1DS5A

Dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
328
structure length
328
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE, ALPHA CHAIN
publication title The crystal structure of the complex of Zea mays alpha subunit with a fragment of human beta subunit provides the clue to the architecture of protein kinase CK2 holoenzyme.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 99
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ds5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ds5A01
3S3IA 4D4RA 4J99A 4W4VA 2R9SA 5EHOA 2XUUA 4CMUA 1CSNA 3QQUA 3G51A 4TY1A 2XRUA 4JX7A 4KIPA 2C3JA 4QMOA 2H96A 4XOZA 4O96A 3BEAA 3BBWA 3E87A 4FKOA 2PZ5A 2VX1A 5BMSA 5EYKA 2YWPA 3WZDA 4CVAA 5IQIA 3B2TA 4XLIA 3HV4A 3SGCA 5K5XA 3CCNA 3DK7A 3KFAA 1OIRA 4V05A 5HZNA 2YERA 1UU8A 2WU6A 1NVQA 1WBOA 2X7OA 4C59A 5D1JA 2J50A 4ID7A 4J97A 4ONAA 3V8WA 3EH9A 2OFVA 2UW5A 3F7ZA 2XYNA 2VGPA 3V6SA 5CVHA 4U81A 3ANRA 3UDBA 3P5KA 4IE9A 1MQBA 3OCBA 4PWNA 3ZSGA 3TV6A 3H9FA 4IB0A 5AUWA 1PMEA 3IW7A 4AU8A 3C0HA 2QOBA 3LJ0A 3F5GA 3Q9ZA 4O1OA 1PJKA 2YM3A 4BRXA 1ZYLA 3I79A 3RJCA 2XMYA 5ETAA 1M52A 5HI2A 2B53A 2HYYA 3GT8A 4ACCA 3DY7A 4D4YA 3ID6C 4EUUA 4XX9A 2W1DA 2WD1A 4OAUC 1KWPA 4JAIA 4FVPA 2VZ6A 4G5JA 5I9VA 4HYHA 4OLIA 4APCA 3DXPA 3PZHA 2C68A 4GH2A 4PTCA 4W8DA 1H1QA 4JRNA 3SG8A 4FSNA 2YM8A 1OKYA 4MXOA 1OBGA 3ORIA 2WQNA 4FKQA 4RVKA 4UV0A 5FTGA 3UP2A 2XJ2A 5FBNC 3BU5A 4JBPA 4BCQA 1Y57A 5B2LA 5ACKA 3RNYA 3QHRA 1YRPA 3II5A 3HP2A 1K3AA 1KE5A 3IDPA 4OTDA 1PF8A 5DWRA 3ZM4A 3ODZX 2ERKA 2HZIA 2JDVA 2UVZA 3NZ0A 3CJFA 5CNNA 4YHFA 2IVTA 3NSZA 3OWPA 1J1CA 2LGCA 2Y6MA 4LMNA 4ALVA 3C9WA 3P7BA 1IEPA 2EWAA 3D5UA 4FL3A 4FSTA 2W1EA 3KMWA 4PX6A 1MQ4A 5IA1A 4DF3A 3BLRA 3CQWA 5LARA 5IH6A 3C0IA 2R3PA 3UMXA 1W8CA 1XH6A 4YPDA 5TO8A 5KCVA 1GAGA 2QOLA 2Z2WA 3EQBA 3MWUA 2UZUE 4JIKA 4QNYA 2Z8CA 3NUNA 3PSBA 4C8BA 2QU5A 4J7BA 5AP6A 5K4IA 3G6HA 2V5QA 3LOKA 3MH2A 3NUYA 4F7JA 4A9TA 3TZMA 3RAIA 4PNKA 4CKIA 4HGSA 4I0TA 1OUKA 4CFFA 3UG2A 3GVUA 4HGTA 4ZSAA 5BVOA 5AR7A 4JQ7A 3SXFA 5IDPA 4ZAUA 4FGRA 3KVXA 3QRUA 4M13A 4TTHB 5AP3A 5L6WL 4FR4A 4N6ZA 2BRGA 1XBBA 3F2RA 1OPKA 1PYEA 3FDNA 4DEBA 4E4MA 3DBCA 4HJOA 4KKEA 3R8ZA 5AX9A 3QZIA 1B6CB 4M0ZA 4KBAA 4PPAA 4WG3A 3V6RA 5ETIA 5HD4A 4ENXA 2XJ0A 3KN6A 3OW4A 4L46A 3OCTA 3W55A 4EUTA 3FKNA 4L6QA 4CCBA 3NRMA 1SVHA 3ZHPC 1IG1A 3ZFYA 3G15A 3VULA 1GIJA 4AW1A 3EQIA 2JDOA 1KOAA 4DTBA 3IW4A 2WMRA 1NT2A 3ACKA 3S95A 4AE9A 4EOSA 4E20A 3M1SA 4LG4A 4XV2A 4EH6A 1CM8A 2PVRA 4NU1A 4YC3A 3BE2A 2PVJA 4FKGA 3W32A 4O1PA 4A07A 3JR1A 3IKAA 3NW6A 4DEIA 4MNEA 4RZVA 3AC1A 3TT0A 3VWAA 3A2CA 3EQDA 3GFEA 3HA8A 3M2WA 4BCKA 2ZV2A 3ZDUA 4NSTA 2VV9A 5D7VA 2Y8OA 4FOCA 2CLXA 3QU0A 1IAJA 1H25A 5GZ9A 5DR9A 3MVJA 3OBJA 4FVQA 4Z9LA 3H9OA 3DBFA 3FI4A 1W7HA 3OS3A 3R02A 4QTEA 2AC5A 3CS9A 3RM6A 2PZRA 3ELJA 3IW5A 4BWKA 4UALA 3ZXTA 4WRSA 4BF2A 5CSXA 3BWJA 3K2LA 4OAVB 4RZWA 3ZBFA 5B2KA 4D4SA 3QRTA 5EM5A 3R7IA 4BCGA 5AFVA 1ZYSA 3IQ7A 3R73A 4JAJA 1SVEA 2HWOA 2OZOA 4FSUA 4I5HA 4M15A 4ZTQA 5HVYA 3SHEA 2WOTA 4B6LA 4IDTA 3R9OA 4CTCA 2CN5A 5FM2A 4EEVA 2HENA 2GFCA 3IOKA 4G3FA 4X3FA 3OXZA 2CJMA 4CG9A 4F09A 2C5YA 5CSHA 4J71A 3FC1X 4ASXA 3MVHA 2OI4X 4XG8A 1XH4A 5AUUA 3SOAA 1QPEA 3NNUA 5LQFA 4HCUA 3BHTA 4UBAA 5CXZA 5FDXA 4R78A 4BDEA 5C4KA 2R3NA 1JPAA 4R7IA 3PRIA 3FQSA 1VEBA 2OZAB 3I5ZA 4A4OA 1AQ1A 5I9WA 2ZDUA 2XK4A 4FKWA 2X7GA 5K4JA 4ARKA 3MH0A 5DNRA 4HCVA 3ZC6A 4RX5A 2YABA 4WIHA 3RCDA 4DITA 2EXEA 3DB6A 3VBQA 2UV2A 5HE3A 5AR3A 5K5NA 3VO3A 3ATSA 3U54A 1JKTA 2Y0AA 3A8XA 3N4TA 4DGNA 4CKJA 1Q8YA 4YMJA 4LL0A 1H0WA 4GK3A 1Q8TA 2YCQA 4IB1A 4UWCA 4GT4A 1GZ8A 2QOHA 2R3IA 2F2CB 3BZ3A 5FLFA 5M4FA 5EDRA 4DEEA 3AT4A 2H8HA 5KX8A 4L42A 2YIQA 3KRWA 3L8PA 4JX3A 3RAWA 4YO4A 3D15A 3DLZA 3HX4A 2GQGA 3FZ1A 3VNTA 2UZBA 4LGDA 3EQPA 4L44A 5DPVA 2PMLX 3QC4A 4I6QA 3E63A 5EH0A 5JMSA 5M51A 3QC9A 1H27A 2O64A 3FWQA 5A3XA 2JDRA 3ZOSA 3QZGA 1R0PA 3HDMA 3HMNA 4AF3A 2GS6A 5AUYA 2CKOA 3IW6A 3FL4A 2J90A 4UWBA 3G6GA 5J1WA 1HCLA 3ZUVA 2CGUA 4H36A 4FEQA 1OL2A 4H3PA 4PTEA 2VWBA 4D58A 3DGKA 3PJ8A 5JRSA 4WRGA 2PSQA 3PTGA 4Y5QA 3QUEA 4XV3A 3RTPA 2XM8A 4K0YA 4ZK5A 3UOJA 5M08A 2P2IA 1JNKA 4RJ8A 2FH9A 1QCFA 4BDFA 3D0EA 4GCJA 5C01A 2RSVA 4IW0A 4MD8E 2XH5A 3TIYA 4RJ5A 1XH8A 4BCHA 4USEA 5KMIA 4CGAA 2ETRA 4EZ7A 5AJQA 3WZJA 1YXUA 4FSQA 5LOHA 3JYAA 4ZTHA 2O0UA 3CTHA 2IG7A 3DBQA 4OT6A 2WOUA 1YI3A 3L8XA 3R22A 5FXQA 2CKPA 5HIEA 4MWHA 4CLJA 5EHYA 2F9GA 4K9YA 1J7LA 4E6QA 5KBRA 2CHLA 4DEHA 2RGPA 3K54A 4NKSA 3WILA 4ZZOA 3QGWA 5AP4A 5M53A 3DU8A 4LUEA 3GENA 4FF8A 4HVIA 4GUEA 2GNGA 4P90A 3UGCA 1VZOA 5T68A 3UZTA 4O84A 3I6UA 1EH4A 2PMIA 3B2WA 4IVCA 3V5QA 3EFJA 3QBNA 2I40A 4AZWA 1G8AA 1PXKA 3BPRA 3EYHA 4I0SA 4R5SA 1DS5A 4YTIA 3GOKA 4EOLA 3BV3A 3AG9A 2OK1A 5JH6A 4FMQA 4JNWA 4BTMA 2VU3A 2VX3A 1E1XA 4QP9A 2C6KA 2J4ZA 5CZHA 2BDJA 4AT3A 5KMKA 2PMOX 5EQEA 2BHEA 4FNYA 4O82A 5HE1A 4DG3E 4QMVA 2O65A 5T6KA 3ROYA 5IUHA 3AGLA 2BAKA 3UC3A 3HMPA 4E6AA 4Z16A 4CT2A 4RSSA 4USFA 3ZUUA 3NMUF 1Q97A 3NUUA 4TWPA 3RPSA 3FKOA 5DIAA 2XIXA 3V5PA 4JJRA 2ITUA 3D7ZA 4X2NA 4CV9A 4DBXA 2EU9A 