4FVQA

Crystal structure of the jak2 pseudokinase domain (mg-atp-bound form)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
274
Chain Sequence
VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the JAK2 pseudokinase domain and the pathogenic mutant V617F.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
total genus 85
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fvqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fvqA01
1H1WA 4HNIA 4BCIA 5AA9A 4RIWB 3EJ1A 3OT3A 3UOKA 5CLPA 2W1DA 4BDIA 2OJIA 3UP7A 4YJRA 1BL6A 3DQWA 5J87A 1PYXA 1YXUA 2UZWE 2WTDA 4C38A 4XMOA 1Y6AA 2PZYA 2XBAA 2ZYBA 5CNNA 3TCPA 3Q2MA 4CT1A 5IISA 2QOCA 3OWLA 3MJ1A 2CSNA 4NSTA 2UW9A 3W2PA 2VZ6A 4GJ3A 1VJYA 3NPCA 4BHNA 2PSQA 3IECA 1OITA 4RC3A 2R3LA 5AR8A 1GJOA 4FEXA 5DR9A 3SD0A 3AOXA 1RQQA 3JXWA 4TTHB 4YHFA 2UW7A 5AUZA 4TYIA 3PDTA 3ANRA 4TYGA 3U6IA 4B99A 3GQLA 2CDZA 4FT0A 3ZLXA 2JDOA 2VTJA 5IEVA 2W1FA 3BBWA 1GZOA 3LPBA 2BALA 3IGOA 2WMXA 4J96A 4K9YA 2W9FB 4EOOA 3C4ZA 4JQ7A 3DK6A 1LUFA 4LRJA 4BKZA 1ZMVA 4IXPA 3MA3A 2QG7A 5HKMA 2BHHA 5IH6A 1CTPE 5EI8A 4NUSA 1A48A 5A14A 2UZTA 5AP0A 4EOPA 4ZZOA 5A6NA 2HCKA 4P2KA 4YC3A 2WQOA 5DPVA 2YN8A 5ETAA 2XVDA 3MTFA 4QMNA 5TO8A 4R78A 1KSWA 3LFNA 4W4XA 4YURA 4EL9A 1ZZLA 4C8BA 3HKOA 3ROCA 1FVRA 5KX8A 3FZSA 5EW9A 3OOGA 1UWJA 1PRYA 3AC1A 3VF9A 3DFCB 4AX8A 3BE9A 5CF4A 4O6EA 5L8JA 3LW0A 2JFMA 1A06A 4FSQA 1SVHA 3HP5A 4C3PA 4PP9A 2VN9A 4CZYB 5CSXA 3QXPA 5G6VA 4E73A 4WD5A 3OMVA 4M68A 3HMOA 2XF0A 4L7SA 2B0QA 1W83A 3KB7A 1M2QA 2X9EA 3F7ZA 5EHYA 4XG8A 4D2TA 3QLFA 2H6DA 4ANBA 3MPTA 4EZ7A 4WT6A 4BTKA 3RP9A 2WU7A 5H9BA 1TVOA 2A27A 5F1ZA 3VUDA 4H3BA 4HJOA 4KBAA 4DEBA 3CTQA 4AS0A 3M2WA 1O6LA 1JKKA 4FZFB 2YITA 2YAKA 3CQWA 3HGKA 5HO8A 3VS3A 3ZCLA 4D9UA 4DA5A 2GTNA 5IQCA 5EM6A 4IWQA 1SMHA 2IJMA 4MXCA 3EKNA 3W2OA 2XNPA 3NCGA 4EEVA 3BRBA 2WAJA 4CLIA 3RAIA 4K77A 4FTJA 4FYNA 4GH2A 4I20A 5CAQA 3Q52A 3QX4A 3ACKA 3VF8A 3TZ8A 2PZRA 3ZZEA 1H1PA 2RL5A 4YHJA 4DBNA 5IQHA 3QTIA 1BI8A 4L6QA 3WIKA 4FEVA 3HAVA 3FSFA 4TYJA 2JC6A 3P5KA 1Q3DA 3CTJA 3QRKA 1TQIA 5K4JA 3I5NA 1B6CB 2XH5A 4RIYA 2HZNA 2WTWA 4OLIA 3SRVA 