1DS5A

Dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
328
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE, ALPHA CHAIN
publication title The crystal structure of the complex of Zea mays alpha subunit with a fragment of human beta subunit provides the clue to the architecture of protein kinase CK2 holoenzyme.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 99
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ds5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ds5A01
3FMDA 1PYEA 3GCPA 5CXHA 5KMIA 1EH4A 4HGSA 4RIWA 4UMQA 3RAIA 3UIUA 4EQUA 3OY1A 3QFVA 5JFXA 1TQIA 3G15A 4FEXA 4C4JA 2WMWA 5DR6A 4RIOA 4BDDA 4BDBA 4XHKB 3HV5A 2R4BA 4CLJA 5AP3A 3TV4A 5HLNA 4FOBA 1JKLA 3D7ZA 4G6OA 3SKCA 3UGCA 2VTTA 5HU3A 3QQLA 4B99A 3ORPA 4Y83A 4YLJA 1M14A 2O8YA 1VR2A 2WIHA 2PULA 5BVKA 3W1FA 3P9JA 5D9HA 4FV5A 4AE6A 2ZDTA 1WBTA 3C9WA 4I4FA 4TYIA 2J4ZA 4R7IA 4G17A 1WZYA 1RW8A 2BRHA 1KE6A 4K18A 4M7IA 4QYYA 4IBMA 4KBKA 4DYMA 3WILA 2R7IA 4I21A 4CFNA 2BKKA 2UV2A 3JY0A 4GVAA 4QMQA 1Q99A 4CYJA 4RWKA 3SRVB 4M3QA 5C27A 3RP9A 3C4FA 4K9YA 3FXZA 1URCA 2QKRA 3LM0A 4KA3A 3WF5A 2C6LA 3M2WA 3U9CA 3V8SA 3TT0A 4BY9E 5HIBA 3ETAA 5AMNA 2GS7A 2W5AA 3EYGA 3ZOSA 2IVUA 4A9RA 1FINA 1SM2A 1Y91A 4JXFA 2CGXA 2XBJA 3QRUA 4MCVA 4P5QA 3VNTA 4WNKA 5LWNA 3ULZA 2CMWA 3C51A 3MI9A 2YM5A 2CNQA 2PVKA 4JDHA 1ZYLA 3GC8A 4CT2A 4HYUA 1PXPA 4FNWA 3V6SA 3HA6A 3PTGA 3AD4A 4EH9A 5EDQA 4FGRA 2VWYA 4UXLA 3QTZA 5GJGA 1OIRA 5T6KA 3TIYA 3ZXTA 3CCNA 2GTMA 3W2QA 2B9FA 1WCCA 2OKRA 2YCSA 4O2PA 3VUDA 3IONA 4PDOA 2X1NA 2XNNA 5ICPA 2V55A 4F9WA 3TZ7A 4DC2A 4Q5EA 3UVRA 4ZJVA 4FTAA 3O23A 3BYUA 3EIDA 3FMNA 3BWJA 5KO1A 3PRIA 1YXSA 2BILB 2QD9A 3KK9A 3OUNB 4BI0A 3SV0A 4D2TA 3EQRA 3KRWA 3RK5A 2OFVA 3I7CA 1ZZ2A 3R21A 3NUPA 4ANSA 2P55A 2CJMA 2OXXA 3DJ7A 5IUIA 3A99A 3BELA 3RINA 4LRMA 5IA1A 4L44A 1WMKA 4YZCA 3IW6A 4PPCA 5C8NA 2WELA 4AWIA 4TYHB 1MRUA 2VX3A 2XNOA 3KXXA 1KUTA 2UZUE 5J9YA 1H27A 5J5TA 4BZDA 4AG8A 4RJ3A 4ZZOA 4QMMA 1QL6A 3U6HA 1S9JA 5CASA 1PXMA 3BHVA 4D55A 4E3CA 3QHWA 2Z7LA 2QO2A 1W82A 4KRDA 5DLSA 4APPA 5C1QB 4H3PA 3UIMA 2J0IA 4IZYA 4M69A 5IMEA 2QG5A 3HMOA 2XNGA 3CR0A 3I5ZA 3PG1A 1WVYA 4JT3A 2QKWB 4XS2A 4YJNA 4R6VA 2UZOA 3KMUA 2G2FA 4BDEA 2XVDA 4AA0A 4W9WA 4OAUC 3DNEA 4KNBA 3UVPA 3ZSHA 2J50A 1P4OA 1YI3A 5FLFA 5H9BA 5IA5A 5HE0A 2J7TA 3E93A 4JVGA 3ZLYA 3TJDA 2X8EA 2W06A 4JR7A 4R3RA 4CFVA 3R22A 4AFJA 1KSWA 4LUDA 5HO7A 4FTTA 4I23A 3MYGA 4F7SA 1FMKA 5GZ9A 2GNHA 3NSZA 3PIYA 3LQ8A 1NY3A 4KABA 4H36A 2REIA 5FG8A 2GHLA 3L9LA 1JPAA 2OSCA 2C5NA 4FT7A 2YA9A 3RNIA 3A7GA 5HZNA 3IW7A 2Y0AA 3RALA 3FLYA 5GINE 4CYIA 4AOJA 4V0GA 5FTOA 4FZ6A 3HRCA 1DAYA 2ZM4A 4ZSGA 5EQEA 1H1PA 3OUKA 4O0SA 4FI1A 3ZBXA 1MQ4A 3ZZEA 2JIUA 4BC6A 3F5GA 5CEKA 3PJCA 5JK3A 3I81A 2A2AA 2HXLA 3NNVA 4X6QC 3ACKA 1OL1A 4QMWA 4E8AA 2JAMA 2ITOA 3H3CA 2EWAA 4HGEA 3DT1A 3QQHA 2CNVA 4L67A 4OBQA 2Z60A 3UBDA 4HW7A 1QPCA 3WF7A 4FK3A 3ANQA 4DH3A 3HGKA 3ZRMA 5J5SA 4NCTA 2R3PA 3NNUA 3I1AA 2BIYA 4JL9A 3MWUA 4YPSA 4G5PA 3KF7A 3ITZA 4ZY6A 4HPUE 4QTAA 3WBLA 2F7ZE 4L01A 1IEPA 1OI9A 2C5VA 2I0HA 2R3HA 3QA8A 4LV5A 1W0XC 5K3YA 4D1XA 5G6VA 5KE0A 4PDYA 5AP6A 1YOMA 5EKOA 2R2PA 5EHLA 3ZYAA 5A4LA 4JDKA 5EQYA 1YI4A 4BBEA 4DEDA 4C58A 3RHKA 2J6MA 4TWOA 4Y5QA 3COKA 1O6LA 5AV0A 2X81A 3D2KA 1PMNA 2OG8A 3C50A 4NK9A 4DA5A 4ANBA 4EC8A 1H1WA 3FZOA 4QMLA 4XV1A 4UYAA 2XF0A 2CKPA 4AZSA 2XRWA 4TN6A 4XV9A 3Q96A 1JKKA 5AUUA 2B9IA 3C0IA 1CKJA 2C6MA 3DGKA 5CI7A 5DT4A 3II5A 1XH4A 3FZSA 4IANA 5JQ8A 5CEIA 3ORXA 2XP2A 3JUHA 4BDAA 2DS1A 4D0XA 3QRJA 4QTCA 3MVLA 5LMBA 3SAYA 2C0IA 4EYMA 3IK3A 3CTQA 4C36A 2VWWA 4TYEA 3FQHA 2R3OA 4PL4A 3BYVA 4JNWA 5B2MA 3WARA 4ZSEA 3FE3A 2PL0A 5DVRA 4FIGA 4WNPA 4BF2A 4E26A 3GENA 3LQ3A 1T45A 2WKMA 4A06A 3LKMA 4TWNA 1Q61A 5FM2A 1MP8A 4XCUA 2QU5A 4JIKA 3QQGA 4MNEB 3WZEA 2EU9A 4AGWA 1YKRA 3KL8A 2YCQA 1LUFA 3VWAA 5LCKA 5A6NA 3OCBA 4KIKB 4CFWA 5IKWA 4BI1A 2Q0NA 4IDTA 2VWBA 4KKGA 1OL2A 2OZAA 3FLZA 3EZVA 2BRBA 1PXLA 4PV0A 4UMTA 4YNEA 2ITQA 3F61A 4HVSA 3CQWA 3V3VA 1URWA 3SG8A 2O3PA 3E63A 2PUUA 5JSMA 2PUIA 5E90A 3BU5A 3P4KA 3G0FA 3QTXA 4CFFA 3DQXA 3EFJA 4GCJA 3GU7A 2QOOA 2FA2A 3EN6A 4OT6A 3R63A 4P2KA 4AZWA 3LCOA 4V05A 3ZEPA 5KHXA 1FMOE 3EQDA 3R8MA 4KWPA 3AC2A 3EQHA 2X4FA 4IWDA 3UZRA 2HWOA 1OITA 2OXDA 5IA3A 3TACA 4GT3A 2YFXA 5ACBC 1OMWA 3DQWA 4DFNA 4Z7HA 3QCXA 4FVRA 4RC4A 1R1WA 3KULA 3B2WA 4JOAA 4GRBA 5LARA 3PXZA 4NTTA 2QLQA 4XP3A 1V0OA 3VUMA 4C62A 3HZTA 1GIIA 3E5AA 3I4BA 4U3ZA 4D9UA 1ZAOA 3TEIA 3TUDA 3HLLA 2XKEA 3FHIA 3EFKA 3FI4A 4MNFA 5M56A 4U9AA 4EOOA 2IW6A 3AC8A 4DT9A 1NVRA 4TT7A 4KKEA 3UNJA 5HOAA 4TXCA 2V5QA 1QPDA 3Q5IA 3TKIA 1OL5A 2AUHA 4C8BA 1U59A 1RE8A 3QTUA 4NKAA 2CSNA 4O0XA 2HWPA 3PE1A 4J53A 3PLSA 2C0TA 4TTHB 2PE0A 4FGBA 4NM0A 4FV3A 2PVLA 2UW7A 2YM3A 3A7FA 3AMBA 2W1IA 3CJGA 4PP9A 5JKGA 3R8PA 3PSBA 4HVHA 2BKZA 3FKLA 2JKMA 5CS6A 1OIQA 2H6DA 2PZYA 1IAHA 3KFAA 2B7AA 4RJ4A 5E8ZA 5HICA 4Z7GA 4O84A 4R1YA 4GH2A 4FKUA 5E8SA 3RAWA 4DEIA 3QZIA 5FP5A 3UC4A 4XG7A 1KOBA 4GKIA 4LYNA 4D2RA 4Z55A 4X21A 3WE8A 4RC3A 4W8DA 2NP8A 4PMTA 1FOTA 3R8UA 5IDPA 4RIYA 5IG1A 