1DS5A

Dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
328
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CASEIN KINASE, ALPHA CHAIN
publication title The crystal structure of the complex of Zea mays alpha subunit with a fragment of human beta subunit provides the clue to the architecture of protein kinase CK2 holoenzyme.
pubmed doi rcsb
source organism Zea mays
total genus 99
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ds5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ds5A01
3PRFA 4JJRA 4CTCA 2F4JA 4FTNA 2ITOA 3TNWA 3CGFA 4EZ3A 4USEA 5JFWA 4FSMA 4FC0A 5EYMA 4DFLA 5KBRA 2IG7A 4M69A 4GIIA 2ITWA 4LV8A 5CF6A 5IG1A 3KMWA 4XNEA 4KABA 4JLCA 3LQ3A 3MIAA 4FTJA 4TYHB 1M2PA 3H9FA 3VS3A 3ROCA 1UKIA 2A27A 3FKNA 3V6SA 3OWJA 3NZ0A 3DAEA 4F4PA 5A46A 2PVJA 5L2WA 4W8DA 4F0GA 1KE7A 4TXCA 3DZQA 5HTIA 2UVXA 2RFEA 2CKEA 4CFWA 4OTRA 4DGOA 3Q52A 5IDPA 4BDGA 5I9XA 4XP2A 3AC1A 1R1WA 3E92A 4YZ9A 1FVVA 1SNUA 5GJFA 4DBNA 1XQZA 3SGCA 5IQAA 3R02A 4BWKA 1GZNA 3VUDA 4PY1A 4C4GA 3F5GA 4NIFA 3BEGA 4II5A 4X3FA 4DC2A 4FIHA 5G1XA 3WZUA 4A4XA 4C2WA 5DI1A 4PUZA 3DB8A 4YC8A 3OP5A 4ACMA 2O8YA 2PU8A 4FT9A 2R3JA 4L00A 3FMJA 3U4UA 4DLIA 4FYNA 5IUIA 3GT8A 4LGHA 5FEDA 5M51A 4U43A 4BTMA 5CWZA 4CMTA 3R8PA 1ZYLA 5LJJA 3TWJA 4I5PA 4MBLA 4C35A 4FT5A 2RSVA 2BHEA 1NXKA 3TNPC 3UOLA 4QMOA 4B6LA 4F1MA 3R71A 4RWKA 4O38A 4DEEA 5HE0A 3RKBA 2C6LA 2Q0NA 3O8UA 3QWJA 1OBDA 4IBMA 4D55A 2QOLA 4AAAA 3PPJA 4AE6A 3H4JA 3JY9A 5EKNA 3LLAA 3ZLWA 3BI6A 4X0MA 4JG7A 3C0GA 4J96A 4J7BA 4EKKA 3BHTA 3HX4A 4L68A 4QMWA 3LJ1A 2VGPA 3TUDA 5FM3A 4GVJA 4ALVA 3DKGA 3Q4ZA 2R4BA 3T9IA 3L8VA 2OH4A 4RWIA 3LVPA 3ZLYA 4F70A 4U5JA 2XM8A 1Q61A 3DFAA 4Y46A 3DT1A 3SRVB 5J8IA 1URWA 4ENXA 3Q2JA 3UBDA 1SNXA 3D83A 1JVPP 1OPKA 3FLZA 4FKOA 5LWNA 2C5OA 2H9VA 5I3RA 2ITPA 2ITVA 3F3UA 3UO6A 3FV8A 4MK0A 5M4FA 3FXWA 3GP0A 1Z5MA 2W06A 4X2FA 4EYMA 1OUKA 4S32A 5J1VA 3H3CA 2VO6A 4USDA 4FTAA 1R0EA 4BCQA 3D94A 4MX9A 3O96A 1J7LA 2YIYA 2IZTA 1TKIA 4IH8A 4RSSA 2QG7A 1Q24A 2BRNA 2WKMA 5L8LA 4MF1A 5CVHA 5FBNC 2WMVA 3MIYA 3OUKA 3SW7A 2WTDA 2ZM1A 3BV2A 4H3QA 5EDRA 3UVRA 3W32A 2RL5A 3CPBA 5A3XA 2C6OA 3V5WA 1H0VA 1O9UA 4IIRA 3UO5A 4LL0A 3E93A 3V3VA 4BDHA 4ZTHA 5F20A 4B8LA 3LKMA 3AD5A 3G6HA 4UBAA 2J0LA 1H1WA 3A7IA 3TJDA 2C0IA 1ZZ2A 2X6DA 4PL4A 4ALUA 2R3LA 3JVSA 3V5JA 3SG9A 3DBEA 3ANQA 4R7IA 3FZSA 1OUYA 4JG6A 5AWMA 3FI2A 2I0YA 4XP0A 3P79A 3MTLA 4TRLA 3FUPA 2V55A 3HVCA 3OF0A 4L44A 4JVGA 5CAQA 5AAFA 3LFDA 3DDQA 3QD2B 3R1NA 3SG8A 3IKAA 3AT4A 4BKJA 3SXRA 3CCNA 2Q0BA 2WB8A 3VW6A 5AV1A 1S9IA 2RFNA 4DGMA 4BGGA 5A6OA 2DWBA 1Z57A 3R30A 2PZ5A 5EQYA 3TV7A 3NS9A 4FKVA 5HG5A 5J9LA 4MQ1A 3VJNA 4CZUA 3ZLSA 3MVJA 5CAVA 3LM0A 1B38A 2QOKA 2VN9A 2UZLA 3LCDA 4HCVA 4RZVA 5GNKA 4AW2A 2QHMA 2O0UA 3VS2A 2UW3A 4CYJA 4H1JA 4AOIA 3TM0A 4DEDA 1FINA 2HZ0A 4Z16A 3CR0A 2VTQA 4O6EA 3MPMA 3WIKA 3VRZA 4P5QA 4D2SA 2ZVAA 3IW5A 4TY1A 5E8TA 2C6MA 3L8XA 4GH2A 3R0TA 3VHEA 3ZSGA 1IR3A 4WSQA 1OIQA 4BVUA 1G8SA 5HX8A 2DUVA 4M7IA 2XP2A 4ASZA 2CN8A 4FYOA 1WVYA 5CY3A 3AMBA 4XS2A 5HESA 3G51A 4YC6A 4ZTLA 5EI6A 1E1VA 1PMNA 4GG7A 2OI4X 3RPSA 3EQIA 4ANMA 3A4OX 1A48A 1V0OA 5HIDA 4G3GA 3LAUA 3UMXA 2W1CA 5CAUA 1UVRA 3NIEA 1W82A 5CEPA 4DFBA 3G6GA 5LVOA 2VO7A 4FZ6A 2HYYA 2J9MA 4W4VA 5B2KA 1R0PA 3BHHA 4WG5A 4KINA 1JQHA 2HY0A 5E1EA 2B9FA 4PWNA 2YDKA 4CT1A 4I93A 3GCQA 4X21A 3FC1X 3NVMB 4FZDB 4RA4A 4FGRA 5CT0A 4S30A 4Q9ZA 4HVHA 4NW5A 3QD3A 3QRIA 4FE2A 3QQGA 5AP4A 2XIYA 3OTUA 3R8ZA 2B1PA 3EQPA 1I09A 3H10A 1KOBA 2W1GA 1F0QA 4C36A 2Z2WA 4D5KA 3RMFA 2Y6MA 2GS2A 3CQUA 4N0SA 3MFUA 4DEIA 2WAJA 1KE8A 4IZYA 5BVFA 4I0TA 4MEDA 4JBVA 1XBCA 3R8VA 1Q41A 4JT3A 4E93A 3FYJX 4XYFA 5HD4A 2H8HA 5IA4A 2BVAA 4HZSA 4MWHA 5E8UA 2Y4IB 3UYSA 1ERKA 2EWAA 4HNFA 1APME 3MS9A 4MXCA 5C1QB 4BWXA 4QYHA 4DYMA 5BVEA 4D1ZA 2BUJA 2IVTA 3FEGA 3NX8A 5EM5A 4HVGA 4R78A 2I0VA 4C38A 4U6RA 4AUAA 4C58A 1ZMVA 4YSMA 4EH3A 5KMNA 2EB2A 2YITA 4IEBA 4AWIA 4TN6A 4BL1A 5IMXA 1HCLA 3LHJA 3WZJA 3JR1A 2GDOA 2CHLA 5JFSA 2QCSA 5JSMA 3LXNA 1G5SA 3ZSHA 3FLWA 3R63A 2C5XA 1YHVA 4DEAA 2Z02A 4I22A 2XNPA 3WYYA 5M08A 2ZOQA 4I5CA 1UWJA 3M2WA 3QCQA 4EZ7A 5EHLA 4OT6A 5CXZA 1IRKA 5EYKA 3MN3A 3U51A 4NL0A 3AMAA 1NVRA 5AM7A 1PYXA 3HV5A 5D9HA 2IW9A 4ZXTA 5IQHA 4CEGA 4YU2A 4CCBA 4EQMA 4PMMA 1JKSA 2ITXA 3QQKA 3PTGA 2ZV9A 1WBNA 2F7XE 3SD0A 1WZYA 2UV2A 3MFRA 4QYYA 5IH5A 3NSZA 2GNJA 4G3EA 4ITJA 5CSWA 4DINA 4YHFA 4CFFA 5KUPA 2XMYA 1A9UA 3KMMA 1Z9XA 4RVLA 1UNGA 5GZ8A 4ACGA 2BZIB 2R0IA 4QQ5A 4D2VA 3BYSA 2R3NA 4U80A 3F66A 3PIXA 2W99B 4HCTA 4ZTNA 4ZMFA 3MFSA 1PKDA 4M14A 5HG8A 1XH9A 3BBTB 5CT7A 4RC2A 2IN6A 1MRYA 1UU3A 2BFXA 3IOKA 3EQDA 4LM5A 1G8AA 4CSVA 1J1CA 3C4FA 2RFSA 3ULIA 2FYSA 2X4FA 4UX9A 5DYJA 2B55A 2JDRA 4XUFA 4FSYA 5J87A 2R3IA 4RIOA 2C5NA 1XH4A 4C34A 1BI8A 1AGWA 5HNGA 2VWUA 3MPTA 3NIZA 4U81A 5FLFA 2WMUA 3BQCA 5KE0A 1QL6A 3Q4TA 4U3YA 4AXAA 4UMUA 3TNQB 4UN0C 4K2RA 3E88A 3RPYA 4XH6A 1TQMA 2QOBA 2R3MA 2OZOA 1BUHA 2YACA 1H00A 5L8JA 5IEYA 4IDTA 3WZEA 2PMIA 4L9IA 4P2KA 3B2WA 3ZRKA 4F9CA 5CAOA 1UNLA 1FPUA 3MH1A 3FSFA 3S2PA 1P4OA 4OBOA 4O91A 5AA8A 3R7GA 