA 3HP5A 4G3DA 3GC8A 1ZAOA 2PVLA 4ERWA 3ULIA 1YQJA 4A07A 5CSXA 4IWOA 2VX0A 4ITHA 5H9BA 4BRXA 3JXWA 4YJVA 2O64A 3ANRA 4CLIA 2VGOA 1MQBA 2X6EA 2X8IA 1W7HA 4C34A 4D2WA 3FKOA 3EQFA 3KXGA 2YN8A 3BYSA 3V51A 3FXXA 4DGGA 2YERA 4IAZA 4TW9A 5GNKA 2X9FA 2I40A 2I6LA 1FINA 3F88A 1OBDA 3RHXA 4FTRA 4NSTA 3SKCA 3LE6A 3OFMA 2G2IA 4P4CA 3AXWA 3VBYA 5A3XA 1OECA 4KA3A 1YHVA 4MQ2A 5LVPA 3W55A 3I7CA 4XV3A 3QRTA 1TVOA 4X2JA 5F20A 4RX5A 5D11A 3ZLYA 4E4LA 4U8ZA 2JDOA 4RIWB 2CDZA 4WBOA 3RPYA 3TT0A 2PVHA 3FLZA 3NUNA 3EHAA 3RZBA 3QLGA 3GU5A 4EBVA 3NVMB 1FMKA 2UUEA 1SNXA 3FSFA 5IA5A 3HL7A 3R73A 4OGRA 3MH3A 5C8MA 3TNQB 3N4TA 2XIZA 4AP7A 2VN9A 3P0MA 4J98A 4BZNA 3QQLA 1J7LA 4DFXE 1M52A 3ZFYA 3R8LA 4BHZA 5EOLA 3QQHA 4I93A 3VUKA 3NNXA 4FTNA 4GFMA 4L52A 4R3RA 4O81A 3ODZX 3OTUA 1P5EA 2CCHA 4TPTA 3F7WA 2UZNA 2QO7A 3FI8A 3GCQA 5AADA 4C4FA 4AAAA 2WMUA 3EOCA 3MPAA 2WQOA 3QRUA 4RX7A 3VS0A 4GKHA 2R3LA 2JC6A 1ZYLA 3DNDA 5ACBC 2VWBA 5J5TA 3TZ8A 4F63A 3O51A 3LMHA 1T45A 1WAKA 4GCJA 3LMGA 3QQKA 4XV1A 4AN2A 1G8AA 2C0OA 3DLSA 3FLYA 3DZOA 3FZ1A 5I9VA 3W16A 4AGWA 3N4UA 4IX6A 4AE6A 5AR7A 4QPAA 3U6IA 1PW2A 3UGCA 2XP2A 2AC5A 2VWUA 3LJ1A 4EH6A 4USFA 2GS2A 4GIHA 4AE9A 5CF5A 3GC7A 1W0XC 3BEAA 3I4BA 2J2IB 4AW1A 3F82A 3W1FA 4L7SA 3MA6A 4XG8A 4FG8A 4X6RA 4MXCA 2WTKB 2UZUE 2VTPA 1KSWA 3PWYA 2W05A 3AT2A 4ALVA 3H4JA 2C6OA 3NUSA 3QUDA 4AA0A 4QYHA 2OXYA 2C6DA 4F1TA 1SZMA 2W9FB 5EYDA 2NRYA 4IVBA 2X7GA 4BDCA 4O7WA 2QR8A 4HVHA 3C4CA 2QHMA 4E93A 4IADA 5F9EA 5LJJA 2WEIA 3QTIA 2RF9A 4TYHB 3M2WA 2W4KA 4ZTLA 4D2VA 5EKNA 5HX6A 1Z9XA 4C57A 4AZSA 5HO7A 3QZIA 3UOLA 4QQJA 1H1RA 4A9SA 4U3YA 3PYYA 4NK9A 3NW7A 2B9IA 3IOKA 5IISA 5LQFA 3F2RA 2JDSA 2WB8A 3C7QA 3VS6A 4I23A 3MTLA 4PX6A 3RWPA 3OW3A 3R7UA 5HZNA 4O0UA 5I9WA 3W2RA 4FSTA 4ZAUA 4L7FA 2VWWA 4BBMA 3DTWA 4NTSA 2JKKA 4ZJIA 4YPSA 4BIDA 4F0FA 4GVAA 1TQPA 2F57A 4JIKA 4XG2A 5FP6A 2XVDA 4EQMA 3U9CA 4QO9A 4EWQA 3R6XA 2PZYA 4FG7A 4U42A 3RAKA 3F2AA 3ZDUA 4A9TA 5A4EA 4H1MA 3P5KA 4ZTRA 3R9HA 1U54B 3E7VA 4O0WA 4EKKA 3ZOSA 5M44A 1WFCA 5EYMA 1TKIA 1XH4A 5FXQA 3HDMA 2PHKA 2FSLX 5GJFA 4UXLA 4W4VA 3M1SA 3ORNA 5IKWA 1FMOE 2WTVA 3PJ1A 3PPZA 3RK9A 3TTJA 4YUQA 5HU9A 3C0HA 1WVYA 4PL4A 5AP3A 1ND4A 4QRCA 4RVKA 4AOJA 3L9NA 5J87A 1L8TA 5C26A 3CPCA 3VF9A 2VWVA 2XK4A 2YM6A 3MIAA 4DEBA 3EFWA 4BZOA 4BZDA 3VIDA 2WQMA 2XEZA 3IGGA 4QP7A 2YCFA 3QHRA 2PMOX 3DGKA 5IQFA 3HA6A 4YJUA 3LJ0A 3FV8A 4O0YA 3IS5A 3O8PA 2XK3A 4OBPA 4GEOA 3W8QA 5E8YA 3KMMA 3MS9A 3MBLA 3FZTA 4X2NA 4GRBA 5EFQA 3RP9A 2REIA 