2YCRA 1U46A 3JVSA 4RBLA 1UNHA 4FUYA 4LRKA 4L52A 2BR1A 4C02A 4FV7A 5HG8A 4AGDA 3LXLA 3P1AA 4M12A 3UYTA 1I09A 3HV6A 4FOCA 4J52A 4QPAA 4KUJA 1IASA 5CQUA 4F9CA 4PMPA 2V62A 4NIFB 4DLIA 3HUBA 3T3VA 3UP2A 3KC3A 3ZTXA 3VRZA 4C3PA 5FDPA 4DG2E 3B2TA 3DFCB 4FV0A 5H3QA 2FO0A 4WIHA 3O96A 2YISA 4MH7A 4CMUA 2YM8A 5CT7A 3LOKA 5CVFA 2R7BA 3ZO4A 4O6EA 5JH6A 5BVEA 3LXKA 2QR8A 3AD5A 1PMEA 3GUBA 4ZS4A 1IA8A 4YHJA 4G16A 5D10A 2YIYA 4GMYA 1YDTE 2WMVA 4UV0A 4OUCA 4IAYA 4NFMA 1PXNA 5B2LA 1GAGA 3TDWA 3GU4A 3I79A 5CZHA 5IEYA 2VTIA 3ZMMA 4A4LA 4FNZA 4E1ZA 5D7AA 3HVCA 4IZAA 2X39A 3H10A 3H30A 5EW9A 4DFLA 4I24A 3BGZA 4AZFA 3COIA 4JI9A 4MXAA 4QMSA 5M53A 3F3WA 4PWNA 4QMYA 2QI8A 3POOA 5K5XA 4RFYA 5CXZA 4EOPA 3RPOA 2UVXA 4WUNA 5ANJA 5C26A 3TNIA 5C9CA 3DZQA 4UMRA 1W84A 4YJUA 2VTJA 3VVHA 5L6WL 4FIEA 1CTPE 3FLQA 4U97A 4O7NA 4RVKA 4NTSA 1WVWA 4A4XA 2Z2WA 3LPBA 3NYOA 4MF1A 4DINA 5CLPA 3QXOA 1K9AA 1V1KA 3CEKA 4DCAA 5CEMA 3C4ZA 3OS3A 5IH5A 4LI5A 5FXRA 4EH4A 1TQMA 3AT4A 3TI1A 1FGKA 1WBNA 3ZH8A 4RFMA 4FSQA 3BLQA 3K3IA 2JEDA 2XH5A 2VTSA 4AT4A 4ALUA 1UV5A 5BNJA 2VTOA 3GXLA 3I5NA 4L7SA 4CG8A 1GIHA 3E7VA 5C4LA 4BGGA 2B55A 3O51A 1OECA 3QBNA 3RZBA 4LQMA 4DT8A 5AUTA 4CTBA 1GZKA 3AC3A 1L8TA 5DEWA 4NWMA 4PPAA 5ANDA 5HTIA 5AUXA 4GG7A 5AWMA 3FQEA 4MF0A 4BCJA 3MS9A 5IF1A 2Z8CA 3HX4A 1B6CB 4EWHA 4NUSA 4C4IA 5AUVA 3IOPA 3SXFA 3F3UA 3NWWA 2BDWA 3D83A 3IS5A 4FTKA 3Q9WA 3QWKA 3V04A 3MTFA 4OTIA 2R3RA 4L8MA 4BL1A 4DGGA 4YMJA 4GKHA 2Q0BA 1NW1A 3BLRA 3LM5A 4XLIA 2GS6A 4QQ5A 1GNGA 3LE6A 3CP9A 5M4FA 2JDTA 3R8LA 3TDVA 4XOZA 5ITAA 5JN2A 1OIUA 3E88A 1PF8A 5LWMA 4DG3E 3PIXA 4BCQA 1ZOGA 3FZTA 2Q83A 2BTRA 5CU4A 4XLVA 2R9SA 2JBOA 3ROCA 3DB8A 3DXNA 4K77A 4NW6A 2IVVA 4AE9A 5CEOA 2WTKB 2J9MA 4FV6A 3WF8A 3NX8A 3TUCA 2PUNA 3LLAA 1NT2A 3A4OX 2O5KA 2WTIA 3NPCA 2WNTA 3BQCA 2F9GA 4IQ6A 2WOTA 2WD1A 2OF4A 2W1GA 3QRIA 3A4PA 1IRKA 3LFNA 2PVRA 3QX4A 4BGHA 4F70A 3AQVA 2WQEA 2XJ2A 2ZV7A 2BFXA 4JS8A 4FYOA 2XM8A 4MKCA 2J0KA 1LP4A 4ALVA 4F6UA 4AQCA 3KU2A 4B7TA 2SRCA 4X2GA 5H8BA 5KKRC 2OJIA 4OGRA 3HRFA 3PXFA 4DEAA 2XUUA 3HNGA 4GUEA 2ETKA 3JXWA 3R7IA 2X8IA 3POZA 4IB1A 4ZLOA 4D4RA 4FZFB 3BYSA 4W8EA 1S9IA 5E7RA 4AUAA 5A46A 3G0EA 2F2CB 4IIRA 3SX9A 5HTCA 3FMJA 2VWVA 1KOAA 3OXZA 5DMZA 3W18A 4WG3A 5AV3A 3VBQA 4A9TA 2GFSA 3NW5A 5HU9A 4FG9A 2GDOA 3F6XA 3PVGA 3FAAA 4HYIA 5LMAA 4ALWA 4LL5A 5L8LA 4ZP5A 1CM8A 5D7VA 2BUJA 5DOSA 3QC9A 2CKEA 3SOCA 3QD3A 5C01A 3QRKA 5E8WA 3T9IA 4HVGA 3D14A 3NUYA 2XYNA 4C4HA 2BHHA 3OHTA 4XG2A 1YDRE 4X3FC 4XV3A 2NRYA 4CLIA 5D12A 2G1TA 4RZWA 2YIQA 3LFFA 5EM6A 3R0TA 4O82A 4DGNA 2QOLA 4BCHA 3TTJA 3BV2A 4X7QA 4HCUA 3BRBA 4KD1A 4P7EA 3VUGA 3GC9A 4F7LA 3BPRA 3GC7A 1OZ1A 2XRUA 2ZV9A 2XCKA 5FEEA 2QOHA 5E91A 4JQ8A 3THBA 2P2IA 3DLZA 4EZ7A 4CT1A 2BROA 5EFQA 3UQGA 3ZFXA 3OOGA 3KRRA 3HDNA 4FV8A 2VX0A 2WQNA 4TNBA 2VWUA 4DFBA 3ZXZA 3RHXA 3QUEA 4NM7A 2C6KA 3RPSA 4FX3A 5A54A 5DR2A 3N51A 4QNYA 4BTKA 3DPKA 2WMSA 1ZYDA 3O0GA 3A7IA 4Y73A 4BCPA 3HMIA 3ZM9A 4GSBA 3MH3A 4LOPA 2OJ9A 3TL8A 2ETRA 1XBAA 3U9NA 2PE1A 2OH4A 4IVBA 5AX3A 4D9TA 5LCJA 3BU3A 4IX6A 4U3YA 4USDA 5CAUA 4OR5A 5HE2A 3ODZX 3R8ZA 5G1XA 1Q97A 3EKKA 3PRFA 1M2QA 3EH9A 2IZTA 2B1PA 4JBQA 3D7TA 4J1RA 4CVAA 3N9XA 4FZ7A 2B9JA 4F09A 4R7HA 4EOJA 3NVMB 1ZYSA 1K3AA 2R3NA 4FKQA 3COHA 2W96B 4GIHA 4O86A 3G90X 2QVSE 3HUCA 3MFRA 5AV2A 2ZVAA 3DAEA 3EHAA 1YI6A 3MN3A 4QMTA 4I4EA 2W4OA 3W2PA 3R73A 1QMZA 3LFCA 2AC3A 3U8WA 5LVLA 3NW7A 4H58A 3UPXA 4MXZA 1H0VA 2JBPA 3PY3A 4WD5A 2P33A 5TE0A 3UC3A 3BYMA 4UEUA 3JVRA 2BZIB 5C03A 2E9OA 4W9XA 5HX6A 2OK1A 4QP7A 4D0WA 3DOGA 4FSMA 3MPMA 2BDJA 2ITZA 2WTDA 4BDHA 1OB3A 4C57A 3Q2JA 4O1OA 5IQCA 1V0BA 4L6QA 1F3MC 3DKCA 4LGDA 4QQCA 5CANA 1KWPA 2P0CA 4RIXB 3HV4A 3EB0A 5FDXA 1H1RA 3VULA 4AT3A 4E4MA 2E9UA 2ZAZA 1E1VA 5CU3A 4WNMA 1B39A 1Y6BA 4FL1A 3VC4A 3WIGA 3OWLA 3CE3A 4BKZA 2YIWA 3G33A 4QTDA 1L3RE 3OFMA 2GNJA 2QCSA 3KKVA 4QYGA 4CTCA 2BMCA 2YM6A 4MXCA 5DHJA 3CQUA 2VTQA 2CPKE 2OGVA 4AN3A 3AG9A 4PDPA 2ZM1A 3ORTA 2OWBA 3MVHA 5EH0A 3PYYA 4UWYA 3PDTA 5EHOA 4BTMA 1KE8A 4FICA 3G2FA 4IC7A 3V5WA 2I0VA 2JIVA 3IECA 4ZS0A 3G6GA 2B9HA 4OTQA 4QP1A 3CSVA 1RJBA 2A27A 4FTOA 4LFIA 4ACCA 3WZDA 1R3CA 3KCKA 4YC6A 2G2HA 2HW7A 4FNXA 1B38A 2WHBA 4O7LA 3TKUA 2PTKA 3QZFA 4AU8A 4FVPA 5CQWA 3Q32A 3RZFA 2LAVA 4R78A 2XYUA 3TNHA 1WVXA 4F9YA 4IJPA 4HGTA 3QRTA 4XNEA 3S00A 5J1WA 3GOPA 4TYJA 4W4YA 1YDSE 2PK9A 4F0IA 4O81A 4RA4A 4MXYA 3R9HA 3DS6A 2QOKA 3QUPA 3B8QA 4YJRA 3MVMA 3PSDA 5ANEA 3VIDA 2YABA 2W5HA 4W4WA 4WBBB 4CRSA 4RLKA 5IQIA 5A9UA 4BYIA 3LFSA 3QTIA 3LIJA 4D4YA 5LMKC 3VW8A 4KIPA 4IM3A 2X0GA 4JDIA 5DFPA 2FVDA 3BI6A 4FSYA 4R3PA 3SDJA 1ZOEA 3MFSA 4BDJA 3A7JA 1M7QA 4J7BA 4FT0A 4EZ5A 4BCMA 4UWCA 3C0HA 5IPJA 4NL0A 4FTIA 4P90A 5CNNA 3DTCA 4NM5A 1PKGA 4FKJA 5BVDA 3PWYA 3BGPA 4FKSA 5EQPA 3ROYA 3QALE 4EQMA 4H3QA 4APCA 2PVMA 4N70A 1O6YA 3LHJA 2ITNA 3UZTA 4GFMA 3LCKA 2GHGA 4O96A 4EJNA 2VTRA 4EHZA 2R64A 3OWPA 3V8WA 2J0MB 4XG8A 3BX5A 4IZ5A 5CF4A 4IW0A 4YHTA 4S2ZA 4CV8A 4AP7A 5BUEA 3IW4A 3JPVA 3PE2A 4IACA 3LXNA 4F7NA 3MIAA 5CEQA 4C3FA 2VGOA 5AEPA 3SVVA 3F5UA 2R3IA 3FWQA 4A07A 4EC9A 1A06A 