4RX8A 5KBQA 2HENA 2WQEA 2XYNA 2QNJA 3EOCA 3FSKA 3W55A 2J2IB 3FE3A 3HV3A 5FP5A 5IKWA 4NM3A 4QTEA 3EN9A 3GQLA 3ORZA 4FI1A 4C3RA 3PPKA 2GS7A 4HPTE 4U0IA 5EH0A 3MFTA 4G1WA 2RIOA 3NW5A 3W2QA 2XM9A 3A61A 2UW4A 5CLPA 2YDJA 4X3JA 4R6VA 3K2LA 5FQDC 4CNHA 2VTTA 3SOAA 3NWWA 3V51A 3DLSA 1QMZA 1SVHA 3UNZA 3LE6A 4J1RA 1J91A 3R7VA 1OB3A 5KMOA 4YR8A 5IUHA 4R7BA 3TCPA 4MXZA 3PP1A 1ZMWA 2OIBA 3D0EA 2J0IA 3G9LX 4XRJA 5JGBA 3FI3A 1OGUA 1E9HA 3RP9A 3R9OA 3DQWA 2WMXA 4WIHA 4GFOA 1OIUA 2PVFA 3PUPA 1LR4A 4MXYA 4AFJA 5CEMA 3PRIA 4RIXB 3CSVA 3ZDUA 3IDBA 4FV6A 3DGKA 2YCFA 2XNMA 3ERKA 2Z7SA 3FI4A 2XBJA 3FQSA 3W1FA 2QONA 2IVVA 4HJOA 4FTKA 1WBPA 5D1JA 3QWKA 4E8AA 4EBVA 2QU5A 3LZBA 3DNEA 4GMYA 4F1TA 2OG8A 3JS2A 3IONA 4BI2A 3HYHA 3R28A 4ZTSA 3OW4A 4ANBA 2BRMA 3PWDA 3MH0A 3DTWA 3KVXA 4L7SA 2VTJA 4KSPA 4ZTRA 3BHVA 4C37A 3H0YA 1PXMA 3FZTA 2KTYA 1FGKA 4UALA 1VR2A 2HWPA 2B9HA 3DXNA 3EYHA 5HE2A 3PDTA 3BKBA 4B99A 5F1ZA 1QPEA 4ACHA 1K3AA 1M17A 2DS1A 1ZY4A 3CJGA 1WBWA 3HGKA 3Q60A 4G5JA 3WF9A 4EOJA 2X2MA 4IMYA 3R83A 1J7IA 4BYIA 2C0OA 2X9EA 2PYWA 4ZSEA 4D1SA 3PIZA 1CKIA 4XRLA 4EOIA 3KA0A 2AC3A 3A7GA 2GNFA 2OIQA 4TYHA 3FZPA 4R1YA 4BCJA 1BX6A 2YCRA 3EL8A 3F3ZA 4YJPA 5JGAA 3W8LA 3ZRLA 3UYTA 4FEXA 1XH6A 3GFWA 5FXQA 3RZBA 5IPJA 3NVKI 2XRWA 2C3IB 2O65A 3BU3A 4KBKA 4A9UA 1TVOA 4RJ5A 4K33A 3FMEA 2A4LA 2G2FA 3L9NA 4YTHA 4L52A 3EN4A 2V0DA 4IZ5A 3FPQA 3R8MA 3UG2A 4AZWA 3Q32A 3RHXA 1QPCA 4TW9A 3ZBXA 5I5ZA 5IQFA 4EK6A 2WQBA 4F7JA 2A19B 4G6LA 1JWHA 1I44A 4EI4A 4A4OA 4XOZA 2JITA 2VWYA 3P7CA 5HBJA 4FT7A 3FHIA 4XEYA 3KRLA 3ORTA 3VBQA 1OECA 1YHSA 3OZ6A 4F9BA 3KC3A 4BCGA 2UZNA 4NYEA 5K3YA 4C0TA 4O7RA 2F7EE 3P23A 2WEVA 4XG6A 4RJ8A 3R7YA 1STCE 4OTFA 4XG3A 4S2ZA 5A54A 3ORLA 5D7AA 3ORIA 3C0IA 3DS6A 5AP1A 4EYJA 2YAKA 4M68A 3TTJA 2B52A 4FKPA 2HELA 4YPDA 2VTRA 4NW6A 4U7ZA 4QQJA 4QTAA 2VTLA 3ALOA 1XKKA 4V04A 4MXAA 3LCOA 4O27B 2JKOA 5B2MA 3QYZA 3NUNA 4ZTMA 5TOZA 2XNGA 1KOAA 3JYAA 3TV6A 3A8WA 2UVZA 3RM7A 3AMYA 4ZSJA 4YTCA 2R7BA 3C4CA 4E6DA 1SMHA 1Y57A 2EB3A 1PKGA 2C3LA 2JEDA 3RGFA 2BHHA 1YXXA 1P14A 4TYIA 4X6RA 4LUEA 4GV1A 4QMTA 2X1NA 2YHVA 4FZAB 1YWRA 3I0OA 3QAME 5CENA 5CANA 3TTIA 4FIFA 3FZRA 5KMLA 3AD6A 1B39A 3LXKA 4JR3A 1LEZA 3CLYA 2B0QA 3ORNA 2OU7A 5L2QA 3QA0A 3KCKA 2C6DA 2X7OA 2FUMA 4FTLA 1WCCA 5HLWA 4FV4A 3P5KA 3UNKA 4K77A 5CSHA 4DHFA 2B9IA 2BAJA 1Q8WA 3F3TA 3ZUUA 3IG7A 1XH5A 4OBQA 4AE9A 3Q4CA 3SHEA 4EJ7A 4BCNA 2PTKA 3FQEA 1VJYA 4K9YA 1UWHA 3EN7A 3UZRA 4FICA 3BU5A 5BVOA 1F3MC 3C1XA 4H3PA 4NJDA 3PE2A 1L8TA 1PXNA 3HMOA 3FKLA 4MH7A 2YWVA 3SX9A 3PLSA 5ETAA 3VBTA 4FV0A 3NNXA 4QYFA 3QTQA 3RCJA 3H0ZA 5EHYA 4EC9A 2YN8A 4I4EA 5HOAA 4AACA 2YLFA 3LCTA 3ZC6A 3OHTA 3FLSA 4Y5HA 2X39A 4MVFA 3QC9A 4GUBA 2RG5A 4QPSA 5DR2A 3II5A 1OM1A 3PSCA 1YWNA 3UIBA 4Z3VA 1VYZA 5CU0A 4EKLA 4YPSA 1CSNA 4IAFA 5FBOA 1AQ1A 3VUHA 5J79A 4FF8A 3W2RA 5FTGA 1WBVA 3W2CA 2JIIA 5JH6A 5FWKK 1PXOA 4JDJA 3ZHPC 3W2OA 3NEWA 1JSUA 4LMUA 2R64A 3KRRA 4IX4A 3UOHA 5HVKA 4WO5A 1NA7A 2QURA 4I0SA 2UVYA 3FLYA 2C6IA 1ZYDA 2ITUA 2JDOA 3EQGA 2BRHA 3FL4A 4ITHA 3F5PA 4R7HA 3KXNA 3ODZX 4OAUC 5AUYA 4KB8A 3RBWA 3NNWA 2E2BA 4NSTA 3QQUA 3BCEA 5GJGA 5IA2A 4EK3A 5KZIA 5B7VA 2C6KA 4LMNA 4S33A 4YJUA 5CU2A 5TT7A 3UQFA 4BCIA 3A4PA 2O64A 4JAJA 1YXVA 1FVTA 4YZMA 3HRBA 4CXAA 5L2SA 3WBLA 3R2BA 4KIOA 2PVRA 4N6ZA 5M06A 3QZIA 3WARA 4O1PA 1OIYA 4YHJA 1H4LA 5AUXA 3KRXA 4BGHA 5A4QA 5ANEA 4O0RA 3V5QA 4CKIA 2UZWE 3R8UA 4O7ZA 2BMCA 4F9WA 4FG7A 5AP6A 3LMIA 2GQRA 2YABA 3KY2A 3GUBA 3DK7A 2Z7RA 4JR7A 4I24A 3OROA 4F7SA 4GG5A 2JDSA 4UMTA 2ONLC 2ONLA 5EFQA 3HNGA 4E3CA 2WOTA 4IFCA 5AR8A 3R21A 4O96A 3WF7A 5K5NA 2CKOA 2Y9QA 3R04A 3DDPA 4PQNA 3CKXA 5E8SA 1JOWB 4Z55A 1ZYCA 1K2PA 5HO7A 5L2TA 3EN6A 3SC1A 1H08A 3Q9ZA 2BRBA 5AP5A 4R5YA 2JKMA 2XRUA 2IPXA 4ZMEA 4I6FA 2YISA 2J51A 3P7BA 5DLSA 3ZFYA 3OWPA 4OT5A 4RMZA 4C7TA 4DCAA 3LFEA 2CSNA 5FDXA 1OVEA 3ZFMA 1OPLA 3LLTA 4GT3A 4Z7HA 2ETKA 2FH9A 3ZXZA 4AS0A 4C2VA 4EH4A 5J7BA 3LMHA 2HOGA 3TNHA 3W33A 4F65A 4FTCA 2EXCX 2FSTX 2QR7A 2Y4IC 1IASA 1H1PA 2QD9A 4WUAA 2HK5A 5FTOA 4CRSA 1YDSE 3PA3A 5E8XA 2V7AA 4PNKA 3CTQA 4RPVA 1GY3A 2V22A 3IGGA 5M57A 2R9SA 3PJ1A 1R39A 3IPHA 3LXPA 3O8TA 2R3QA 2HY81 4IHPA 4RWLA 2OSCA 1DS5A 3F69A 4WSYA 1OKWA 5FD2A 4ZS0A 3WZDA 2B7AA 4BKYA 1GOLA 2HW6A 2VGOA 3C7QA 2W1ZA 1ZRZA 4CCUA 5BYLA 3O50A 5H3QA 3Q9XA 3U6IA 1ZXEA 3AC2A 3IK3A 5FXSA 3R9DA 3GFEA 2R3KA 2VWIA 4G3DA 5TO8A 4ZJVA 3G15A 3VBVA 3AT2A 5JQ8A 4ACCA 1YXSA 3A7JA 4GEOA 4TWPA 4USFA 2YM7A 3P0MA 3O17A 5LMBA 4EQCA 3HP2A 3QF9A 4YJOA 5CVGA 3SAYA 2GNLA 4IX3A 5H2UA 3K5UA 3ZS5A 1JKKA 3D5WA 5EYCA 4KRDA 2XK7A 4CKJA 2B4SB 4F0IA 2ITNA 2R7IA 4ZJJA 4MF0A 4GW8A 5LCJA 4HNIA 2YIWA 2LGCA 1YI6A 2PY3A 4A7CA 3RK9A 5DG5A 4D2RA 4LUDA 3KEXA 2VWVA 3IW4A 2BKZA 4DT9A 3NAXA 4E4LA 2A0CX 3EFWA 1J1BA 2F49A 5ANJA 2YZLA 3EQBA 2OH0E 1Q8UA 2YCSA 2R0UA 2C3KA 4A9RA 5A6NA 5IQIA 2YIRA 4FSUA 4IVDA 4U3ZA 5DOSA 5BMMA 1M14A 3U55A 3MDYA 3U6HA 5EM6A 5J5TA 4JG8A 3R73A 4PX6A 3ZLXA 4BDIA 3CD8A 3KULB 2CDZA 4HVDA 4QQTA 2HWOA 4DF3A 3C13A 3GXLA 4N4SA 2I7QA 4FNWA 5DEWA 5E91A 2IVUA 4Q9SA 3V8WA 4H36A 4QMPA 2QOHA 4PP7A 4L3PA 3V5PA 