4EKKA 4ITJA 4IB1A 2DYLA 2CHLA 3H9RA 4OTDA 4DITA 3IW8A 4E20A 4YJUA 4F70A 1XHAA 5EDQA 4AT3A 2OXYA 1WFCA 4FNYA 2VWIA 3RI1A 4QMQA 4ANQA 1ERKA 1RE8A 2HW7A 5AIRA 2QQ7A 4NK9A 2O65A 3PUPA 3Q4TA 1Y57A 1KWPA 5KMIA 4I23A 3EFWA 4I92A 4Z16A 3H9FA 2BDJA 3D0EA 3DXNA 4YLJA 3R8LA 4R7IA 3LXNA 3VWAA 5HD4A 4UMRA 3LQ3A 3R01A 3NGAA 5AV4A 3UQFA 5T6KA 3PVGA 3NNUA 3G6GA 5HHWA 2PVLA 4CFVA 3TNHA 4OT6A 2QD9A 4FKPA 4F6WA 2UW8A 3HECA 3HV6A 4MNFA 5AEPA 1SVGA 3ZDIA 3DAKA 4FI1A 3ZUTA 4UMQA 5JQ8A 3PXQA 3QKKA 5FEDA 4FT9A 5GJGA 3R9OA 2ITTA 4QMMA 4XCUA 3QTXA 2VWUA 2Z7QA 2GQSA 1V0BA 3O0GA 3ZSIA 5HEZA 4CTBA 4Z9LA 2GU8A 1NVQA 3PP0A 2JDRA 3TN8A 4CNHA 4EI4A 3LCSA 4BDAA 3OXTA 4F1MA 4M69B 2B52A 4GG7A 2C6LA 3ZXZA 5BVDA 4Q5EA 3EWHA 4K11A 3BU3A 4F7NA 1MQ4A 4ANOA 1REJA 2R3GA 3NWWA 4IAZA 2IO6A 4M15A 5AM6A 1OPJA 5HIDA 3WF9A 4BDGA 5A4QA 4G5JA 4R1YA 4ZTMA 2VX3A 2HOGA 2YWVA 2OJFE 4DBXA 5L2TA 3FDNA 5L2QA 3AGLA 4E6AA 3IDPA 3GXLA 3NMUF 3NUSA 1YWVA 4O7WA 4G3FA 4KD1A 3W32A 3OD6X 4X7QA 4F9WA 2WMSA 3H3CA 2YFXA 3RINA 4S2ZA 1R39A 4FZ7A 5AUWA 3UPZA 4I21A 4W9XA 4AGUA 3VUIA 4U0IA 4K1BA 5JK3A 4ZSEA 5HU3A 3M11A 5AUVA 3U6HA 4D5KA 2C0IA 3VO3A 2E9PA 2F9GA 3VRZA 4ITHA 3EQDA 4L44A 4OTGA 5GZAA 3G15A 2UVYA 1UU9A 1P2AA 3V5TA 3HA8A 2VTPA 5AR2A 4LL5A 4GUBA 3FZ1A 5JKGA 2HELA 5M4CA 1YDRE 3C0HA 2W1HA 4I0TA 4EK6A 4H36A 4HCVA 3WARA 4IAAA 3CKXA 3OEFX 2Z7RA 4RJ3A 4C36A 3UQGA 3FLQA 5J5TA 3IKAA 2C3LA 1OB3A 5E8YA 1G3NA 2W5HA 1GIJA 3B2TA 4NM3A 3ZUUA 3FBVA 1JKSA 1XKKA 3AC8A 2OIDA 2W5BA 4JDJA 4M12A 4QYHA 4RA4A 3QRUA 3Q96A 4DH5A 2JEDA 4BWXA 3OHTA 2XYNA 4F63A 3LIJA 4D4YA 3RPRA 1PMVA 3DJ5A 2GQRA 4BDKA 4X2KA 4JDIA 2XJ0A 4JAJA 4G9RA 4DINA 3QHWA 4I6BA 4YZNA 4FGRA 2NRYA 4NL0A 3MFUA 3BV2A 1FVVA 3ERKA 4CV8A 3QGWA 4UALA 2JDSA 1VEBA 4FV5A 3OY3A 1CKPA 1OKVA 3MY0A 4FG7A 5KHXA 3C7QA 3A61A 2BPMA 4DLJA 3K5VA 2PUPA 1OIRA 1R0EA 3PLAE 2QHNA 3DQXA 3TTIA 4FOBA 4AU8A 2VWYA 1V0PA 2QI8A 2GFSA 3ZM4A 4AZVA 3UYSA 4I5HA 3QTZA 3FWQA 4FV6A 4YP8A 4YPSA 5HO7A 2NRUA 2BCJA 4DFBA 2HW6A 2F7ZE 1Q99A 1ZAOA 3FZTA 4AW5A 3BWJA 4PNIA 4QTBA 4WA9A 2GS2A 3B2WA 4PPAA 3SHEA 3TZ7A 2CPKE 3MFSA 3UDBA 3CTHA 4CZUA 2QOIA 3I7BA 5E8WA 