3QWJA 4F99A 3HA8A 4TRLA 2R3FA 4BGQA 3O8TA 4O0UA 1Q8YA 5J9ZA 5JFWA 4FTMA 4QP9A 3ZRKA 5BUIA 4O22A 4XBRA 5IQEA 4ACDA 1JQHA 4G2FA 4BCOA 5M4UA 4QMOA 4RQVA 4L42A 3KXHA 3KMWA 3UE4A 4F9BA 3R7YA 2OI4X 3OW4A 3W2CA 3Q60A 4YBKA 2Y7JA 4FTQA 4DAWA 3L9NA 4MBIA 3MY5A 3UNZA 4I3ZA 5KBQA 4QP3A 3V01A 2OLCA 4BWXA 3NCGA 2C68A 3AC1A 3U4UA 4ASDA 4EJ7A 2YN8A 2YAAA 4M67A 5FGKA 3SW7A 3QAME 3QA0A 3IDPA 4EK3A 2OIDA 4GYGA 2VNYA 4X2FA 3GP0A 1Q3DA 4I0TA 4L7FA 4U42A 2WMUA 4J8MA 3E3BX 4JDJA 1J3HA 4F4PA 2OH0E 3NCZA 1JOWB 4MVFA 4I5PA 5FRIA 2OBJA 4MQ2A 3F82A 2HYYA 5LQFA 2BZHB 2I7QA 4IX3A 5EOLA 5HIEA 3ALNA 3K5UA 3DBDA 1XH5A 3LFBA 3VAPA 4J96A 2UZDA 3F66A 4A4OA 5AV1A 3PA3A 4M69B 2F57A 1FBNA 1ZLTA 2E2BA 3F2NA 4B6LA 4LOOA 4QP6A 3OMVA 2GNFA 4C59A 4CKIA 5JFSA 2ZJWA 3KRJA 2GU8A 4OW8A 3QGYA 2C0OA 3NEWA 5CU2A 4GW8A 3I60A 2O63A 3MSSA 4YJOA 3GC0A 4DGMA 5KX8A 5GIOE 5CENA 3S4QA 3OBJA 4RLLA 2CN8A 2R3GA 4V01A 5D41A 3R1NA 3GQIA 2XMYA 4FKWA 3FDNA 4I5MA 3BHUA 4RZVA 4UZDA 3EL7A 2XEYA 3UQCA 2J0LA 5KZ0A 3TV6A 3D9VA 4O0VA 3R7OA 3MY1A 3IW5A 4ERKA 4DFUA 4S32A 3D15A 3T9TA 3IKAA 3C4CA 3K3JA 4FZAB 2QQ7A 4G1WA 2HY81 4M15A 3ZS5A 4F1MA 3N4TA 4H05A 4OTFA 2VTMA 5IU2A 4HYSA 2XNPA 4UMUA 3KVWA 2WZJA 2C3KA 2QU6A 5HD4A 3ORNA 2C47A 3V5TA 2QODA 2C30A 4C34A 4DGLC 3O7LB 5A4EA 2RKUA 4QP2A 1ZWSA 4PP7A 2HXQA 5H8EA 4ARKA 2W9FB 4DE4A 4RJ6A 5J9LA 5K4IA 3UDBA 4AW2A 2UVZA 4DEHA 1IAJA 1OBGA 4RWLA 3MESA 4L43A 1CKPA 1U5RA 5AFVA 2XKDA 3EFWA 5KMMA 2W9ZB 4GG5A 1GZOA 1Z9XA 2HZNA 4D2VA 2OO8X 4Q9ZA 5TF9A 4AA5A 4L3PA 2RF9A 3KB7A 4KB8A 4GT5A 1KE7A 2WU7A 3CPCA 3NW6A 5BYZA 1PW2A 4BCFA 4EBVA 5A4CA 4EKLA 2RFDA 5J95A 3BE9A 1OPKA 2WQBA 1IR3A 3A61A 3HL7A 2YM4A 2YM7A 3CKWA 4FODA 4HGLA 2WMRA 3L8PA 2VO7A 5AA8A 4I41A 4EK8A 4U41A 5DG5A 4DFZE 3PA4A 3OOMA 1JNKA 3EZRA 4JBPA 4EHVA 4U45A 3CD3A 3MA3A 3TG1A 4CKJA 4NW5A 4U79A 4G3GA 3AT2A 5M44A 5EYKA 2YIRA 3CXWA 2B4SB 3OXIA 2P2HA 3NZ0A 2CCHA 3OEFX 4YZNA 2WOUA 1E1XA 1K2PA 2IZUA 2BZKB 3BZ3A 4L9IA 4J98A 3QYWA 4Y46A 3E8EA 4BWPA 1REKA 1M17A 5ETCA 4QTEA 3ACJA 1JAMA 3COMA 4RGJA 4ZTQA 5I9UA 4DFXE 3A60A 2ITXA 4OTDA 1QCFA 2OJFE 4YPDA 3GEQA 4MAOA 1GZNA 4WSQA 3H9OA 4IAAA 4GK3A 1GJOA 2QO9A 2GCDA 4D4SA 2QURA 4QP4A 3NR9A 5DIAA 3FI2A 4MD8E 3LJ1A 3ORZA 3F9NA 1AD5A 3MFTA 5H2UA 5EK7A 5DH3A 4XG9A 5E8TA 3F88A 1Z57A 4KSQA 1CDKA 3PY1A 3RKBA 4PRJA 1KE9A 3BGQA 3HMNA 5CU0A 2VUWA 4IJ9A 2CDZA 2F4JA 3KN6A 3OD6X 4FEQA 1X8BA 3R7UA 5I9YA 3VF8A 3R2YA 5KUPA 4D2SA 1YHSA 2C3IB 3PXQA 2I1MA 4M13A 4HJOA 4V04A 4Y5HA 2UZTA 4Z16A 2W99B 2WPAA 2Y6MA 1QPJA 3FLSA 3QQUA 1GOLA 4BIEA 3B8RA 4IM2A 5AAFA 4ZLYA 4ZZNA 3A62A 4ZTMA 4ANMA 4O7ZA 4S30A 3UJGA 2LGCA 3S95A 3O50A 4CFUA 2FB8A 4PTEA 3WIKA 2QG7A 2ERKA 5IQDA 3Q9XA 3ZDIA 4EQCA 4CZTA 3HAMA 4QYHA 3UVQA 2OZAB 1OPLA 2BRMA 4UN0C 5LVPA 1VJYA 3CGFA 2XK6A 4G3EA 4HYHA 4PQNA 5J87A 4BHNA 3R7VA 3BE2A 4FSZA 3NYVA 5HNBA 3JR1A 5AJQA 3S1HA 1ATPE 3ZHPC 2YWPA 4QP8A 2YERA 3DZOA 5T3QA 4ZJIA 2PHKA 3FYKX 4YTCA 3LW0A 4YJVA 3KGAA 3F7ZA 3IQ7A 4FG7A 2WMBA 5EYDA 5TKDA 5J7HA 4G3DA 2IVTA 2AC5A 4PTGA 2UUEA 4X2NA 3ZC6A 4FV2A 5CF8A 2PZRA 4QMZA 1J1CA 4FEUA 1SYKA 1ZY4A 2WEIA 3OROA 2Y8OA 2BZJA 4EUTA 5IEVA 2VU3A 1R0PA 5IEXA 3VUKA 4M8TA 2FSLX 4GS6A 4YP8A 3V5LA 4U7ZA 3EN4A 4ANQA 2W4JA 2JKQA 2ITWA 3GNIB 1XH6A 4AF3A 5CAQA 1OM1A 2KULA 3SW4A 5HORA 3Q6UA 1UA2A 1V0PA 3V5PA 4ZAUA 3MPTA 4L00A 4O27B 3KULB 2XK8A 3CIKA 3GBZA 3CGOA 4LGHA 2KTYA 2UW0A 3ZLWA 2XK3A 5I0BA 3PG3A 3QYZA 5L4QA 3R83A 3RM6A 3TCPA 3FXXA 4RRVA 3UQFA 2VAGA 3GU6A 4D2PA 3D5VA 1R78A 4DEEA 5E4HA 3VRYA 4A9YA 3BKBA 4ZSJA 4E93A 4BVUA 4IDVA 4QT1A 4XV2A 2UZVA 2G15A 4L3JA 5GZAA 3VBVA 3CS9A 4FKGA 1H24A 4WBOA 4B8LA 2HIWA 3S3IA 3C4XA 3D5UA 3VHEA 5E1SA 3FV8A 4XP0A 3UO6A 4BHZA 5ACKA 4ACHA 1FVRA 3MY0A 2ZB1A 5HHWA 2VWZA 1XH9A 3CTHA 4JIAA 5BVOA 1M52A 5I9WA 4FEVA 4U0IA 2H9VA 3AGLA 1Y8GA 4M68A 4UX9A 3CY2A 3PLAE 4FTCA 4E73A 5ANGA 4AN9A 3AXWA 2DWBA 2GFCA 2VWXA 3RVGA 4A9UA 4GFGA 4B8MA 3QD2B 2IWIA 4G9CA 1SNXA 3KY2A 4QPSA 4XBUA 1PY5A 4RIYB 2IJMA 4ZTLA 3UODA 1SMHA 3FC2A 3FUPA 3VUHA 3CC6A 3NLBA 4AZTA 2X2KA 2XKFA 4IZ7A 3W33A 5IQFA 4JG6A 4X3FA 5L2QA 3TIZA 2X7OA 5CSWA 3EQIA 4G34A 4C7TA 2W05A 3WF9A 1Q8UA 4D1SA 2PVHA 3RWQA 2W4KA 4C4GA 5AR5A 3Q4TA 4RVMA 4YSMA 2R3QA 3ZO3A 2HELA 1IA9A 4F9AA 3VN9A 3NUAA 4N57A 5D11A 4QQTA 2EXMA 3Q5ZA 4ITHA 5JZNA 5HX8A 3N4UA 4EH3A 3DTWA 3LCSA 1LPUA 3EN7A 3ATSA 3OW3A 2W1EA 5JQ5A 3DY7A 2BCJA 3IGOA 1H26A 1P5EA 4S31A 2RGPA 2W1CA 3PWDA 3UOHA 3G51A 3W8QA 4MXOA 3OTUA 4RX5A 2C1BA 4KAOA 3RK7A 4KSPA 4L68A 5I5ZA 4ZSLA 4R8QA 5J79A 2A19B 2R0UA 1PXJA 4FIFA 4IAIA 4C33A 3V5QA 5B7VA 5CY3A 2GQGA 3CY3A 2X2LA 4RFZA 3JS2A 4FKRA 3GCUA 5FBOA 4RWJA 3RK9A 3GCSA 2VNWA 4E20A 2A0CX 1DS5A 4IB0A 4EOIA 5HBHA 3ZZWA 1OUYA 1M2RA 2C6DA 2WEVA 2GTNA 2HW6A 3KK8A 3LFQA 3U6JA 3UNKA 4XG6A 2OU7A 2X6DA 3QX2A 4FIIA 3KRLA 5K0XA 3KVXA 5FEDA 3VF9A 4TY1A 4QQJA 2Y4IB 4UYNA 4C61A 3FMKA 2BAQA 4FYNA 2ZMCA 1PJKA 1YW2A 4NM3A 5CF6A 2WTVA 3RMFA 2ITPA 4Y8DA 5CAVA 4AZEA 3R8VA 4TL0A 3NVKI 3U55A 3ZO2A 4WT6A 4TYGA 4AAAA 4AGUA 3ZLXA 1YHVA 2WMTA 3BHTA 2GMXA 3MJ2A 3MW1A 4EH7A 2YACA 2J51A 3ZUUA 2YIXA 3EOCA 3LFAA 3HAVA 4E6CA 5M09A 