2VRXA 3CLYA 3ZS5A 3SA0A 4CZUA 4ZMEA 2BCJA 4RQKA 4IAYA 4U3YA 5ITAA 3PSDA 3QAME 2R2PA 2R3MA 3F66A 3GC7A 3ORNA 3RHKA 4E4LA 3GB2A 3Q04A 3QLGA 2O5KA 4UB7A 3PIZA 4LOOA 2XK8A 3CIKA 3TUBA 5GJFA 3SAYA 2VTTA 3VW6A 5DT3A 5CAUA 5HU3A 3A60A 4QQ5A 5CEOA 2B1PA 1S9IA 2QHNA 3BI6A 3D83A 3NUPA 4IC7A 3C5IA 2HY81 2WHBA 3LCDA 5E90A 4FOBA 4DGOA 3EOCA 4EKLA 1OKZA 4JG7A 4FYOA 3P7CA 4ZS4A 4JBOA 3UIMA 3U9NA 1BI8A 2W5AA 3B8RA 3OCSA 3TCPA 5HTBA 2XS0A 4KIOA 3F3ZA 4Q9ZA 3P79A 3NYVA 3VC4A 4U43A 3UQFA 2WMTA 5BVDA 5IH5A 5IZFA 4IVAA 2FSLX 1T45A 2WMWA 4X3FC 3FBVA 3JVSA 1R78A 4R3PA 1PXJA 4GT3A 4HPTE 4JQ8A 5L2QA 4AUAA 4GYIA 5EI2A 3TNIA 4RC2A 5KMMA 3LLAA 3A7FA 3OFMA 4KS8A 4J96A 5TF9A 3L8VA 3FMDA 3R7EA 4K33A 3A7IA 2UZDA 1A06A 4W9XA 1XWSA 4OBPA 3SKCA 2F7XE 4IZ5A 3KQ7A 4QPSA 4RIXA 5FXRA 1YXVA 3T9TA 2P0CA 3KCFA 4JBQA 2J0LA 5E8UA 3FXZA 1OL5A 3LJ2A 3ZFXA 5LVMA 2BKKA 3Q4ZA 5JQ8A 4U40A 1WFCA 3ENMA 2QCSA 2XNEA 2BRHA 5EQPA 3FMJA 2W0JA 2G01A 3TDVA 4KA3A 2W1CA 1W98A 3G9LX 4ANLA 4IBMA 3HMIA 4NM5A 3I7CA 3KXZA 4Z3VA 4B8MA 4PRJA 1FQ1B 1NA7A 4C37A 4O27B 4ZY5A 5LVLA 2BIYA 4CNHA 5K3YA 5A4LA 2OJ9A 3KRXA 3IG7A 4XYFA 5DOSA 5EKNA 3JUHA 4IVDA 1SYKA 4EOMA 5CEMA 1SNUA 3ALNA 4QO9A 3MB6A 5CX9A 3BHYA 4PDSA 4IXPA 1XO2B 2BZJA 2XJ1A 5BPYA 1JOWB 4GT5A 4NJ3A 4C4IA 4CFUA 5DR2A 3TUCA 3QWJA 3VQHA 2YDIA 4CEGA 4DT8A 4O7LA 4NIFA 3KY2A 5I4NA 1OKVA 3Q96A 3ZO2A 2WMXA 3O51A 4J1RA 2WQOA 4L01A 4RIYA 4RWIA 4ZEGA 2IVVA 2FO0A 1XJDA 3C5UA 3H30A 3QQLA 2WAJA 4M66A 4TWNA 4RX8A 4QMLA 3VUTA 3DQXA 1OIYA 2YAAA 3MSSA 3QWKA 3DK6A 3L1SA 4GYGA 5D41A 3A99A 3EN6A 4TXCA 5E8YA 1STCE 3QA8A 4TYGA 2ZMDA 2ZV7A 5CI7A 3QD3A 3S4QA 4EHGA 2XCHA 1P5EA 3JY0A 2EUFB 3A4PA 5KE0A 5CI6A 1O9UA 3MJ2A 4AOJA 3COMA 5CAQA 3CC6A 4I4EA 4F9CA 3IO7A 3ORTA 3LKMA 4G6OA 3V5LA 4BDHA 2BUJA 4GUBA 5A9UA 4AE6A 3BX5A 3ET7A 2J6MA 4HYUA 3T9IA 4BN1A 4X21A 2J2IB 3KA0A 3L9MA 5EOBA 1IR3A 4KS7A 3F2NA 4C3FA 3MPTA 4RRVA 2ACXA 3CY3A 3UOLA 5JGDA 4QRCA 4IEBA 4GFMA 4FBXA 2XEZA 2JAMA 3IPHA 4JT3A 5GINE 3R7YA 3OVVA 3QD2B 4BHNA 2OXXA 4LMUA 4PMMA 4RJ7A 3GEQA 2C5XA 3ZRKA 4ALUA 4RIWA 1JKLA 1OI9A 4HYIA 4X0MA 3H3CA 2DUVA 5HKMA 4QTDA 3ZO4A 4EQUA 2OJGA 4R8QA 4MQ1A 5HD7A 2UZOA 3RWQA 4K11A 2JIVA 2B52A 3TTJA 3ZZWA 2WO6A 4C35A 1H00A 5M4IA 5AV4A 4U3ZA 5L4QA 4WNOA 2HZNA 3FPQA 1Q8UA 4BI2A 5BYYA 4TL0A 1JKSA 4WNMA 1IRKA 4FNZA 2QO7A 3SQQA 3LLTA 1T46A 2HY0A 2Y6OA 4F08A 3FQEA 4ZY4A 2BZKB 2X6DA 3VJOA 2FUMA 4MHAA 4L7SA 5D7AA 2PU8A 4G3EA 4PMSA 2RFSA 4UWYA 3LM5A 4OTGA 2QG5A 4MBLA 4YZNA 3FLSA 3LM0A 4L67A 4FG8A 5IUIA 4EH3A 2BRMA 2FA2A 1BI7A 2PL0A 4GU6A 3TKUA 4BDKA 4FT0A 2BHHA 3LFDA 3LQ5A 2CKEA 3CQEA 2BIKB 3MVLA 3VRYA 4AACA 4XUFA 4NW6A 4I6FA 5AR4A 3F5UA 3IDCA 3VJNA 2Z7RA 4JG8A 2HCKA 1WZYA 2GU8A 1ZXEA 4YO6A 1CKIA 1RE8A 4EK6A 3PVGA 3VRZA 3OXTA 2OLCA 4Y46A 3WZKA 4ANSA 2PTKA 3UNZA 3R6XA 3MIYA 3FZRA 3T3VA 4GJ2A 2OF4A 3TTIA 1APME 2E9NA 3F9NA 5L2SA 4EZ5A 4BIEA 4TZRA 3G2FA 3HEGA 4FSZA 2P33A 1BMKA 2XIKA 3FZPA 2XA4A 5CENA 3I7BA 2ETMA 3ULZA 4M69B 2YDKA 1OECA 5LVOA 4L3LA 4J95A 3EQRA 3ZLYA 5EOLA 4EH7A 1IA8A 4WA9A 4RX9A 4YNOA 4ZJJA 4QQTA 2GNLA 2HZ0A 2BALA 4DCEA 3RPVA 3P78A 4EL9A 4EHVA 1E9HA 1KE6A 3QQKA 3BYUA 4XJ0A 2OIDA 3PPZA 3QTIA 4NYEA 4NUSA 3LXNA 5EM6A 5HQ0A 5ETCA 3RI1A 2PVYA 5E8ZA 3QXPA 2G1TA 2IW8A 3JXWA 4F6WA 1A48A 2WFYA 5EQYA 1SMHA 3AMYA 4Y5HA 3QF9A 4IADA 5EM8A 3EB0A 5GJGA 3AOXA 3QQHA 2XNGA 5ANEA 4X3JA 4U44A 4OTHA 5G6VA 3WE8A 1JSTA 4FSMA 2WIPA 4ZJIA 2E9UA 4KRCA 4DE4A 1GZOA 4AWIA 4QTCA 4LL5A 1YKRA 3VUHA 2EXMA 2GMXA 2XYUA 4PP9A 1Q5KA 3AC8A 3QA0A 4TYHB 4ZTSA 5BYZA 4S33A 3TL8A 4P5QA 4H3BA 3WE4A 4AOIA 4EK5A 1UWHA 4NEUA 5CU6A 4J8NA 4OUCA 3TWJA 4F7NA 5IA4A 2V7OA 3S0OA 4UZHA 3NYNA 3GCVA 4Q2AA 4EOQA 4CFXA 4ORKA 3R30A 1O6KA 3D5VA 2Y4IC 3QCYA 3Q6UA 3MDYA 4KKHA 4ZTRA 4EK4A 3E8DA 2QR7A 3QHWA 4AAAA 5CY3A 3DA6A 4AX8A 4F9BA 4G16A 2YLFA 4FTUA 3GUBA 5LVPA 3V01A 4ITIA 3HAVA 2WTWA 4MBJA 3OCGA 4FTIA 3TKIA 1SVGA 3PJ3A 4FKSA 5A4CA 4K8AA 1WBVA 5IMEA 3OWJA 5JZJA 1P14A 2PE2A 3EQHA 4YJQA 1WBWA 3FL5A 4ANQA 4L8MA 4EYJA 3F7WA 2UW9A 3HZTA 5HLWA 4NTTA 4M67A 3E92A 3RWPA 5GZAA 3EL8A 5EKOA 2HXLA 3AGMA 2FSMX 3D14A 2QONA 3QYWA 3O50A 4BY9E 4D5KA 4BDCA 4GW8A 4BFMA 4YNEA 3ENHA 1OKWA 4MYGA 4E73A 3FE3A 4LRMA 5CF6A 4AFJA 3DPKA 5AP7A 1U4DA 1OMWA 3QTQA 3RPOA 5CASA 1CKJA 3GCQA 4FTMA 4DTKA 3GC9A 4CCUA 4NT4A 3C51A 3R8VA 2YHVA 3LFCA 4HGEA 3D2IA 4PUZA 4O7VA 4E26A 3SW4A 4BI1A 3MVMA 4J8MA 3ATTA 1QPJA 4FEXA 4R77A 3HUCA 1IA9A 1W84A 2AYPA 3F2AA 4JIAA 5J5TA 3O8TA 3MY0A 3BIZA 3FI2A 3R9DA 4AGWA 2PUUA 4X7QA 3TJDA 1ND4A 2UZVA 2BDFA 4FV2A 3UTOA 2R3OA 2I0EA 2IZSA 4U0IA 4FSRA 3TI1A 2QC6A 4HZSA 3VS3A 2ZV9A 5DFPA 4I93A 4FUYA 5EYMA 5FEEA 3CQUA 2W9FB 1IASA 2YCRA 4FK3A 3PP1A 5H8BA 3WF9A 1U46A 3AMAA 3G0EA 4A9SA 3MFSA 4ITHA 4ZSEA 5EG3A 2XM9A 4QYEA 5E8WA 4C33A 3ZBXA 3MY5A 2F4JA 1ZYJA 3DFCB 3VQUA 3MTLA 4S31A 4U5JA 4EH9A 3A7GA 1KE7A 5FM3A 4EH4A 5IQHA 2QOOA 3PUPA 4YGAA 4A4XA 1WCCA 1UNHA 1UU7A 5GNKA 1LR4A 3RZFA 4EOOA 5H8EA 5IQBA 5IQGA 1WBTA 5LMAA 4RWLA 3UPXA 5HX8A 2XVDA 4RA4A 1URCA 2WB8A 2YIXA 2A1AB 3OROA 4MF1A 3AC3A 3FXXA 3KVWA 4ZSJA 4PTGA 4NJDA 5HE2A 3T3UA 5B2MA 5I9ZA 5JGAA 3QZFA 