2X7GA 5BYZA 3VUHA 4U79A 2PMIA 3M1SA 1JAMA 1PMEA 3KU2A 3FY2A 3BHYA 4LV8A 3HNGA 3NUYA 3EOCA 3E3BX 3NCZA 4U44A 5CU2A 3TKHA 2DS1A 4N0SA 3E63A 5A3XA 3DV3A 5CAVA 2C5YA 3DK7A 2V0DA 3V51A 3UZPA 4RLKA 4FZ6A 4ZTLA 4M0YA 3QTRA 3RBWA 4MX9A 5B7VA 3P7BA 1FMOE 3N9XA 5HG7A 2HXQA 4PTCA 4IZ5A 4CZTA 2HK5A 4K8AA 1L3RE 3MVLA 4OR5A 3EQHA 2C6OA 3A7IA 4BDCA 4LOOA 4DEEA 3MH0A 3TG1A 5FD2A 2XKFA 3R83A 4CXAA 4LI5A 4WHZA 3HRBA 5FLFA 3PWDA 3IDBA 1GZKA 2HENA 4AT5A 4ASXA 2RSVA 5CEMA 4ZTHA 2VAGA 4CFFA 4BWKA 4TZRA 3C0GA 3FSKA 5AP1A 4FZAB 2GPHA 4MKCA 2CGVA 2UZNA 4C33A 3R02A 1AD5A 5M09A 2Y4IB 5KZIA 5CALA 5HTIA 1PMUA 3DA6A 2WQBA 4ACGA 2JLDA 3L9NA 1NY3A 3MN3A 4BZNA 4PDOA 3R7IA 3SGCA 3COKA 4CQEA 4CFUA 1WBPA 4YZBA 4MXZA 5DEWA 4RJ4A 4Y95A 4V05A 4DT9A 1UKHA 5GIOE 3PXRA 1G8AA 2XKEA 3EFKA 3DNDA 4LGGA 3TIZA 4IVDA 4MXYA 5M55A 3KULB 3PA3A 3LLTA 5AIKA 3WI6A 5E7RA 3BYSA 5IH4A 3JR1A 3C9WA 3QYZA 4ZZMA 4X2FA 3DOGA 2XNBA 2EXMA 3FL4A 2DWBA 1LEWA 4MD9E 4KSQA 3ZSHA 4ACHA 4BWPA 3WIGA 4F65A 5I3RA 4NTTA 2PMNX 4UN0C 3P79A 4WBOA 1SNXA 3DT1A 3A7GA 3FE3A 2YAAA 3LCOA 3R2YA 4IVBA 3LFFA 4IX6A 4OTFA 5BVOA 2CKOA 4FTRA 1ZYDA 4I4EA 3GCUA 2YIRA 4MQ2A 4LUDA 3F5XA 4Y5HA 3UVPA 4EWHA 5AUYA 4J8NA 5IEYA 3DKGA 4GKHA 3ZO1A 3GGFA 4ORKA 4AA4A 3ZFYA 1ZXEA 5JQ5A 2ITOA 4JBPA 4LMNA 5DR6A 1G5SA 4ITIA 2OZAA 2BRBA 3PA5A 3QU0A 4D2SA 5CF6A 2R3RA 3A2CA 3ELJA 5AR3A 4YC8A 3DLSA 3ZDUA 4CYIA 4O7NA 5HX6A 4MNEA 4EOKA 1IG1A 3QQLA 3R2BA 3FHRA 2QURA 2QLQA 2WB8A 5CAPA 2BRGA 3Q9XA 4X3FC 2UW4A 5DVRA 5FQDC 2XNOA 3LE6A 2VRXA 5HO6A 5L6PA 1OKZA 3CQUA 4IAKA 4CLJA 5J95A 4QP6A 3CSVA 2WPAA 3FQEA 5EYKA 3DBDA 3VJNA 5CT0A 4R3CA 3I6UA 3R8MA 2FA2A 3C51A 3LCKA 2W7XA 3DBQA 4ACMA 2H34A 4XG4A 3RMFA 3PY1A 4G9CA 4D0XA 5JFVA 3LXKA 1ZWSA 1WVWA 3R7YA 3FZPA 3ATSA 5EFQA 3DKFA 2IPXA 2YISA 3OT8A 4AW2A 1Q8YA 2WMTA 3IONA 1IRKA 4GU6A 5EDRA 5AV3A 5M4IA 3SX9A 1OL2A 4QPMA 4EC8A 4ANSA 3D9VA 1ZY4A 3SA0A 4ZSAA 4R1VA 1M7NA 3TJDA 4GT5A 5IMEA 5FDXA 3PIYA 2Z7SA 5CI7A 1GY3A 4U5JA 3PXYA 5EYDA 3VBTA 5KMNA 3UJGA 5FTQA 1XH9A 5I9XA 5DEYA 1OECA 5CEQA 2BHEA 4C2WA 1H25A 2Y0AA 4LGDA 4UY9A 4BBMA 4RX7A 4FODA 5M44A 4J95A 2OH0E 2B55A 2X1NA 3I79A 