3LMGA 3P86A 3BEGA 5KCVA 4O38A 4IAZA 3FMHA 1LR4A 4U5JA 4DH8A 5HIDA 4CXAA 3QD4A 2H34A 4YO4A 5EW8A 5EKNA 4WKQA 4FEWA 3NUUA 5M4IA 2Z7QA 2DUVA 3DDPA 4I0RA 1TKIA 5CEPA 3W2SA 4ZMFA 2PMLX 2IW8A 2BDFA 3OT3A 3QXPA 5AP1A 4GYIA 2Y9QA 2W1FA 3BU6A 5GHVA 3C4EA 4NKSA 3D0EA 3FZPA 4YZDA 4FSRA 5AIRA 3DKFA 4EK6A 2V22A 1TVOA 1LEWA 3VW6A 1JKTA 1FVVA 3FHRA 2BALA 1BI8A 3FPMA 4RVTA 3FKOA 4ASXA 4HZSA 4B9DA 3KF4A 5ETIA 2ONLC 3S2PA 3EL8A 3VS7A 3FPQA 4MBLA 3ORLA 3W2RA 4AOTA 1WBPA 3L1SA 4CV9A 3UG2A 4U44A 5C8KA 2QO7A 3L9PA 3O17A 5BMMA 5BVWA 4L45A 5FEQA 4BI2A 3ZSIA 3ODYX 1OPJA 2X7FA 4TWPA 3L8XA 3TNWA 2PU8A 4ASZA 4CEGA 4H3BA 3E8DA 1ND4A 5F20A 3MJ1A 2YLEA 3T8OA 3PVWA 5ETAA 4EOLA 3ZC5A 1PHKA 1XHAA 1YXXA 5IA4A 2GHMA 1JSVA 2CLQA 3F5PA 5M06A 3ZUVA 1OUKA 4K2RA 1W98A 4ANOA 1J7LA 2QLUA 5FBNC 5K0KA 1JKSA 1G3NA 3BV3A 2W0JA 5IDNA 3FSKA 4EOSA 1U54A 4RX8A 3OBGA 2F49A 2BRGA 2J90A 4K33A 4ACMA 4U43A 5L6PA 3LAUA 4OLIA 4IVAA 4DTKA 2YDIA 4YLLA 4J97A 4EI4A 2BAKA 1GY3A 2UW5A 3CQEA 4GIIA 4IVCA 2FSOX 4IX4A 4C38A 5KMLA 4XRJA 4DG0E 5LMKA 2ZV8A 4RX7A 5CALA 3QU0A 3MA6A 4ID7A 1WBSA 2X7GA 3HDMA 3OC1A 3OT8A 3P23A 3IGGA 4WHZA 5HI2A 3HKOA 4BR3A 4CFMA 4TNDA 5EM7A 3HP5A 2HZIA 3BHYA 4FE2A 3Q04A 3TZMA 4CQEA 4KBCA 2WXVA 2XK4A 3KN5A 3C4WA 3P0MA 4ZOGA 2X6EA 5CVHA 3LQ5A 5CSXA 4X0MA 4BBMA 1LEZA 2JKOA 4QYEA 4AN2A 5AUWA 3H4JA 3P5KA 2ETMA 4BYJA 1BUHA 1Q5KA 1Q8TA 4BWKA 4K11A 5AA9A 2VD5A 3NAXA 2UW6A 3OWJA 4E6AA 2BHEA 1ZRZA 3L9MA 3R02A 4I5HA 4K6ZA 4ZZMA 4D5HA 2F7XE 3FZRA 3MH0A 3ULIA 4JQEA 2QR7A 4RVLA 1XQZA 4PDSA 2XBAA 4F08A 1ERKA 4J99A 4XUFA 3RJCA 4R77A 5AR8A 4LOQA 5HCYA 4E4XA 3UTOA 1UNGA 4R3CA 1VZOA 5AR4A 3DAKA 1STCE 3VO3A 3PXKA 4RT7A 4PL5A 4E4NA 4RX9A 5AUYA 4IVDA 4YBJA 5E1EA 4G6LA 4FG8A 5I9XA 2XIRA 2XNEA 1XO2B 1JVPP 5FXSA 2IZSA 3QHRA 3AGMA 3OZ6A 4D4VA 4N6YA 5JRSA 3NNXA 2W1ZA 3BYOA 4ZTNA 5I9VA 2VTHA 5CYIA 4PX6A 4YZ9A 4BB4A 4E6QA 2ERZE 3GT8A 4XYFA 4L3LA 3DCVA 4KIOA 3OXTA 2UZWE 5EYCA 3Q52A 4RPVA 3ALOA 2HK5A 3REPA 3WYXA 3L8VA 3OVVA 5M4CA 4YGAA 5FUTA 4RJ7A 3CBLA 4JX3A 5CSPA 1H08A 1Y57A 3SHEA 4P4CA 4ZTSA 1J91A 4JG7A 4F1TA 4M66A 3Q9YA 1BMKA 3P79A 3R7GA 2XM9A 3FZ1A 5CT0A 5AM6A 3IW8A 3ZEWA 3Q9ZA 1AGWA 3IO7A 2WTWA 4FTRA 4XG3A 4RG0A 3TNQB 5CZIA 5HG7A 3QZGA 3EKNA 2XIZA 1HCKA 2BAJA 5LOHA 4R7BA 3LMHA 4GEOA 4EUUA 4F64A 1IG1A 4NJ3A 2R3LA 1NVSA 3GB2A 4GL9A 3D7TB 4BN1A 1BKXA 4BDGA 2R0IA 3R9RA 5BMSA 1F5QA 4ZK5A 4FKOA 4DF3A 2VTLA 4AACA 4E7WA 4ERWA 2VGPA 1OKZA 5EM8A 3TKHA 4EOMA 1SVGA 3AD6A 4I20A 4H1JA 1XH7A 4HOKA 4GU9A 2R3JA 2PMOX 3UG1A 4E5WA 2R3MA 4XJ0A 1I44A 4TPTA 3TV7A 4IX5A 4R5YA 2QNJA 5K5NA 2GNIA 3QC4A 1REJA 5DBXA 2XIKA 5HVKA 3V51A 3UMWA 4ACGA 2OIQA 4O0WA 3EFLA 3WYYA 3F3ZA 4JRVA 2XEZA 5E8UA 4YR8A 2X9EA 3OY3A 5EG3A 4CCBA 4FSNA 3DBQA 5HLPA 5KZIA 4ZMEA 2PZ5A 3FSFA 3VBYA 5KBRA 2RSVA 3NS9A 4II5A 2ZV2A 2C6OA 3QZHA 5I4NA 4MWHA 1J7UA 3W16A 2GPHA 4XP2A 4FBXA 4M97A 5HG9A 5CAPA 2ZDUA 3KA0A 3TN8A 2WTKC 2JFMA 5HO8A 1G8SA 4TW9A 2EB2A 4OTPA 4EHGA 5IQBA 5EM5A 2YITA 2YDKA 5HE1A 5CVGA 3W2OA 2IZRA 1GIJA 2B52A 3DBFA 3NIEA 2WQMA 2C3LA 2BRNA 2WU6A 4RIWB 4YO6A 5HQ0A 4FV4A 3F2AA 4BCNA 4BRXA 4W4XA 3RBWA 2ITUA 2X8DA 5TT7A 3RGFA 1YWRA 3LJ2A 4O7RA 3C0GA 3PPZA 4PL3A 2VTPA 4AT5A 4HNFA 3FBVA 2QC6A 4FSUA 1Q41A 3FXWA 4UWBA 3CTJA 3FKNA 3DK7A 3LXPA 5EI2A 1Q8WA 3WOWA 4BCKA 3LCTA 4J8NA 3R7EA 4PNIA 4DHFA 2H96A 4C2WA 4C3RA 4GVJA 4RSSA 4IFGA 5DYJA 1G8AA 5ANKA 4O0TA 2C6EA 1UU7A 3SRVA 3TWJA 2C69A 4OTGA 3VHKA 2PZPA 4Q2AA 3SGCA 5CU6A 4KRCA 4BKYA 5DNRA 5LVNA 2XIYA 3FI8A 3I7BA 4YC3A 4FT9A 4MEDA 4FIJA 4XRLA 2RG5A 3HMMA 2UVYA 5TR6A 1OKYA 3E64A 1NVQA 4QMUA 3FY2A 3OCTA 1H28A 4AXAA 4YJQA 3AC4A 2IN6A 4IWPA 4F1OA 5CSVA 2EVAA 2XJ0A 4YTIA 3HP2A 3E8CA 1SZMA 3I0QA 2QOFA 2OW3A 2JIIA 3EMGA 4K0YA 3UOJA 5AX9A 2F7EE 4N6ZA 2HAKA 2OXYA 4KS8A 1TQPA 4R5SA 3RAHA 1DI8A 2VTAA 4ZTRA 3NGAA 3GCVA 4XX9A 2CN5A 2FSTX 2X9FA 4NT4A 3L8SA 3IDCA 3HECA 4HVIA 1OKWA 4QMNA 3KEXA 4IB3A 4AW0A 5CF5A 4IAKA 3DFAA 2C6IA 2J5FA 5IH4A 3VBWA 4MBJA 2CGWA 5BX0A 4BZNA 4OBOA 4NSTA 4QMPA 2YAKA 3P7BA 3ANRA 5HO6A 3QCSA 4GFOA 4BTJA 3O7LD 4AW5A 3D94A 2G2IA 5M07A 2I0YA 5DI1A 2WB8A 4GV1A 5HESA 4ENXA 3C5IA 4EOKA 2VTNA 3CLYA 2C5OA 2C5XA 3ENHA 2EB3A 1UU8A 4FKPA 4TYHA 4Z9LA 3D5WA 3NDMA 4O21A 4U81A 4D28A 3QTWA 4HCVA 1Q62A 3KXMA 4QRCA 3V5JA 4CRLA 4O7TA 4DITA 4WG4A 5FTQA 3RPVA 3E7OA 1E9HA 3EN9A 2NO3A 4GU6A 3SXSA 3V8TA 3ZM4A 1WFCA 1VEBA 2WO6A 4JAIA 4JRNA 4CMOA 4QPMA 4JQ7A 4HNIA 5ETFA 4FC0A 3E62A 4IWQA 5HVJA 4OAVB 2IO6A 5A3XA 4FTNA 2J5EA 3KCFA 1J7IA 1OBDA 3SC1A 4HCTA 3QLGA 4E4LA 2Z7RA 3ERKA 2IG7A 1NXKA 3NRMA 3PJ1A 3K5VA 5FWKK 3UMXA 1Z5MA 1ZMWA 5BQ0A 1WAKA 4IADA 4IXPA 4OTWA 4IMYA 3QF9A 4X3JA 5I3OA 4E5AX 1J1BA 3BIZA 2UZNA 5HEZA 2YZAA 5B2KA 3GU8A 2WFYA 2HOGA 3DB6A 3KREA 5HBJA 4H1MA 5AP2A 2VO6A 4CZYB 2YZLA 2NRUA 4RC2A 4AFEA 4FF8A 2XNMA 4XOYA 4FL3A 4CD0A 4PTCA 3DJ5A 3LCDA 1R0EA 3Q53A 2WMXA 5CTPA 3H0YA 4USFA 4WO5A 3WE4A 4F6WA 1HCLA 3TJCA 3FI3A 3Q6WA 4WUAA 3NMUF 4G5JA 3UZPA 3PP1A 5AAEA 2JDSA 1P14A 5DE2A 3ZSGA 1H1SA 3R1QA 1ZMUA 3QQJA 4G3CA 4DCEA 4A7CA 3TNPC 5M51A 3OCGA 3RAKA 4O7SA 2W1DA 2V7AA 4V0GB 2C4GA 1XKKA 2WGJA 4WG5A 5ANIA 