4TKSA 3R01A 3G90X 4H58A 3P86A 4FEVA 2OXYA 1JQHA 4OTPA 2CNQA 3BQCA 3O8UA 2XBAA 3DJ7A 5M44A 3PPKA 4I5PA 2VTRA 5ANJA 5TOZA 2ZM1A 4XBRA 4D0WA 5JFVA 5EI6A 2P3GX 1U54B 4PMPA 3EL7A 3V5WA 4FA2A 3U4WA 4FUXA 4C4EA 4E4NA 2CNVA 3P08A 3WZEA 1JAMA 2CMWA 5JFSA 4HVHA 4GVJA 4L3PA 3MFTA 4QMWA 4YBKA 2YACA 3LW0A 4ZS0A 3R0TA 4V0GA 4C4HA 4EQMA 2JDSA 4QMXA 3IS5A 3C4ZA 2WTJA 1O6LA 3E88A 3TM0A 2ZVAA 4NK9A 2UUEA 1LPUA 4U9AA 3UPZA 3KC3A 1UA2A 4U6RA 4GIIA 3HGKA 1XBAA 4KIKB 4IJPA 3FY0A 2FGIA 3OT3A 4N0SA 5CXHA 3ZLWA 4DFXE 1A9UA 5HG5A 4FE2A 2CN8A 2WGJA 4PL3A 5EK7A 4FNWA 3NUAA 3F69A 5AP5A 3UBDA 3DXNA 2IWIA 3RK9A 5KHXA 3G9NA 2ZM3A 2BZIB 1LEWA 3JS2A 2OIQA 4M97A 4QPMA 2JKQA 5M4UA 4S30A 3W2QA 4EBVA 4GSBA 3UZRA 2B9JA 5H8GA 2I7QA 3I4BA 5JSMA 3OWKA 4RJ4A 2ZV8A 4O7TA 2B4SB 2YAKA 2A27A 5HNIX 4YTHA 4NM7A 4KRDA 1UKIA 4C4GA 3U6IA 3GBZA 3L9LA 2DS1A 1YWNA 1Q62A 4IIRA 1Q61A 3SDJA 2PZPA 5EW9A 4C38A 2WEVA 4F9YA 4J98A 3NS9A 5GZ8A 2BKZA 3BWFA 4BWXA 5HVJA 4A4LA 4YLKA 3KK8A 2OBJA 4NWMA 5CSWA 1UVRA 5CF4A 5E7RA 3OWLA 5L6OA 3DTCA 2C30A 2PMNX 3W16A 3BU6A 1GY3A 2C6LA 2WNTA 4GFGA 1LUFA 4S34A 4AZFA 3TNHA 5LXMA 5CEKA 1XH7A 2PHKA 3E3PA 3K5VA 1JSVA 4I94A 3UYTA 2JBPA 3AT2A 1WBNA 2IVSA 4GFOA 4L53A 4TWOA 5CNOA 5CWZA 3CXWA 3F6XA 3HNGA 5AIRA 3TXOA 4F9WA 1Z9XA 5FTQA 2QG7A 3MTFA 4AW0A 2BAQA 3KL8A 2WMAA 3ZEWA 4UYAA 2UVXA 3HP5A 4IB3A 1H28A 3UO4A 2VD5A 3UE4A 4YJSA 3IECA 4N4SA 5CQUA 3W2OA 4CT1A 4G9RA 2OW3A 2W1HA 4MH7A 3NNWA 4Q5EA 3ZRMA 2O8YA 2OKRA 3C4XA 4YJOA 4ZJVA 1P4OA 5HG9A 3VUIA 2GDOA 2ITZA 4E3CA 1TQMA 3K3IA 4MD9E 3PXRA 5ACBC 2VO6A 4NZWB 3D7TB 4EH8A 5FUTA 5DN3A 2PVMA 4G6LA 2W9ZB 5E91A 1ZWSA 4FICA 2W1FA 4DT9A 4L9IA 2HWPA 3BV2A 5AA9A 4DGLC 3BLQA 1Z57A 4ZTNA 1F3MC 4I3ZA 5AV0A 4IB5A 2C4GA 1OBDA 5J9YA 4CG8A 3D5WA 5I9UA 3OTVA 3SRVA 4XG4A 2ITWA 4JL9A 3GOPA 5ANOA 4BZNA 5CZIA 3NW5A 3OMVA 2R7IA 5E8XA 1H1WA 1Y8YA 5AA8A 3PPJA 4XP3A 3IGGA 4XV1A 1H1PA 5C8KA 4UXLA 1B39A 4XG6A 4BCJA 4O0RA 1BX6A 2X9FA 1FINA 1YDRE 5F1ZA 2W4OA 3DBDA 4WG5A 2J0MB 4W9WA 4KINA 2B54A 2JITA 3U87A 3LE6A 4TYJA 4B99A 4GRBA 4E8AA 3BE9A 5C03A 2V0DA 4E5BA 2JAVA 4V01A 4Q9SA 4QYYA 4G34A 4ANBA 3FSFA 4ZY6A 3R1QA 2G15A 4K1BA 1XH9A 4TYIA 5M57A 4EC9A 5AM6A 2OH0E 1F0QA 3QCQA 5DBXA 4F4PA 4DFZE 3PA4A 4IVBA 1VR2A 4JXFA 4JDIA 4I20A 1OB3A 1DM2A 5CEPA 4LQMA 2GNHA 4LRJA 1ZOGA 2ZB0A 1TKIA 4UZDA 3COKA 4UY9A 3AC2A 5D10A 3FHRA 2BMCA 2QOQA 4KAOA 4BDDA 2FSOX 1Q8ZA 3UO6A 2YWVA 1MRUA 3PLSA 5DH3A 3P9JA 5IA0A 2OGVA 2R0IA 3AQVA 1GOLA 5M09A 4EBWA 5BMMA 4AGCA 5L2TA 3PVBA 4ZSLA 2XKEA 3RCJA 3BELA 1PMUA 3KMUA 4JG6A 3OOGA 3RHXA 1CMKE 4YBJA 2OJFE 3EYGA 1ZMVA 3CPBA 4XLVA 5KZ0A 4EHEA 2BAJA 3QTRA 3UVQA 4ERKA 2HW7A 3QKLA 3N4VA 1ZZLA 4U79A 4O21A 4AA5A 2PVLA 3EN9A 2UW0A 3CKWA 4FTRA 3DKOA 4UMRA 1BL7A 4BGQA 1FBNA 4CKRA 2V7AA 4TYEA 2W06A 3A8WA 4A7CA 4HNIA 5CU2A 1ZRZA 3Q2MA 3SG9A 3QYZA 5F20A 4C62A 4DGGA 3DK3A 4I24A 3FEGA 4ANOA 2KULA 2WMSA 2VTJA 3OEFX 3OZ6A 3NLBA 4IAFA 4DHFA 5LWMA 1GZNA 5C1QB 3F88A 3PYYA 5EHLA 5TT7A 4BGHA 4ZLOA 3NWWA 4F9AA 4IX3A 3HV7A 3VIDA 4C2VA 4CD0A 2VGOA 4DFYA 4DH1A 3OXIA 3U4UA 3RM7A 3S2PA 5LMBA 1SNXA 2R64A 4L43A 2YLEA 3WF6A 2XIRA 3A62A 1JWHA 2GTNA 2C0OA 2WTVA 2H34A 3KXMA 3UIBA 3ZU7A 5BUJA 5BX0A 4MQ2A 3EQFA 4OW8A 4BYIA 5TKDA 4EQCA 4FKLA 3ITZA 2CDZA 1V0BA 4D28A 4S2ZA 2B9HA 5A6NA 4FSWA 3KXNA 4ZZNA 3CR0A 3S1HA 4BZOA 1I09A 4EZ3A 4EJ7A 3Q6WA 2JKOA 3EZRA 4OBOA 4DN5A 2OJJA 2A2AA 3NYOA 4IZYA 4CMTA 5AP1A 3R7GA 3BGZA 3VN9A 3MS9A 3BHVA 4AW2A 5CF5A 3QRIA 5IUGA 1OIQA 5HBHA 4CXAA 3NNVA 3WF7A 2OWBA 3GXLA 4C61A 5HE0A 4EOIA 4EK8A 2OICA 2W1ZA 5I3OA 3OY3A 2CPKE 4WD5A 2IN6A 1NY3A 3VS5A 3KU2A 2XNOA 4HCTA 3LXPA 4E1ZA 4MNEB 1JBPE 1YWRA 3FLNC 4TPTA 3LFNA 3ORKA 3G33A 4ZXTA 1WBSA 3DKFA 4BC6A 2X4ZA 3U8WA 2J0IA 3FLYA 1U5QA 5HCZA 3VS1A 3R71A 3R2BA 3I1AA 1YHVA 4XRLA 3COHA 4QMSA 4DINA 3PP0A 3RAHA 4FKVA 4LYNA 2ERZE 4C0TA 3QXOA 4KSQA 4G3DA 1Y91A 4ANMA 4QMTA 3DAJA 5H2UA 2BFXA 4DH3A 5I9YA 5K9IA 3AXWA 4ZMFA 2R3LA 3EKNA 3OC1A 3ORXA 4Y8DA 1RJBA 2Y7JA 2IW9A 2NPQA 3A4OX 2IW6A 4IFCA 4JR3A 5KHWA 2W4JA 1E1VA 4WNPA 5CVFA 3MA6A 2ITPA 2EXCX 5TR6A 5D9HA 2V62A 4BCFA 1G5SA 1NVRA 4LV5A 3TV4A 1PXLA 4FTJA 1H4LA 3D5XA 4QP3A 3UIUA 5A14A 4BICA 3HMMA 1XHAA 4YZMA 1KE8A 3KULA 5DT4A 5BVEA 2GSFA 5AMNA 3IOPA 5I3RA 4X3FB 2GPHA 2W96B 4C3PA 2C6EA 4M69A 1H1RA 3MV5A 4RPVA 4FX3A 4YP8A 4IZAA 4DYMA 5C8NA 1M2RA 4XG7A 1L3RE 3ZC5A 2XK3A 1J7IA 3FYKX 5L8JA 5HCYA 1J91A 2GHMA 3GFWA 1BKXA 4QTBA 4RFZA 4X6QC 3UQCA 3QQJA 2VO7A 3R1YA 4YJPA 3EMGA 3KEXA 3L8SA 4MX9A 3R8PA 3FUPA 4O2ZA 4RG0A 3UOKA 4EORA 5KKRB 2OU7A 3EJ1A 4QP6A 3R9HA 1YOMA 3IW8A 3MYGA 1K2PA 2CGXA 2OH4A 2VWWA 2YN8A 3DJ6A 4PV0A 4UXQA 3ZLXA 3WI6A 4ANNA 4FV1A 4N57A 3EQGA 3FJQE 1HCKA 4XV9A 3QQGA 2YDJA 1B38A 2AC3A 3FMEA 2HELA 2C0TA 2X8IA 4NFMA 4OTQA 3VBTA 3MH1A 3C50A 5FTOA 3RK5A 2C3LA 2UZLA 4EKKA 2B7AA 3QRKA 4OBQA 3OY1A 4TW9A 5EI8A 3NR9A 1VYWA 4RLLA 5H3QA 3WARA 1UWJA 5A6OA 4GKHA 3GU4A 5FDPA 4YZDA 3BHUA 5HBJA 2VTOA 4QMZA 4XP0A 4X6RA 1ZMUA 2BFYA 3LCTA 3LFSA 3MPAA 3H0ZA 4BCNA 3ZMMA 5CYIA 4MNFA 5IA3A 4D0XA 2UZNA 4DFNA 3PA5A 3NIZA 3RZBA 2YIYA 4L52A 4OTWA 2XNMA 2C5NA 2EB2A 2PVKA 3H9RA 