4HZRA 4O22A 2ITQA 4QT1A 4D1ZA 4EK8A 4ERKA 4FVRA 5DT0A 4ZLZA 5ITAA 5AADA 1DI8A 4ACCA 2W1EA 2ONLA 4ZS0A 3OCSA 1Q8WA 3BLQA 5DRDA 5LVOA 1W82A 3MFRA 3KMWA 5EQPA 2QODA 3RHKA 3R7EA 4QYGA 2WQNA 4WSQA 3EN4A 4BBFA 1H01A 1Q61A 5ANKA 4WUAA 5EK7A 4IVCA 4XV1A 4X3FA 4FEUA 3KRLA 3UZTA 3TM0A 3FHIA 1O6YA 4F09A 1RW8A 2J9MA 3MTLA 5H8EA 4GEOA 4GW8A 2O2UA 3RTPA 1YI4A 4RIWA 4IX4A 3EL8A 5J8IA 3PIZA 1S9JA 1LP4A 4M84A 3PJCA 4IIRA 4XX9A 4CV9A 3C4WA 4KS7A 1GIHA 4KIOA 1FINA 2OZAB 5KUPA 1YWNA 1PF8A 3A4PA 5K9IA 3QD0A 2OJJA 2NNWB 4FKRA 3DAEA 3F6XA 3DU8A 5EW3A 2C4GA 4MTAA 2JBOA 2VTIA 5FUTA 3MB7A 4QOXA 5JZNA 3FMKA 2CCIA 4H05A 2WMVA 2VTHA 3WZKA 5LVNA 5GIPE 4TYHB 2YZLA 4O0SA 4U3YA 2YLEA 1PHKA 3NAXA 4O0RA 4OTWA 4V01A 1XH6A 3BU6A 2VTQA 4AOTA 2PTKA 3WZJA 2F4JA 3CY2A 2NPQA 5E8UA 2RKUA 4KS8A 3L8PA 1W8CA 3KXNA 3OP5A 4F1TA 1XR1A 3FQHA 1R0PA 3BGQA 3KEXA 1KE7A 3SLSA 5IQIA 5AV2A 4BB4A 2SRCA 3VUMA 3SXRA 3PRIA 3HAMA 2EWAA 3KF4A 3QF9A 5DFPA 2OBJA 3QAME 4FKUA 5M56A 3LFSA 3D83A 4C3RA 1PKDA 4DH1A 4BCJA 4BCPA 3KRXA 3CE3A 5BVKA 3R9RA 4RX9A 5EG3A 2VX1A 3RAHA 3UG1A 3FUPA 3QTUA 1NW1A 4F64A 4RJ8A 3V6SA 5J1WA 4BI2A 3DDQA 5GINE 4PMPA 3VNTA 4QP9A 5A6OA 5ANDA 5BUIA 5E8ZA 2XA4A 3WYYA 3E7VA 3P78A 3LM5A 1WVXA 4MWIA 3KN6A 4J99A 4QP1A 3MV5A 3GCSA 4MHAA 4KWPA 3HLLA 2B9IA 5CXHA 4JDHA 3F88A 4ZSGA 2X7FA 4AA0A 5CENA 1OUKA 5LCKA 4AAAA 3R8UA 3ETAA 3W10A 3EYHA 1A9UA 4UBAA 5KBRA 5ANIA 4JR7A 2HAKA 4L3JA 4X2NA 1YQJA 1V1KA 3MH2A 2ZM3A 4IDVA 4G6LA 2QVSE 2WKMA 5KMLA 4AN2A 5FXSA 2W4KA 2GNGA 2IZRA 2R3NA 1BUHA 4F7SA 4NZWB 5EQEA 1JSUA 3RAWA 2VD5A 3R73A 4NFNA 3KMMA 3WF6A 4PPCA 4U41A 4YR8A 4FKTA 3KY2A 1FQ1B 2XNEA 4FT5A 4AW1A 3WBLA 2IWIA 2V5QA 3GVUA 3ROYA 3PE2A 1LEZA 2BRHA 1OPLA 1Q41A 3JY0A 4FL1A 4IC7A 3QFVA 4YBKA 1DAWA 2GHLA 5HNGA 3SG9A 1BX6A 1FPUA 4X21A 4PUZA 3L9PA 4JG8A 3QC4A 2WMQA 4G17A 4OTIA 5IDPA 5LQFA 3DS6A 3BYMA 3BYVA 5B2MA 4XG6A 2WOUA 3QTWA 2VNWA 5ANJA 3EZVA 4UXQA 2ZV9A 4D1SA 5LARA 5JMSA 3ZFMA 3RVGA 3DTWA 2PL0A 4FYOA 2BZJA 5AP7A 3TUDA 5J9YA 5HESA 2QOFA 3Q2JA 1WAKA 5C8NA 4G1WA 3PA4A 3QQKA 5J1VA 2BR1A 1BKXA 3RPSA 3UNJA 4AWIA 5JT2A 4GG5A 1IEPA 1MUOA 1OZ1A 1URCA 4Q2AA 4TNDA 