4BZOA 3CKXA 5DPVA 3RPRA 2HZ0A 4BIBA 4EBWA 4F65A 5AADA 4WOVA 3ZFYA 3QLFA 3MIYA 3SQQA 1Y6AA 4JJRA 4KINA 4IM0A 1XBBA 2PMIA 2PE2A 3DLSA 1UKHA 4I94A 1UVRA 2BPMA 3EQCA 1BL7A 1SVHA 5L2WA 3U54A 4MYGA 2VZ6A 1MRYA 4CCUA 4F6SA 2VN9A 4C2VA 3EN5A 3DKOA 4O91A 4GT4A 2PSQA 2UW8A 3Q2MA 2BTSA 4YSJA 1FPUA 4DBNA 2WTJA 1CMKE 3CD8A 2RFEA 2YJSA 3BLHA 3GGFA 3AMYA 1KV1A 3M1SA 5FD2A 3UP7A 4YLKA 5J8IA 2WQOA 1BI7A 5A14A 3PVBA 3QQFA 3PPKA 5L3AA 4S34A 1FVTA 4ZJJA 5DEYA 5AR3A 2FH9A 3C7QA 3PSCA 4O1PA 3M42A 3MB6A 3R9OA 4AW1A 3DK3A 1A9UA 3NYNA 3Q4ZA 3RCJA 4G9RA 3KMMA 3ZUTA 4CMTA 4ANLA 1PMVA 1SVEA 2C1AA 5M08A 4C4EA 4HZRA 3TZ8A 1PRYA 5HNIX 2UW4A 3A8XA 4KKHA 4O2ZA 2RG6A 3OWKA 1KV2A 3QTQA 3G9NA 3OCSA 4L46A 2OFUA 3D5XA 4M14A 5TOZA 3DKGA 2IW9A 3RI1A 4BBFA 3KXNA 4HPTE 1H4LA 4NFNA 3LMIA 3QCYA 1YXUA 3I6UA 3IG7A 3MB7A 3DAJA 4MXXA 4QOXA 1JSTA 1WBVA 2XZSA 3O2MA 3R1SA 5EDRA 3ATTA 2XK7A 4GUBA 5EYMA 5IUHA 2A1AB 2Z7SA 4MK0A 4NU1A 3WI6A 4FR4A 2JDVA 2XIXA 3EJ1A 4G31A 4IAFA 4RA5A 4FTUA 3VBTA 4EOQA 3VS1A 4I92A 3R30A 3VS6A 5M57A 1Q8ZA 3BBWA 4O6LA 4CG9A 4LL0A 2JITA 3GU5A 3LLTA 4MNEA 3RPYA 4ENYA 4PUZA 3W8LA 2BFYA 3VS0A 4FMQA 4FT3A 4YTHA 5A6OA 5KMKA 4PMSA 4M84A 3NIZA 3UOLA 3UIBA 5FQDC 5FTGA 3ORMA 3U87A 4CSVA 4KIKA 1G5SA 4IE9A 5ANOA 3F5XA 4A9SA 2EXEA 3H9FA 3C1XA 3HV3A 4FL2A 1APME 2C6TA 3UO4A 3VUTA 4CNHA 1ZY5A 1OVEA 2VO3A 4C37A 5DWRA 3DBCA 5IQGA 3T3UA 5BVFA 2B53A 4MTAA 2FYSA 1H00A 2QHNA 2ACXA 3EQFA 2WIPA 4YZMA 3WF6A 3SG9A 3W10A 4YTFA 1XWSA 5C4KA 2PZIA 4BFMA 3UIXA 2R5TA 3ZLSA 5HCZA 4TWCA 4O7WA 2QHMA 3FQSA 2WMAA 4P5ZA 3HRBA 5IQAA 5HGIA 3CPBA 1UU9A 3GFWA 4MHAA 5F94A 1ZYJA 3NAYA 4FKVA 3VS3A 1HOWA 3MV5A 2HENA 4K8AA 5F4NA 4YU2A 3NYXA 5IISA 2YHVA 2ZYBA 3K54A 5IA2A 3BCEA 4ITIA 4GK2A 1A48A 2ONLA 4UMPA 1F0QA 2JD5A 3MTLA 2O0UA 1XJDA 5AR7A 2W5BA 5BVNA 4ZXTA 4ZY4A 2QOIA 4FK6A 4WA9A 2WAJA 1P2AA 4CZUA 4ONAA 4B4LA 5JRQA 3IPHA 3TUBA 2CKOA 4BDKA 5E9EA 4XG4A 5E8YA 4ZY5A 3GQLA 1PXIA 5DGZA 3R01A 4AOIA 2G01A 1YOJA 4FSWA 1R39A 5AM7A 3R04A 1ZYCA 5BYLA 3DU8A 4E5BA 5KHWA 2JKKA 4EH8A 5J7BA 4D1ZA 1YXVA 4NYEA 2I40A 4M0ZA 2A4LA 3QCQA 2OZOA 5BPYA 5DA3A 4I6QA 4I6HA 4LMNA 5C8MA 4DTBA 4CFXA 3PJ8A 2XS0A 3ZBFA 1YWNA 1DAWA 2BIKB 1OGUA 4C4FA 4RJ8A 3AOXA 3ET7A 1PXKA 5HCXA 4YURA 3VQUA 1O6KA 4PY1A 3VS4A 3G6HA 4BIDA 1VYZA 3KQ7A 4D5KA 3D2IA 5I9ZA 1H07A 4DTAA 5F95A 3JY9A 2CGUA 5HD7A 3HYHA 3P78A 3P7CA 3FC1X 4WNOA 3DJ6A 5KKRB 1AQ1A 1FQ1B 2RFSA 1M2PA 5KMJA 2B54A 2CCIA 4IEBA 4C35A 2QONA 2X2MA 3DV3A 2XA4A 1RQQA 4B0GA 3SOAA 5KNJA 1YQJA 4EONA 2RFNA 4QMXA 3R9NA 4EZ3A 3G5DA 5JT2A 3PY0A 1UNLA 2P4IA 3ZDUA 5K9IA 3PPJA 3ORIA 3GFEA 3O71A 2UZEA 1YXTA 1SNUA 1Q24A 3WZUA 4NIFA 1Q3WA 4FV1A 5AP5A 4MD7E 2DQ7X 1OKVA 1XR1A 2OIBA 1PMUA 4PPBA 4U8ZA 5TO8A 3RNYA 2UZBA 3FLNC 1MQBA 2UZLA 4GJ3A 4IH8A 1W8CA 3H9RA 2X4ZA 2JDRA 4EHEA 3OP5A 4EH6A 4NCTC 4JG8A 2P3GX 1DI9A 3PZEA 3Q4UA 5AP7A 3QKLA 1W83A 5DRBA 4OT5A 4EKKA 3DXPA 4X3FB 4USEA 2YWVA 4QO9A 1ZMVA 4XEYA 4DBXA 3QD0A 2E9PA 4JAJA 2I6LA 4Q5HA 4N4SA 5EW3A 2E9NA 4RJ5A 2R3KA 1T46A 5T68A 2ZMDA 5IMXA 4UALA 4LMUA 2ITYA 3MPAA 2PUPA 3LVPA 5HBEA 4KS7A 3DA6A 3OF0A 4YJPA 3TM0A 3F3VA 1H1QA 3BEAA 2PY3A 3KXZA 3LFEA 5JEBA 3ID6C 4O7YA 4MD9E 3TZ9A 3W32A 2CNUA 4QD6A 3MVJA 3FEGA 3PVUA 4OBPA 2CGVA 3PXRA 3MH2A 1XH8A 2WMQA 1W7HA 5EOBA 2QOQA 3GVUA 4FTLA 4AX8A 4ITJA 2J0JA 1H0WA 4DH1A 4GK4A 3EQGA 5HE3A 3IOKA 4FZDB 2PVJA 2O64A 4JBOA 5L2TA 4YZBA 5CX9A 4FT5A 3A2CA 4MQ1A 1Y8YA 4I0SA 2PYWA 2CLXA 5HTBA 4U80A 5DT3A 2ITTA 2PPQA 4AGCA 4DLJA 4O0YA 3ZU7A 3MH1A 5AUZA 4EWQA 2XNBA 3U51A 4ORKA 3DK6A 5EDPA 3AT3A 4FKTA 5I3RA 4PNKA 5IA0A 3F7WA 3PA5A 3RWPA 5JMSA 1ZXEA 4F0FA 4M0YA 2YEXA 4Y72A 2FGIA 3PFQA 3ZRLA 1OIYA 4RMZA 5F9EA 2EUFB 3PUPA 3FMLA 5GZ8A 4EH2A 4Y95A 4O0RA 5FM3A 4EH5A 3P08A 3PXYA 4ZLZA 5AIKA 2XCHA 3Q4CA 4X2KA 4EORA 3NNWA 2I0EA 1CKIA 4W4VA 3LFDA 1PYXA 3IDBA 5H8GA 1UWJA 2PVNA 1ZARA 3O8UA 5JGBA 3I6WA 4D58A 1JSUA 3UO5A 4ASEA 5J1VA 1WBWA 2Y4PA 5A4QA 3S0OA 2XKCA 2J2IB 4FV9A 4J95A 2G9XA 4ANNA 1BLXA 1MUOA 2JLDA 3E8NA 5L2IA 4DEGA 2VO0A 2O2UA 3CJFA 3WZKA 4YHFA 1VYWA 1WBOA 3D4QA 3E92A 4MX9A 4EYJA 4NJDA 4PF4A 4BCIA 2ZB0A 4YJSA 3OEZA 3QTSA 4YUQA 5K4JA 4BDCA 2XB7A 4UBAA 4DH5A 1H01A 3FMEA 4FKIA 4I1ZA 4TKSA 2HCKA 2GNGA 5EHYA 4FVQA 3OG7A 3A8WA 3DNDA 3MDYA 4MWIA 5EI8A 2ESMA 3DBEA 4EL9A 5IH6A 3ZCLA 3R9DA 3RCDA 2F2UA 3R1YA 2WTCA 4JLCA 3V6RA 3MBLA 4NH1A 4F0GA 2OF2A 4ZEGA 4F7JA 3GCQA 4YJTA 1YHWA 5KMNA 3UYSA 5L2SA 5JGDA 2JFLA 4Q9SA 3EQBA 1NA7A 4E6DA 5AR2A 3VBXA 4CQGA 3FLWA 3QQKA 2V0DA 2CKQA 2YLFA 5GIPE 2C5YA 3PJ3A 1U54B 4XMOA 4IHPA 2GSFA 3GOKA 3AMAA 3N4VA 5LJJA 2W1HA 3AC5A 3EQPA 4EK5A 3FL4A 5DRDA 3U6IA 1RDQE 4DH7A 4WSYA 5AAGA 3PP0A 4ZSAA 2XK9A 5LVMA 3R6XA 1XBCA 1MRVA 2YJRA 4QNAA 5DN3A 1BYGA 4Y85A 2OICA 1YOLA 2FSMX 4N0SA 3VS2A 4LV8A 5JGAA 5HLWA 2QOBA 4FA2A 5JZJA 3VQHA 4IB5A 2HZ4A 4TZRA 5JFVA 1BX6A 1FGIA 2W17A 3R2BA 3R28A 5E92A 4LM5A 2B0QA 4UY9A 3K2LA 2CHLA 1QPEA 3KRXA 4H39A 4I22A 4G6NA 4IC8A 4U6RA 5GJDA 5CI6A 3ZFMA 1JLUE 4JX7A 4O83A 1H25A 3QKMA 3Q3BA 5HKMA 3E87A 3HV7A 3QL8A 4QYFA 2OJGA 3WZJA 3C13A 5LVOA 4YC8A 3DDQA 4F63A 2IVSA 4BICA 4C0TA 4CKRA 3SXRA 3VS5A 