3DK6A 5J8IA 3NUUA 2UZLA 2O5KA 3E3BX 5HI2A 3V5JA 4RJ5A 4FT7A 5AP2A 5L6WL 2PULA 3CP9A 4J8NA 5IQCA 3BIZA 2WMTA 2WQBA 3LFAA 2JFLA 4NUSA 4PUZA 2CN5A 2QI8A 2WMBA 3G9LX 3WF9A 1K3AA 2RG5A 3C5IA 2WGJA 4AZEA 1MQ4A 3DA6A 2SRCA 1CKJA 2VRXA 4LGDA 5JFSA 4F0GA 3E63A 3W2SA 4FR4A 4PRJA 5FM3A 5J1WA 4JDKA 3PZEA 4RIXA 3AQVA 4UV0A 3DKOA 4RBLA 4R7IA 3QWKA 3FHRA 3MVMA 2B9FA 5CLPA 1YXSA 3Q4TA 2R3MA 2QG5A 3QYZA 4ZS0A 2UW0A 2ITTA 3R8PA 3ERKA 4ANLA 3Q2JA 4ACDA 5LVMA 3TJCA 2ITOA 2PMIA 5EYCA 3WF8A 3LCKA 4DH1A 2R2PA 3QTRA 5JFWA 3AGMA 5HIBA 2EWAA 2VO6A 4YTIA 5LVOA 4CRSA 4F7SA 3GU6A 4Y5HA 4TYEA 1OBGA 3E8DA 4TNBA 3TM0A 1Q61A 3SD0A 5BYYA 3ZO1A 1PKDA 2R3PA 4YZDA 3EQBA 3QA8A 3GQIA 3MA3A 4JG7A 3RINA 5L6PA 3FMKA 3KVWA 1ZRZA 5E8XA 4LRJA 5EKOA 4FK6A 3CD3A 4F9CA 2UVYA 5J5SA 2WNTA 3ORZA 4WNMA 3MH2A 1XH5A 3RNIA 3RPRA 3V01A 2IZUA 5I9UA 3FMEA 3V5PA 3HKOA 4YJNA 2BDWA 3R04A 4XX9A 5IH5A 1HCLA 4FNZA 3R1QA 5AA9A 3LFFA 4QTBA 4C58A 3PJ8A 2UW4A 2XNEA 3VS3A 2ZMCA 3Q4CA 3KF4A 2XNMA 5JEBA 3DBQA 1DI9A 3R1SA 3QGWA 4H58A 3DBCA 1F3MC 1ZMUA 1BKXA 2PVMA 3KXHA 2BVAA 4I24A 4D0WA 4EHGA 2RL5A 4FSUA 4I6HA 3MFTA 3QYWA 4FNWA 4MF1A 3GFWA 2GS7A 3FI4A 1PXIA 4IC8A 3WE4A 3KMUA 2X39A 3LQ5A 1LUFA 2BTSA 4PMMA 3HV6A 3UQGA 3BHUA 3TZMA 4BI0A 4D4RA 2VNWA 4KB8A 2PUPA 2OXXA 3ENMA 5HTCA 3R22A 1MP8A 2G2HA 3F3TA 2ERZE 4FTJA 3Q9YA 1GY3A 2W1DA 2OZAA 2YIYA 4J8MA 3UNJA 2C47A 2FSTX 3TV4A 3B8QA 3CQUA 4J95A 4Y95A 3V5LA 4ZZOA 4MD8E 4D2RA 4L45A 2WMRA 3OW4A 4WG5A 4AZWA 5JQ8A 5DIAA 2C30A 5M07A 4U97A 2CSNA 2Z7LA 4ITIA 4U3ZA 3VHKA 4F7LA 4YSMA 1JAMA 2CMWA 3PXKA 4U7ZA 2NO3A 1ERKA 1PF8A 4JBPA 1UNGA 3UP7A 2JAMA 1JNKA 3LCDA 2WOTA 4BKJA 5FDPA 1Q3WA 4YZCA 1FVTA 4E20A 2XKFA 3CIKA 3NEWA 4FV3A 4QQ5A 3WIGA 1YHSA 4DG3E 2GS6A 3ALNA 2I0HA 2WMWA 4EC8A 4KAOA 2ETRA 4JJRA 4LRMA 2OZOA 4Q9SA 3BELA 4BDBA 5CNNA 3KXNA 4PNIA 3VHEA 3Q6WA 1BMKA 2XMYA 4MK0A 4YZBA 2XK6A 3V8TA 3U9NA 4BF2A 2ZV2A 1M7QA 5L6OA 2XRWA 2DS1A 3AC8A 4EJNA 5EOBA 5IEYA 4IIRA 2OJGA 3ZXZA 1JWHA 1QPCA 4GT4A 3UOHA 4UEUA 2WTJA 1H0WA 1PHKA 2Z7QA 2QD9A 4GFGA 4LUDA 2YDJA 4OBOA 5EHOA 4AW2A 2B7AA 4PV0A 3Q4UA 3PY1A 4YJPA 5FEDA 5HE2A 3DKCA 2OJ9A 2XK7A 3NIEA 2UZEA 3F3ZA 4PTCA 4J97A 4TYIA 5KMKA 2ETMA 4E4NA 3AD4A 4AACA 4J99A 3RJCA 5HESA 3DQWA 4YZ9A 5DMZA 1WBVA 4AWIA 4JQ7A 4CKIA 2W7XA 3ZS5A 3TZ7A 3REPA 4EZ3A 3MTFA 3CSVA 3SXRA 5E8SA 2WMVA 1REKA 5CENA 4LL0A 3KK8A 1R0PA 2QOIA 3PRFA 5IA0A 4A9UA 4YU2A 4ZIMA 3PP0A 1ZYSA 3UG1A 2ITNA 1YOMA 3O96A 2VO3A 3WZUA 3Q53A 2ZM3A 2BRBA 1YVJA 3LQ8A 5C8NA 1KUTA 