4YTFA 5AAEA 3MESA 3OFMA 4YJOA 4KSPA 3O51A 4A9UA 1YHVA 4OAVB 2W05A 3FKNA 5TE0A 3AG9A 5AM7A 4GKIA 2JKKA 2JD5A 2VO3A 3LJ2A 4L00A 3PRFA 4UZHA 4BCMA 1FGKA 3EQGA 2JITA 5FDPA 4PX6A 3EQRA 4YJVA 3EHAA 5HORA 3GP0A 2HY81 3ZC5A 4UWCA 3UO5A 3KCKA 1ZARA 4LRMA 1H24A 1OGUA 1JSVA 4W4YA 5AX9A 2WMUA 3GBZA 2ZJWA 3PZHA 2WZJA 3R7UA 5HICA 4ZEGA 3VQUA 3W18A 4USEA 3QCXA 2CGXA 2BZKB 3NRMA 1OL5A 3DFAA 4RIYB 4D2PA 3EQFA 5HBJA 2ZVAA 3R1NA 2Y8OA 5DGZA 4FK6A 3MVMA 4O81A 3CXWA 3P23A 1H4LA 3CD8A 5AP2A 4TWCA 3UMXA 4LM5A 4BDHA 3MVHA 3OW3A 3B8RA 4TL0A 4QMYA 3JUHA 3WE4A 4HVHA 3K3JA 4IZ7A 4R8QA 3QD3A 2BAJA 3OW4A 4ZLYA 5JGAA 5JSMA 1ND4A 3W2RA 1PJKA 4XLIA 3PXZA 4MQ1A 3KXMA 3ZXTA 4IJ9A 3SAYA 2I0YA 3PIXA 4BFMA 2RG6A 5FM2A 2VTTA 3SKCA 1K2PA 4FSRA 5AA8A 2XP2A 3S3IA 4QMSA 4ZSJA 3LFBA 2WMAA 2XM8A 3RPVA 3E8EA 4OGRA 3UIXA 3MW1A 3NVMB 3QWKA 4FG8A 5KMJA 2R4BA 1ZOHA 2R3IA 3V5WA 1KUTA 2BRNA 2XEYA 3EN6A 3HMPA 4FKVA 3D7TA 5IZFA 2Z02A 2QOHA 3EMGA 4FSYA 4XV3A 3O7LD 3UE4A 4U43A 4Z7HA 4LGHA 3AGMA 1CDKA 1M2PA 4QP7A 2IZTA 4QQJA 2FO0A 5HVYA 3Q5IA 3ORXA 3Q04A 4TW9A 5L2WA 4NWMA 3LAUA 4FF8A 5M08A 2WQMA 2C0TA 4FVPA 5IQDA 1QPJA 4BI0A 4GCJA 2CNUA 3OWJA 4NM7A 1FMKA 2E9OA 1RDQE 3ANQA 4NW5A 2EU9A 3BQCA 3FY0A 4XOZA 3KA0A 4BZOA 5E8SA 5CVFA 4Q9SA 2ITNA 2OIQA 1X8BA 3L9MA 3PJ2A 4L9IA 3GUBA 4E4MA 1BYGA 1M2RA 3V5PA 4J1RA 5ANOA 1PXJA 1PMNA 3BGZA 2XCKA 2UW6A 3MJ2A 5CEOA 4GFGA 5L6WL 4WBBB 5ETFA 3Q9ZA 4PL5A 3LCTA 4J52A 4WG4A 3D94A 4FT7A 2EXCX 3GT8A 2BKZA 4O1OA 4ZOGA 3BHVA 2IVTA 5C26A 4RX5A 4RWLA 3CIKA 2ZAZA 4O0YA 3Q32A 1YHSA 3S4QA 4CEGA 4IFGA 3RNYA 1LPUA 3ZEWA 2X4ZA 3GC9A 2PU8A 3KRRA 2B4SB 2BUJA 3WF7A 4DFNA 3RWPA 5L8KA 3MY5A 3DXPA 5DT3A 3WZDA 2VUWA 3FAAA 2F2UA 2Z60A 3HMIA 4XYFA 4OTHA 4WSYA 1IASA 4I5CA 2YEXA 2O3PA 4RT7A 4QTCA 4QP4A 3KQ7A 3W2CA 4OTRA 4MD8E 4FIJA 3QQHA 3S0OA 4FE2A 3ZO3A 4B8LA 2LAVA 4RWJA 4X2GA 3FMEA 4YSMA 3ZSGA 2VTOA 3KN5A 2XRUA 3LKMA 3WZUA 4J98A 3BI6A 1CM8A 4XEYA 2R7BA 1BI7A 2O5KA 3F3VA 2G2IA 4EUUA 1KOBA 3AT2A 3E64A 4V0GB 5HE0A 4UB7A 4GIHA 5HX8A 1JSTA 1Q24A 3BQRA 4IQ6A 3D7TB 5EYMA 3UNZA 3ZS5A 4DGMA 5CEKA 3PTGA 3VHEA 4DFLA 3DJ7A 1VZOA 3OTVA 4AOIA 4FK3A 2I0EA 