4IFCA 2VWIA 3OTVA 4L53A 1GZ8A 3R71A 1P4FA 4GJ2A 2NPQA 2ITVA 5HVYA 4DFYA 4UXQA 2YDJA 4PMMA 3KXGA 2RL5A 5FP6A 3F2RA 3VJOA 3QTRA 5HNGA 2QOCA 3BHHA 4ZTHA 2VRXA 5CNOA 3FMMA 3HEGA 4I6BA 3LJ0A 4OTRA 3RTPA 5CSHA 3PIZA 4HVDA 4FTJA 1YRPA 2ZOQA 3FY0A 4JBVA 5F1ZA 3SD0A 4FNYA 4DEBA 1YVJA 2H8HA 3BWFA 3ENMA 2PWLA 3NUSA 3F69A 2JC6A 2EXCX 1KE5A 4U40A 4Z3VA 5KMOA 2ZM3A 3DXQA 2DYLA 4J71A 4LUEA 3RM7A 4QTBA 2PVFA 4OTHA 2JGZA 1ZZLA 2E9VA 3LZBA 4X6RA 3UPZA 2GNLA 3MGYA 2JAVA 1JWHA 5E8XA 2Y4IC 3ZO1A 3H0ZA 3QUDA 1JBPE 3QGWA 3E3PA 4LGGA 3C5UA 2PMNX 5D1JA 5HG5A 4I93A 3MFUA 3A7HA 4BKJA 3SLSA 2GQSA 3VJNA 3M11A 1BL6A 4NEUA 4UB7A 3EYHA 5EI6A 3ZONA 1O9UA 4NZWB 4ZIMA 2IPXA 4G3FA 2PVYA 4KBAA 3VUIA 4FUXA 4EEVA 5GNKA 1OL6A 2W7XA 1UU3A 2AYPA 3PJ2A 2V7OA 4UZHA 1U4DA 5CWZA 3TTIA 4DGOA 5DT0A 4BDFA 1PKDA 2XJ1A 2VV9A 4S33A 4FIHA 4QMVA 4LRJA 3NUNA 4AA4A 5IZFA 2OJJA 2GQRA 5CAOA 2VX1A 2Y6OA 2FUMA 5L8KA 4D2WA 2NNWB 2O65A 4O7VA 3BBTB 5AV4A 4I6FA 4YNOA 4RIXA 4BTFA 3FJQE 4R1VA 4XH6A 3I0OA 4LG4A 3GI3A 3SA0A 3UOKA 4EK4A 4RQKA 3G9LX 2UW9A 4BDIA 4CGAA 5B0XA 1YWVA 1ZOHA 4AZVA 3U4WA 4RWIA 5FXQA 5L8JA 3W55A 4K1BA 5AP0A 1UWHA 5LXMA 4I5CA 5DR9A 5AP4A 5M55A 5IUGA 1UKIA 3ORKA 5BUJA 3TXOA 1DM2A 1PXOA 3FYJX 2RIOA 3NUXA 3R00A 3QKKA 5IQHA 5L6OA 1U5QA 5E8VA 4IWOA 2JDOA 3HMPA 4WRSA 5BYYA 3O8PA 4KIQA 4JR3A 2UW3A 3EWHA 4WRGA 2BVAA 4X2JA 3JYAA 4DN5A 1Q4LA 5A4TA 4FKLA 2Z02A 3BQRA 1H8FA 1OL7A 2C3JA 4AS0A 3ELJA 4FSTA 5GJFA 3FL5A 3F3TA 3P7AA 1CSNA 2YCFA 2HY0A 1M7NA 3PZHA 2GS2A 4BCGA
chains in the Genus database with same CATH superfamily
3FMDA 1PYEA 3GCPA 5CXHA 5KMIA 1EH4A 4HGSA 4RIWA 4UMQA 3RAIA 3UIUA 4EQUA 3OY1A 3QFVA 5JFXA 1TQIA 3G15A 4FEXA 4C4JA 2WMWA 5DR6A 4RIOA 4BDDA 4BDBA 4XHKB 3HV5A 2R4BA 4CLJA 5AP3A 3TV4A 5HLNA 4FOBA 1JKLA 3D7ZA 2XAOA 4G6OA 3SKCA 3UGCA 2VTTA 5HU3A 3QQLA 4B99A 3ORPA 4Y83A 4YLJA 1M14A 2O8YA 1VR2A 2WIHA 2PULA 5BVKA 3W1FA 3P9JA 5D9HA 4FV5A 4AE6A 2ZDTA 1WBTA 3C9WA 4I4FA 4TYIA 2J4ZA 4R7IA 4G17A 1WZYA 1RW8A 2BRHA 1KE6A 4K18A 4M7IA 4QYYA 4IBMA 4KBKA 4DYMA 3WILA 2R7IA 4I21A 4CFNA 2BKKA 2UV2A 3JY0A 4GVAA 4QMQA 1Q99A 4CYJA 4RWKA 3SRVB 3W0SA 4M3QA 5C27A 3RP9A 3C4FA 4K9YA 3FXZA 1URCA 2QKRA 3LM0A 4KA3A 3WF5A 2C6LA 3M2WA 3U9CA 3V8SA 3TT0A 4BY9E 5HIBA 3ETAA 5AMNA 2GS7A 2W5AA 3EYGA 3ZOSA 2IVUA 4A9RA 1FINA 1SM2A 1Y91A 4JXFA 2CGXA 2XBJA 3QRUA 4MCVA 4P5QA 3VNTA 4WNKA 5LWNA 3ULZA 2CMWA 3C51A 3MI9A 2YM5A 2CNQA 2PVKA 4JDHA 1ZYLA 3GC8A 4CT2A 4HYUA 1PXPA 4FNWA 3V6SA 3HA6A 3PTGA 3AD4A 4EH9A 5EDQA 4FGRA 2VWYA 4UXLA 3QTZA 5GJGA 1OIRA 5T6KA 3TIYA 3ZXTA 3CCNA 2GTMA 3W2QA 2B9FA 1WCCA 2OKRA 2YCSA 4O2PA 3VUDA 3IONA 4PDOA 2X1NA 2XNNA 5ICPA 2V55A 4F9WA 3TZ7A 4DC2A 4Q5EA 3UVRA 4ZJVA 4FTAA 3O23A 3BYUA 3EIDA 3FMNA 3BWJA 5KO1A 3PRIA 1YXSA 2BILB 2QD9A 3KK9A 3OUNB 4BI0A 3W0NA 3SV0A 4D2TA 3EQRA 3KRWA 3RK5A 2OFVA 3I7CA 1ZZ2A 3R21A 3NUPA 4ANSA 2P55A 2CJMA 2OXXA 3DJ7A 5IUIA 3A99A 3BELA 3RINA 4LRMA 5IA1A 4L44A 1WMKA 4YZCA 3IW6A 4PPCA 5C8NA 2WELA 4AWIA 4TYHB 1MRUA 2VX3A 2XNOA 3KXXA 1KUTA 2UZUE 5J9YA 1H27A 5J5TA 4BZDA 4AG8A 4RJ3A 4ZZOA 4QMMA 1QL6A 3U6HA 1S9JA 5CASA 1PXMA 3BHVA 4D55A 4E3CA 3QHWA 2Z7LA 2QO2A 1W82A 4KRDA 5DLSA 4APPA 5C1QB 4H3PA 3UIMA 2J0IA 4IZYA 4M69A 5IMEA 2QG5A 3HMOA 2XNGA 3CR0A 3I5ZA 3PG1A 1WVYA 4JT3A 2QKWB 4XS2A 4YJNA 4R6VA 2UZOA 3KMUA 2G2FA 4BDEA 2XVDA 4AA0A 4W9WA 4OAUC 3DNEA 4KNBA 3UVPA 3ZSHA 2J50A 1P4OA 1YI3A 5FLFA 5H9BA 5IA5A 5HE0A 2J7TA 3E93A 4JVGA 3ZLYA 3TJDA 2X8EA 2W06A 4JR7A 4R3RA 4CFVA 3R22A 4AFJA 1KSWA 4LUDA 5HO7A 4FTTA 4I23A 3MYGA 4F7SA 1FMKA 5GZ9A 2GNHA 3NSZA 3PIYA 3LQ8A 1NY3A 4KABA 3AKLA 4H36A 2REIA 5FG8A 2GHLA 3L9LA 1JPAA 2OSCA 2C5NA 4FT7A 2YA9A 3RNIA 3A7GA 5HZNA 3IW7A 2Y0AA 3RALA 3FLYA 5GINE 4CYIA 4AOJA 4V0GA 5FTOA 4FZ6A 3HRCA 1DAYA 2ZM4A 4ZSGA 5EQEA 1H1PA 3OUKA 4O0SA 4FI1A 3ZBXA 1MQ4A 3ZZEA 2JIUA 4BC6A 3F5GA 5CEKA 3PJCA 5JK3A 3I81A 2A2AA 2HXLA 3NNVA 4X6QC 3ACKA 1OL1A 4QMWA 4E8AA 2JAMA 2ITOA 3H3CA 2EWAA 4HGEA 3DT1A 3QQHA 2CNVA 4L67A 4OBQA 2Z60A 3UBDA 4HW7A 1QPCA 1XMLA 3WF7A 4DDIA 4FK3A 3ANQA 1TFFA 4DH3A 3HGKA 3ZRMA 5J5SA 4NCTA 2R3PA 3NNUA 3I1AA 2BIYA 4JL9A 3MWUA 4YPSA 4G5PA 3KF7A 3ITZA 4ZY6A 4HPUE 4QTAA 3WBLA 2F7ZE 4L01A 1IEPA 1OI9A 2C5VA 2I0HA 2R3HA 3QA8A 4LV5A 1W0XC 5K3YA 4D1XA 5G6VA 5KE0A 4PDYA 5AP6A 1YOMA 5EKOA 2R2PA 5EHLA 3ZYAA 5A4LA 4JDKA 5EQYA 1YI4A 4BBEA 4DEDA 4C58A 3RHKA 2J6MA 4TWOA 4Y5QA 3COKA 1O6LA 5AV0A 2X81A 3D2KA 1PMNA 2OG8A 3C50A 4NK9A 4DA5A 4ANBA 4EC8A 1H1WA 3FZOA 4QMLA 4XV1A 4UYAA 2XF0A 2CKPA 4AZSA 2XRWA 4TN6A 4XV9A 3Q96A 4AQKA 1JKKA 5AUUA 2B9IA 3C0IA 1CKJA 2C6MA 3DGKA 5CI7A 5DT4A 3II5A 1XH4A 3FZSA 4IANA 5JQ8A 5CEIA 3ORXA 2XP2A 3JUHA 4BDAA 2DS1A 4D0XA 3UDZA 3QRJA 4QTCA 3MVLA 5LMBA 3SAYA 2C0IA 4EYMA 3IK3A 3CTQA 4C36A 2VWWA 4TYEA 3FQHA 2R3OA 4PL4A 3BYVA 4JNWA 5B2MA 3WARA 4ZSEA 3FE3A 2PL0A 5DVRA 4FIGA 4WNPA 4BF2A 4E26A 3GENA 3LQ3A 1T45A 2WKMA 4A06A 3LKMA 4TWNA 1Q61A 5FM2A 1MP8A 4FJVA 4XCUA 2QU5A 4JIKA 3QQGA 4MNEB 3WZEA 2EU9A 4AGWA 1YKRA 3KL8A 2XARA 2YCQA 1LUFA 3VWAA 5LCKA 5A6NA 3OCBA 4KIKB 4CFWA 5IKWA 4BI1A 2Q0NA 4IDTA 2VWBA 4KKGA 1OL2A 2OZAA 3FLZA 3EZVA 2BRBA 1PXLA 