3MGYA 5J5SA 4APPA 2VWZA 3DZQA 3HDNA 3PXQA 1M2PA 4I4FA 4MEDA 5CQWA 4M12A 3WYXA 4BB4A 3Q2JA 4QMUA 1YXTA 4FIFA 3EN7A 3IK3A 2RKUA 4CRSA 3PE2A 4QMNA 4IH8A 5KMOA 2BRNA 1SZMA 2YM6A 4JRVA 4QMYA 5CAPA 5IF1A 1ZARA 3O23A 3W1FA 2PUNA 4G1WA 4EC8A 3OD6X 5CSVA 2QOFA 3E7OA 4W8EA 4C7TA 5KNJA 2VWUA 4CQGA 3UYSA 3R7VA 5J9ZA 2XRWA 1R39A 4F0IA 4FG7A 5HX6A 4WSQA 3FYJX 4YTCA 3R28A 4QP4A 2J0JA 3CKXA 3LCSA 4F0GA 2X2LA 4M8TA 4NTSA 3SVVA 3FMNA 3ORLA 5CSPA 4KUJA 2W05A 5EDQA 1OUYA 4FIEA 4AT4A 3HV3A 3MJ1A 2QLUA 3DNEA 5DEWA 5DI1A 3CGFA 4PL4A 3WBLA 3R1SA 2QOCA 2X2MA 3LMGA 3RPYA 2HZ4A 4KKGA 3P23A 4R3RA 4HVGA 2R0UA 2I0VA 2XNPA 5E4HA 2JC6A 3KGAA 4R5YA 5D11A 4LOPA 3PVUA 4IM0A 5IQEA 4BBMA 3FMMA 1U5RA 2CNUA 3QCSA 3ZXZA 5HICA 3VBWA 1ZOHA 2W5HA 2C1BA 2Z60A 4F1TA 4YR8A 4LRKA 1LEZA 3C0GA 3REPA 5J8IA 4CFNA 4O6EA 4F0FA 5AADA 3KREA 5BUIA 3HV6A 2GFSA 4FYNA 4P4CA 5L8KA 3QUDA 4X2FA 2QQ7A 4IM2A 3OOMA 2H6DA 2Y9QA 4RFMA 1WVWA 5ETFA 2XEYA 3F3VA 2O63A 4GG7A 1CKPA 3EN4A 4ACDA 4D2SA 2WTCA 4KBCA 2IZUA 2WQBA 3O0GA 4E5WA 4EH2A 4FIGA 3RBWA 4GKIA 3DOGA 3E5AA 1FOTA 5AV1A 4WKQA 3TKHA 5LJJA 3PJ2A 4RIOA 3E62A 3G5DA 3LHJA 3AMBA 5C9CA 3P4KA 5EW3A 4FTCA 1OL6A 3DS6A 3TACA 5J1VA 1PXPA 4QMMA 4MXXA 3V5TA 1YWVA 4IWQA 3UJGA 2XBJA 1J3HA 3LFQA 4GVAA 5HEZA 5AR8A 2RFEA 4DAWA 3GQLA 3O17A 2PVHA 2VTPA 5CS6A 4YLLA 4I92A 3R2YA 3GC8A 1YXSA 3BKBA 3BRBA 2PK9A 4FIJA 4M68A 5LCKA 3R9RA 5KMNA 3FZOA 4KNBA 5EW8A 4C4JA 3U6HA 5DA3A 2WQMA 5AP0A 5DYJA 1R0EA 3E93A 3NUXA 3KXGA 4AN3A 4KWPA 2ZM4A 4H39A 2OXDA 5BNJA 2WMBA 2J51A 4ITJA 3PRFA 3CSVA 1YI6A 1Q8WA 3RALA 4W4XA 3MH3A 3DKGA 2I1MA 4HZRA 4E4XA 3A61A 4G9CA 4BR3A 2YZAA 4M84A 3S00A 3W18A 1G3NA 2CGVA 2JGZA 4IAIA 4JDKA 5M06A 3H4JA 1JSUA 2AUHA 3WYYA 5ANGA 3GC0A 3F5XA 3HKOA 1OITA 4MWIA 3MIAA 2R3GA 3E7VA 5LWNA 3FZSA 5AV3A 3QQFA 3W8LA 4ASDA 4D5HA 2R4BA 4C57A 3EIDA 3KK9A 3EFWA 3LMHA 4RIXB 2BROA 3GCUA 3C4FA 4U80A 2GS7A 4FTOA 5I0BA 2UW3A 1BL6A 4CFVA 5HVKA 2YM5A 2JIIA 2PE0A 3CD8A 3KXHA 2QU6A 3OTUA 4YZCA 3W2SA 4BDJA 1UKHA 1HOWA 2ITQA 3Q52A 5A4TA 4QTAA 3VAPA 5IEYA 4ACGA 5AEPA 4W4YA 3DAKA 3NCZA 3VBXA 1RW8A 4RFYA 4I21A 2OF2A 4BDIA 3BEGA 2B0QA 4B8LA 4MKCA 3HUBA 3DBEA 3QCXA 4H1JA 4YHJA 1YDTE 5JEBA 4CYJA 2ONLA 2B9IA 5C27A 2GQRA 4D9UA 1V1KA 3AD5A 2IZTA 4H05A 4QQJA 4NFNA 3KRLA 4R3CA 5J87A 2ETKA 2Y4IB 3W33A 2YCFA 1GJOA 3QTWA 4H1MA 3R9NA 3PG1A 4YPSA 3UNJA 3A7JA 3MESA 1OPLA 3EKKA 3NVKI 4IAAA 4UEUA 1LP4A 1OL1A 2NRYA 2YA9A 2QD9A 4EI4A 3CY2A 3PXZA 2NNWB 4EHZA 3AC5A 5CAVA 2WTDA 3LJ1A 4IQ6A 3ANQA 1PYXA 2YIRA 4EOJA 2C3KA 3C13A 4RIYB 3N9XA 5F95A 2DWBA 4U45A 4FKRA 3K5UA 2Q0NA 3VS2A 4D2PA 4R7BA 2E9PA 4F6SA 5JFWA 2CCIA 3RMFA 2R5TA 4D2RA 3W2PA 3FV8A 4F7SA 5KO1A 5CEQA 2PYWA 4NM3A 4LUDA 3CE3A 1QL6A 2JKKA 3NW7A 1Q4LA 4YC8A 4KABA 3SXRA 3DXQA 4DFBA 4XOYA 2HAKA 2VTAA 4XBUA 5JZNA 2XF0A 5JGBA 4EWQA 1YQJA 1ZZ2A 1NVSA 4F1MA 5KBQA 4M0YA 3R7OA 4H3QA 4RMZA 1J7UA 1OIUA 2H9VA 3K3JA 5JT2A 1TQPA 3CGOA 4K2RA 3RAKA 5KUPA 2X2KA 3HL7A 3ZO1A 3VUDA 3CD3A 3HMOA 1KOBA 3GGFA 4XNEA 2JFLA 5H9BA 3QX4A 2PULA 2QKWB 4FKJA 2PZIA 4RIWB 1PKDA 3RGFA 2I0YA 4O38A 3NAYA 2VX0A 4XCUA 4BWPA 4JQEA 5B0XA 4O0XA 4G3GA 5FWKK 5IH4A 3P7AA 2JKMA 3ODYX 5AP2A 4RT7A 1W83A 4LI5A 4YLJA 3LFAA 4RJ6A 1W82A 5DG5A 4FTQA 4C2WA 4MK0A 5E9EA 2KTYA 4HNFA 3VS4A 2B55A 1Q3DA 3QALE 4QT1A 1Q3WA 5M56A 1YHWA 2A4LA 2VNWA 3Q9YA 3PJ1A 5GIPE 1UU3A 4I22A 4BDBA 2Y4PA 5E92A 5HLPA 2OZAA 4UMUA 3FPMA 4RWJA 1QMZA 4ZZMA 3QZHA 4FT5A 4NW5A 3LAUA 3PG3A 5TE0A 3MN3A 4PQNA 5HU9A 2Z7LA 3FC2A 3LQ3A 4WOVA 3TDWA 4HOKA 3F82A 4FV7A 4FTNA 1BYGA 4QQCA 3PVWA 3C7QA 5HHWA 2QKRA 4BTKA 3AC4A 4EWHA 2WMQA 4XG9A 5AX3A 2PVFA 4FC0A 5EYCA 5IU2A 1XQZA 3R8MA 3NIEA 1JLUE 1ZYCA 2V22A 4IJ9A 4DEAA 1PY5A 2R3JA 2YCSA 1WVYA 3A7HA 4FK6A 4IAZA 4L00A 3ZH8A 4CMOA 4CTBA 2F2UA 3F61A 3OP5A 3DTWA 4QP7A 5D12A 2VUWA 4JVGA 4AZEA 3PDTA 3WIKA 4AS0A 3R83A 3GU6A 4QOXA 3F3UA 3OBGA 3VHKA 2WEIA 2PUIA 3MFUA 4J53A 5CLPA 4QP2A 5JN2A 1REKA 4PL5A 5B7VA 4Y85A 2DQ7X 2WU7A 3F3WA 3CPCA 1WBPA 4KSPA 4TWCA 1QPCA 4YTFA 5KMJA 2C3IB 3O7LD 3PIXA 4J52A 4U42A 2RF9A 1VYZA 4GEOA 5L3AA 3RKBA 5GIOE 2I6LA 2WIHA 4C58A 5DRBA 4YC6A 5AUZA 4BGGA 2YITA 1OM1A 2F7ZE 3GU8A 4NL0A 4JBVA 5LVNA 3F5PA 4FV4A 3PY1A 4O0VA 1NXKA 5FP6A 1Q41A 3W2RA 4BKJA 5IEVA 3DCVA 1J1BA 4AN9A 4DEDA 5IISA 3GQIA 3OG7A 1DI9A 2VNYA 3AD4A 4LM5A 2WPAA 4RBLA 2O3PA 4MBIA 5A4QA 4GIHA 4M14A 4AW5A 4IWOA 4IFGA 4TN6A 2BVAA 1PHKA 4X2GA 3ZONA 4PPCA 3HECA 3CTQA 4NH1A 4BCIA 2X6EA 3QKMA 4O0TA 5E1SA 2Z02A 4O7YA 4QMQA 3LVPA 3NUSA 5BVFA 3RPRA 1Z5MA 1ZOEA 1FVVA 4WUNA 3DAEA 3L9PA 2HOGA 3C4WA 2O2UA 2ONLC 1H01A 3LCKA 1YXXA 2G2HA 2GTMA 3R1NA 1W0XC 3P1AA 3R63A 1ZYDA 3U9CA 1ZAOA 3NNXA 2W5BA 5CEIA 2XP2A 4IANA 5AWMA 3VF8A 2PPQA 2HW6A 3LZBA 3FLWA 2RG6A 1YVJA 4RQVA 4FZ6A 4RLKA 4D2VA 2JEDA 3VHEA 2VTMA 4DH8A 1OPJA 3Q53A 2VTIA 4ZLZA 4MXCA 2Z7QA 3C1XA 3V04A 2RIOA 3PJCA 4NCTA 2QR8A 4XMOA 3MI9A 4AGUA 2ITNA 3Q4CA 2PUPA 4AA4A 1PKGA 3LCOA 5A54A 2WTKC 5AAFA 2ZB1A 4HPUE 5E8TA 4LOQA 5M07A 3V5JA 2J9MA 2JLDA 4AXAA 2VWYA 2VTLA 3D2KA 2UZEA 5DRDA 5BYLA 4L7FA 5FXSA 2VO0A 2WTKB 1WMKA 3Q60A 4C4FA 3IGOA 3TNPC 2JDTA 5CT7A 3WF5A 5LCJA 4PDPA 