4GFOA 5D41A 4CRSA 3KXXA 4M66A 4H58A 4P5QA 4CVAA 5CY3A 4IACA 4NEUA 5C4KA 3ORPA 2XK8A 3L8XA 4FOCA 1JNKA 4JL9A 4HZSA 3A7JA 4HW7A 3ORLA 4EKLA 3SVVA 4GS6A 1UU3A 2OJGA 3UBDA 3UIMA 3LVPA 5ICPA 2XJ2A 2JIVA 3QKMA 2XJ1A 4EJNA 4CKIA 4FV9A 2P3GX 3CJGA 4PMTA 1OKYA 4G6OA 2XIKA 4S31A 2C6KA 2V22A 2B54A 2J4ZA 3PG3A 3VULA 3I6WA 4PMMA 5CX9A 1MP8A 2ZM1A 1ZY5A 4UV0A 1DAYA 3Q9YA 4N6YA 3P86A 5DHJA 3EFJA 4AFJA 1REKA 4QMPA 4S32A 2FSTX 3NX8A 4JNWA 4OBOA 5F4NA 4HVSA 5JRSA 1O9UA 2YM5A 4XG9A 3EB0A 4E5AX 4D2RA 5K0XA 4BKYA 3HP2A 4HGEA 4I5MA 2C30A 4X3JA 5KNJA 4CCUA 2OFVA 3RK7A 2X2LA 4AZWA 1U5QA 4O91A 4O0WA 5BUJA 2LGCA 4WG3A 1YRPA 2ITUA 3R30A 1HOWA 4EH9A 4PDYA 3G9LX 2BMCA 3NDMA 4LOPA 1ATPE 4HVGA 3QQJA 3ZLYA 1H08A 4L01A 3REPA 4RBLA 5LMBA 1U4DA 4E1ZA 4R3RA 3QTQA 1OIQA 2PMOX 4XG7A 4AQCA 3LQ8A 4FR4A 4L43A 4XLVA 1F5QA 2PZ5A 1W0XC 1T46A 4FUYA 5ACKA 1R3CA 3HZTA 4JVGA 1IA9A 3P0MA 2V7OA 4X6RA 3KREA 2JAVA 4R6VA 4FL2A 5FTOA 3RJCA 3ZONA 5J7BA 1IAHA 4PL4A 5AV0A 2OIBA 5E91A 3U87A 2OF4A 4E4LA 1H8FA 3SW7A 4A9RA 3TDWA 4D2WA 2XK4A 2JKOA 3LXPA 4EHGA 1AQ1A 2UZEA 5JZJA 2I7QA 4DAWA 3ZLWA 2CKQA 4EOIA 4PQNA 2E9VA 3FZOA 3SXSA 3AXWA 4BGHA 2YM8A 2OLCA 2C68A 3LZBA 1XJDA 4RC4A 3VBVA 3DKCA 3P08A 2C6DA 4OTQA 2UZUE 3HVCA 4GRBA 4MBIA 3V01A 5HU9A 2UZOA 2GNLA 4FKQA 3NZ0A 1FVTA 4II5A 3N4TA 3CBLA 4AP7A 1I09A 4AACA 3KXHA 4KIPA 3AC5A 2C6IA 4WNKA 4XHKB 3ZRMA 4FIEA 4XP3A 4I3ZA 4UEUA 4MD7E 4ZTQA 2BFXA 2W06A 3VRYA 4XP0A 5ANGA 4F1OA 4IH8A 3OBGA 4FGBA 4L3LA 3TJCA 2HZIA 2HWOA 2Y7JA 3A7FA 3TUBA 3IW7A 4IZYA 3M42A 1GZ8A 3NUPA 4ARKA 1QMZA 1KOAA 4U45A 4F6SA 2VTNA 1XH8A 4ANNA 4EONA 1J3HA 4FKGA 1ZYJA 4C4EA 4WO5A 2ESMA 3ODYX 3D5UA 5IG1A 3B8QA 4FSZA 2IZUA 3ENMA 4JQEA 5CSHA 3RM7A 2W1GA 3EFLA 4EOQA 4AN9A 3FMLA 3R8PA 4U97A 3P7AA 4D4RA 5D12A 4FV3A 5HG5A 3W2QA 4E5WA 2VTLA 2XIYA 5CVHA 3R7OA 4YBJA 2AYPA 2AC3A 4FC0A 3RNIA 5CF5A 2BAKA 4BN1A 2YCFA 4D28A 2IVVA 3KXZA 4KAOA 4QO9A 5CI6A 2PZPA 5AV1A 3QD2B 1YOJA 5DYJA 5I4NA 2JDTA 2ERZE 2X6DA 5CT7A 3K54A 1Y6BA 4YU2A 2EB3A 1Q3WA 4FBXA 4NYEA 4U80A 5BVWA 3JVRA 5FTGA 3U55A 3ODZX 4EOJA 3FMMA 4C02A 3I5ZA 4IX3A 2YCRA 3D7ZA 1XBAA 3VIDA 4AZEA 1H28A 1UNHA 