5AAEA 4BN1A 3WZKA 3DOGA 4YJSA 5CEKA 3O7LD 2OKRA 1CKJA 1FMOE 1SVGA 1W8CA 1MUOA 4F63A 2C5YA 3MH2A 4ZS4A 1NY3A 2AC5A 3AQVA 3I60A 4ZEGA 5HCXA 1XO2B 4YJTA 3LFCA 3HAVA 3E8CA 4O7YA 1M2RA 3VS0A 4LGDA 5AV4A 5IH4A 2C5VA 3QXOA 4A07A 3ENMA 4XLIA 2CLQA 4I20A 4E5WA 4FSQA 2OJ9A 3KRJA 4FIIA 2VAGA 3NLBA 1ZARA 4XG4A 3T3VA 4BY9E 1XH8A 4U40A 4TKSA 4BZDA 1IA8A 4KKEA 3KXZA 4YZDA 5AUZA 3M1SA 2BALA 3F3WA 4PPAA 5KHWA 3PXYA 5A14A 4KBCA 3D15A 3NDMA 1UA2A 1PRYA 3VJOA 4BFMA 4UYNA 2WTKB 1MQ4A 2PMOX 4PDOA 4AT5A 3C9WA 2FSOX 4M0YA 3EL7A 3HUCA 4QMSA 4RC4A 3FMLA 2F9GA 3QGWA 2XK4A 4ANSA 5DT4A 1PW2A 3A7HA 4BKZA 2QVSE 3V04A 3ZZEA 2VWWA 2XKCA 4NM5A 4PF4A 5F94A 3MESA 4O86A 4IX6A 4ZY5A 2J4ZA 5E8VA 2X7GA 3QBNA 4UZDA 4W4WA 4CFUA 3RZFA 3AC4A 4H1MA 5LMKC 5LMKA 2NNWB 4APCA 4H3BA 3ELJA 2ITQA 3GU7A 3MH3A 2JDTA 4LOOA 2CKQA 3DK3A 4FTMA 3SOCA 4CFMA 1FMKA 4DN5A 3MSSA 1P4FA 3QD0A 3QCXA 3EKKA 4R8QA 2W1EA 4QMXA 3VNTA 2BILB 4C3FA 2WIHA 3CE3A 1CTPE 2I0HA 5LVPA 2GS6A 4HGLA 1EH4A 1WBOA 4GSBA 4RIXA 1CM8A 4AZVA 4FSZA 4NT4A 4XMOA 1YOJA 3HKOA 5CNOA 3OCBA 5AP7A 4QP4A 5F95A 3KL8A 1YQJA 2W1DA 2UW7A 3GU4A 3QKLA 3N4VA 4YSJA 3IW8A 4A4LA 3NUYA 2KULA 5AP2A 4DH3A 4B9DA 1SM2A 4UEUA 5CQWA 3HV7A 4FV1A 2XEZA 4YO6A 1GNGA 2WNTA 2JKKA 4YLLA 5C4LA 5M09A 4FSWA 3LMGA 4IJPA 4QD6A 2OF4A 4ERKA 3A60A 3GC0A 4IVAA 4L6QA 4NM7A 3FPMA 4QTCA 5M4UA 3QQFA 3F3VA 1CDKA 5EOBA 3QRUA 4RIWA 3OOMA 5I0BA 1KE5A 2UW5A 3PG3A 2PZPA 3UQGA 3HV6A 2IWIA 3QD4A 5D7VA 5A4CA 5IQDA 1PXJA 3RJCA 2QOFA 4RX7A 3UOJA 1H25A 2VV9A 4FBXA 5HLNA 4C33A 4D9UA 2OW3A 4UV0A 2NO3A 2UZVA 3COMA 3QRKA 2PWLA 4EH8A 3EWHA 3VQHA 3TDWA 1PXLA 3AGLA 3BELA 2BAKA 2C47A 4CQEA 3UPZA 4F9AA 3OFMA 1PMUA 1R3CA 2G2HA 2VX0A 2A2AA 4MAOA 3FXZA 2VO0A 2XIXA 5CU3A 3UIMA 2HCKA 1JPAA 4QPAA 4XHKB 2YZAA 5CZHA 4EH2A 4IVBA 4RIYA 4W4XA 3RPVA 4O0TA 5BYYA 4FMQA 4N6YA 3SA0A 3IECA 4R77A 5I9ZA 3C51A 3T9TA 4ASEA 5FXRA 4C02A 4R1VA 3OXIA 3OWKA 4K1BA 4CQGA 5KMJA 1XH7A 3EYGA 3OS3A 4PMSA 1R78A 4JIKA 2NRUA 3LIJA 3W16A 2RGPA 3GGFA 5DWRA 4KBAA 3IQ7A 4RG0A 4BIDA 1SVEA 2GPHA 5EM7A 4AX8A 5CEOA 2VTOA 5KKRB 1FVRA 3OXTA 4IM3A 1XBBA 3RTPA 4JX3A 3OEZA 2BZKB 3ZCLA 4JNWA 4LQMA 3FYKX 4RJ7A 3VHKA 3PZHA 5K4IA 2I40A 4BYJA 4RBLA 3R9RA 2YIQA 2B53A 3DB6A 2GHLA 5C9CA 2IZUA 5AAGA 4GK4A 5AR3A 5CAPA 1FOTA 3GCPA 3EJ1A 3TN8A 5KMKA 2E9NA 4AF3A 5HD7A 2IO6A 4PP9A 5I4NA 2YDIA 4FSTA 3L1SA 5CQUA 5M56A 3NYXA 4QPMA 5HCYA 2VTAA 5TF9A 3BV3A 2OFVA 1O6YA 3AXWA 4CD0A 3DQXA 4M69B 2QOCA 3QKMA 4DFZE 4EOSA 1AD5A 3F88A 3C5IA 5GIPE 2JIUA 4U97A 4CZTA 4GRBA 3RAWA 3VUKA 4MCVA 5J1WA 3A2CA 4G6OA 2WGJA 3RK5A 3UG1A 5DRBA 5HU3A 3MPAA 3D7ZA 5LARA 4J71A 2Z8CA 3A7FA 2H96A 3LW0A 4UWBA 2QHNA 4D2WA 2QKRA 2QR8A 3CY2A 2IZRA 3UGCA 4JX7A 5E8YA 3UIXA 1K9AA 5EKOA 5EOLA 4CG9A 4RQKA 3I7BA 4TZRA 5HO8A 4YLKA 2BTSA 5KX8A 4FTTA 3GNIB 1M2QA 1PHKA 4KSQA 3RM6A 5IF1A 3N4TA 3R8LA 3I5NA 4L7FA 3RAKA 3C50A 5ANIA 4BWPA 2J0KA 4X3FB 2OBJA 2X8EA 3ATSA 2WMRA 4FTQA 5JRQA 4PMTA 4C4FA 5J5SA 2ZAZA 3NNVA 3RINA 3NUSA 4EOQA 4I41A 1UU8A 3QUDA 3GU5A 1LUFA 3ETAA 2LAVA 4MQ2A 4IADA 1UNHA 4C59A 2ITTA 4L45A 4NCTA 4NCTC 3LCSA 1GAGA 3IW6A 2OLCA 2F2UA 3BE2A 1H26A 2QI8A 3LOKA 4J95A 4P4CA 2EXEA 3TUBA 3VUIA 3LFFA 4IANA 2OXXA 4JS8A 2WQNA 1Q8ZA 4NK9A 4O0WA 4AGUA 4R3CA 2QU6A 3SKCA 4FEUA 2BCJA 4MBJA 3D2KA 4IB0A 4BDEA 4BHNA 1ND4A 4FUXA 3I79A 4GFMA 4L53A 3VUGA 3MV5A 4KIKA 2YEXA 4AZFA 4FSRA 4FZFB 2X2LA 4AN2A 3QTZA 4ZSLA 4Y73A 3UQCA 3EIDA 3QX4A 3TZ8A 4JDHA 4O84A 2GTNA 2CGXA 3HP5A 5HVJA 3RHKA 4EHGA 3S0OA 4IQ6A 2BPMA 4FT0A 3G33A 3Q2MA 4X2KA 2QO2A 3PJ2A 3PY3A 4LFIA 3MI9A 3B8RA 3WE8A 4BDFA 4F64A 4I6BA 4EK4A 3MA3A 5EYDA 2EU9A 4BHZA 4O0VA 1LP4A 2GQGA 4AOTA 4IWQA 5BUIA 4G3CA 4NKSA 3KK9A 3F6XA 4L3LA 2P4IA 3D7TB 2YWPA 3ALNA 2Y7JA 3TACA 1W0XC 2UZOA 3ET7A 3IDCA 1XJDA 3HECA 1BYGA 1S9JA 2QO9A 4ZK5A 4FEVA 4D4VA 1IG1A 4IAYA 3ZOSA 2JIVA 3ZC5A 5JFVA 4YZNA 4G2FA 4KS8A 4KAOA 3AC5A 3QZHA 4PDYA 4NM0A 5K5XA 1KWPA 3EKNA 3EH9A 3UZPA 5AX3A 3KFAA 4BDCA 1U5RA 4QQCA 1YDRE 1XWSA 1REKA 3SXSA 4JQ8A 5HEZA 3E7OA 4MKCA 4I21A 3COHA 5CTPA 4C8BA 4QP2A 3WILA 4D2PA 5IUGA 5C4KA 3PYYA 4XG2A 3KXHA 4PRJA 3L9MA 4FK6A 1Q5KA 5T68A 4Z9LA 3ZYAA 2G2IA 3LFNA 2OO8X 5H9BA 4EQUA 5A4LA 5JFXA 1BMKA 4D58A 3W18A 3Q5ZA 4EONA 1OMWA 3BIZA 4LRKA 4BIEA 2VNYA 1ZMUA 2QLUA 2W5AA 3E63A 4YJQA 1KV2A 4O6LA 4JI9A 3E8NA 2VWBA 3MB7A 2HXLA 4WRGA 1UU9A 3ZFXA 3UMWA 4D5HA 2E9VA 5HHWA 5IDNA 5TR6A 1VZOA 4XCUA 2WOUA 3PSDA 1H27A 3GCSA 4DG0E 4XLVA 2RFDA 3NPCA 5ANKA 3ZU7A 3E8DA 3F2NA 3OWLA 4JBQA 3QHRA 4ITIA 4X6QC 4OUCA 3C4XA 4BCFA 5IQEA 3QTWA 4NU1A 3VS1A 2PHKA 4XG8A 3BQRA 2WTVA 3FKOA 2CLXA 5AX9A 1OIRA 3ZUTA 3S95A 2BKKA 3K3IA 2WMTA 2YFXA 4O21A 3L8PA 3P1AA 5AMNA 4GFGA 2PL0A 2BFYA 3RALA 5J9ZA 4BCMA 5BUEA 2V5QA 4UY9A 5BVNA 2UW0A 3C0HA 3PXRA 4M97A 3N9XA 4F6SA 4F6UA 4FKUA 3PJ8A 2YJSA 1GIIA 1FGIA 3JXWA 3KRWA 3DXPA 2GNGA 2HIWA 2P2HA 5EHOA 1KSWA 3R6XA 3TZ9A 3LFAA 3OC1A 4U45A 1GZKA 1SYKA 2YM6A 2XBAA 4ZTQA 5HBHA 4ARKA 2BAQA 3FMMA 5FEQA 5H8EA 3BLHA 2VTHA 3HA6A 4O7VA 3D2IA 3NYVA 4AT3A 4FNYA 2W1HA 4R3RA 3FMDA 1YWVA 2PZRA 3AGMA 4E6QA 4IAIA 4YJNA 3VC4A 3S3IA 4GT4A 4RLLA 3PLAE 1LPUA 2QQ7A 2W0JA 