4PV0A 4UMTA 4YNEA 2ITQA 3F61A 4HVSA 3CQWA 3V3VA 1URWA 3SG8A 2O3PA 3E63A 2PUUA 5JSMA 2PUIA 5E90A 3BU5A 3P4KA 3G0FA 3QTXA 4CFFA 3DQXA 3EFJA 4GCJA 3GU7A 2QOOA 2FA2A 3EN6A 4OT6A 3R63A 4P2KA 4AZWA 3LCOA 4V05A 3ZEPA 5KHXA 1FMOE 3EQDA 3R8MA 4KWPA 3AC2A 3EQHA 2X4FA 4IWDA 3UZRA 2HWOA 1OITA 3W0PA 2OXDA 5IA3A 3TACA 4GT3A 2YFXA 5ACBC 1OMWA 3DQWA 4DFNA 4Z7HA 3QCXA 4FVRA 4RC4A 1R1WA 3KULA 3B2WA 4JOAA 4GRBA 5LARA 3PXZA 4NTTA 2QLQA 4XP3A 1V0OA 3VUMA 4C62A 3HZTA 3BL9A 1GIIA 3E5AA 3I4BA 4U3ZA 4D9UA 1ZAOA 3TEIA 3TUDA 3HLLA 2XKEA 3FHIA 3EFKA 3FI4A 4MNFA 5M56A 4U9AA 4EOOA 2IW6A 3AC8A 4DT9A 1NVRA 4TT7A 4KKEA 3UNJA 5HOAA 4TXCA 2V5QA 1QPDA 3Q5IA 3TKIA 1OL5A 2AUHA 4C8BA 1U59A 1RE8A 3QTUA 4NKAA 2CSNA 4O0XA 2HWPA 3PE1A 4J53A 3PLSA 2C0TA 4TTHB 2PE0A 4FGBA 4NM0A 4FV3A 2PVLA 2UW7A 2YM3A 3A7FA 3AMBA 3W0MA 2W1IA 3CJGA 4PP9A 5JKGA 3R8PA 3PSBA 4HVHA 2BKZA 3FKLA 2JKMA 5CS6A 1OIQA 2H6DA 2PZYA 1IAHA 3KFAA 2B7AA 4RJ4A 5E8ZA 5HICA 4Z7GA 4O84A 4R1YA 4GH2A 4FKUA 5E8SA 3RAWA 4DEIA 2IF8A 3QZIA 5FP5A 3UC4A 4XG7A 1KOBA 4GKIA 4LYNA 4D2RA 4Z55A 4X21A 3WE8A 4RC3A 4W8DA 2NP8A 4PMTA 1FOTA 3R8UA 5IDPA 4RIYA 3NFGB 5IG1A 2YCRA 1U46A 3JVSA 4RBLA 1UNHA 4FUYA 4LRKA 4L52A 2BR1A 4C02A 4FV7A 5HG8A 4AGDA 3LXLA 3P1AA 4M12A 3UYTA 1I09A 3HV6A 4FOCA 4J52A 4QPAA 4KUJA 1IASA 5CQUA 4F9CA 4PMPA 2V62A 4NIFB 4DLIA 3HUBA 3T3VA 3UP2A 3KC3A 3ZTXA 3VRZA 4C3PA 5FDPA 4DG2E 3B2TA 3DFCB 4FV0A 4BJJA 5H3QA 2FO0A 4WIHA 3O96A 2YISA 4MH7A 4CMUA 2YM8A 5CT7A 3LOKA 5CVFA 2R7BA 3ZO4A 4O6EA 3TMOA 5JH6A 3O5AA 5BVEA 3LXKA 2QR8A 3AD5A 1PMEA 3GUBA 4ZS4A 1IA8A 4YHJA 4G16A 5D10A 2YIYA 4GMYA 1YDTE 2WMVA 4UV0A 4OUCA 4IAYA 4NFMA 1PXNA 5B2LA 1GAGA 3TDWA 3GU4A 3I79A 5CZHA 5IEYA 2VTIA 3ZMMA 4A4LA 4FNZA 4E1ZA 5D7AA 3HVCA 4IZAA 2X39A 3H10A 3H30A 5EW9A 4DFLA 4I24A 3BGZA 4AZFA 3COIA 4O4DA 4JI9A 4MXAA 4QMSA 5M53A 3F3WA 4PWNA 4QDVA 4QMYA 2QI8A 3POOA 5K5XA 4RFYA 5CXZA 4EOPA 3RPOA 2UVXA 4WUNA 5ANJA 5C26A 3TNIA 5C9CA 3DZQA 4UMRA 1W84A 4YJUA 2VTJA 3VVHA 5L6WL 4FIEA 1CTPE 3FLQA 4U97A 4O7NA 4RVKA 4NTSA 1WVWA 4A4XA 2Z2WA 3LPBA 3NYOA 4MF1A 4DINA 5CLPA 3QXOA 1K9AA 1V1KA 3CEKA 4DCAA 5CEMA 3C4ZA 3OS3A 5IH5A 4LI5A 5FXRA 4EH4A 1TQMA 3AT4A 3TI1A 1FGKA 1WBNA 3ZH8A 4RFMA 4FSQA 3BLQA 3K3IA 2JEDA 2XH5A 2VTSA 4AT4A 4ALUA 1UV5A 5BNJA 2VTOA 3GXLA 3I5NA 4L7SA 4CG8A 1GIHA 3E7VA 5C4LA 4BGGA 2B55A 3O51A 1OECA 3QBNA 3RZBA 4LQMA 4DT8A 5AUTA 4CTBA 1GZKA 3AC3A 1L8TA 5DEWA 4NWMA 4PPAA 5ANDA 5HTIA 5AUXA 4GG7A 5AWMA 3FQEA 4MF0A 4BCJA 3MS9A 5IF1A 2Z8CA 3HX4A 1B6CB 4EWHA 4NUSA 4C4IA 5AUVA 3IOPA 3SXFA 3F3UA 3NWWA 2BDWA 3D83A 3IS5A 4FTKA 3Q9WA 3QWKA 3V04A 3MTFA 4OTIA 2R3RA 4L8MA 4BL1A 4DGGA 4YMJA 4GKHA 2Q0BA 1NW1A 3BLRA 3LM5A 4XLIA 2GS6A 4QQ5A 1GNGA 3LE6A 3CP9A 5M4FA 2JDTA 3R8LA 3TDVA 4XOZA 5ITAA 5JN2A 1OIUA 3E88A 1PF8A 5LWMA 4DG3E 3PIXA 4BCQA 1ZOGA 3FZTA 2Q83A 2BTRA 5CU4A 4XLVA 2R9SA 2JBOA 3ROCA 3DB8A 3DXNA 4K77A 4NW6A 2IVVA 4AE9A 5CEOA 2WTKB 2J9MA 4FV6A 3WF8A 3NX8A 3TUCA 2PUNA 3LLAA 1NT2A 3A4OX 2O5KA 2WTIA 3NPCA 2WNTA 3BQCA 2F9GA 4IQ6A 2WOTA 2WD1A 2OF4A 2W1GA 3QRIA 3A4PA 1IRKA 3LFNA 2PVRA 3QX4A 4BGHA 4F70A 3AQVA 2WQEA 2XJ2A 2ZV7A 2BFXA 4JS8A 4FYOA 2XM8A 4MKCA 2J0KA 1LP4A 4ALVA 4F6UA 4AQCA 3KU2A 4B7TA 2SRCA 4X2GA 5H8BA 5KKRC 2OJIA 4OGRA 3HRFA 3PXFA 4DEAA 2XUUA 3HNGA 4GUEA 2IEWA 2ETKA 3JXWA 3R7IA 2X8IA 3POZA 4IB1A 4ZLOA 4D4RA 4FZFB 3BYSA 4W8EA 1S9IA 5E7RA 4AUAA 5A46A 3G0EA 2F2CB 4IIRA 3SX9A 5HTCA 3W0QA 3FMJA 2VWVA 1KOAA 3OXZA 5DMZA 5BV3A 3W18A 4WG3A 5AV3A 3VBQA 4A9TA 2GFSA 3NW5A 5HU9A 4FG9A 2GDOA 3F6XA 3PVGA 3FAAA 4HYIA 5LMAA 4ALWA 4LL5A 5L8LA 4ZP5A 1CM8A 5D7VA 2BUJA 2NYAA 5DOSA 2X0QA 3QC9A 2CKEA 3SOCA 3QD3A 5C01A 3QRKA 5E8WA 3T9IA 4HVGA 3D14A 3NUYA 2XYNA 4C4HA 2BHHA 3OHTA 4XG2A 1YDRE 4X3FC 4XV3A 2NRYA 4CLIA 5D12A 2G1TA 1G8KA 4RZWA 2YIQA 3LFFA 5EM6A 3R0TA 4O82A 4DGNA 2QOLA 4BCHA 3TTJA 3BV2A 4X7QA 4HCUA 3BRBA 4KD1A 4P7EA 3VUGA 3GC9A 4F7LA 3BPRA 3GC7A 1OZ1A 2XRUA 2ZV9A 2XCKA 5FEEA 2QOHA 5E91A 4JQ8A 3THBA 2P2IA 3DLZA 4EZ7A 4CT1A 2BROA 5EFQA 3UQGA 3ZFXA 3OOGA 3KRRA 3HDNA 4FV8A 2VX0A 2WQNA 4TNBA 2VWUA 4DFBA 3ZXZA 3RHXA 3QUEA 4NM7A 2C6KA 3RPSA 4FX3A 5A54A 5DR2A 3N51A 4QNYA 4BTKA 3DPKA 2WMSA 1ZYDA 3O0GA 3A7IA 4Y73A 4BCPA 3HMIA 3ZM9A 4GSBA 3MH3A 4LOPA 2OJ9A 3TL8A 2ETRA 1XBAA 3U9NA 2PE1A 2OH4A 4IVBA 5AX3A 4D9TA 5LCJA 3BU3A 4IX6A 4U3YA 4USDA 5CAUA 4OR5A 5HE2A 3ODZX 3R8ZA 5G1XA 1Q97A 3EKKA 3PRFA 1M2QA 3EH9A 2IZTA 2B1PA 4JBQA 3D7TA 4J1RA 4CVAA 3N9XA 4FZ7A 2B9JA 4F09A 4R7HA 4EOJA 3NVMB 1ZYSA 1K3AA 2R3NA 4FKQA 4O4BB 3COHA 2W96B 4GIHA 4O86A 3G90X 2QVSE 3HUCA 3MFRA 5AV2A 2ZVAA 3DAEA 3EHAA 1YI6A 3MN3A 4QMTA 4I4EA 2W4OA 3W2PA 3R73A 1QMZA 3LFCA 2AC3A 3U8WA 3NFFB 5LVLA 3NW7A 4H58A 3UPXA 4MXZA 1H0VA 2JBPA 3PY3A 4WD5A 2P33A 5TE0A 3UC3A 3BYMA 4UEUA 3JVRA 2BZIB 5C03A 2E9OA 4W9XA 4FRFA 2OK1A 5HX6A 4QP7A 4D0WA 3DOGA 4FSMA 3MPMA 2BDJA 2ITZA 2WTDA 4BDHA 1OB3A 4C57A 3Q2JA 4O1OA 5IQCA 1V0BA 4L6QA 1F3MC 3DKCA 4LGDA 4QQCA 5CANA 1KWPA 2P0CA 4RIXB 3HV4A 3EB0A 5FDXA 1H1RA 3VULA 4AT3A 4E4MA 2E9UA 2ZAZA 1E1VA 5CU3A 4WNMA 1B39A 1Y6BA 4FL1A 3VC4A 3WIGA 3OWLA 3CE3A 4BKZA 2YIWA 3G33A 4QTDA 1L3RE 