4BRXA 5J9ZA 4ANMA 3F9NA 3RWQA 4AF3A 5CQUA 5CVGA 4FG9A 2WO6A 5KE0A 5LVPA 5FBOA 5IUHA 3R21A 3FMDA 4I0RA 4IM2A 3QX2A 3CCNA 4RVLA 4A07A 3OY1A 3FC1X 3A60A 2PVJA 4DH3A 1VYWA 2OG8A 2VWZA 3R7VA 3NUUA 3QXOA 5LXMA 4RA5A 2C5VA 2ONLC 4FEWA 1ZYCA 2ETMA 4EH5A 2EUFB 4ZJJA 4RJ7A 3LHJA 4O21A 5EHOA 3N4VA 2HWPA 5E9EA 2VWBA 2R5TA 2W0JA 4S33A 5FGKA 2QOQA 1L8TA 4DTAA 3BHHA 2G01A 3SW4A 3ZO2A 4FTMA 3NR9A 1OL1A 5FWKK 5TF9A 3EYGA 2J5EA 4DG2E 2X2MA 3O8TA 2PYWA 4FV8A 5IKWA 2R3KA 4EUTA 2OH4A 3VS2A 2NO3A 4XV2A 4ASDA 2VO0A 1YHWA 4TRLA 2G15A 2CNVA 4HVDA 2OKRA 2WIHA 4IM0A 4PY1A 1I44A 2EB2A 4NKAA 5GJDA 5KKRC 5E90A 2ZM4A 4ZY6A 2GQGA 2WMRA 4HGLA 3MDYA 4XUFA 1Y8YA 3PJ8A 4EH4A 2E9UA 3O71A 4Y72A 3Q53A 5CWZA 4EH8A 3FEGA 2CKEA 3DAJA 4M7IA 3E87A 2PPQA 3P1AA 4ENYA 2WU6A 1WCCA 3BCEA 3WF8A 4W9WA 2C1BA 2JDVA 4JDKA 5HCXA 4S30A 2WTCA 5KCVA 3OTUA 5HG8A 4AN3A 1XH5A 4G6NA 2YA9A 1QPCA 4L3PA 2X0GA 5I9VA 2BZHB 1J7LA 2UW5A 2RFDA 1HCKA 2RFNA 4Z3VA 3ZLSA 4HYIA 3QGYA 5EKNA 2RG5A 2C6TA 4B0GA 1SM2A 1ZOGA 3VS7A 4DEGA 3DGKA 3C4FA 4CD0A 4EWQA 5HLWA 2C3JA 2C5OA 1YWRA 4XRJA 5LMAA 5J9LA 4CG8A 3QA0A 2AUHA 3MPAA 1LR4A 3K2LA 4G3GA 4ALUA 3RK9A 4H1MA 5DRBA 3QHRA 2WFYA 3OXIA 3MYGA 3R0TA 3TKUA 2XKCA 3OROA 4D4VA 3FC2A 3GOKA 1BMKA 4C58A 3ID6C 1J1BA 4RPVA 3HRFA 3F69A 4C4JA 3PVBA 3BHUA 4IX5A 4ALWA 2B9JA 4IAFA 4ZSLA 5BVEA 4D1XA 4JT3A 4EH2A 2QOOA 4GK4A 4JRVA 2PVKA 3HUBA 3L8SA 4H3PA 3KF7A 4DTKA 4HYHA 2CNQA 4MAOA 4APPA 1TQMA 3DZQA 4YTIA 4EBVA 3CPBA 2W96B 4DEIA 4Y85A 4B4LA 4BCQA 3NS9A 3ZUVA 2RGPA 3SXFA 3G2FA 5IUIA 3RPYA 3Q6WA 4EHVA 5CU3A 4QYYA 3F5PA 4XS2A 2Z8CA 2JKMA 3HMNA 3QKLA 2FYSA 4KBCA 5GJFA 4Q5HA 3NYNA 3P4KA 2HZ4A 5CAUA 2J0LA 3S00A 1OMWA 2YACA 3MVJA 4HYUA 1WZYA 4BCGA 4RJ5A 3V8TA 2C6MA 5J5SA 4A9TA 1CMKE 3EIDA 2YJRA 4M69A 4ZJVA 4EH7A 4BDFA 4RVMA 3IW5A 4RFYA 3FLNC 1CSNA 4O6LA 3UO6A 2W1CA 3QYWA 4JQ8A 1H07A 4YJTA 3N4UA 2X7OA 2CMWA 3FKOA 3QZHA 2XEZA 4NM0A 4QMTA 3WILA 3MGYA 3QWJA 2XK9A 4HGTA 2W1ZA 3D4QA 2BFYA 1UWHA 4NKSA 1H0WA 3PY3A 4O0TA 3TZ9A 5IPJA 2WGJA 3BKBA 2FGIA 4WIHA 5AMNA 3ZFXA 2JAMA 3QLGA 3S2PA 4CFMA 3S1HA 3A8XA 3Q4CA 4F4PA 5DA3A 4O2ZA 2QO2A 3GOPA 2GSFA 2VNYA 5HIEA 