4XG7A 2HW7A 3GC8A 3PIYA 3QRJA 4U42A 5HCZA 4DFNA 4F6WA 4YO4A 5M4CA 5KNJA 4QMLA 4K18A 3VAPA 4UMPA 5LVNA 2GU8A 4EBWA 4MBIA 3BHYA 4OTWA 4XOYA 3IGOA 3QU0A 3AD4A 4D1XA 2WHBA 5CEIA 2BDJA 3LPBA 4MNEB 4FK3A 3ITZA 4D4YA 4EH6A 4GKIA 3Q3BA 4HYHA 3UO4A 2HAKA 2P3GX 2ETMA 4FNZA 4CYIA 4AG8A 2QODA 3SW4A 4EH5A 1Q8TA 2J6MA 3K54A 4RGJA 3R22A 2CNVA 4DFUA 4I6HA 4YTIA 2UW6A 2C0TA 1U4DA 4EH7A 2CN5A 4BCPA 4ZZOA 2AYPA 5EW8A 2GNIA 3OW3A 3A62A 3VRYA 4ALWA 1JSVA 4GS6A 3F2RA 3TNIA 1VYWA 4G5PA 3P08A 4RZWA 2UZTA 1YI4A 2XCKA 3BU6A 3G5DA 5EDPA 4ZSGA 3ZBFA 4YHTA 3DKOA 4ZIMA 4DFXE 3ULZA 2YIXA 1U54B 4FV8A 5KCVA 4R3PA 5CEQA 4CG8A 2XF0A 2R5TA 4FKRA 4FL3A 4M0ZA 1Y6AA 4OTIA 4RJ3A 5DPVA 5LOHA 1REJA 4FTIA 3POOA 4A9YA 3U54A 4L67A 1OL7A 3SRVA 3BGZA 4ERWA 3PG1A 4DTKA 3ZM4A 5AADA 4RVMA 4WHZA 4B8MA 3KK8A 3BLQA 2XA4A 4RC3A 3TIYA 3OVVA 4EUTA 2X6EA 1JNKA 1M7QA 2PE2A 4JRNA 3MVMA 3TEIA 3JUHA 2JLDA 3QTSA 4FKSA 3KB7A 4DA5A 4UZHA 2PVMA 4CFXA 1JBPE 2F57A 2GCDA 4B4LA 2XCHA 4O22A 4ORKA 3DNDA 5K9IA 4QP3A 1A06A 5JQ5A 1IA9A 2B9JA 3THBA 4C57A 5ETIA 5BMSA 2WTKC 3OY1A 4QMVA 4HGEA 4CFNA 3DV3A 4W9XA 2JKQA 4DITA 3FBVA 2NP8A 4BICA 5JZNA 4ZZNA 5J9YA 3FI8A 4L43A 5EQEA 1OZ1A 1Q4LA 2BRGA 3PP0A 2BDFA 2ZB1A 2FA2A 3QGYA 4XV2A 4LOQA 5FGKA 1XBAA 1P5EA 4KWPA 3VF8A 5H8GA 3QC4A 3OCSA 3O71A 2Y8OA 3UP7A 1NVSA 3VW8A 4FKIA 4YJRA 3VBWA 2JC6A 5AP3A 2ERKA 3R00A 2J0JA 4QMZA 4MXXA 3BGPA 3ORKA 4DG2E 4D2TA 5CSXA 4QP7A 1UKHA 3UVPA 3RPRA 4BF2A 3PE1A 4U44A 3TL8A 4G34A 3UVQA 4YC3A 5D41A 5AP0A 4E4NA 5DT3A 3GEQA 5T6KA 4YNOA 4I92A 3C4EA 2V62A 5DNRA 4JRVA 3GI3A 5B2LA 1OKZA 3LJ2A 3NUUA 1BKXA 4IACA 4RVKA 5LXMA 4V01A 1OKYA 5KHXA 3TZMA 5A4TA 4PTGA 5LMAA 1ZOHA 4CFVA 5CSVA 3GCVA 3COKA 2WXVA 5HE1A 2I6LA 3F2AA 3ACKA 3H9OA 3G0EA 4LGGA 3BE9A 2YM3A 2J5EA 1Y8GA 3FHRA 3MY5A 3LFSA 3R2YA 4MYGA 2XB7A 3CC6A 3P9JA 4QNAA 2GHGA 4DFYA 1YI3A 4AOJA 4PL3A 3V5LA 3RWQA 3UE4A 5H8BA 4YTFA 4GK3A 4J53A 4FVRA 4JL9A 4NJ3A 4MWIA 1NT2A 4JQEA 4MD8E 2QKWB 4OW8A 3Q04A 5HICA 3VS4A 3ZO4A 4FA2A 5ANGA 4H05A 2F2CB 3MJ1A 2VU3A 3JPVA 4FSNA 2VWXA 3QUPA 1ZLTA 1YW2A 1URCA 4YNEA 5IEXA 3VWAA 2X9FA 4GYGA 3ORPA 2O3PA 4AZSA 1F5QA 2UW8A 3PY0A 1WVXA 5HVYA 3W8QA 1WVWA 3CQWA 3F9NA 4K6ZA 4PDPA 3HMIA 5TE0A 3I6WA 5ITAA 3CD3A 3KGAA 1H28A 4ZOGA 3VF9A 2WTCA 4J97A 2PVHA 5BYZA 1U46A 2ZYBA 4D0WA 2ITZA 5E92A 1YOMA 4XBUA 2XNOA 3TJCA 4YJVA 4F7LA 2PUPA 3MA6A 4BB4A 2HZIA 3BRBA 3DCVA 3OD6X 4CGAA 4DT8A 3VVHA 3TUCA 5E7RA 2YM8A 4H39A 4EWHA 2CMWA 4E6CA 4DE4A 2R3PA 5DN3A 2X4ZA 3TZ7A 4O7SA 4FOCA 2VRXA 3FC2A 4O0UA 3EHAA 3HDNA 2BDWA 4EOKA 3LQ5A 2BROA 4LOPA 4NFMA 1XHAA 4BI0A 5IZFA 2DQ7X 4B0GA 4FKLA 3QCYA 4D4SA 2E9UA 4QMUA 4D28A 4YUQA 1OL5A 5LVMA 3MY1A 4FKGA 5KKRC 3MJ2A 2J5FA 4O83A 3D5UA 3FZOA 4GVAA 1GZOA 1YVJA 2UUEA 4WKQA 3WYXA 3TKUA 3NUPA 3POZA 3VULA 5LVLA 2PUIA 4WBBB 1H01A 2ITYA 2O5KA 2WEIA 4ZJIA 3V8SA 3CQEA 4E73A 5KMMA 5EDQA 3Q96A 4G17A 2WIPA 3E3BX 3VUMA 4O0XA 4QMYA 2PZIA 5JEBA 3S00A 4RA5A 5M55A 2OZAB 4EC8A 2J90A 3QZGA 3SV0A 3PA4A 1H1QA 4OTQA 3TKHA 1Y91A 3L9LA 3Q53A 1XR1A 3ZZWA 4ZLZA 5CNNA 2XVDA 2W4KA 5DRDA 3DXQA 3IDPA 4IWOA 4JDKA 4L3JA 5HU9A 5I9UA 3FMHA 3DK6A 1FQ1B 3V5TA 4O0YA 2WPAA 4ANOA 4Q5HA 2CCIA 3AOXA 3G2FA 3I0QA 4YLJA 3RNIA 3EQCA 4CV8A 4CT2A 5F9EA 1TQPA 4H58A 5IA0A 2PK9A 4DEBA 1WBTA 1H0WA 5CI7A 5EG3A 4AW1A 2FSLX 4KNBA 1GIJA 5AUUA 4XJ0A 4FV3A 3TI1A 4HZRA 2P2IA 4UWCA 4TL0A 5I9YA 2BR1A 2XS0A 2ESMA 2XK3A 4I3ZA 2ZDUA 4L46A 3CKWA 4X3FC 4X2NA 3MGYA 4XP3A 5E1SA 4EOLA 2GFSA 3WE4A 4O2PA 3OCTA 2VX3A 4L8MA 4YURA 5BQ0A 5DIAA 4V0GB 5J95A 4NTSA 3BWJA 4AGWA 3D5XA 4IM2A 3NUXA 5AUWA 4BDBA 4ID7A 5HG9A 4JXFA 3VN9A 3A99A 5IH6A 2W5BA 3DA6A 5DE2A 4O81A 4Q5EA 4RQVA 2WMAA 1PF8A 1JKTA 4DH7A 5EI2A 4IW0A 4AGDA 5M07A 3MY0A 3PVGA 4DEGA 4QMQA 5A9UA 4FG9A 3TDVA 1CKPA 3EN5A 4PTCA 3COIA 4NKAA 3CIKA 4WNKA 2UW9A 4IJ9A 5AR2A 3DKFA 3OXZA 1SZMA 3DLZA 4MNFA 4AN9A 2DYLA 5DT0A 4WNPA 2PVYA 1Q3WA 2XZSA 2X8IA 3VS5A 3NYOA 5AR4A 5FUTA 5EW9A 5FTQA 4AP7A 3FLQA 3QQLA 4RRVA 3UNJA 4DTBA 3EMGA 4HGTA 2PE0A 4IVCA 2WMWA 3PFQA 3Q6UA 3QLFA 3QTRA 3R9HA 2J7TA 1GJOA 3EZRA 4J99A 5G6VA 3KMUA 1V0BA 4IC7A 5K0XA 2WZJA 5ANOA 4YBJA 4CVAA 1DI9A 1ZOGA 2WFYA 4HYIA 3DKCA 4XG9A 2NRYA 3EZVA 3D7TA 1OI9A 4FVQA 2W7XA 4WA9A 4JOAA 3QXPA 5IQGA 4O82A 3QTIA 3I6UA 3CTHA 3EQRA 3OOGA 3QQHA 2Z7LA 3PJ3A 2XNNA 1BI7A 4EUUA 4GJ3A 2XIRA 3LM5A 5CASA 4LG4A 3TKIA 3U87A 4D0XA 4ASXA 5FRIA 3I1AA 4CRLA 4J8MA 2R3HA 2QOQA 4TT7A 2J50A 5BPYA 1W84A 3GCUA 2RF9A 3I7CA 4YGAA 5AV3A 2QG5A 3DZOA 1M52A 4K0YA 3OT8A 4BTFA 5AUTA 4WT6A 4EK5A 2C68A 4J98A 5HQ0A 1OITA 4I5MA 3BGQA 3VBYA 4EOPA 5HGIA 5C8NA 4RLKA 3W10A 4J8NA 3R9NA 1T46A 3C4ZA 3ZONA 3CY3A 3FY2A 4IAZA 5C01A 3NRMA 3NCZA 3UPXA 3Q5IA 4BBFA 1PYEA 3FLNC 3GC9A 3L8SA 4HW7A 4FGBA 1PMVA 1P2AA 1YDTE 4M8TA 4FV2A 1G3NA 5JKGA 2JDVA 3WF6A 3DBDA 3GU8A 3KXXA 4FEQA 2WO6A 3ZUVA 5AFVA 5HZNA 3UC3A 3WF8A 2QOIA 3HRCA 3HMNA 3DFCB 3K5VA 3P78A 4AN3A 2B54A 4FZ7A 1PXKA 4E6AA 1E1XA 1H1RA 3SDJA 3ZEPA 2XUUA 2OJIA 3BYOA 4A9TA 3F7WA 5HIEA 3P7AA 3F7ZA 2VUWA 3FZ1A 3Q9YA 2YERA 2BIKB 3QL8A 2JBOA 4KS7A 3R7EA 3QTUA 4RJ4A 5ACBC 3HA8A 4GT5A 3CXWA 3KXMA 4BIBA 3R1SA 1OL2A 4LYNA 