3OFMA 2GNJA 2QCSA 3KKVA 4QYGA 4CTCA 2BMCA 2YM6A 4MXCA 5DHJA 3CQUA 2VTQA 2CPKE 2OGVA 4AN3A 3AG9A 4PDPA 2ZM1A 3ORTA 2OWBA 3MVHA 5EH0A 3PYYA 4UWYA 3PDTA 5EHOA 4BTMA 1KE8A 4FICA 3G2FA 4IC7A 3V5WA 2I0VA 2JIVA 3IECA 4ZS0A 3G6GA 2B9HA 4OTQA 4QP1A 3CSVA 1RJBA 2A27A 4FTOA 4LFIA 4ACCA 3WZDA 1R3CA 3KCKA 4YC6A 2G2HA 2HW7A 4FNXA 1B38A 2WHBA 4O7LA 3TKUA 1W2FA 2PTKA 3QZFA 4AU8A 4FVPA 5CQWA 3Q32A 3RZFA 2LAVA 4R78A 2XYUA 3TNHA 1WVXA 4F9YA 4IJPA 4HGTA 3QRTA 4XNEA 3S00A 5J1WA 3GOPA 4TYJA 4W4YA 1YDSE 2PK9A 4F0IA 4O81A 4RA4A 4MXYA 3R9HA 3DS6A 2QOKA 3QUPA 3B8QA 4YJRA 3MVMA 3PSDA 5ANEA 3VIDA 2YABA 2W5HA 4W4WA 4WBBB 4CRSA 4RLKA 1OGYA 5IQIA 5A9UA 4BYIA 3LFSA 3QTIA 3LIJA 4D4YA 5LMKC 3VW8A 4KIPA 4IM3A 2X0GA 4JDIA 5DFPA 2FVDA 3BI6A 4FSYA 4R3PA 3SDJA 1ZOEA 3MFSA 4BDJA 3A7JA 1M7QA 4J7BA 4FT0A 4EZ5A 4BCMA 4UWCA 3C0HA 5IPJA 4NL0A 4FTIA 4P90A 5CNNA 3DTCA 4NM5A 1PKGA 4FKJA 5BVDA 3PWYA 3BGPA 4FKSA 5EQPA 3ROYA 3QALE 4EQMA 4H3QA 4APCA 2PVMA 4N70A 1O6YA 3LHJA 2ITNA 3UZTA 4GFMA 3LCKA 2GHGA 4O96A 4EJNA 2VTRA 4EHZA 2R64A 3OWPA 3V8WA 2J0MB 4XG8A 3BX5A 4IZ5A 5CF4A 4IW0A 3PFYA 4YHTA 4S2ZA 4CV8A 4AP7A 5BUEA 3IW4A 3JPVA 3PE2A 4IACA 3LXNA 4F7NA 3MIAA 5CEQA 4C3FA 2VGOA 5AEPA 3SVVA 3F5UA 2R3IA 3FWQA 4A07A 4EC9A 1A06A 3QWJA 4F99A 3HA8A 4TRLA 2R3FA 4BGQA 3O8TA 4O0UA 1Q8YA 5J9ZA 5JFWA 4FTMA 4QP9A 3ZRKA 5BUIA 4O22A 4XBRA 5IQEA 4ACDA 1JQHA 4G2FA 4BCOA 5M4UA 4QMOA 4RQVA 4L42A 3KXHA 3KMWA 3UE4A 4F9BA 3R7YA 2OI4X 3OW4A 3W2CA 3Q60A 4YBKA 2Y7JA 4FTQA 4DAWA 3L9NA 4MBIA 3MY5A 3UNZA 4I3ZA 5KBQA 4QP3A 3V01A 2OLCA 4BWXA 3NCGA 2C68A 3AC1A 3U4UA 4ASDA 4EJ7A 2YN8A 2YAAA 4M67A 5FGKA 3SW7A 3QAME 3QA0A 3IDPA 4EK3A 2OIDA 4GYGA 2VNYA 4X2FA 3GP0A 1Q3DA 4I0TA 4L7FA 4U42A 2WMUA 4J8MA 3E3BX 4JDJA 1J3HA 4F4PA 2OH0E 3NCZA 1JOWB 4MVFA 2ZFYA 4I5PA 5FRIA 3AKKA 2OBJA 4MQ2A 3F82A 2HYYA 5LQFA 2BZHB 2I7QA 3TYKA 4IX3A 5EOLA 5HIEA 3ALNA 3K5UA 3DBDA 1XH5A 3LFBA 3VAPA 4J96A 2UZDA 3F66A 4A4OA 5AV1A 3PA3A 4M69B 2F57A 1FBNA 1ZLTA 2E2BA 3F2NA 4B6LA 4LOOA 4QP6A 3OMVA 2GNFA 4C59A 4CKIA 5JFSA 2ZJWA 3KRJA 2GU8A 2AEGA 4OW8A 3QGYA 2C0OA 3NEWA 5CU2A 4DHJA 4GW8A 3I60A 2O63A 3MSSA 4YJOA 3GC0A 4DGMA 5KX8A 5GIOE 5CENA 3S4QA 3OBJA 4RLLA 2CN8A 2R3GA 4V01A 5D41A 3R1NA 3GQIA 2XMYA 4FKWA 3FDNA 4I5MA 3BHUA 4RZVA 4UZDA 3EL7A 3BLAA 2XEYA 3UQCA 2J0LA 5KZ0A 3TV6A 3D9VA 4O0VA 3R7OA 3MY1A 3IW5A 4ERKA 4DFUA 4S32A 3D15A 3T9TA 3IKAA 3C4CA 3K3JA 4FZAB 2QQ7A 4G1WA 2HY81 4M15A 3ZS5A 4F1MA 3N4TA 4H05A 4OTFA 2VTMA 5IU2A 4HYSA 2XNPA 4UMUA 3KVWA 2WZJA 2C3KA 2QU6A 5HD4A 3ORNA 2C47A 3V5TA 2QODA 2C30A 4C34A 4DGLC 3O7LB 5A4EA 2RKUA 4QP2A 1ZWSA 4PP7A 2HXQA 5H8EA 4ARKA 2W9FB 4DE4A 4RJ6A 5J9LA 5K4IA 3UDBA 4AW2A 2UVZA 4DEHA 1IAJA 1OBGA 4RWLA 3MESA 4L43A 1CKPA 1U5RA 5AFVA 2XKDA 3EFWA 5KMMA 4QDEA 2W9ZB 4GG5A 1GZOA 1Z9XA 2HZNA 4D2VA 2OO8X 4Q9ZA 5TF9A 4AA5A 4L3PA 2RF9A 3KB7A 4KB8A 4GT5A 1KE7A 2WU7A 4AAYA 3CPCA 3NW6A 5BYZA 1PW2A 4BCFA 4EBVA 5A4CA 4EKLA 2RFDA 5J95A 3BE9A 1OPKA 2WQBA 1IR3A 3A61A 3HL7A 2YM4A 2YM7A 3CKWA 4FODA 4HGLA 2WMRA 3L8PA 2VO7A 5AA8A 4I41A 4EK8A 4U41A 5DG5A 4DFZE 3PA4A 3OOMA 1JNKA 3EZRA 4JBPA 4EHVA 4U45A 3CD3A 3MA3A 3TG1A 4CKJA 4NW5A 4U79A 4G3GA 3AT2A 5M44A 5EYKA 2YIRA 3CXWA 2B4SB 3OXIA 2P2HA 3NZ0A 2CCHA 3OEFX 4YZNA 2WOUA 1E1XA 1K2PA 2IZUA 2BZKB 3BZ3A 4L9IA 4J98A 3QYWA 4Y46A 3E8EA 4BWPA 1REKA 1M17A 5ETCA 4DDGA 4QTEA 3ACJA 1JAMA 3COMA 4RGJA 4ZTQA 5I9UA 4DFXE 3A60A 2ITXA 4OTDA 1QCFA 2OJFE 4YPDA 3GEQA 4MAOA 1GZNA 4WSQA 3H9OA 4IAAA 4GK3A 1GJOA 2QO9A 2GCDA 4D4SA 2QURA 4QP4A 3NR9A 5DIAA 3FI2A 4MD8E 3LJ1A 3ORZA 3F9NA 1AD5A 3MFTA 5H2UA 5EK7A 5DH3A 4XG9A 5E8TA 3F88A 1Z57A 4KSQA 1CDKA 3PY1A 3RKBA 4PRJA 1KE9A 3BGQA 3HMNA 5CU0A 2VUWA 4IJ9A 2CDZA 2F4JA 3KN6A 3OD6X 4FEQA 1X8BA 3R7UA 5I9YA 3VF8A 3R2YA 5KUPA 4D2SA 1YHSA 2C3IB 3PXQA 2I1MA 4M13A 4HJOA 4V04A 4Y5HA 2UZTA 4Z16A 2W99B 2WPAA 2Y6MA 1QPJA 3FLSA 3QQUA 1GOLA 4BIEA 3B8RA 4IM2A 5AAFA 4ZLYA 4ZZNA 3A62A 4ZTMA 4ANMA 4O7ZA 3UDTA 4S30A 3UJGA 2LGCA 3S95A 3O50A 4CFUA 2FB8A 4PTEA 3WIKA 2QG7A 2ERKA 5IQDA 3Q9XA 3ZDIA 4EQCA 4CZTA 3HAMA 4QYHA 3UVQA 2OZAB 1OPLA 2BRMA 4UN0C 5LVPA 1VJYA 3CGFA 2XK6A 4G3EA 4HYHA 4PQNA 5J87A 4BHNA 3R7VA 3BE2A 4FSZA 3NYVA 5HNBA 3JR1A 5AJQA 3S1HA 1ATPE 3ZHPC 2YWPA 4QP8A 2YERA 3DZOA 5T3QA 4ZJIA 2PHKA 3FYKX 4YTCA 3LW0A 4YJVA 3KGAA 3F7ZA 3IQ7A 4FG7A 2WMBA 5EYDA 5TKDA 5J7HA 4G3DA 2IVTA 2AC5A 4PTGA 2UUEA 4X2NA 3ZC6A 4FV2A 5CF8A 2PZRA 4QMZA 1J1CA 4FEUA 1SYKA 1ZY4A 2WEIA 3OROA 2Y8OA 2BZJA 4EUTA 5IEVA 2VU3A 1R0PA 5IEXA 3VUKA 4M8TA 2FSLX 4GS6A 4YP8A 3V5LA 4U7ZA 3EN4A 4ANQA 2W4JA 2JKQA 2ITWA 3GNIB 1XH6A 4AF3A 5CAQA 1OM1A 2KULA 3SW4A 5HORA 3Q6UA 1UA2A 1V0PA 3V5PA 4ZAUA 3MPTA 4L00A 4O27B 3KULB 2XK8A 3CIKA 3GBZA 3CGOA 4LGHA 2KTYA 2UW0A 3ZLWA 2XK3A 5I0BA 3PG3A 3QYZA 5L4QA 3R83A 3RM6A 3TCPA 3FXXA 4RRVA 3UQFA 2VAGA 3GU6A 4D2PA 3D5VA 1R78A 4DEEA 5E4HA 3VRYA 4A9YA 3BKBA 4ZSJA 4E93A 4BVUA 4IDVA 4QT1A 4XV2A 2UZVA 2G15A 4L3JA 5GZAA 3VBVA 3CS9A 4FKGA 1H24A 4WBOA 4B8LA 2HIWA 3S3IA 3C4XA 3D5UA 3VHEA 5E1SA 3FV8A 4XP0A 3UO6A 4BHZA 5ACKA 4ACHA 1FVRA 3MY0A 2ZB1A 5HHWA 2VWZA 1XH9A 3CTHA 4JIAA 5BVOA 1M52A 5I9WA