3HRCA 4XS2A 3W8QA 4Z7GA 2CGWA 5BVWA 4BCOA 3O8PA 4AZVA 2C6TA 3QTSA 4L68A 3QUPA 3KB7A 1GNGA 4WNKA 3OHTA 1ZY4A 2CSNA 3KCKA 3FQHA 1UNLA 4F99A 2JFMA 3QGYA 3VF9A 4YUQA 5G1XA 3SLSA 3SW7A 4O0WA 3I60A 2C6OA 3GU7A 5HO8A 4EOPA 4JS8A 1H8FA 4FKTA 5GHVA 4S32A 4AOTA 4ACHA 5CU4A 2C69A 4DGMA 2UW6A 4C3RA 2QI8A 1UV5A 2E9OA 5HOAA 5EFQA 1MUOA 3EWHA 4I23A 3ZZEA 4AGDA 2XKFA 4O6LA 3ZO3A 2GCDA 2C47A 3MB7A 2OO8X 4DA5A 3D9VA 3RP9A 3Q9XA 1JVPP 1P4FA 2BRBA 3Q9WA 2QVSE 3V8TA 3UQGA 2NP8A 3UIXA 4DFUA 4DEGA 1ERKA 1REJA 2R3QA 3QRJA 4JOAA 4FL1A 1OZ1A 3VBYA 2FB8A 1PW2A 1PMNA 3PE1A 1PXOA 2NRUA 4O91A 2CKQA 3OT8A 2J5EA 1URWA 4I0RA 4RC3A 3N4UA 4D55A 2XNBA 1VJYA 1AGWA 2DYLA 4CZTA 5IA5A 3MFRA 5HNBA 1TQIA 2YIWA 4FZ7A 4M7IA 5K0KA 4OTRA 4MXZA 4D2TA 4KIQA 3UZPA 2VN9A 1WVXA 3QX2A 5FRIA 2GNFA 3UP7A 1WAKA 4NM0A 3VUKA 3KF7A 4IZ7A 4AP7A 4EYMA 3DDQA 4ZSGA 4CSVA 4U97A 4RVTA 3KRJA 4PNIA 5I9XA 4P2KA 4BDGA 5A46A 4N6YA 3PXFA 2HXQA 4Z7HA 3NCGA 4DH7A 4GJ3A 1I44A 3UNKA 2J0KA 5FG8A 3TG1A 3H10A 3LXLA 4XRJA 4A9UA 4MAOA 5FGKA 4OTIA 4FIIA 2UZTA 4L3JA 3O2MA 5IQDA 4TRLA 2A0CX 4HGLA 1H07A 1KE9A 2W1IA 5JK3A 5ANDA 2BTRA 3R8UA 4IM3A 2XK9A 3NDMA 4FSYA 4AZSA 2W99B 1PXNA 1M14A 2RL5A 4XG3A 4PMTA 3BQRA 2R3FA 4JI9A 4V0GB 4YJVA 4FVRA 2ZJWA 2P55A 3OW3A 3PSCA 2ITVA 3DB8A 1MP8A 2UW8A 4TNDA 3VUMA 3R7UA 5FD2A 4BHZA 2Z7SA 2E9VA 2VO3A 3EHAA 4UMPA 4AQCA 4D9TA 4LGGA 5F9EA 1QPDA 3UVPA 5FEDA 5CTPA 3ZUTA 5FEQA 2PVNA 3DDPA 4PDYA 4UMTA 3OEZA 3PXKA 5ICPA 3UG1A 4WUAA 4PF4A 4YJTA 4TT7A 1O6YA 3HRBA 3Q4TA 2FSTX 3R21A 4G2FA 4FV5A 2J5FA 4QYHA 1KSWA 3T8OA 4A06A 5F94A 1DAWA 3SX9A 5HO7A 1FGIA 2QOIA 4GU9A 4Y83A 5IEXA 3NAXA 2QHMA 4FGBA 4ZTLA 3UMWA 3ZEPA 3NYXA 3V8SA 4G31A 3LIJA 1Y6AA 3WF8A 4YURA 2GQSA 4QNAA 3GP0A 2G2IA 2QOKA 4U41A 5AAGA 5IQCA 3ZSHA 2OSCA 4O2PA 2JBOA 4E5AX 2W17A 2XK6A 3UOHA 4BI0A 4ZLYA 3D4QA 3VS6A 3Q5IA 3LQ8A 3VW8A 5IDNA 3LXKA 3TEIA 2XIZA 1FPUA 4HVSA 4FTKA 2E2BA 4MF0A 1JKKA 1YI4A 2X81A 4FV6A 3ZTXA 3TN8A 5FBOA 3SXSA 4FV8A 4DG2E 5C26A 2BR1A 4FT3A 2R3RA 3Q3BA 4ASZA 4OTFA 4IACA 4GK4A 4FTLA 4BL1A 2FYSA 2ITTA 3N51A 3U6JA 4Y95A 4FODA 3FAAA 3NGAA 4NCTC 5J95A 5M55A 2X39A 2XKCA 4BTJA 4YZBA 4G17A 3PLAE 3DZOA 2PZYA 3PIYA 5CU3A 3SD0A 2W1GA 5HO6A 4B4LA 4YHTA 4CYIA 3TZ7A 5ANKA 2P2HA 2XK7A 4AFEA 3R04A 3ZCLA 3HAMA 3G0FA 3OUKA 5LMKA 1R3CA 1G8SA 3FLZA 4P7EA 3NEWA 2IO6A 2R3KA 3FHIA 5E8VA 4EOKA 5HESA 3BHHA 4GMYA 3U51A 4FKUA 4RA5A 4QMPA 4Z55A 3O7LB 3KXXA 2ESMA 2VTHA 2X1NA 3FMHA 5DT0A 3L9NA 3OUNB 4QYGA 4USDA 1M2QA 4RVLA 2EB3A 3SV0A 2F49A 3FMLA 3QL8A 5DEYA 4E6DA 4WT6A 2XIYA 3MY1A 2RFNA 3EN5A 3ZYAA 4QP1A 2ZOQA 5L2IA 1FVTA 1OGUA 4AZTA 4BCMA 3SC1A 2GNIA 4MVFA 2XZSA 2IPXA 1RQQA 3CP9A 2GHLA 4JR7A 1BUHA 4IWDA 3RINA 2VTNA 2W4KA 2GHGA 1OVEA 4BKYA 3Q32A 3SRVB 5DGZA 4ZOGA 3GNIB 1SM2A 3LFBA 4FT9A 3HVCA 3HYHA 5JRQA 4R6VA 3VS7A 1CDKA 5T3QA 1KV1A 3MA3A 3ETAA 3CEKA 4AG8A 5JKGA 3IONA 4QP8A 4C36A 4O7ZA 3U55A 4KBKA 1M7QA 3QTXA 4CZYB 5E8SA 3TJCA 1X8BA 3ERKA 4LFIA 3UO5A 5K0XA 4WHZA 3V51A 2VTQA 4OR5A 1Y6BA 2ITOA 1M17A 3UODA 2QURA 1YOJA 5HG7A 1GZKA 5KZIA 4IX5A 4UMQA 4R1YA 1ZMWA 2V55A 2ZMCA 4YJRA 2X7FA 4B9DA 2HK5A 2WMVA 5BQ0A 3CBLA 4TNBA 5IMXA 3M11A 3D94A 2JD5A 1UU9A 2C5VA 1P2AA 2YISA 4FV0A 5HIBA 4E93A 5CALA 2BZHB 3UVRA 3FI8A 1YW2A 3ZFMA 4BDAA 5KMLA 4IHPA 2I0HA 3OF0A 3THBA 4RGJA 4FTAA 5IPJA 4IX6A 4JDJA 3ZLSA 3BYMA 2XNNA 3W2CA 4YSMA 2C6MA 2YM7A 4TYHA 1PMVA 4ALWA 4B0GA 4I5MA 4XG2A 2QLQA 5I5ZA 4F63A 4FV9A 1K9AA 2C0IA 4QPAA 1H1SA 4JDHA 5IKWA 4CLIA 2REIA 4FIHA 4D2WA 3DV3A 3GCPA 4EONA 3C4CA 2OIBA 2X4FA 2YJRA 3KRRA 4U7ZA 3E64A 4RWKA 1H26A 2YZLA 3PWDA 4IDVA 5CT0A 2VAGA 3BGPA 2SRCA 4C02A 4DLJA 1F5QA 2LAVA 4IC8A 3EFLA 1FMOE 1YHSA 3FY2A 3RNIA 1RDQE 4I1ZA 2X8DA 3TZ9A 4ACMA 4BBEA 4E7WA 3EQCA 4HVDA 1V0PA 3NVMB 4O7RA 1OL7A 4I6HA 3MPMA 4RC4A 5L8LA 3NX8A 4O86A 4X2KA 3FLQA 4GK2A 3WIGA 5AUTA 2WQEA 5AIKA 3KF4A 2IZRA 3BLHA 2WELA 4WSYA 2GNJA 4GS6A 4O7SA 2WZJA 3BGQA 3Q5ZA 2WKMA 1MRYA 5DE2A 1FVRA 3ORZA 3UC4A 2G9XA 5HIDA 2EVAA 1L8TA 4FNXA 5HTIA 4ZTMA 2VWVA 4O0YA 1TVOA 4G3CA 4DG0E 4PPBA 2YM4A 3CTJA 4O83A 3NPCA 4G6NA 5L6PA 2C6IA 4PDOA 3TIZA 3PWYA 2QNJA 1GIHA 2WTIA 3H0YA 3HLLA 2NO3A 2R3HA 3IDBA 4YJUA 5AUXA 2J7TA 2X0GA 3RK7A 4HW7A 4XP2A 3JY9A 5HNGA 2ITYA 2ZDTA 3LPBA 3PA3A 4BIDA 4DC2A 2UW4A 3GU5A 3AT3A 3ULIA 4F70A 3LFEA 4DTAA 2RFDA 1S9JA 3LFFA 3FI3A 3HV5A 4MD7E 4RJ3A 2OFUA 4UYNA 3VBVA 4LGHA 3VUGA 3TZ8A 4R1VA 4BKZA 1XKKA 1ZLTA 2FVDA 2WMUA 3M42A 2YFXA 4WBBB 4QYFA 4QD6A 5DMZA 5HORA 4F64A 3E8CA 4K18A 2UW7A 4I5CA 1U59A 4CFWA 5J7HA 1ZY5A 3COIA 2OJIA 3AD6A 3EZVA 5EM7A 2Q83A 2F57A 3E3BX 5DR6A 4IX4A 4O7NA 3BYSA 3FXWA 3JPVA 3PY3A 3DFAA 2C5OA 3BYVA 5HLNA 2B9FA 4EJNA 5E1EA 4BYJA 2W7XA 2HIWA 4UX9A 5JQ5A 1M7NA 3ACJA 5LMKC 1IAHA 2F7EE 5FQDC 1YDSE 4DCAA 4G5PA 5F4NA 2WXVA 3DQWA 3FKLA 3KN5A 5AAEA 5HTCA 2BILB 4EH5A 2C6DA 4Y73A 4NKAA 4F6UA 2X8EA 4OGRA 3F3TA 4DFLA 5IA2A 4FV3A 4MTAA 3R00A 4AN2A 4F65A 3ALOA 4O22A 3V3VA 4MXYA 4O0UA 4II5A 4WG4A 3ROCA 4O0SA 4XHKB 4ZP5A 5C8MA 2X9EA 4FI1A 4B7TA 4PP7A 4WBOA 3FSKA 4A9RA 3QFVA 1H24A 4BVUA 3E8NA 4I41A 1GIIA 2PE1A 3VVHA 4BTFA 1KUTA 3ZM9A 1U54A 3I5NA 1KV2A 2JIUA 3WZUA 