4JQ7A 3B8QA 4QMNA 3LCKA 2WTIA 2Z60A 3QLGA 4FTRA 3E8EA 1Q8YA 4XBRA 2C6EA 3ODYX 4HGSA 5HIBA 5HNBA 4MTAA 4BGQA 3LJ0A 3MYGA 4PDSA 4FVPA 3PXKA 4UB7A 5BVKA 3IO7A 2CCHA 4DH8A 1J7UA 3QUEA 4FV9A 1DM2A 5E8WA 1MRVA 3CTJA 5AIKA 3MVLA 5L4QA 2HXQA 3BYUA 3AC8A 4XV3A 5CX9A 4DAWA 4IZAA 4S34A 3ZO2A 1YXUA 4MXOA 4RWJA 2C6TA 4IFGA 5GIOE 2W05A 2XK9A 4NH1A 2OK1A 3R7OA 1PJKA 2OIDA 3DBCA 4O2ZA 2OXYA 5GHVA 4TNBA 4EK8A 4FKTA 3TIZA 4I4FA 4M12A 5IA3A 3DBQA 1ATPE 3V6RA 5C27A 3VUTA 3DJ5A 2REIA 4KKGA 4WOVA 3RI1A 3VS6A 1JSTA 3FJQE 3NNUA 5HBEA 3E64A 3KQ7A 4FIJA 1MQBA 4DH5A 3TG1A 5E9EA 3NYNA 4MNEA 5AUVA 2HZ4A 2GMXA 4GYIA 1NVQA 3OCGA 4Y5QA 5E90A 3GB2A 2W96B 4UWYA 2PMLX 5EQPA 3ZDIA 5JMSA 2X2KA 3NMUF 5IU2A 3ID6C 2FGIA 1Q99A 3KKVA 1Y6BA 2WQOA 3GOPA 3QRTA 4AA4A 2PVNA 3UJGA 1KV1A 4BZNA 4E20A 2RKUA 2XK8A 3NW6A 3FMNA 3PXQA 5DA3A 4CMOA 1OBGA 3R01A 3KREA 1WMKA 3NW7A 5CZIA 1HOWA 4CLIA 4EEVA 3OTVA 2R3GA 5AJQA 3FXXA 4BC6A 3D14A 5EI8A 1OL1A 1U54A 3PWYA 3H30A 5KZ0A 4BZOA 3OY3A 3GC7A 3I5ZA 4IAAA 2VTMA 3MW1A 4UXLA 4NTTA 4Y8DA 2JAVA 2X0GA 3ZXTA 4EL9A 4QO9A 5C8KA 4RFZA 3G0FA 1U59A 3SXFA 3PSBA 4IX5A 5CI6A 2ZB0A 4FT3A 3ENHA 2XKEA 1W83A 5GINE 3ZSIA 1RQQA 2AUHA 2PZYA 2PVLA 3O51A 3BX5A 3CS9A 4C4JA 4MHAA 3PXZA 4FTOA 2FB8A 5TKDA 1Y8YA 1GZ8A 3O23A 4IWDA 4J52A 4NIFB 1WBSA 2VO3A 3IOPA 2IW8A 4APPA 2IW6A 1BL7A 1B6CB 1OPJA 2R2PA 3NAYA 1WAKA 2ERZE 4Y72A 5DMZA 2Q83A 5AM6A 1O6LA 3MVHA 3VIDA 2A1AB 5I9VA 1QPJA 3O2MA 4MD7E 2OF2A 4XX9A 5CF5A 5KMIA 1ZWSA 4C3PA 4E1ZA 3BBWA 2E9OA 3ACJA 4O7TA 2YAAA 2G15A 2H34A 4BCHA 4RT7A 4FTUA 2P55A 5EW3A 3OG7A 3OBGA 5M4IA 4QRCA 3EFJA 3MWUA 4GJ2A 4FUYA 4EOOA 4Z7GA 4LI5A 1IAHA 4LL5A 4Y85A 4KRCA 3Q9WA 5A4EA 5M44A 4V05A 4WG3A 5C8MA 4DCEA 5HO6A 4I5HA 1RJBA 1Q3DA 3PVUA 3DY7A 4OTPA 2FVDA 1Q97A 2JFLA 4G9RA 4RFMA 2UZDA 5I9WA 2CNQA 4O0SA 4BDJA 3E5AA 5HORA 5JGDA 1WFCA 4ZLOA 3N51A 1FBNA 3R1QA 1PXPA 1TQIA 4OBPA 3OT3A 4G3FA 5IQBA 4IDVA 2IJMA 5IISA 4TTHB 1HCKA 3DJ6A 3PVWA 4OTHA 3W2SA 3E7VA 2C30A 4FV7A 4N70A 5HG7A 2ZMCA 3G9NA 3NCGA 2FSMX 2WMBA 3ZMMA 4JDIA 3ORMA 4PMPA 5F4NA 3DJ7A 1ZYSA 3FY0A 3DPKA 3P4KA 5AR7A 2V7OA 4BTJA 3HDMA 2FO0A 2F7ZE 5K0KA 3BEAA 2EXMA 2W4JA 4DH1A 2VX1A 4FKJA 1M7NA 4W4YA 4KKHA 4W9WA 4WG4A 3RK7A 3UC4A 3QHWA 3MTFA 2PULA 4F1OA 4KIQA 4HVIA 3RAHA 3AG9A 4QYGA 4LV5A 4UXQA 3TT0A 4NEUA 3SLSA 1UV5A 3K3JA 1OL6A 4DG3E 2CNUA 3RWPA 3CBLA 4FIEA 4I23A 3ZM9A 3KF7A 3MB6A 4GCJA 2W1IA 4DEHA 4FEWA 2VNWA 4GKHA 1Q62A 2X8DA 2XKDA 4MD9E 4O7LA 3EFLA 2Y0AA 3L9PA 4HYSA 4QYEA 3SVVA 4TPTA 2XJ1A 4FR4A 4OTDA 4Y95A 4EHEA 2OJGA 4HPUE 2GSFA 4IWPA 5EM8A 3P86A 2QC6A 3QTXA 2ACXA 5DR6A 4EOMA 4RX5A 5IEVA 1NW1A 4WNOA 1LEWA 5LQFA 2YJRA 4AA0A 2JBPA 4AW5A 4P7EA 4Q2AA 4NUSA 3UIUA 4C4EA 4E7WA 2R3FA 3R1YA 1QPDA 4IXPA 4QP8A 3GBZA 4ANQA 1O6KA 2OJJA 2OFUA 2W9FB 4L42A 5ACKA 3N4UA 3ZEWA 3CJFA 4C4IA 3PZEA 5LCKA 4BRXA 4TYEA 2EVAA 4G6NA 4QT1A 2P33A 5AV0A 1GIHA 3GQIA 4P90A 3LFQA 2SRCA 2GHMA 2XJ0A 4ACDA 3WF5A 3WOWA 4TNDA 4TWOA 2GQSA 5FP6A 2XNEA 4AW0A 5L8KA 3QCSA 4RJ6A 1YKRA 2R3RA 2JGZA 2QO7A 4GK2A 4NFNA 5CYIA 3JY0A 1RW8A 2CPKE 4M13A 4ZLYA 1H24A 3AT3A 4M66A 5B0XA 4IAKA 4ZY6A 4E5BA 2ZDTA 3QX2A 4HYUA 4G16A 5I3OA 3ATTA 3U9NA 4XV9A 4Y83A 5BVWA 2WMQA 4JIAA 3BZ3A 3FAAA 2G9XA 4CLJA 3KN5A 2O2UA 4IB5A 5ANDA 3OMVA 2VWZA 3KCFA 4AGCA 3LFBA 5JZJA 2CJMA 4A06A 3QFVA 3BWFA 4EZ5A 3OUNB 2OXDA 4U9AA 5CXHA 4AQCA 5KO1A 5IQCA 4RIWB 4YZCA 4QNYA 2ZM3A 4R5SA 3T8OA 4DTAA 3UZTA 4OAVB 2W17A 3QALE 2OZAA 3JVRA 4BI1A 3BPRA 3SQQA 5IA1A 2PPQA 3O7LB 3UOKA 4RFYA 5BX0A 2PSQA 4F0FA 3TXOA 4F7NA 4IE9A 4I0RA 2PVKA 2X81A 3PY1A 5BUJA 2HZNA 2JD5A 2PMNX 4FX3A 4QTBA 2W9ZB 3GOKA 4AFEA 1J3HA 3ZH8A 3F5XA 5C03A 4BBMA 3OBJA 3Q6WA 3GENA 2I1MA 1YOLA 4CZYB 2GNHA 4KA3A 5IMEA 2VTPA 2BZJA 2YA9A 4RIYB 3UDBA 2IVSA 3EB0A 5HLPA 2BZHB 1ZAOA 3B2TA 4NWMA 2OJFE 4DLJA 3RPOA 2BIYA 3NR9A 4KUJA 5E8ZA 3AC3A 3A8XA 3S4QA 4GUEA 4AZEA 2J0MB 1UU7A 3ZO3A 4BTKA 4IC8A 5FEEA 3R7UA 5IA5A 4I1ZA 1IEPA 3CEKA 3BLRA 3RVGA 2WELA 3HMMA 4V0GA 4WNMA 5CALA 5CF8A 3KULA 4IB1A 4U8ZA 4BBEA 4EH9A 5GZAA 2WTJA 1MRUA 4G9CA 4GL9A 4PNIA 3HV4A 4FL2A 4FV5A 4F08A 3BYVA 2C3JA 5DR9A 3ZTXA 3FL5A 3ORXA 4G31A 5ETCA 2Y4PA 3C4WA 5FDPA 2EUFB 4O7WA 3KF4A 5DVRA 2QLQA 5AA9A 1RE8A 2PE1A 4QP6A 3EQHA 4FL1A 4RVTA 4CMUA 4DBXA 3C5UA 4GIHA 4M67A 4TWCA 3NUAA 3HMPA 4D9TA 4TYGA 3BYMA 3LXLA 4TWNA 2W1FA 4ANLA 5E4HA 1L3RE 1H8FA 2YM5A 4PV0A 4UYAA 4OR5A 1BL6A 3V8TA 4OLIA 5ETFA 2XJ2A 5LWMA 1ZZLA 3F82A 3F61A 3O0GA 3UP2A 2ZV8A 4WBOA 4ZZMA 3M42A 3VBXA 3HAMA 4JBOA 4EHZA 4E5AX 2XH5A 3HUBA 3QA8A 5CS6A 4FOBA 4BDAA 3DBFA 4A9SA 4GU9A 4U41A 5HKMA 3D5VA 3KU2A 3QQJA 4QOXA 3HLLA 5HTCA 2UZUE 1JKLA 5GJDA 4E4MA 5D12A 3QKKA 4C62A 3TV4A 3EQFA 2ZMDA 4HCUA 3U6JA 5D11A 4ONAA 5CF4A 2VTIA 3HEGA 3FDNA 4AA5A 3REPA 1PXIA 3WI6A 3U8WA 3VQUA 4FG8A 2VZ6A 1OKVA 4EWQA 2XNBA 5JN2A 2WTWA 2GFCA 2I0EA 1U5QA 2OGVA 1DI8A 2W5HA 2WU7A 5K4JA 4LRJA 3IS5A 2WD1A 4TYJA 4EJNA 1VEBA 4E4XA 2ETRA 2C1BA 3E3PA 4AT4A 3DU8A 2PUNA 4M3QA 5D10A 4L01A 5L2IA 1YXTA 1YHWA 4RX9A 1H1SA 3R7IA 1JAMA 3GU6A 5CU6A 4F99A 2NPQA 2CGVA 2WU6A 4AZTA 4CTBA 2E9PA 4JBPA 4IZ7A 4YZBA 5HE3A 3V01A 3Q4UA 3M11A 5HX6A 