2O2UA 2J5FA 2C6IA 1Q97A 2H34A 5KHXA 4R7BA 3SG8A 3T3UA 2UW9A 3R9OA 4B99A 3ORIA 3TV7A 4B8MA 2OW3A 1JKSA 2CNVA 2Z7RA 4O91A 4S31A 3OXIA 4QPMA 1VYZA 2UVXA 3H0YA 5ETFA 4F6SA 1YKRA 3CKWA 2YIQA 3MVHA 4DE4A 3LVPA 5CTPA 1MUOA 1ZYJA 3EFLA 2XYNA 4LG4A 5CXZA 4OBQA 4Q5HA 5IH4A 3QCQA 4BTKA 3PG1A 4DH5A 3ZEPA 3SAYA 4YZMA 4EH5A 4EK6A 5K0XA 4O7ZA 2I1MA 2BZKB 4JI9A 1Y6BA 4MHAA 4AA4A 4P5ZA 5BVDA 3KN6A 2QNJA 4BCIA 5GZ9A 4L67A 4MKCA 3E7OA 4AX8A 5CXHA 1XO2B 2WEVA 3H9FA 1PJKA 4IM3A 4P90A 5HHWA 3U51A 3Q96A 4CQGA 3K3IA 4FNXA 4GSBA 3OMVA 3MH0A 2JKMA 4PWNA 2W9ZB 1J1BA 2E9NA 2JDRA 2PY3A 4QP8A 5CQWA 5LWMA 5DN3A 4E6AA 5KZIA 1O6KA 4AW0A 3T9IA 4XRJA 4A9RA 4NYEA 4CRLA 4ENXA 5G6VA 2GDOA 3ZLWA 5E7RA 4F4PA 3G2FA 3LW0A 2BILB 3SHEA 4NJDA 2B9HA 5M09A 1OKVA 2XNOA 3O8UA 4XJ0A 4B6LA 4IW0A 2X2KA 1ZLTA 3OBJA 4D4YA 4K18A 4L9IA 4MBLA 4CZTA 3DZQA 3V5QA 4JVGA 3RMFA 5A14A 4OTRA 4IAKA 4NEUA 3CQWA 1HOWA 3G15A 3FC2A 4FV8A 4GG7A 5CAVA 3MI9A 4IX4A 3UMXA 4RX8A 4JRVA 4WOVA 3KREA 3KRJA 5B2MA 3A7GA 2Y4IC 4FKTA 3CXWA 3PIXA 3DTCA 4FUYA 2OJFE 4RC3A 3JYAA 4ACCA 1P4OA 4HVSA 1WBPA 3R8UA 4FV0A 4PTEA 4QMYA 4UX9A 4O96A 2F2CB 3HMNA 4L3LA 4ZMFA 3FQSA 5IH6A 5EK7A 3PJ3A 4NCTC 5HCYA 3DAEA 4RMZA 3C4XA 5HNBA 3TUDA 1UWHA 2VTAA 2X4ZA 4YC6A 3DNEA 1S9IA 4NH1A
chains in the Genus database with same CATH superfamily
5EW9A 3IDBA 3KCFA 4FV2A 3ZSHA 5IUIA 2ZM1A 2ITWA 4U44A 5BVFA 5FDXA 3JR1A 2YJRA 4EK4A 2IG7A 4U0IA 4O22A 4TYJA 5M56A 1YOJA 2Q83A 3DOGA 4BR3A 4DDGA 4PDSA 1QMZA 1U5QA 1QL6A 3EWHA 2O3PA 4RWJA 4EUUA 1Q8ZA 3R30A 4IBMA 4D28A 1YI3A 2BPMA 4HNFA 4HYSA 5E1SA 4PQNA 5FM2A 3TL8A 4OUCA 4ZJVA 3BKBA 4FKWA 4X7QA 3HYHA 4Y72A 2C1BA 4YC8A 3R9DA 2YEXA 4M66A 4FEUA 4BFMA 5AEPA 1PXMA 3LMIA 4USEA 2BIKB 4L43A 1QCFA 5CF8A 2VTIA 5CI7A 5E8VA 4EH7A 3FHIA 1PMVA 4QMSA 3IG7A 4XV2A 5AFVA 3CY2A 4WRSA 4UWYA 2WTCA 4XUFA 4XYFA 3HV5A 2HAKA 3BGQA 3QCYA 4E5AX 1XH6A 3OCSA 2UV2A 1QPEA 3A7HA 1PRYA 4HW7A 2J0IA 4L42A 1R1WA 4IZYA 4HCTA 5ICPA 3UO6A 3DFCB 4CKRA 2R0UA 4A4LA 4JX3A 3MJ2A 4C37A 3W8LA 4ZLOA 3SLSA 4FSQA 3VBWA 2J4ZA 2XIYA 5BUEA 1G8KA 3OF0A 2GFSA 3G9NA 4IWPA 1XHAA 1E1XA 5HG7A 3SGCA 1GOLA 3B2TA 3W10A 2GNJA 3IDPA 4O0RA 5AP6A 4G9RA 4ZY4A 4R77A 2OK1A 2AYPA 5ANDA 2PZIA 3R7YA 1YDRE 5A54A 3UC3A 5HCZA 3VF8A 2C5OA 3S00A 4YP8A 1ATPE 3OEZA 3QQUA 3G90X 4FT3A 3D5WA 4TXCA 2WIPA 3EYGA 2XJ1A 4QMLA 4UMQA 2BZHB 5HTBA 4AXCA 4JDIA 3MV5A 4BCJA 5CAPA 1OUKA 4Z55A 3Q3BA 4OTQA 3V8WA 2J0JA 3W32A 2PVJA 3CQEA 2WO6A 1M2QA 1ZWSA 1IAHA 4NM7A 2CNUA 2UZTA 4TL0A 4DF3A 1H0VA 