4P5ZA 1BLXA 4KB8A 2ITXA 3Q4UA 4XEYA 2UVYA 4Q5HA 3VS0A 5CU0A 2UZWE 3MW1A 4AA0A 4M3QA 2XCKA 4DBNA 3ZRLA 2YJSA 1MRVA 3KULB 3DKCA 3GCSA 4MXAA 4O7WA 2C1AA 3DJ5A 4YU2A 1PRYA 3POZA 3I6WA 4YSJA 5DVRA 1PXIA 2P4IA 1PXMA 1Q24A 4FKIA 4HYSA 4JLCA 4KIKA 1YOLA 4L45A 5ANIA 5A4EA 5KKRC 2BTSA 3BCEA 2IVUA 4XH6A 5AR5A 4IWPA 3R8LA 4FTTA 3QLFA 4Y72A 5GJDA 4IMYA 5J7BA 5J9LA 3PXYA 3KMMA 4GG5A 2ZYBA 4UN0C 5J79A 3RVGA 3TNWA 3DT1A 4CRLA 3P0MA 3ORPA 4N70A 3KKVA 3O96A 4FZDB 4ZIMA 4D1XA 3I81A 4ENYA 4K77A 4MCVA 4W4WA 5EDPA 2XKDA 5IG1A 1NW1A 2QODA 3BYOA 3FZTA 2Q0BA 4D4VA 1H0VA 3CJGA 4CV8A 2ZAZA 1FMKA 4YJNA 4D1SA 3LMIA 5IQAA 5AR2A 2PWLA 4R7HA 4DLIA 3PY0A 4K6ZA 4V04A 4IAKA 4A9YA 3FMKA 3EFKA 5BVKA 5DLSA 2CCHA 2XB7A 3E8EA 2CLQA 3QTZA 2VWXA 1AD5A 2R7BA 5EYDA 5AUVA 1DAYA 3O71A 5FP5A 3TV7A 1XR1A 5CAOA 1V0OA 5L2WA 4RX7A 5DHJA 3B8QA 2GS2A 4WO5A 4O81A 2PY3A 4OT5A 4BBFA 3DNDA 2QO9A 2BDWA 2RG5A 4FZAB 4FZFB 4ERWA 5CANA 5M4CA 4NIFB 2BPMA 2QO2A 2G2FA 2OG8A 3MBLA 3BBTB 3PZEA 4I6BA 5HCXA 5BUEA 1DI8A 1FGKA 2VTSA 3ZSIA 1ATPE 4GL9A 3QKKA 3PFQA 4DH5A 3ZDIA 1XH5A 4PY1A 3C4EA 1Y8GA 3DLSA 3POOA 4RVMA 4FL2A 4FT7A 5AV2A 2YEXA 4LV8A 5AM7A 5HBEA 4D1ZA 5BVNA 4F1OA 5IQFA 2A19B 3QTUA 1CTPE 3TNQB 5HGIA 3HRFA 1Q99A 2IJMA 4FEUA 3W10A 4ASEA 1UNGA 3WOWA 1XBCA 3HA6A 4YZ9A 4BCPA 4BZDA 4F7LA 5CF8A 4CQEA 4FEWA 3QD4A 3TUDA 3D7TA 3GI3A 4FKPA 1H08A 3JVRA 5HG8A 4E6CA 4KD1A 3SOCA 5C4LA 3I0OA 2VWIA 4X2JA 3I0QA 4C34A 4AT5A 4EK3A 4CFMA 5CVGA 1R1WA 3ORMA 4BIBA 4FG9A 3QD0A 3BU3A 4U8ZA 4GV1A 5JFXA
chains in the Genus database with same CATH superfamily
3S3IA 4D4RA 4J99A 4W4VA 2R9SA 5EHOA 2XUUA 4CMUA 1CSNA 3QQUA 3G51A 4TY1A 2XRUA 4JX7A 4KIPA 2C3JA 4QMOA 2H96A 4XOZA 4O96A 3BEAA 3BBWA 3E87A 4FKOA 4DHJA 2PZ5A 2VX1A 5BMSA 5EYKA 1W2DA 2YWPA 3WZDA 4CVAA 5IQIA 3B2TA 4XLIA 3HV4A 3SGCA 5K5XA 3CCNA 3DK7A 3KFAA 1OIRA 4V05A 5HZNA 2YERA 1UU8A 2WU6A 1NVQA 1WBOA 2X7OA 4C59A 5D1JA 4BJJA 2J50A 4ID7A 4J97A 4ONAA 3V8WA 3EH9A 2OFVA 4O4DA 2UW5A 3F7ZA 2XYNA 2VGPA 3V6SA 5CVHA 4U81A 3ANRA 3UDBA 3P5KA 4IE9A 1MQBA 3OCBA 4PWNA 3ZSGA 3TV6A 3H9FA 4IB0A 5AUWA 1PMEA 3IW7A 4AU8A 3C0HA 2QOBA 3LJ0A 2NYAA 3F5GA 3Q9ZA 4O1OA 1PJKA 2YM3A 4BRXA 1ZYLA 3I79A 3RJCA 2XMYA 5ETAA 1M52A 5HI2A 2B53A 2HYYA 3GT8A 4ACCA 3DY7A 4D4YA 3ID6C 4EUUA 4XX9A 2W1DA 2WD1A 4OAUC 1KWPA 4JAIA 4FVPA 2VZ6A 4G5JA 5I9VA 4HYHA 4OLIA 4APCA 3DXPA 3PZHA 2C68A 4GH2A 4PTCA 4W8DA 1H1QA 4JRNA 3VONA 3SG8A 4FSNA 2YM8A 1OKYA 4MXOA 1OBGA 3ORIA 2WQNA 4FKQA 4RVKA 4UV0A 5FTGA 3UP2A 2XJ2A 5FBNC 3BU5A 4JBPA 4BCQA 1Y57A 5B2LA 5ACKA 3RNYA 3QHRA 1YRPA 3II5A 3HP2A 1K3AA 1KE5A 3IDPA 4JMQA 4OTDA 1PF8A 5DWRA 3ZM4A 3ODZX 2ERKA 2HZIA 2JDVA 2UVZA 3NZ0A 3CJFA 5CNNA 4YHFA 2IVTA 3NSZA 3OWPA 1J1CA 2LGCA 2Y6MA 4LMNA 4ALVA 4AXEA 3C9WA 3P7BA 1IEPA 2EWAA 3D5UA 4FL3A 4FSTA 2W1EA 3KMWA 4PX6A 1MQ4A 5IA1A 4DF3A 3BLRA 3CQWA 5LARA 5IH6A 3C0IA 2R3PA 3UMXA 1W8CA 1XH6A 4YPDA 5TO8A 5KCVA 1GAGA 2QOLA 2Z2WA 3EQBA 3MWUA 2UZUE 4JIKA 4QNYA 2Z8CA 3NUNA 3PSBA 4C8BA 2QU5A 4J7BA 5AP6A 5K4IA 1TFFA 3G6HA 2V5QA 3LOKA 3MH2A 3NUYA 4F7JA 4A9TA 3TZMA 3RAIA 4PNKA 4CKIA 4HGSA 4I0TA 1OUKA 4CFFA 3UG2A 3GVUA 4HGTA 4ZSAA 5BVOA 5AR7A 4JQ7A 3SXFA 5IDPA 4ZAUA 4FGRA 3KVXA 3QRUA 4M13A 4TTHB 5AP3A 2X0OA 4FR4A 4N6ZA 5L6WL 4DDIA 2BRGA 1XBBA 4DHZA 3F2RA 1OPKA 1PYEA 3FDNA 4DEBA 4E4MA 3DBCA 4HJOA 4KKEA 3R8ZA 5AX9A 3QZIA 1B6CB 4M0ZA 4KBAA 4PPAA 4WG3A 3V6RA 5ETIA 5HD4A 4ENXA 2XJ0A 3KN6A 3OW4A 4L46A 3OCTA 3W55A 4EUTA 3FKNA 4L6QA 4CCBA 3NRMA 1SVHA 3ZHPC 1IG1A 3ZFYA 3G15A 3VULA 1GIJA 4AW1A 3EQIA 2XANA 2JDOA 1KOAA 4DTBA 3IW4A 2WMRA 1NT2A 3ACKA 3S95A 4AE9A 4EOSA 4E20A 3M1SA 4LG4A 4XV2A 4EH6A 1CM8A 2PVRA 4NU1A 4YC3A 3BE2A 2PVJA 4FKGA 3W32A 4O1PA 4A07A 3JR1A 4QDVA 3IKAA 3NW6A 4DEIA 4MNEA 4RZVA 3AC1A 3TT0A 3VWAA 3A2CA 3EQDA 3GFEA 3HA8A 3M2WA 4BCKA 2ZV2A 3ZDUA 4NSTA 2VV9A 5D7VA 2Y8OA 4FOCA 2CLXA 3QU0A 1IAJA 1H25A 5GZ9A 5DR9A 3MVJA 3OBJA 4FVQA 4Z9LA 3H9OA 3DBFA 3FI4A 1W7HA 3OS3A 3R02A 4QTEA 2AC5A 3CS9A 3RM6A 2PZRA 3ELJA 3IW5A 4BWKA 4UALA 3ZXTA 4WRSA 4BF2A 5CSXA 3BWJA 3K2LA 4OAVB 4RZWA 3ZBFA 5B2KA 4D4SA 3QRTA 5EM5A 3R7IA 4BCGA 5AFVA 1ZYSA 3IQ7A 3R73A 4JAJA 1SVEA 2HWOA 2OZOA 4FSUA 4I5HA 4M15A 4ZTQA 5HVYA 3SHEA 2WOTA 4B6LA 1OGYA 4IDTA 3R9OA 4CTCA 2CN5A 5FM2A 4EEVA 2HENA 2GFCA 3IOKA 4G3FA 1W2CA 4X3FA 3OXZA 2CJMA 4CG9A 4F09A 2C5YA 5CSHA 4J71A 3FC1X 4ASXA 3MVHA 2OI4X 4XG8A 1XH4A 5AUUA 3SOAA 4FRFA 1QPEA 3NNUA 5LQFA 4HCUA 3BHTA 4UBAA 5CXZA 5FDXA 4R78A 4BDEA 5C4KA 2R3NA 1JPAA 4R7IA 3PRIA 3FQSA 1VEBA 2OZAB 3I5ZA 4A4OA 1AQ1A 5I9WA 2ZDUA 2XK4A 4FKWA 2X7GA 5K4JA 4ARKA 3MH0A 5DNRA 4HCVA 3ZC6A 4RX5A 2YABA 4WIHA 3RCDA 4DITA 2EXEA 3DB6A 3VBQA 2UV2A 5HE3A 5AR3A 5K5NA 3VO3A 3ATSA 3U54A 1JKTA 2Y0AA 4O4CA 3A8XA 3N4TA 4DGNA 4CKJA 1Q8YA 4YMJA 4LL0A 1H0WA 4GK3A 1Q8TA 2YCQA 4IB1A 4UWCA 4GT4A 1GZ8A 2QOHA 2R3IA 2F2CB 3BZ3A 5FLFA 5M4FA 5EDRA 3ML1A 4DEEA 3AT4A 2H8HA 5KX8A 4L42A 2YIQA 3KRWA 3L8PA 4JX3A 3RAWA 4YO4A 3D15A 3DLZA 3HX4A 2GQGA 3FZ1A 3VNTA 2UZBA 4LGDA 3EQPA 4L44A 5DPVA 2PMLX 3QC4A 4I6QA 3E63A 5EH0A 5JMSA 5M51A 3QC9A 1H27A 2O64A 3FWQA 5A3XA 2JDRA 3ZOSA 3QZGA 1R0PA 3HDMA 3HMNA 