4BCKA 2W4OA 4K11A 4EHVA 3E87A 2XYUA 5BNJA 3ANRA 1ZY5A 4I6QA 3I4BA 1KE6A 2O63A 4HVSA 1W98A 2VTSA 3OEFX 4ASDA 3RCDA 2CKPA 2XK6A 3I81A 4HOKA 3VO3A 4IM0A 3DAKA 2WQMA 2ZV2A 1QCFA 4CKRA 3QYWA 1KE9A 4FKWA 5CU4A 2ZJWA 4B7TA 2YM4A 4KIPA 2XIKA 3NGAA 4U79A 4KIKB 3T3UA 4F09A 4D4RA 4F9YA 2Z7QA 2P0CA 2VTNA 3ZRMA 2X7FA 4N57A 4C4HA 2YCQA 4PL5A 4QP9A 4QTDA 5CVFA 3IW7A 5EK7A 3E62A 5L6WL 5T3QA 4EORA 1YRPA 2G01A 5AEPA 4X7QA 2G1TA 2XKFA 4FIGA 4JAIA 5BVDA 4FKQA 2C4GA 5DBXA 5HNIX 5JT2A 3HZTA 4ZY4A 4O1OA 4YMJA 5M53A 3ROYA 3D9VA 2WMSA 5CSPA 1CMKE 1W7HA 3PPZA 4I94A 4PPBA 3PVBA 4WRSA 4OTGA 4ZAUA 2GTMA 1DAWA 4DGLC 2PUUA 2ZM4A 5GZ9A 4C61A 1PY5A 3QZFA 3H9RA 2IZSA 4ZP5A 3FQHA 4E26A 5ICPA 3PXFA 4FNXA 4M84A 3FMKA 5JK3A 3D4QA 1PMEA 3PJCA 5FG8A 2XEYA 4LRMA 4ENYA 4QP1A 3CGOA 2ZV7A 3WIGA 4BR3A 3U9CA 3CPCA 1V1KA 4BCOA 4YBKA 4AU8A 3MBLA 4X2GA 4QMMA 5AR5A 4BDKA 5L6PA 5HTBA 4S31A 1V0PA 3G90X 2C1AA 2Y6OA 4X2JA 4XV1A 3RAIA 4PTEA 2UZEA 4DGGA 3EFKA 4WD5A 1BLXA 3BHUA 4DGNA 4ZSAA 5DH3A 3HL7A 4UMQA 2QOOA 4CV9A 3FWQA 1T45A 3HRFA 4IB3A 4W8EA 4YP8A 1ZOEA 2CGUA 2XIZA 2CGWA 3DTCA 3PA5A 3ZO1A 5J7HA 1H07A 4O7NA 2OICA 4P5ZA 5AV2A 4KD1A 5L3AA 4UMRA 2RG6A 4PPCA 2R3OA 2UZBA 2VD5A 1DAYA 1JLUE 4GU6A 3W2PA 1MP8A 1RDQE 3S1HA 4BDDA 4OGRA 3DAJA 5DEYA 3O8PA 4NZWB 2BTRA 3U4WA 3RNYA 5AIRA 2H6DA 3UODA 4M15A 4FODA 5DHJA 3KXGA 5DGZA 5L6OA 2JFMA 3KVWA 5DFPA 4K8AA 1ZYJA 1IAJA 3KN6A 4WUNA 3UTOA 2C69A 5HI2A 1KUTA 5FM2A 3LQ8A 1X8BA 3F5UA 2OWBA 2JAMA 5C26A 2YLEA 3CP9A 3GVUA 5JRSA 3VS7A 4ANNA
chains in the Genus database with same CATH superfamily
3PRFA 4JJRA 4CTCA 1W2CA 2F4JA 4FTNA 2ITOA 3TNWA 3CGFA 4EZ3A 4USEA 5JFWA 4FSMA 4FC0A 5EYMA 4DFLA 5KBRA 2IG7A 4AXCA 4M69A 4GIIA 2ITWA 4LV8A 5CF6A 5IG1A 3KMWA 4XNEA 4KABA 4JLCA 3LQ3A 3MIAA 4FTJA 4TYHB 1M2PA 3H9FA 3VS3A 3ROCA 1UKIA 2A27A 3FKNA 3V6SA 3OWJA 3NZ0A 3DAEA 4F4PA 5A46A 2PVJA 5L2WA 4W8DA 4F0GA 1KE7A 4TXCA 3DZQA 5HTIA 2UVXA 2RFEA 2CKEA 4CFWA 4OTRA 4DGOA 3Q52A 5IDPA 4BDGA 5I9XA 4XP2A 3AC1A 1R1WA 3E92A 4YZ9A 1FVVA 1SNUA 5GJFA 4DBNA 1XQZA 3SGCA 5IQAA 3R02A 3P5JC 4BWKA 1GZNA 3VUDA 4PY1A 4C4GA 3F5GA 4NIFA 3BEGA 4II5A 4X3FA 4DC2A 4FIHA 5G1XA 3WZUA 4A4XA 4C2WA 5DI1A 4PUZA 3DB8A 4YC8A 3OP5A 4ACMA 2O8YA 2PU8A 4FT9A 2R3JA 4L00A 3FMJA 3U4UA 4DLIA 4FYNA 5IUIA 3GT8A 4LGHA 5FEDA 5M51A 4U43A 4BTMA 5CWZA 4CMTA 3R8PA 1ZYLA 5LJJA 3TWJA 4I5PA 4MBLA 4C35A 4FT5A 2RSVA 2BHEA 1NXKA 3TNPC 3UOLA 4QMOA 4B6LA 4F1MA 3R71A 4RWKA 4O38A 4DEEA 5HE0A 3RKBA 2C6LA 2Q0NA 3O8UA 3QWJA 1OBDA 4IBMA 4D55A 2QOLA 4AAAA 3PPJA 4AE6A 3H4JA 3JY9A 5EKNA 3LLAA 3ZLWA 3BI6A 4X0MA 4JG7A 3C0GA 4J96A 4J7BA 4EKKA 3BHTA 3HX4A 4L68A 4QMWA 3LJ1A 2VGPA 3TUDA 5FM3A 4GVJA 4ALVA 3DKGA 3Q4ZA 2R4BA 3T9IA 3L8VA 2OH4A 4RWIA 3LVPA 3ZLYA 4F70A 4U5JA 2XM8A 1Q61A 3DFAA 4Y46A 3DT1A 3SRVB 5J8IA 1URWA 4ENXA 3Q2JA 3UBDA 1SNXA 3D83A 1JVPP 1OPKA 3FLZA 4FKOA 5LWNA 2C5OA 2H9VA 5I3RA 2ITPA 2ITVA 3F3UA 3UO6A 3FV8A 4MK0A 5M4FA 3FXWA 3GP0A 2XAOA 1Z5MA 2W06A 4X2FA 4EYMA 1OUKA 4S32A 5J1VA 3H3CA 2VO6A 4USDA 4FTAA 1R0EA 4BCQA 3D94A 4MX9A 3O96A 1J7LA 2YIYA 2IZTA 1TKIA 4IH8A 4RSSA 2QG7A 1Q24A 2BRNA 2WKMA 5L8LA 4MF1A 5CVHA 5FBNC 2WMVA 3MIYA 3OUKA 3SW7A 2WTDA 2ZM1A 3BV2A 4H3QA 5EDRA 3UVRA 3W32A 2RL5A 3CPBA 5A3XA 2C6OA 3V5WA 1H0VA 1O9UA 4IIRA 3UO5A 4LL0A 3E93A 3V3VA 4BDHA 4ZTHA 5F20A 4B8LA 3LKMA 3AD5A 3G6HA 4UBAA 2J0LA 1H1WA 3A7IA 3TJDA 2C0IA 1ZZ2A 2X6DA 4PL4A 4ALUA 2R3LA 3JVSA 3V5JA 3SG9A 3DBEA 3ANQA 4R7IA 3FZSA 1OUYA 4JG6A 5AWMA 3FI2A 2I0YA 4XP0A 3P79A 3MTLA 4TRLA 3FUPA 2V55A 3HVCA 3OF0A 4L44A 4JVGA 5CAQA 5AAFA 3LFDA 3DDQA 3QD2B 3R1NA 3SG8A 3IKAA 3AT4A 4BKJA 3SXRA 3CCNA 2Q0BA 2WB8A 3VW6A 5AV1A 1S9IA 2RFNA 4DGMA 4BGGA 5A6OA 2DWBA 1Z57A 3R30A 2PZ5A 5EQYA 3TV7A 3NS9A 4FKVA 5HG5A 5J9LA 4MQ1A 3VJNA 4CZUA 3ZLSA 3MVJA 5CAVA 3LM0A 1B38A 2QOKA 2VN9A 2UZLA 3LCDA 4HCVA 4RZVA 5GNKA 4AW2A 2QHMA 2O0UA 3VS2A 2UW3A 4CYJA 4H1JA 4AOIA 3TM0A 4DEDA 1FINA 2HZ0A 4Z16A 3CR0A 2VTQA 4O6EA 3MPMA 3WIKA 3VRZA 4P5QA 4D2SA 2ZVAA 3IW5A 4TY1A 5E8TA 2C6MA 3L8XA 4GH2A 3R0TA 3VHEA 3ZSGA 1IR3A 4WSQA 1OIQA 4BVUA 1G8SA 5HX8A 2DUVA 4M7IA 2XP2A 4ASZA 2CN8A 4FYOA 1WVYA 5CY3A 3AMBA 4XS2A 5HESA 4DHJA 3G51A 4YC6A 4ZTLA 5EI6A 1E1VA 1PMNA 2X0OA 4GG7A 2OI4X 3RPSA 3EQIA 4ANMA 3A4OX 1A48A 1V0OA 5HIDA 4G3GA 3LAUA 2IF8A 3UMXA 2W1CA 5CAUA 1UVRA 3NIEA 1W82A 5CEPA 4DFBA 3G6GA 5LVOA 2VO7A 4FZ6A 2HYYA 2J9MA 4W4VA 5B2KA 1R0PA 3BHHA 3PUFC 4WG5A 4KINA 1JQHA 2HY0A 5E1EA 2B9FA 4PWNA 2YDKA 4CT1A 4I93A 3GCQA 4X21A 3FC1X 3NVMB 4FZDB 4RA4A 4FGRA 5CT0A 4S30A 4Q9ZA 4HVHA 4NW5A 3QD3A 3QRIA 4FE2A 3QQGA 5AP4A 2XIYA 3OTUA 3R8ZA 2B1PA 3EQPA 1I09A 3H10A 1KOBA 2W1GA 1F0QA 4C36A 2Z2WA 4D5KA 3RMFA 2Y6MA 2GS2A 3CQUA 4N0SA 3MFUA 4DEIA 2WAJA 1KE8A 4IZYA 5BVFA 4I0TA 4MEDA 4JBVA 1XBCA 3R8VA 1Q41A 4JT3A 4E93A 3FYJX 4XYFA 5HD4A 2H8HA 5IA4A 2BVAA 4HZSA 4MWHA 5E8UA 2Y4IB 3UYSA 1ERKA 2EWAA 4HNFA 1APME 3MS9A 4MXCA 5C1QB 2NYAA 4BWXA 4QYHA 4DYMA 5BVEA 4D1ZA 2BUJA 4AXDA 2IVTA 3FEGA 3NX8A 5EM5A 4HVGA 4R78A 2I0VA 4C38A 4U6RA 4AUAA 4C58A 1ZMVA 4YSMA 4EH3A 5KMNA 2EB2A 2YITA 4IEBA 4AWIA 4TN6A 4BL1A 5IMXA 1HCLA 3LHJA 3WZJA 3JR1A 