5CVFA 3P7BA 3NX8A 4P5QA 2WMXA 1XR1A 1XQZA 4FT9A 4YC3A 3DU8A 5IDPA 4RQVA 2YFXA 3TWJA 4DFYA 3KFAA 5GINE 2UZVA 5C4KA 3MWUA 4M84A 2WMQA 1PYXA 4EZ5A 3HV4A 3FLNC 5FP5A 4B8LA 3HNGA 1UU9A 2YZLA 3QKMA 2YM8A 3FLQA 3PP1A 3LFDA 5AUTA 4LOQA 3NCGA 3PY0A 5JGBA 4X3JA 2R3NA 3L9PA 2BCJA 3DJ7A 4K77A 4C02A 4UMUA 3VWAA 4OLIA 4FYOA 2GNIA 3MYGA 5HG9A 3VNTA 3DB8A 1FOTA 2BUJA 2OBJA 4DN5A 3BHYA 5DOSA 2HENA 1CKPA 2ZB1A 4FV4A 4IZ7A 5IA1A 3DDQA 5H2UA 1YI6A 3QRJA 3ID6C 5E91A 2B54A 4WA9A 3ZFMA 4I5PA 3FI2A 2IW9A 2AQXA 3RVGA 1J7IA 1UU7A 2JGZA 2YDKA 3HAMA 2QQ7A 2I0EA 4MX9A 5FBOA 2CN8A 3O50A 3BHHA 2VWIA 3EFJA 2QHNA 3AMBA 3FMHA 4IZ5A 4P2KA 3ODYX 1ZYDA 2XB7A 3NNVA 3IW5A 2IVUA 3Q60A 5H8GA 3TN8A 1OL2A 4I5HA 4BGHA 3NFFB 4MWHA 2B53A 2KULA 1URWA 3EQPA 3OBGA 4U5JA 5CS6A 4OTHA 3IGOA 3H9OA 5LXMA 2YACA 5CSHA 5L3AA 4BC6A 2J50A 2B55A 5AV4A 3PA5A 2BKKA 2R3OA 3KK9A 3QTZA 3CY3A 5TO8A 2X0GA 3E8CA 4CNHA 1SM2A 4GK3A 3SXFA 5CU0A 2R3IA 4M3QA 5F95A 1H01A 2QKRA 5CI6A 1RDQE 3P08A 1XH7A 1KE5A 4N6YA 3DK3A 5GZ8A 4N70A 4BTJA 2ZFYA 3AGLA 5CEIA 4RJ8A 4DHFA 1U46A 3EQRA 3GC9A 1O9UA 4D2SA 3D2KA 3NLBA 1H00A 4FTIA 4GIIA 4RJ4A 4D5KA 4FKLA 4MXYA 4DFBA 4IB1A 4RVTA 2OJIA 5HBHA 2YABA 2ZVAA 4O6EA 3ZDIA 4CMOA 3K5VA 4ZTMA 5KCVA 4QMOA 4C3FA 1ZMWA 2PVYA 4GG5A 3AC5A 2XCHA 2JD5A 4IACA 4YHJA 2F7ZE 3P5JC 5DYJA 1RE8A 1Z57A 5AX3A 4K8AA 1GZKA 5HE3A 4FTOA 2BDFA 3CTHA 3GC0A 1PYEA 3PPJA 3HA8A 4PL5A 3QHWA 4YGAA 3TIZA 4BKZA 4DEAA 1U4DA 1H25A 3R7EA 4ALUA 4YURA 4OAVB 3ETAA 4BKYA 5DEYA 2LAVA 3RGFA 2F7XE 5AUYA 1H1QA 3R7OA 4IWQA 4IAAA 3PSDA 3S0OA 2QOFA 4ZTHA 4RT7A 3NPCA 4FX3A 4RWKA 5IZFA 1HCKA 3L8SA 1OKWA 2JLDA 5DLSA 2NNWB 2CLXA 5EM5A 3CTQA 1MRYA 3BYVA 3O7LB 3ZM4A 4QQCA 2R0IA 2X9EA 2IW8A 1OM1A 1IEPA 4DFNA 4RSSA 2R3JA 3KRXA 1KE7A 5DT4A 4O7SA 5C4LA 1H8FA 2UW8A 3MB7A 1J7UA 3C0GA 3I79A 3NSZA 1UVRA 1ZZLA 3QBNA 5LOHA 3OT3A 4YTCA 2X6DA 3D5VA 4ASZA 3ZUTA 4FIGA 5IA2A 3CLYA 2QO9A 3KY2A 4ZS4A 4C33A 3A7FA 5AWMA 5HO6A 1OGUA 2P55A 4IFGA 4KS8A 4V0GA 4E6DA 4DITA 1B6CB 5HX8A 2HW6A 3I0QA 2XCKA 5GIPE 5AP0A 4G34A 3GBZA 3UJGA 3IOPA 3EB0A 2C3JA 3TKUA 4RZWA 3BCEA 2IVTA 4YTHA 2A98A 5BVOA 4FEWA 3O71A 1BI7A 5AUXA 3HRBA 2IW6A 4FGBA 3IQ7A 2DWBA 3NIZA 4AF3A 5B2LA 5CF4A 4ZSLA 3SRVA 3TMOA 1S9JA 4IB0A 4FVRA 5AAGA 3MDYA 2ONLA 3C0IA 3UO5A 3GCPA 3PZHA 3RKBA 2BMCA 3A61A 2WTWA 4D55A 3DQXA 4NIFB 3FEGA 1DM2A 3DY7A 3BLHA 3ZBFA 3NFGB 5KMIA 4I6QA 4LUEA 3IO7A 4CFWA 5K9IA 3ACJA 4O0XA 3ORMA 3SW4A 4XV9A 3ZTXA 4AOTA 4CGAA 3FUPA 1ZY4A 3OG7A 4XNEA 4CFMA 4R1YA 3KC3A 2CGXA 