4AF3A 2GS6A 5AUYA 2CKOA 3IW6A 3FL4A 2J90A 4UWBA 3G6GA 5J1WA 1HCLA 3ZUVA 2CGUA 4H36A 3KIOC 4FEQA 5BV3A 1OL2A 4H3PA 4PTEA 2VWBA 4D58A 3DGKA 3PJ8A 5JRSA 4WRGA 2PSQA 3PTGA 4Y5QA 3QUEA 4XV3A 3RTPA 2XM8A 4K0YA 4ZK5A 3UOJA 5M08A 2P2IA 1JNKA 4RJ8A 2FH9A 1QCFA 4BDFA 3D0EA 4GCJA 5C01A 2RSVA 4IW0A 4MD8E 2XH5A 3TIYA 4RJ5A 1XH8A 4BCHA 4USEA 5KMIA 4CGAA 2ETRA 4EZ7A 5AJQA 3WZJA 1YXUA 4FSQA 5LOHA 3JYAA 4ZTHA 2O0UA 3CTHA 2IG7A 3DBQA 4OT6A 2WOUA 1YI3A 3L8XA 3R22A 5FXQA 2CKPA 5HIEA 4MWHA 4CLJA 5EHYA 2F9GA 4K9YA 1J7LA 4E6QA 5KBRA 2CHLA 4DEHA 2RGPA 3K54A 4NKSA 3WILA 4ZZOA 3QGWA 5AP4A 5M53A 3DU8A 4LUEA 3GENA 4FF8A 4HVIA 4GUEA 2GNGA 4P90A 3UGCA 1VZOA 5T68A 3UZTA 4O84A 3I6UA 1EH4A 2PMIA 3B2WA 4IVCA 3V5QA 3EFJA 3QBNA 2I40A 4AZWA 1G8AA 1PXKA 3BPRA 3EYHA 4I0SA 4R5SA 1DS5A 4YTIA 3GOKA 4EOLA 3BV3A 3AG9A 2OK1A 5JH6A 4FMQA 4JNWA 4BTMA 2VU3A 2VX3A 1E1XA 4QP9A 2C6KA 2J4ZA 5CZHA 2BDJA 2AQXA 4AT3A 2PMOX 5EQEA 2BHEA 4FNYA 4O82A 5HE1A 4DG3E 4QMVA 2O65A 5T6KA 3ROYA 5IUHA 3AGLA 2BAKA 3UC3A 3HMPA 4E6AA 4Z16A 4CT2A 4RSSA 4USFA 3ZUUA 3NMUF 1Q97A 3NUUA 4TWPA 3RPSA 3FKOA 5DIAA 2XIXA 3V5PA 4JJRA 2ITUA 3D7ZA 4X2NA 4CV9A 4DBXA 2EU9A 2VRXA 3CLYA 3ZS5A 3SA0A 4CZUA 4ZMEA 2BCJA 4RQKA 4IAYA 4U3YA 5ITAA 3PSDA 3QAME 2R2PA 2R3MA 3F66A 3GC7A 3ORNA 3RHKA 4E4LA 3GB2A 3Q04A 3QLGA 2O5KA 4UB7A 3PIZA 4LOOA 2XK8A 3CIKA 3TUBA 5GJFA 3SAYA 2VTTA 3VW6A 5DT3A 5CAUA 5HU3A 3A60A 4QQ5A 5CEOA 2B1PA 1S9IA 2QHNA 3BI6A 3D83A 3NUPA 4IC7A 3C5IA 2HY81 2WHBA 3LCDA 5E90A 4FOBA 4DGOA 3EOCA 4EKLA 1OKZA 4JG7A 4FYOA 3P7CA 4ZS4A 4JBOA 3UIMA 3U9NA 1BI8A 2W5AA 3B8RA 3OCSA 3TCPA 5HTBA 2XS0A 4KIOA 3F3ZA 4Q9ZA 3P79A 3NYVA 3VC4A 4U43A 3UQFA 3AKJA 2WMTA 5BVDA 5IH5A 5IZFA 4IVAA 2FSLX 1T45A 2WMWA 4X3FC 3FBVA 3JVSA 1R78A 4R3PA 1PXJA 4GT3A 4HPTE 4JQ8A 5L2QA 4AUAA 4GYIA 5EI2A 3TNIA 4RC2A 5KMMA 3LLAA 3A7FA 3OFMA 4KS8A 4J96A 5TF9A 3L8VA 3FMDA 3R7EA 4K33A 3A7IA 2UZDA 1A06A 4W9XA 1XWSA 4OBPA 3SKCA 2F7XE 4IZ5A 3KQ7A 4QPSA 4RIXA 5FXRA 1YXVA 3T9TA 2P0CA 3KCFA 4JBQA 2J0LA 5E8UA 3FXZA 1OL5A 3LJ2A 3ZFXA 5LVMA 2BKKA 3Q4ZA 5JQ8A 4U40A 1WFCA 3ENMA 2QCSA 2XNEA 2BRHA 5EQPA 3FMJA 2W0JA 2G01A 3TDVA 4KA3A 2W1CA 1W98A 3G9LX 4ANLA 4IBMA 3HMIA 4NM5A 3I7CA 3KXZA 4Z3VA 4B8MA 4PRJA 1FQ1B 1NA7A 4C37A 4O27B 4ZY5A 5LVLA 2BIYA 4CNHA 5K3YA 5A4LA 2OJ9A 3KRXA 3IG7A 4XYFA 5DOSA 5EKNA 3JUHA 4IVDA 1SYKA 4EOMA 5CEMA 1SNUA 3ALNA 4QO9A 3MB6A 5CX9A 3BHYA 4PDSA 4IXPA 1XO2B 2BZJA 2XJ1A 5BPYA 1JOWB 4GT5A 4NJ3A 4C4IA 4CFUA 5DR2A 3TUCA 3QWJA 3VQHA 2YDIA 4CEGA 4DT8A 4O7LA 4NIFA 3KY2A 5I4NA 1OKVA 3Q96A 3ZO2A 2WMXA 3O51A 4J1RA 2WQOA 4L01A 4RIYA 4RWIA 4ZEGA 2IVVA 2FO0A 1XJDA 3C5UA 3H30A 3QQLA 2WAJA 4M66A 4TWNA 4RX8A 4QMLA 3VUTA 3DQXA 1OIYA 2YAAA 3MSSA 3QWKA 3DK6A 3L1SA 4GYGA 5D41A 3A99A 3EN6A 4TXCA 5E8YA 1STCE 3QA8A 4TYGA 2ZMDA 2ZV7A 5CI7A 4AXFA 3QD3A 3S4QA 4EHGA 2XCHA 1P5EA 3JY0A 2EUFB 3A4PA 5KE0A 5CI6A 1O9UA 3MJ2A 4AOJA 3COMA 5CAQA 3CC6A 4I4EA 4F9CA 3IO7A 3ORTA 3LKMA 4G6OA 3V5LA 4BDHA 2BUJA 4GUBA 5A9UA 4AE6A 3BX5A 3ET7A 2J6MA 4HYUA 3T9IA 4BN1A 4X21A 2J2IB 3KA0A 3L9MA 5EOBA 1IR3A 4DHIB 4KS7A 3F2NA 4C3FA 3MPTA 4RRVA 2ACXA 3CY3A 3UOLA 5JGDA 4QRCA 4IEBA 4GFMA 4FBXA 2XEZA 2JAMA 3IPHA 4JT3A 5GINE 3R7YA 3OVVA 3QD2B 4BHNA 2OXXA 4LMUA 4PMMA 4RJ7A 3GEQA 2C5XA 3ZRKA 4ALUA 4RIWA 1JKLA 1OI9A 4HYIA 4X0MA 3H3CA 2DUVA 5HKMA 4QTDA 3ZO4A 4EQUA 2OJGA 4R8QA 4MQ1A 5HD7A 2UZOA 3RWQA 4K11A 2JIVA 2B52A 3TTJA 3ZZWA 2WO6A 4C35A 1H00A 5M4IA 5AV4A 4U3ZA 5L4QA 4WNOA 2HZNA 3FPQA 1Q8UA 4BI2A 5BYYA 4TL0A 1JKSA 4WNMA 1IRKA 4FNZA 2QO7A 3SQQA 3LLTA 1T46A 2HY0A 2Y6OA 4F08A 3FQEA 4ZY4A 2BZKB 2X6DA 3VJOA 2FUMA 4MHAA 4L7SA 5D7AA 2PU8A 4G3EA 4PMSA 2RFSA 4UWYA 3LM5A 4OTGA 2QG5A 4MBLA 4YZNA 3FLSA 3LM0A 4L67A 4FG8A 5IUIA 4EH3A 2BRMA 2FA2A 1BI7A 2PL0A 4GU6A 3TKUA 4BDKA 4FT0A 2BHHA 3LFDA 3LQ5A 2CKEA 3CQEA 2BIKB 3MVLA 3VRYA 4AACA 4XUFA 4NW6A 4I6FA 5AR4A 3F5UA 3IDCA 3VJNA 2Z7RA 4JG8A 2HCKA 1WZYA 2GU8A 1ZXEA 4YO6A 1CKIA 1RE8A 4EK6A 3PVGA 3VRZA 3OXTA 2OLCA 4Y46A 3WZKA 4ANSA 2PTKA 3UNZA 3R6XA 3MIYA 3FZRA 3T3VA 2IF8A 4GJ2A 2OF4A 3TTIA 1APME 2E9NA 3F9NA 5L2SA 4EZ5A 4BIEA 4TZRA 3G2FA 3HEGA 4FSZA 2P33A 1BMKA 2XIKA 3FZPA 2XA4A 5CENA 3I7BA 2ETMA 3ULZA 4M69B 2YDKA 1OECA 5LVOA 4L3LA 3W0NA 4J95A 3EQRA 3ZLYA 5EOLA 4EH7A 1IA8A 4WA9A 4RX9A 4YNOA 4ZJJA 4QQTA 2GNLA 2HZ0A 2BALA 4DCEA 3RPVA 3P78A 4EL9A 4EHVA 1E9HA 1KE6A 3QQKA 3BYUA 2X0QA 4XJ0A 2OIDA 3PPZA 3QTIA 4NYEA 4NUSA 3LXNA 5EM6A 5HQ0A 5ETCA 3RI1A 2PVYA 5E8ZA 3QXPA 2G1TA 2IW8A 3JXWA 4F6WA 1A48A 2WFYA 5EQYA 1SMHA 3AMYA 4Y5HA 4MUQA 3QF9A 4IADA 5EM8A 3EB0A 5GJGA 3AOXA 3QQHA 2XNGA 5ANEA 4X3JA 4U44A 4OTHA 5G6VA 3WE8A 1JSTA 4FSMA 2WIPA 4ZJIA 2E9UA 4KRCA 4DE4A 1GZOA 4AWIA 4QTCA 4LL5A 1YKRA 3VUHA 2EXMA 2GMXA 2XYUA 4PP9A 1Q5KA 3AC8A 3W0QA 3QA0A 4TYHB 4ZTSA 5BYZA 4S33A 3TL8A 4P5QA 4H3BA 3WE4A 4AOIA 4EK5A 1UWHA 4NEUA 4O4BB 4J8NA 4OUCA 5CU6A 3TWJA 5IA4A 2V7OA 3S0OA 4UZHA 3NYNA 3GCVA 4Q2AA 4EOQA 4CFXA 4ORKA 3R30A 1O6KA 3D5VA 2Y4IC 3QCYA 3Q6UA 3MDYA 4KKHA 4ZTRA 4EK4A 3E8DA 2QR7A 3QHWA 4AAAA 5CY3A 3DA6A 4AX8A 4F9BA 4G16A 2YLFA 4FTUA 3GUBA 5LVPA 3V01A 4ITIA 3HAVA 2WTWA 4MBJA 3OCGA 