2GDOA 2CHLA 5JFSA 2QCSA 5JSMA 3LXNA 1G5SA 3ZSHA 3FLWA 3R63A 2C5XA 1YHVA 1XMMA 4DEAA 2Z02A 4I22A 2XNPA 3WYYA 5M08A 2ZOQA 4I5CA 1UWJA 4LDTA 3M2WA 3QCQA 4EZ7A 5EHLA 4OT6A 5CXZA 1IRKA 5EYKA 3MN3A 3U51A 4NL0A 3AMAA 1NVRA 5AM7A 1PYXA 3HV5A 5D9HA 2IW9A 4ZXTA 5IQHA 4CEGA 4YU2A 4CCBA 4EQMA 4PMMA 1JKSA 2ITXA 3QQKA 3PTGA 2ZV9A 1WBNA 2F7XE 3SD0A 1WZYA 2UV2A 3MFRA 4QYYA 5IH5A 3NSZA 2GNJA 4G3EA 4ITJA 5CSWA 4DINA 4YHFA 2AQXA 4O4FA 4CFFA 2XMYA 5KUPA 1A9UA 3KMMA 1Z9XA 4RVLA 1UNGA 5GZ8A 4ACGA 2BZIB 2R0IA 4QQ5A 4D2VA 3BYSA 2R3NA 4U80A 3F66A 3PIXA 2W99B 4HCTA 4ZTNA 4ZMFA 3MFSA 1PKDA 4M14A 5HG8A 1XH9A 3BBTB 5CT7A 4RC2A 2IN6A 1MRYA 1UU3A 2BFXA 3IOKA 3EQDA 4LM5A 1G8AA 4CSVA 1J1CA 3C4FA 2RFSA 3ULIA 2FYSA 2X4FA 4UX9A 5DYJA 2B55A 2JDRA 4XUFA 4FSYA 5J87A 2R3IA 4RIOA 2C5NA 1XH4A 4C34A 1BI8A 1AGWA 5HNGA 2VWUA 3MPTA 3NIZA 4U81A 5FLFA 2WMUA 3BQCA 5KE0A 1QL6A 1TZDA 3Q4TA 4U3YA 4AXAA 3TNQB 4UMUA 4UN0C 4K2RA 3UDZA 3E88A 3RPYA 4XH6A 1TQMA 2QOBA 2R3MA 2OZOA 1BUHA 2YACA 1H00A 5L8JA 5IEYA 4IDTA 3WZEA 2PMIA 4L9IA 4P2KA 3B2WA 3ZRKA 4F9CA 5CAOA 1UNLA 1FPUA 3MH1A 3FSFA 3S2PA 1P4OA 4OBOA 4O91A 5AA8A 3R7GA 4RX8A 5KBQA 2HENA 2WQEA 2XYNA 2QNJA 3EOCA 3FSKA 3W55A 2J2IB 3FE3A 3HV3A 5FP5A 5IKWA 4NM3A 4QTEA 3EN9A 3GQLA 3ORZA 4FI1A 4C3RA 3PPKA 2GS7A 4HPTE 4U0IA 5EH0A 3MFTA 4G1WA 2RIOA 3NW5A 3W2QA 2XM9A 3A61A 2UW4A 5CLPA 2YDJA 4X3JA 4R6VA 3K2LA 3AKLA 5FQDC 4CNHA 2VTTA 3SOAA 3NWWA 3V51A 3DLSA 1QMZA 1SVHA 3UNZA 3LE6A 4J1RA 1J91A 3R7VA 1OB3A 5KMOA 4YR8A 5IUHA 4R7BA 3TCPA 4MXZA 3PP1A 1ZMWA 2OIBA 3D0EA 2J0IA 3G9LX 4XRJA 5JGBA 3FI3A 1OGUA 1E9HA 3RP9A 3R9OA 3DQWA 2WMXA 4WIHA 4GFOA 1OIUA 2PVFA 3PUPA 1LR4A 4MXYA 4AFJA 5CEMA 3PRIA 4RIXB 3CSVA 3ZDUA 3IDBA 4FV6A 3DGKA 2YCFA 2XNMA 3ERKA 2Z7SA 3FI4A 2XBJA 3FQSA 3W1FA 2QONA 2IVVA 4HJOA 4FTKA 1WBPA 5D1JA 3QWKA 4E8AA 4EBVA 2QU5A 3LZBA 3DNEA 4GMYA 4F1TA 2OG8A 3JS2A 3IONA 4BI2A 3HYHA 3R28A 4ZTSA 3OW4A 4ANBA 2BRMA 3W0RA 3PWDA 3MH0A 3DTWA 3KVXA 4L7SA 2VTJA 4KSPA 4ZTRA 3BHVA 4C37A 3H0YA 1PXMA 3FZTA 2KTYA 1FGKA 4UALA 1VR2A 2HWPA 2B9HA 3DXNA 3EYHA 5HE2A 3PDTA 3BKBA 4B99A 5F1ZA 1QPEA 4ACHA 1K3AA 1M17A 2DS1A 1ZY4A 3CJGA 1WBWA 3HGKA 3Q60A 4G5JA 3WF9A 4EOJA 2X2MA 4IMYA 3R83A 1J7IA 4BYIA 2C0OA 2X9EA 2PYWA 4ZSEA 4D1SA 3PIZA 1CKIA 4XRLA 4EOIA 3KA0A 2AC3A 3A7GA 2GNFA 2OIQA 4TYHA 3FZPA 4R1YA 4BCJA 1BX6A 2YCRA 3EL8A 3F3ZA 4YJPA 5JGAA 3W8LA 3ZRLA 3UYTA 4FEXA 1XH6A 3GFWA 5FXQA 3RZBA 5IPJA 3NVKI 2XRWA 2C3IB 2O65A 3BU3A 4KBKA 4A9UA 1TVOA 4RJ5A 4K33A 3FMEA 2A4LA 2G2FA 3L9NA 4YTHA 4L52A 3EN4A 2V0DA 4IZ5A 3FPQA 3R8MA 3UG2A 4AZWA 3Q32A 3RHXA 1QPCA 4TW9A 3ZBXA 5I5ZA 5IQFA 4EK6A 2WQBA 4F7JA 2A19B 4G6LA 1JWHA 1I44A 4EI4A 4A4OA 4XOZA 2JITA 2VWYA 3P7CA 5HBJA 4FT7A 3FHIA 4XEYA 3KRLA 3ORTA 3VBQA 1OECA 1YHSA 3OZ6A 4F9BA 3KC3A 4BCGA 2UZNA 3UDTA 4NYEA 5K3YA 4C0TA 4O7RA 2F7EE 3P23A 2WEVA 4XG6A 4RJ8A 3R7YA 1STCE 4FRFA 4OTFA 4S2ZA 4XG3A 3ORLA 5A54A 5D7AA 3ORIA 3C0IA 3DS6A 5AP1A 4EYJA 2YAKA 4M68A 3TTJA 2B52A 4FKPA 2HELA 4YPDA 2VTRA 4NW6A 4U7ZA 4QQJA 4QTAA 2VTLA 3ALOA 1XKKA 4V04A 4MXAA 3LCOA 4O27B 2JKOA 5B2MA 3QYZA 3NUNA 4ZTMA 5TOZA 2XNGA 1KOAA 3JYAA 3TV6A 3A8WA 2UVZA 3RM7A 3AMYA 4ZSJA 4YTCA 2R7BA 3C4CA 4E6DA 1SMHA 1Y57A 2EB3A 1PKGA 2C3LA 2JEDA 3RGFA 2BHHA 1YXXA 1P14A 4TYIA 4JMQA 4X6RA 4LUEA 4GV1A 4QMTA 2X1NA 2YHVA 4FZAB 1YWRA 3I0OA 3QAME 5CENA 5CANA 3TTIA 4FIFA 3FZRA 5KMLA 3AD6A 1B39A 3LXKA 4JR3A 1LEZA 4BJJB 3CLYA 2B0QA 3ORNA 2OU7A 5L2QA 3QA0A 3KCKA 2C6DA 2X7OA 2FUMA 4FTLA 1WCCA 5HLWA 4FV4A 3P5KA 3UNKA 4K77A 5CSHA 4DHFA 4AXEA 2B9IA 2BAJA 1Q8WA 3F3TA 3ZUUA 3IG7A 1XH5A 4OBQA 4AE9A 3Q4CA 3SHEA 4EJ7A 4BCNA 2PTKA 3FQEA 1VJYA 4K9YA 1UWHA 3EN7A 3UZRA 4FICA 3BU5A 5BVOA 1F3MC 3C1XA 4H3PA 4NJDA 3PE2A 1L8TA 1PXNA 3HMOA 3FKLA 4MH7A 2YWVA 3SX9A 3PLSA 5ETAA 3VBTA 4FV0A 3NNXA 4QYFA 3QTQA 3RCJA 3H0ZA 5EHYA 4EC9A 2YN8A 4I4EA 5HOAA 4AACA 2YLFA 3LCTA 3ZC6A 3OHTA 3FLSA 4Y5HA 2X39A 4MVFA 3QC9A 4GUBA 2RG5A 4QPSA 5DR2A 3II5A 1OM1A 3PSCA 1YWNA 3W0SA 3UIBA 4Z3VA 1VYZA 5CU0A 4EKLA 4YPSA 1CSNA 4IAFA 5FBOA 1AQ1A 3VUHA 5J79A 4FF8A 3W2RA 1VLRA 5FTGA 1WBVA 3W2CA 2JIIA 5JH6A 5FWKK 1PXOA 4JDJA 3ZHPC 3W2OA 3NEWA 1JSUA 4LMUA 2R64A 3KRRA 4IX4A 3UOHA 5HVKA 4WO5A 1NA7A 2QURA 4I0SA 2UVYA 3FLYA 2C6IA 1ZYDA 2ITUA 2JDOA 3EQGA 2BRHA 3FL4A 4ITHA 3F5PA 4R7HA 3KXNA 3ODZX 4OAUC 4MUQA 5AUYA 4KB8A 3RBWA 3NNWA 2E2BA 4NSTA 3QQUA 3BCEA 5GJGA 5IA2A 4EK3A 5KZIA 5B7VA 2C6KA 4LMNA 4S33A 4YJUA 5CU2A 5TT7A 3UQFA 4BCIA 3A4PA 2O64A 3KIOC 4JAJA 1YXVA 1FVTA 4YZMA 3HRBA 4CXAA 5L2SA 3WBLA 3R2BA 4KIOA 3W0OA 2PVRA 4N6ZA 5M06A 3QZIA 3WARA 4O1PA 1OIYA 4YHJA 1H4LA 5AUXA 3KRXA 4BGHA 5A4QA 5ANEA 4O0RA 3V5QA 4CKIA 2UZWE 3R8UA 4O7ZA 2BMCA 4F9WA 4FG7A 5AP6A 3LMIA 2GQRA 2YABA 3KY2A 3GUBA 3DK7A 2Z7RA 4JR7A 4I24A 3OROA 4F7SA 4GG5A 2JDSA 4UMTA 2ONLC 2ONLA 5EFQA 3HNGA 4E3CA 2WOTA 4IFCA 5AR8A 3R21A 4O96A 3WF7A 5K5NA 2CKOA 2Y9QA 3R04A 3DDPA 4PQNA 3CKXA 5E8SA 1JOWB 4Z55A 1ZYCA 1K2PA 5HO7A 5L2TA 3EN6A 3SC1A 1H08A 3Q9ZA 2BRBA 5AP5A 4R5YA 2JKMA 2XRUA 2IPXA 4ZMEA 4I6FA 2YISA 2J51A 3P7BA 5DLSA 3ZFYA 3OWPA 4OT5A 4RMZA 4C7TA 4DCAA 3LFEA 2CSNA 5FDXA 1OVEA 3ZFMA 1OPLA 