4BYIA 4HVGA 3D9VA 3OHTA 4ASEA 3BLRA 5DRDA 3PJCA 3CPBA 2W5AA 4F9BA 5CU6A 1H07A 2Q0BA 1KWPA 2ZDUA 4ACHA 4GS6A 2WXVA 4DH8A 4H39A 4BCFA 3LFCA 2RFDA 4FTLA 4N0SA 1Q24A 1Q99A 4UWCA 4WO5A 5AV3A 5C27A 4C4EA 2VWZA 2YIXA 4B7TA 4Y73A 5FEEA 4EHZA 2C3LA 3O2MA 3QTUA 4X2GA 3LFQA 4PDYA 3TACA 2B4SB 3ATSA 4BCMA 4C2WA 2W5BA 3PXQA 3W0PA 3SQQA 3EQHA 5BVWA 3WF6A 4A4XA 2PYWA 4DCAA 3UMWA 5D7AA 3QGYA 3R8MA 4YNEA 4FV1A 5EQYA 3EN9A 3QLFA 2GHLA 4XG3A 4L00A 4YLJA 4LOPA 3UE4A 5CSPA 1IRKA 2ITXA 2BZIB 3PIYA 3ZCLA 2QOQA 4BCKA 1OL1A 3LIJA 2PU8A 2WHBA 3VW6A 5CX9A 5IQAA 2W5HA 4JG6A 1A06A 3VBQA 2FA2A 4QOXA 4CFNA 2H8HA 5ANJA 4GUEA 3QD0A 5KO1A 3NUYA 3AD6A 3A4PA 4TWNA 2V0DA 3L9MA 4FZ6A 4E8AA 5FG8A 4FTUA 5ANIA 5M06A 3BV2A 4ARKA 5HBEA 4ZEGA 2JDVA 4RWIA 2GTNA 1PXNA 2OF2A 4MNEA 4WIHA 3UQFA 2PE2A 4TT7A 3V6RA 1VZOA 4O0TA 2ACXA 3BE9A 3L9LA 4EOJA 3PJ2A 2VUWA 2XZSA 5ETAA 2NRUA 2Y9QA 3NYXA 2XKDA 3LZBA 2Z02A 4IHPA 5HGIA 3DBFA 4C3PA 4ANBA 3Q32A 3C51A 3BYUA 5DR2A 4AZVA 4F7NA 5B7VA 5M4IA 5CANA 2CGVA 1R3CA 5L8LA 1Y57A 4WNKA 5HOAA 4FTCA 1W84A 4DLJA 4HGSA 3AT4A 3CTJA 4IMYA 1TZDA 1PXPA 2R3KA 3G51A 3NAYA 4FKOA 4IB5A 4FBXA 1OZ1A 3QXPA 3TNWA 5J7HA 3UNKA 4FJVA 2QLUA 1GIJA 2F9GA 3OD6X 3FYJX 2X4FA 3PTGA 5CASA 3PLSA 3D7TB 5TKDA 1RJBA 1OUYA 3H9RA 3NZ0A 5TOZA 4RFZA 4EZ7A 2BHEA 3TDVA 3LAUA 4ZTSA 1JSTA 3VONA 3MY0A 3S95A 4PMSA 4I0TA 5IEVA 2W99B 2OH4A 4PPAA 4RGJA 4KKEA 1IR3A 2PTKA 5DR9A 3ZFXA 1PXLA 3CC6A 3R2BA 4N57A 3QX2A 4H36A 3UZTA 1V0PA 1NW1A 3MSSA 3ZO3A 4O7YA 4NKAA 5BUIA 4OT5A 4U40A 4ACGA 3KULA 3QZGA 4RPVA 3ZRMA 4BN1A 3DXQA 2VAGA 1OL5A 4TZRA 3ULZA 4HYIA 4DGNA 2VTHA 4EHEA 4EOLA 4QMQA 5LMBA 5H8BA 3GT8A 4V01A 3GCVA 2ETKA 3P23A 2PVRA 4DCEA 4MXZA 4EOOA 5CAOA 5IA3A 3KEXA 3CBLA 4FEQA 2J9MA 2OICA 1JKKA 3EL7A 4FK3A 4CKJA 4R8QA 4J53A 4W8DA 3CJFA 2BDJA 4W4YA 3C4EA 4OR5A 5GJGA 2PE0A 1WBTA 3UDZA 1OPLA 1XBAA 3K3JA 4NFMA 1FQ1B 4B4LA 3RAWA 4D4SA 2W96B 4PNKA 4G16A 4ASXA 5AUUA 3TTIA 4F9AA 3OCBA 4FV9A 2WZJA 3Q4ZA 4EH4A 5KBRA 2PSQA 2O8YA 2OH0E 5B0XA 4F09A 4QMTA 4IVDA 2Y4PA 4WG3A 4PDPA 3KXZA 4U80A 4YZNA 4FKGA 4CG9A 4W9XA 1UU8A 3FY2A 4LGHA 3VS7A 3BL7A 1Q8WA 3EL8A 3ACKA 3KCKA 4R5YA 1JSVA 4XG4A 4JRNA 3LJ2A 2OWBA 2UW7A 4O2ZA 5TE0A 4CVAA 5HIEA 3V3VA 1Q8YA 5LCKA 4F7JA 3R02A 4HPUE 1NXKA 3COIA 3LM0A 2XH5A 5AMNA 2XJ0A 2QU5A 4CXAA 5FTQA 1NVQA 3NVKI 1W82A 4DA5A 4AUAA 2C1AA 3UPXA 3FAAA 3NNWA 2ZDTA 3QL8A 4PP9A 2X1NA 2PVNA 3I1AA 2QC6A 3LHJA 4IVAA 1OPJA 2ITVA 5DG5A 5BVEA 3R8ZA 4R3CA 4BDEA 3VBXA 4BDIA 3UQCA 1DAWA 1ZZ2A 2CKEA 4GVJA 