4FTIA 3TKIA 1SVGA 3PJ3A 4FKSA 5A4CA 4K8AA 1WBVA 5IMEA 3OWJA 5JZJA 1P14A 2PE2A 3EQHA 4YJQA 1WBWA 3FL5A 4ANQA 4L8MA 4EYJA 3F7WA 2UW9A 3HZTA 5HLWA 4NTTA 4M67A 3E92A 3RWPA 5GZAA 3EL8A 5EKOA 2HXLA 3AGMA 2FSMX 3D14A 2QONA 3QYWA 3O50A 4BY9E 4D5KA 4BDCA 4GW8A 4BFMA 4YNEA 3ENHA 1OKWA 4MYGA 4E73A 3FE3A 4AXCA 4LRMA 5CF6A 4AFJA 3DPKA 5AP7A 1U4DA 1OMWA 3QTQA 3RPOA 5CASA 1CKJA 3GCQA 4FTMA 4DTKA 3GC9A 4CCUA 2XAOA 4NT4A 3C51A 3R8VA 2YHVA 3LFCA 4HGEA 3D2IA 4PUZA 4O7VA 4E26A 3SW4A 4BI1A 3MVMA 4J8MA 3ATTA 3PFYA 1QPJA 4FEXA 4R77A 3HUCA 1IA9A 1W84A 2AYPA 3F2AA 4JIAA 5J5TA 3O8TA 3MY0A 3BIZA 3FI2A 3R9DA 4AGWA 2PUUA 4X7QA 3TJDA 1ND4A 2UZVA 2BDFA 4FV2A 3UTOA 2R3OA 2I0EA 2IZSA 4U0IA 4FSRA 3TI1A 2QC6A 4HZSA 3VS3A 2ZV9A 5DFPA 4I93A 4FUYA 5EYMA 5FEEA 3CQUA 2W9FB 1IASA 2YCRA 4FK3A 3PP1A 5H8BA 3WF9A 1U46A 3AMAA 3G0EA 4A9SA 3MFSA 4ITHA 4ZSEA 5EG3A 2XM9A 4QYEA 5E8WA 4C33A 3ZBXA 3MY5A 2F4JA 1ZYJA 3DFCB 3VQUA 3MTLA 4S31A 4U5JA 4EH9A 3A7GA 1KE7A 5FM3A 4EH4A 5IQHA 2QOOA 3PUPA 4YGAA 4A4XA 1WCCA 1UNHA 1UU7A 5GNKA 1LR4A 3RZFA 4EOOA 5H8EA 5IQBA 5IQGA 1WBTA 5LMAA 4RWLA 3UPXA 5HX8A 4DDGA 2XVDA 4RA4A 1URCA 2WB8A 2YIXA 2A1AB 3OROA 4MF1A 3AC3A 3FXXA 3KVWA 4ZSJA 4PTGA 4NJDA 5HE2A 3T3UA 5B2MA 5I9ZA 5JGAA 3QZFA 4TKSA 3R01A 3G90X 4H58A 3P86A 4FEVA 2OXYA 1JQHA 4OTPA 2CNQA 3BQCA 3O8UA 2XBAA 3DJ7A 5M44A 3PPKA 4I5PA 2VTRA 5ANJA 5TOZA 2ZM1A 4XBRA 4D0WA 5JFVA 5EI6A 2P3GX 1U54B 4PMPA 3EL7A 3V5WA 4FA2A 3U4WA 4FUXA 4C4EA 4E4NA 2CNVA 3P08A 3WZEA 1JAMA 2CMWA 5JFSA 4HVHA 4GVJA 4L3PA 3MFTA 4QMWA 4YBKA 2YACA 3LW0A 4ZS0A 3R0TA 4V0GA 4C4HA 4EQMA 2JDSA 4QMXA 3IS5A 3C4ZA 2WTJA 1O6LA 3E88A 3TM0A 2ZVAA 4NK9A 2UUEA 1LPUA 4U9AA 3UPZA 3KC3A 1UA2A 4U6RA 4GIIA 3HGKA 1XBAA 4KIKB 4IJPA 3FY0A 2FGIA 3OT3A 4N0SA 5CXHA 3ZLWA 4DFXE 1A9UA 5HG5A 4FE2A 2CN8A 2WGJA 4PL3A 5EK7A 4FNWA 3NUAA 3F69A 5AP5A 3UBDA 3DXNA 2IWIA 3RK9A 5KHXA 3G9NA 2ZM3A 2BZIB 1LEWA 3JS2A 2OIQA 4M97A 4QPMA 2JKQA 5M4UA 4S30A 3W2QA 4EBVA 4GSBA 3UZRA 2B9JA 5H8GA 2I7QA 3I4BA 5JSMA 3OWKA 3TMOA 4RJ4A 2ZV8A 4O7TA 2B4SB 2YAKA 2A27A 5HNIX 4YTHA 4NM7A 4KRDA 1UKIA 4C4GA 3U6IA 3GBZA 3L9LA 2DS1A 1YWNA 1Q62A 4IIRA 1Q61A 3SDJA 2PZPA 5EW9A 4C38A 2WEVA 4F9YA 4J98A 3NS9A 5GZ8A 2BKZA 3BWFA 4BWXA 5HVJA 4A4LA 4YLKA 3KK8A 2OBJA 4NWMA 5CSWA 1UVRA 5CF4A 5E7RA 3OWLA 5L6OA 3DTCA 2C30A 2PMNX 3W16A 3BU6A 1GY3A 2C6LA 2WNTA 4GFGA 1LUFA 4S34A 4AZFA 3TNHA 5LXMA 5CEKA 1XH7A 2PHKA 3E3PA 3K5VA 1JSVA 4I94A 3UYTA 2JBPA 3AT2A 1WBNA 2IVSA 4GFOA 4L53A 4TWOA 5CNOA 5CWZA 3CXWA 3F6XA 3HNGA 5AIRA 3TXOA 4F9WA 1Z9XA 5FTQA 2QG7A 3MTFA 4AW0A 2BAQA 3UDSA 3KL8A 2WMAA 3ZEWA 4UYAA 2UVXA 3HP5A 4IB3A 1H28A 3UO4A 2VD5A 3UE4A 4YJSA 3IECA 4N4SA 5CQUA 3W2OA 4CT1A 4G9RA 2OW3A 2W1HA 4MH7A 3NNWA 4Q5EA 3ZRMA 2O8YA 2OKRA 2AEGA 3C4XA 4YJOA 4ZJVA 1P4OA 5HG9A 3VUIA 2GDOA 4O4FA 2A98A 2ITZA 1TQMA 3K3IA 4E3CA 4MD9E 3P5JC 3PXRA 5ACBC 2VO6A 4NZWB 3D7TB 4EH8A 5FUTA 5DN3A 3W0PA 2PVMA 4G6LA 2W9ZB 5E91A 1ZWSA 4FICA 2W1FA 4DT9A 4L9IA 2HWPA 3BV2A 5AA9A 4DGLC 3BLQA 1Z57A 4ZTNA 1F3MC 4I3ZA 5AV0A 4IB5A 2C4GA 1OBDA 5J9YA 4CG8A 3D5WA 5I9UA 3OTVA 3SRVA 4XG4A 2ITWA 4JL9A 3GOPA 5ANOA 4BZNA 5CZIA 3NW5A 3OMVA 2R7IA 5E8XA 1H1WA 1Y8YA 5AA8A 3PPJA 4XP3A 3IGGA 4XV1A 1H1PA 5C8KA 4UXLA 1B39A 4XG6A 4BCJA 4O0RA 1BX6A 2X9FA 1FINA 1YDRE 5F1ZA 2W4OA 3DBDA 4WG5A 2J0MB 4W9WA 4KINA 2B54A 2JITA 3U87A 3LE6A 4TYJA 4B99A 4GRBA 4BJJB 4E8AA 3BE9A 5C03A 2V0DA 4E5BA 2JAVA 4V01A 4Q9SA 4QYYA 4G34A 4ANBA 3FSFA 4ZY6A 3R1QA 2G15A 4K1BA 1XH9A 4TYIA 5M57A 4EC9A 5AM6A 2OH0E 1F0QA 3QCQA 5DBXA 4F4PA 4DFZE 3PA4A 4IVBA 1VR2A 4JXFA 4JDIA 4I20A 1OB3A 1DM2A 4I6LA 5CEPA 4LQMA 2GNHA 4LRJA 1ZOGA 2ZB0A 1TKIA 4UZDA 3COKA 4UY9A 3AC2A 5D10A 3FHRA 2BMCA 2QOQA 4KAOA 4BDDA 2FSOX 1Q8ZA 3UO6A 2YWVA 1MRUA 3PLSA 5DH3A 3P9JA 5IA0A 2OGVA 2R0IA 3AQVA 1GOLA 5M09A 4EBWA 5BMMA 4AGCA 5L2TA 3PVBA 4ZSLA 1ST0A 2XKEA 3RCJA 3BELA 1PMUA 3KMUA 4JG6A 3OOGA 3RHXA 1CMKE 3NFGB 4YBJA 2OJFE 3EYGA 1ZMVA 3CPBA 4XLVA 5KZ0A 4EHEA 2BAJA 3QTRA 3UVQA 4ERKA 2HW7A 3QKLA 3N4VA 1ZZLA 4U79A 4O21A 4AA5A 2PVLA 3EN9A 3UDZA 2UW0A 3CKWA 4FTRA 3DKOA 4UMRA 1BL7A 4BGQA 1FBNA 4CKRA 2V7AA 4TYEA 2W06A 3A8WA 4A7CA 4HNIA 5CU2A 1ZRZA 3Q2MA 3SG9A 3QYZA 5F20A 4C62A 4DGGA 3DK3A 4I24A 3FEGA 4AQKA 4ANOA 2KULA 2WMSA 2VTJA 3OEFX 3OZ6A 3NLBA 4IAFA 4DHFA 5LWMA 1GZNA 5C1QB 3F88A 3PYYA 5EHLA 5TT7A 4BGHA 4ZLOA 3NWWA 4F9AA 4IX3A 3HV7A 3VIDA 4C2VA 4CD0A 2VGOA 4DFYA 4DH1A 3OXIA 3U4UA 3RM7A 3S2PA 5LMBA 1SNXA 2R64A 4L43A 2YLEA 3WF6A 2XIRA 3A62A 1JWHA 2GTNA 2C0OA 2WTVA 2H34A 3KXMA 3UIBA 3ZU7A 5BUJA 5BX0A 4MQ2A 3EQFA 4OW8A 4BYIA 5TKDA 4EQCA 4FKLA 3ITZA 2CDZA 1V0BA 4D28A 4S2ZA 2B9HA 5A6NA 4FSWA 3KXNA 4ZZNA 3CR0A 3S1HA 4BZOA 1I09A 4EZ3A 4EJ7A 3Q6WA 2JKOA 4FJVA 3EZRA 4OBOA 4DN5A 2OJJA 2A2AA 3NYOA 4IZYA 4CMTA 5AP1A 3R7GA 3BGZA 3VN9A 3MS9A 3BHVA 4AW2A 5CF5A 3QRIA 5IUGA 1OIQA 5HBHA 4CXAA 3NNVA 3WF7A 2OWBA 3GXLA 4C61A 5HE0A 4EOIA 4EK8A 2OICA 2W1ZA 5I3OA 3OY3A 2CPKE 4WD5A 2IN6A 1NY3A 3VS5A 3KU2A 1XMLA 2XNOA 4HCTA 3LXPA 4E1ZA 4MNEB 1JBPE 1YWRA 3FLNC 4TPTA 3LFNA 3ORKA 3G33A 4ZXTA 1WBSA 3DKFA 4BC6A 4F78A 2X4ZA 3U8WA 2J0IA 3FLYA 1U5QA 5HCZA 3VS1A