3LLTA 4GT3A 4Z7HA 2ETKA 2FH9A 3ZXZA 4AS0A 4C2VA 4EH4A 5J7BA 3LMHA 2HOGA 3TNHA 3W33A 2A98A 4LV7A 4F65A 4FTCA 2EXCX 2FSTX 2QR7A 2Y4IC 1IASA 1H1PA 2QD9A 4WUAA 2HK5A 5FTOA 4CRSA 1YDSE 3PA3A 5E8XA 2V7AA 4PNKA 3CTQA 4RPVA 1GY3A 2V22A 3IGGA 5M57A 2R9SA 3PJ1A 1R39A 3IPHA 3LXPA 3O8TA 2R3QA 2HY81 4IHPA 4RWLA 2OSCA 1DS5A 3F69A 4WSYA 1OKWA 5FD2A 4ZS0A 3WZDA 1G8KA 2B7AA 4BKYA 1GOLA 3BLAA 2HW6A 2VGOA 3C7QA 2W1ZA 1ZRZA 4CCUA 5BYLA 3O50A 5H3QA 3Q9XA 3U6IA 1ZXEA 3AC2A 3IK3A 5FXSA 3R9DA 3GFEA 2R3KA 2VWIA 4G3DA 5TO8A 4ZJVA 3G15A 3VBVA 3AT2A 5JQ8A 4ACCA 1YXSA 3A7JA 4GEOA 4TWPA 4USFA 2YM7A 3P0MA 3O17A 5LMBA 4EQCA 3HP2A 3QF9A 4YJOA 5CVGA 3SAYA 2GNLA 4IX3A 5H2UA 3K5UA 3ZS5A 1JKKA 3D5WA 5EYCA 4KRDA 2XK7A 4CKJA 2B4SB 4F0IA 2ITNA 2R7IA 4ZJJA 4MF0A 4GW8A 5LCJA 4HNIA 2ZFYA 2YIWA 2LGCA 1YI6A 2PY3A 4A7CA 3RK9A 5DG5A 4D2RA 4LUDA 3KEXA 2VWVA 3IW4A 2BKZA 4DT9A 3NAXA 4E4LA 2A0CX 3EFWA 1J1BA 2F49A 5ANJA 2YZLA 3EQBA 2OH0E 1Q8UA 2YCSA 2R0UA 2C3KA 4A9RA 5A6NA 5IQIA 2YIRA 4FSUA 4IVDA 4U3ZA 5DOSA 5BMMA 1M14A 3U55A 3MDYA 3U6HA 5EM6A 5J5TA 4JG8A 3R73A 4PX6A 3ZLXA 4BDIA 3CD8A 3KULB 2CDZA 4HVDA 4QQTA 2HWOA 4DF3A 3C13A 3GXLA 4N4SA 2I7QA 4FNWA 5DEWA 5E91A 2IVUA 4Q9SA 3V8WA 4H36A 4QMPA 2QOHA 4PP7A 4L3PA 3V5PA 5AAEA 4BN1A 3WZKA 3DOGA 4YJSA 5CEKA 3O7LD 2OKRA 1CKJA 1FMOE 1SVGA 1W8CA 1MUOA 4F63A 2C5YA 3MH2A 4ZS4A 1NY3A 2AC5A 3AQVA 3I60A 4ZEGA 5HCXA 1XO2B 4YJTA 3LFCA 3HAVA 3E8CA 4O7YA 1M2RA 3VS0A 4LGDA 5AV4A 5IH4A 2C5VA 3QXOA 4A07A 3ENMA 4XLIA 2CLQA 4I20A 4E5WA 4FSQA 2OJ9A 3KRJA 4FIIA 2VAGA 3NLBA 1ZARA 4XG4A 3T3VA 4BY9E 1XH8A 4U40A 4TKSA 4BZDA 1IA8A 4KKEA 3KXZA 4YZDA 5AUZA 3M1SA 2BALA 3F3WA 4PPAA 5KHWA 3PXYA 5A14A 4KBCA 3D15A 3NDMA 1UA2A 1PRYA 3VJOA 4BFMA 4UYNA 2WTKB 1MQ4A 2PMOX 4PDOA 4AT5A 1OGYA 3C9WA 2FSOX 4M0YA 3EL7A 3HUCA 4QMSA 4RC4A 3FMLA 2F9GA 3QGWA 2XK4A 4ANSA 5DT4A 1PW2A 3A7HA 4BKZA 2QVSE 3V04A 3ZZEA 2VWWA 2XKCA 4NM5A 4PF4A 5F94A 3MESA 4O86A 3W0PA 4IX6A 4ZY5A 2J4ZA 5E8VA 2X7GA 3QBNA 4UZDA 4W4WA 4CFUA 3RZFA 3AC4A 4H1MA 5LMKC 5LMKA 2NNWB 4APCA 4H3BA 3ELJA 2ITQA 3GU7A 3MH3A 2JDTA 4LOOA 2CKQA 3DK3A 4FTMA 3SOCA 4O4CA 4CFMA 1FMKA 4DN5A 3MSSA 3BL9A 1P4FA 3QD0A 3QCXA 3EKKA 4R8QA 2W1EA 4QMXA 3VNTA 2BILB 4C3FA 2WIHA 3CE3A 1CTPE 2I0HA 5LVPA 2XAMA 2GS6A 4HGLA 1EH4A 1WBOA 4GSBA 4RIXA 1CM8A 4AZVA 4FSZA 4NT4A 4XMOA 1YOJA 3HKOA 5CNOA 3OCBA 3AKKA 5AP7A 4QP4A 5F95A 3KL8A 4QEBA 1YQJA 2W1DA 2UW7A 3GU4A 3QKLA 3N4VA 4YSJA 3IW8A 4A4LA 3NUYA 2KULA 5AP2A 4DH3A 4B9DA 1SM2A 4UEUA 5CQWA 3HV7A 4FV1A 2XEZA 4YO6A 1GNGA 2WNTA 2JKKA 4YLLA 5C4LA 5M09A 4FSWA 3LMGA 4IJPA 4QD6A 2OF4A 4ERKA 3A60A 3GC0A 4IVAA 4L6QA 4NM7A 3FPMA 4QTCA 5M4UA 3QQFA 3F3VA 1CDKA 5EOBA 3QRUA 4RIWA 3OOMA 5I0BA 1KE5A 2UW5A 3PG3A 2PZPA 3UQGA 3HV6A 2IWIA 3QD4A 5D7VA 5A4CA 5IQDA 1PXJA 3RJCA 2QOFA 4RX7A 3UOJA 1H25A 2VV9A 4FBXA 5HLNA 4C33A 4D9UA 2OW3A 4UV0A 2NO3A 2UZVA 3COMA 3QRKA 2PWLA 4EH8A 3EWHA 3VQHA 3TDWA 1PXLA 3AGLA 3BELA 2BAKA 2C47A 4CQEA 3UPZA 4F9AA 3OFMA 1PMUA 1R3CA 2G2HA 2VX0A 2A2AA 4MAOA 3FXZA 2VO0A 2XIXA 5CU3A 3UIMA 2HCKA 1JPAA 4QPAA 4XHKB 2YZAA 5CZHA 4EH2A 4IVBA 4RIYA 4W4XA 3RPVA 4O0TA 5BYYA 4DHZA 4FMQA 4N6YA 3SA0A 3IECA 4R77A 5I9ZA 3C51A 3T9TA 4ASEA 5FXRA 4C02A 4R1VA 3OXIA 3OWKA 4K1BA 4CQGA 5KMJA 1XH7A 3EYGA 3OS3A 4PMSA 1R78A 4JIKA 2NRUA 3LIJA 3W16A 2RGPA 3GGFA 5DWRA 4KBAA 3IQ7A 4RG0A 4BIDA 1SVEA 2GPHA 5EM7A 4AX8A 5CEOA 2VTOA 5KKRB 1FVRA 3OXTA 4IM3A 1XBBA 3RTPA 4JX3A 3OEZA 2BZKB 3ZCLA 4JNWA 4LQMA 3FYKX 4RJ7A 3VHKA 3PZHA 5K4IA 2I40A 4BYJA 4RBLA 3R9RA 2YIQA 2B53A 3DB6A 2GHLA 5C9CA 2IZUA 5AAGA 4GK4A 5AR3A 5CAPA 1FOTA 3GCPA 3EJ1A 3TN8A 5KMKA 2E9NA 4AF3A 5HD7A 2IO6A 4PP9A 5I4NA 2YDIA 4FSTA 3L1SA 5CQUA 5M56A 3NYXA 4QPMA 5HCYA 2VTAA 5TF9A 3BV3A 2OFVA 2XANA 1O6YA 3AXWA 4CD0A 3DQXA 4M69B 2QOCA 3QKMA 4DFZE 4EOSA 1AD5A 3F88A 3C5IA 5GIPE 2JIUA 4U97A 4CZTA 4GRBA 3RAWA 3VUKA 4MCVA 5J1WA 3A2CA 4G6OA 2WGJA 3RK5A 3UG1A 5DRBA 5HU3A 3MPAA 3D7ZA 5LARA 4J71A 2Z8CA 3A7FA 2H96A 3LW0A 4UWBA 2QHNA 4D2WA 2QKRA 2QR8A 3CY2A 2IZRA 3UGCA 4JX7A 5E8YA 3UIXA 1K9AA 5EKOA 5EOLA 4CG9A 4RQKA 3I7BA 4TZRA 5HO8A 4YLKA 2BTSA 5KX8A 4FTTA 3GNIB 1M2QA 1PHKA 4KSQA 3RM6A 5IF1A 3N4TA 3R8LA 3I5NA 4L7FA 3RAKA 3C50A 5ANIA 4BWPA 2J0KA 4X3FB 2OBJA 2X8EA 3ATSA 2WMRA 4FTQA 5JRQA 4PMTA 4C4FA 5J5SA 2ZAZA 3NNVA 3RINA 3NUSA 4EOQA 4I41A 1UU8A 3QUDA 3O5AA 3GU5A 1LUFA 3ETAA 2LAVA 4MQ2A 4IADA 1UNHA 4C59A 2ITTA 4L45A 4NCTA 4NCTC 3UDSA 3LCSA 1GAGA 3IW6A 2OLCA 2F2UA 3BE2A 1H26A 2QI8A 3LOKA 4J95A 4P4CA 2EXEA 3TUBA 3VUIA 3LFFA 4IANA 2OXXA 4JS8A 2WQNA 1Q8ZA 4NK9A 4O0WA 4AGUA 4R3CA 2QU6A 3SKCA 4FEUA 2BCJA 4MBJA 3D2KA 4IB0A 4BDEA 4BHNA 1ND4A 4FUXA 3I79A 4GFMA 4L53A 3VUGA 3MV5A 5BV3A 4KIKA 2YEXA 4AZFA 4FSRA 4FZFB 2X2LA 4AN2A 3QTZA 4ZSLA 4Y73A 3UQCA 3EIDA 3QX4A 3TZ8A 4JDHA 4O84A 2GTNA 2CGXA 3HP5A 5HVJA 3RHKA 4EHGA 3S0OA 4IQ6A 2BPMA 4FT0A 3G33A 3Q2MA 4X2KA 2QO2A 3PJ2A 3PY3A 4LFIA 3MI9A 3B8RA 3WE8A 4BDFA 4F64A 4I6BA 4EK4A 3MA3A 5EYDA 2EU9A 4BHZA 4O0VA 1LP4A 2GQGA 4AOTA 4IWQA 5BUIA 4G3CA 4NKSA 3KK9A 3F6XA 4L3LA 2P4IA 3D7TB 2YWPA 3ALNA 2Y7JA 3TACA 1W0XC 2UZOA 3ET7A 3IDCA 1XJDA 3HECA 1BYGA