3BWFA 4KSPA 3R7GA 2XBAA 5DHJA 3ZEWA 2XEYA 3GQLA 3IW6A 3ET7A 2WTDA 4F9WA 1FPUA 1ZMVA 3CD8A 2R3HA 4KIOA 2QVSE 3L8XA 3BYOA 4GYIA 3ZUUA 3W2PA 4KIKB 4PL3A 1OIYA 4YLKA 3GU7A 3NUXA 5KBQA 4GFOA 1EH4A 2WFYA 4MYGA 5CZIA 5A4CA 3HMPA 4C61A 4Y46A 2XNPA 3QD2B 3E8EA 3E64A 4IH8A 4GH2A 1U59A 3KRRA 3VAPA 4Z3VA 5CEPA 3RPSA 2IZSA 4RIYA 4ZXTA 1UA2A 2C5YA 4I6BA 2OLCA 5AP4A 4EH9A 3P4KA 3UZPA 4CV8A 4II5A 3FMLA 5M51A 5K4JA 5E90A 5IU2A 2WD1A 2PZ5A 1VEBA 4H3PA 3O17A 2VV9A 3QA0A 5DVRA 4D9TA 3WYYA 4RC2A 3TJDA 5HLNA 2V62A 2C6KA 3A4OX 4XG6A 4TWCA 1V0BA 4YPDA 4BGQA 4FODA 2CHLA 2X2MA 3IDCA 1M2PA 4ERKA 2H9VA 2VX1A 3BWJA 3SG9A 4AN9A 3PPKA 1OL6A 3LCTA 4FIJA 4QP6A 5ETIA 4D2TA 2XYUA 1P4FA 5I0BA 3I5ZA 1XH8A 1JLUE 2GNGA 3R0TA 3Q5ZA 4AS0A 4CV9A 2GNHA 3FL4A 3P78A 2I0YA 5J9YA 4AGDA 4N6ZA 4OAUC 3BBWA 4RFMA 5IUGA 1CMKE 3RALA 4K1BA 4FSYA 4MAOA 2F49A 2RFNA 2VTSA 3AMAA 4C8BA 5AX9A 5DI1A 3MB6A 4PP7A 2UW3A 4LV7A 4ASDA 4J71A 1Q8TA 1CTPE 4NU1A 4DT8A 2J6MA 3MN3A 5AUVA 4G1WA 4AOIA 1O6LA 2C0IA 2IO6A 4M15A 4AZTA 4CMUA 1E1VA 3VS1A 4BHNA 2UVZA 2ZB0A 4NWMA 4YJSA 4Y85A 2P4IA 4QTDA 3NNUA 3E88A 2BHHA 3U6JA 2JEDA 2PUIA 4YO6A 1T46A 3R71A 5HBJA 3A62A 3DKGA 3II5A 2P2HA 3Q9WA 4BWXA 5A4LA 3R9RA 1NVSA 5JZJA 3O0GA 4EWHA 5FTOA 3NYNA 5EW3A 2VTOA 2JDTA 3KRLA 4M7IA 5IQHA 2KTYA 2O0UA 4DEGA 5CY3A 3ZO2A 3PLAE 4CYJA 4OTFA 4UBAA 2AEGA 2HCKA 5DFPA 4DGMA 3WZEA 2XIRA 2C6TA 2RIOA 3A7JA 3BX5A 4O4EA 5LCJA 1OVEA 3ZXTA 4D9UA 3UO4A 3QUEA 3N9XA 3P7AA 3F3UA 3QZHA 1WVWA 2IJMA 3D5XA 3HP2A 3F9NA 3FC1X 1H1SA 1J3HA 5KNJA 2A0CX 3SVVA 2F4JA 3BU5A 4F64A 4XHKB 3FZOA 5F94A 4ORKA 4QP1A 2WQEA 4BBEA 4JS8A 2ITPA 3HV7A 4ANOA 4MCVA 3UOKA 4BDFA 5JT2A 4FKUA 2HK5A 5HVYA 1YXXA 2J5EA 5DEWA 3IW7A 5GIOE 3QKKA 4G6LA 4O2PA 2PMNX 5JN2A 4OTWA 4KBCA 5AA8A 4TRLA 3ZO4A 5D12A 3BU3A 3DFAA 1JQHA 2OXDA 1UKHA 1O6YA 2HELA 1LP4A 1NA7A 3CR0A 4FTKA 5IUHA 3D83A 2Q0NA 1GZ8A 2XS0A 3MFRA 4ITJA 2QU6A 4MD9E 4RIWA 5HCXA 4AU8A 2XK8A 3UIUA 5HLWA 4KS7A 3TZ9A 4CZYB 2PE1A 4K0YA 3GEQA 3R7VA 4FV6A 2I0VA 2X81A 4FSRA 3G6GA 2QODA 1J91A 3FLSA 3VO3A 4ZP5A 4UMRA 4LYNA 3A8XA 4EJ7A 3ZRKA 3WZJA 2BAKA 3ENHA 1A48A 3RK7A 4EOQA 4B0GA 2E9OA 3JUHA 4O27B 4YJQA 4M14A 4BDAA 4YJTA 3W2OA 5JGAA 5CEOA 4FOBA 2R64A 1OI9A 1FVVA 2H6DA 1MRVA 1X8BA 3EFKA 4FSNA 4D58A 5JZNA 3GNIB 5J79A 2V5QA 3R1YA 4CT1A 3DKFA 2W06A 3NDMA 1PXJA 2GQSA 2X2LA 3PXFA 4O83A 4N4SA 4ID7A 3FZPA 4O1PA 5L2IA 3ZMMA 3RAHA 3KA0A 3VUTA 4QMVA 3OVVA 4ZY5A 5AR3A 2B52A 2OG8A 4GW8A 4RLKA 2AUHA 3S1HA 2E2BA 3OP5A 1WMKA 3L8PA 4D1SA 4BJJB 3KXMA 2Y6OA 2FH9A 4C59A 4O84A 4DG2E 4LMUA 4TWOA 4L44A 1VR2A 3ZHPC 3G6HA 3NR9A 3W2CA 2ZAZA 4L6QA 3E62A 3VBTA 5LMKA 4ZSAA 5BQ0A 3DXNA 1UNLA 2C0TA 2JIIA 3O23A 4Y83A 4GU6A 3GP0A 2PK9A 2PWLA 3KF7A 2PZRA 5EHLA 2OO8X 2CGUA 2HZNA 2J90A 5DR6A 2GQRA 3Q52A 4EOIA 4EEVA 4OW8A 5J1VA 4TYHA 4NM3A 2W4JA 4DGOA 3F3WA 2IF8A 3TCPA 4EOMA 5IDNA 2HZIA 5CT7A 4MUQA 4R1VA 4EH2A 5HO8A 5HNIX 2YWVA 3DJ6A 4F65A 4P7EA 5I3RA 1ZYCA 4HGTA 2WAJA 3FJQE 4FKQA 2DQ7X 5FXSA 1ZARA 4CFFA 1SVGA 3MY5A 4IC7A 1V0OA 5KUPA 3OTVA 2FVDA 4QNYA 4RQKA 4V05A 3QUPA 3R63A 1YXVA 5E8WA 3TUBA 4Z16A 3DBDA 5HICA 3PDTA 1XBCA 5D7VA 3SXSA 5J9ZA 1BX6A 4TYGA 4GUBA 4NT4A 3F69A 3F3VA 1UNHA 2J0MB 3P79A 4LM5A 4K33A 4M0YA 1PMEA 4EL9A 1IA8A 1FVRA 3H10A 1UWJA 3I81A 3LXKA 3PRIA 4JXFA 4RIXB 4IEBA 1W8CA 3I6UA 5F4NA 1LR4A 5A9UA 4AN3A 2Z60A 5DA3A 3RI1A 4FG9A 4FV7A 3D2IA 1WBSA 4C4JA 4HNIA 1IA9A 4LMNA 3HMOA 2W1EA 2VTRA 2OU7A 3D94A 3KKVA 1U54A 4F08A 3UODA 3OCTA 4CFUA 5K0KA 1QPJA 3Q04A 5D41A 5ACKA 3F66A 1AQ1A 2HY0A 3C5UA 4GT5A 2JBPA 3EQGA 4I3ZA 2GQGA 3ROCA 3W2QA 3OXTA 4D0XA 3OWPA 3MESA 1P2AA 3GOKA 4CD0A 4GJ3A 4ANNA 2QOLA 4FZ7A 4W4XA 5J95A 3DXPA 2C68A 2F7EE 3GOPA 5GJDA 2GNLA 3EN4A 2RSVA 1SMHA 5K5NA 5LARA 3MY1A 4BI2A 5CSWA 4E3CA 3BGPA 4GV1A 1Y8GA 3AKLA 1GAGA 4EOPA 4FKVA 1KE6A 3D0EA 3P1AA 4A4OA 5E9EA 5TT7A 4RVMA 2LGCA 4UZHA 2YM5A 4FL2A 3UVPA 1DI8A 2GU8A 4U79A 4QTCA 3K2LA 3VS5A 3C1XA 5DRBA 3KU2A 3QRKA 5K5XA 4DT9A 3C4WA 3UBDA 5L2SA 3FZRA 3QXOA 1XJDA 4FTMA 4Y8DA 2HW7A 4QYEA 5JRSA 5CWZA 4S2ZA 4FSWA 3QFVA 2P33A 3E3PA 3I60A 3KRWA 3DAKA 4I0RA 4CQEA 2NPQA 1YXTA 3ANQA 2OGVA 3HUBA 1SVHA 4KD1A 2GTMA 1AGWA 2VTJA 3NS9A 4KWPA 1PKGA 3CEKA 3LCSA 1G8SA 4JBOA 3WZKA 1H1PA 2GSFA 3FZSA 3MH1A 3BU6A 4GL9A 4KKGA 4K2RA 3VN9A 2R9SA 4KRDA 3OT8A 3HMIA 3COKA 2HZ4A 4IX5A 3OCGA 4H1JA 3MPTA 3OOGA 4RC4A 3RM7A 3NW5A 5GHVA 1VYWA 4LOOA 3DDPA 2V55A 5LVLA 2XJ2A 3D4QA 2OZAB 2FGIA 1R78A 4XG9A 4AQCA 4BDHA 2IZRA 4UWBA 3R83A 1FGIA 4Q9ZA 4O0VA 3MVLA 5JRQA 2OFUA 4J52A 4E5WA 3G33A 1JPAA 1YWRA 4AXEA 3GCSA 3TDWA 4FSZA 3A2CA 4PMPA 4ZZMA 3ZLXA 3POOA 2Y4IB 4BICA 1CKIA 3ZC6A 4DTKA 1G8JA 4I6LA 4FTAA 5HG8A 2FUMA 1NT2A 3T9TA 4NJ3A 3VUGA 4KUJA 4DTBA 3LOKA 4PMTA 3TI1A 2UZWE 3NGAA 1OKZA 4KBKA 2NP8A 4DDIA 3MGYA 5E8ZA 4JDJA 3E5AA 4XOYA 4RZVA 3VRYA 1DAYA 4DBXA 2FYSA 3K5UA 4EKLA 4F6WA 3SDJA 4U43A 3GU4A 3QQFA 3A7IA 5CNOA 5HKMA 3WZDA 4DTAA 3FYKX 4MBIA 4UB7A 1RQQA 4F99A 2PUUA 4AFEA 4OTDA 4TTHB 1LPUA 2R5TA 3IW8A 2OJJA 5EDQA 5EW8A 4ZTNA 3Q6UA 3CGOA 3TKIA 3V6SA 2RFEA 4E4XA 4XOZA 3C13A 3NMUF 5EQPA 4U81A 3OROA 1VJYA 3W33A 4D1XA 4CMTA 3QTWA 3LM5A 4EK3A 4EYJA 4G3FA 3HVCA 2XM8A 1R39A 3QTQA 1J1CA 4FF8A 4M69A 4QMPA 5HE0A 4CFXA 3BQRA 1XMMA 2EXEA 3IONA 2HWPA 4YJRA 5H3QA 2XRUA 2ZM4A 4CYIA 2XM9A 4CZUA 5M4FA 4RA4A 5EG3A 4W8EA 3OWLA 4BL1A 3BGZA 4BDKA 3CKXA 3U8WA 5HU3A 2WMSA 2XK9A 5ANGA 5JH6A 3BQCA 1R0EA 4DINA 5FLFA 2R3GA 5HIDA 4ONAA 2F2UA 1JBPE 3KMWA 4DAWA 3PSBA 2CKQA 1DS5A 3C4ZA 4UY9A 4QYYA 3PFYA 4QMZA 4LDTA 3LXLA 4YJOA 3ZC5A 2X8EA 2R3QA 2WU6A 4FTTA 4NM5A 3ZH8A 4XP2A 4LL5A 5EI8A 4CLJA 4IVCA 3ELJA 4EH3A 5CEMA 4MEDA 4G5JA 5HE1A 3R1NA 5JMSA 3IPHA 4JNWA 3MIYA 5FQDC 3RAIA 4U45A 2VWYA 3ORTA 1CDKA 2B1PA 3OS3A 2PZPA 5I9ZA 4DH7A 4BBFA 4NW5A 3KN5A 3QQGA 4G17A 3DS6A 5KMMA 3MW1A 4A7CA 3KL8A 2FB8A 5HG5A 3K54A 4E6CA 2ZYBA 4G2FA 2BAJA 2ITUA 4H3BA 2C3KA 4IQ6A 3M11A 4D5HA 4F9YA 2C6LA 3AC3A 3RTPA 5HNGA 2VWXA 4HCVA 3WILA 4BCOA 4O7LA 3QQJA 2W0JA 5H8EA 3UIXA 1JOWB 5HD7A 5DWRA 2YIRA 4BY9E 4MXXA 3UDBA 3DAJA 1W2DA 4WNOA 3U6HA 2HYYA 4E1ZA 3SA0A 1SYKA 4HPTE 1URCA 2XBJA 3FMDA 1NVRA 3LFSA 3Q9XA 3PFQA 4EONA 4YHFA 5JFXA 4IB3A 4R6VA 4H05A 3KQ7A 2X7OA 3O8TA 5A46A 3RPOA 4HZSA 5EDRA 3AD5A 4DYMA 2O65A 4KINA 4RWLA 4ANMA 2C5VA 3PUPA 3R9NA 3W0NA 4DHJA 1G3NA 2J0KA 3ORKA 1LEZA 1P14A 1KV2A 3UOJA 1SVEA 4R3PA 5IF1A 4FL1A 2A4LA 5C03A 3WYXA 2Z8CA 5A6OA 5M4CA 2V7AA 1REJA 4IE9A 5DNRA 5E4HA 4GKIA 4E7WA 3FWQA 4D2PA 4G5PA 3AC2A 3QCXA 3DCVA 4MD7E 5KX8A 1PMNA 1OKYA 5CEKA 3FXWA 2A19B 2QOOA 4C2VA 4S32A 1M2RA 2JKQA 2CCIA 2OF4A 4DEEA 1IAJA 4WUAA 1Z5MA 4KNBA 2CKOA 4F70A 3A60A 3FQHA 1OIRA 1OPKA 4WKQA 5EH0A 3D7ZA 3ZZWA 4BDDA 4XLIA 1OMWA 5KMOA 3PWDA 4E4MA 3JVSA 3R00A 4I41A 3I0OA 4GMYA 2EVAA 2WOUA 4IJPA 5IA4A 4FEVA 4O6LA 4ANSA 1GZNA 2IPXA 5BPYA 5C01A 2ZOQA 3HUCA 2ESMA 3Q2MA 1H26A 4FZFB 4IXPA 5HVJA 2P0CA 3TNHA 4WRGA 2XF0A 4AG8A 3BHTA 3L1SA 3A99A 3PSCA 2GCDA 5D10A 3WF5A 2VD5A 2I7QA 4KSQA 2PVKA 3F6XA 3HRCA 4X2KA 2UZBA 4DC2A 4FKRA 2XNNA 2C5XA 1IG1A 2XA4A 4FL3A 5AR8A 3UP2A 2VGPA 3H3CA 3WI6A 2C6EA 4EHVA 1Q62A 5KMNA 1B38A 4NM0A 1Q3DA 4RJ3A 1PXKA 3B8RA 3C4FA 2CPKE 4MVFA 3R7IA 5IPJA 4JT3A 3UC4A 2PUNA 5AM6A 4EQUA 2XUUA 4I6FA 3VUDA 2OKRA 3VW8A 1H24A 4O0SA 5FXRA 4ACMA 3LFEA 5AV2A 3SOAA 1GNGA 3HV3A 4G3GA 3ROYA 5LVNA 3OOMA 4FEXA 2EXMA 4J1RA 2YCQA 2AC3A 2YZAA 4CT2A 5AIKA 4ZOGA 1QPDA 1STCE 4BDJA 4C35A 3VUIA 2CLQA 2OI4X 5F1ZA 3VRZA 5A6NA 2R3RA 3HLLA 2BKZA 3PXZA 3RNYA 5AR2A 3R01A 4RG0A 1OB3A 3LLTA 3QC9A 3UG2A 1NY3A 3JVRA 3QX4A 4TNDA 5GZAA 5BUJA 2EU9A 4IZAA 1CM8A 2CGWA 4C38A 2BALA 2IWIA <