3DJ6A 4NM5A 3FJQE 4Q9ZA 3ZRLA 2R0UA 4FV2A 3PLSA 4TN6A 3V5QA 5I3OA 5JGBA 4A9YA 5JH6A 3NYVA 3ZRKA 5IA2A 4JOAA 3NNXA 3QL8A 4QMZA 3DLZA 5BX0A 3BYOA 4O7LA 3ZOSA 2WMBA 3ALNA 4CMTA 5TR6A 5CASA 3FKLA 4AA5A 2PVNA 2O0UA 2OXDA 4C34A 3G0FA 5IU2A 2UVXA 2C69A 2P2IA 3FLYA 5CNOA 4Y46A 3RK5A 3VJOA 4DFZE 5BQ0A 5LVMA 4K0YA 5FRIA 4AZFA 3DNEA 3I60A 4TNBA 2X8EA 1IR3A 3IK3A 3MI9A 3R28A 1JBPE 5FXQA 4CFNA 4AZTA 2XK3A 5JN2A 4IBMA 2R3PA 4GMYA 3D5VA 4D55A 3CD3A 4RC2A 3RZFA 3C4EA 3E62A 2PULA 3VBYA 5IMXA 3H10A 2W1IA 3CLYA 4FIGA 4UWYA 2YM7A 2OICA 4USFA 4EJ7A 1K9AA 2ITYA 3ZHPC 5AR5A 2UVZA 5ETCA 3A4OX 2X6EA 4NH1A 3KCFA 2QU6A 4U8ZA 3FXWA 4NIFB 5LMKA 4EK3A 4UX9A 2B9FA 4HOKA 4QNAA 3FXXA 3H4JA 3FQSA 5H8GA 4BDDA 3R7GA 4U9AA 4O83A 3DXQA 2ZV2A 3G6HA 5CAOA 3KVXA 4QNYA 4X0MA 5DNRA 3HV5A 2WNTA 3QA8A 2XNGA 3O8UA 2XIRA 3R04A 4KINA 4BL1A 4IFCA 4CTCA 3LQ5A 4GU9A 3G33A 1P14A 5F95A 5FEQA 4ZIMA 4NCTC 3UVQA 3SDJA 1OKWA 5FM3A 2YJSA 3FMJA 2B53A 1PXMA 4RX8A 2V62A 2CGUA 5EM5A 3SOCA 3DB8A 4C4HA 4DEAA 1JVPP 4GSBA 4GUEA 4ALVA 5BMSA 2BIKB 2VU3A 3UQCA 1VYZA 2I1MA 5LCJA 3OEZA 4DLIA 4Z7GA 5M06A 3Q9WA 5E8XA 3CC6A 4XP2A 5M4UA 3K5UA 1NVRA 3EQIA 1Q5KA 4L52A 3KVWA 3OS3A 4KA3A 5CSVA 5AUTA 4FV1A 2OZOA 2BKKA 4D2VA 5M4FA 4IAYA 3UMWA 2WQEA 3IGGA 4YJQA 5HBHA 1PKGA 4JR3A 2VTMA 4ZAUA 1H26A 4I93A 4RJ6A 5I9UA 3T9IA 2Q83A 4MBLA 1TQPA 1K3AA 4YNOA 3GNIB 5AUXA 2C3IB 4IM3A 5IQGA 3NW5A 4PF4A 4GVJA 4CKJA 3FMNA 3HV7A 5FEEA 4MEDA 2R3FA 3C0IA 4XG2A 3I1AA 4L45A 5IA5A 2BZIB 3N51A 3C1XA 4LFIA 1XQZA 4C4FA 3MIYA 5KBQA 3PSDA 4A4OA 1YOMA 1YI3A 3IG7A 1JPAA 3GC8A 3GCPA 2B9HA 3HMMA 3VBWA 4O7SA 2C5XA 3FLZA 1SYKA 3VUGA 5DOSA 4F7LA 3GU8A 4LQMA 5AP5A 5HG9A 2W99B 2VX0A 2YDIA 4R3PA 5EM7A 4JXFA 4C62A 3NYOA 4JIAA 3V8SA 4NCTA 3VS5A 4D5HA 1DM2A 3TEIA 1UA2A 5HD7A 4M3QA 5C27A 5L4QA 2QG5A 4LV5A 5AUUA 3KKVA 3QZIA 3BWFA 4QMXA 3T3VA 4OW8A 4BCOA 4XH6A 2XK6A 4LG4A 4YO4A 4C61A 4I5PA 4M13A 2ZV8A 4W4VA 2X81A 4NJ3A 5HTBA 4O82A 3TNPC 4N57A 3IW4A 2FSOX 4FKIA 5EI2A 4BF2A 3C50A 4I6FA 4A7CA 4EQMA 3NIEA 3IDCA 4D0WA 2XMYA 5AFVA 2NP8A 4JX3A 3F61A 5JFXA 4U3ZA 2JIIA 5KZ0A 3HUCA 2EVAA 5LJJA 3O17A 4G5PA 5CYIA 2AC5A 4J97A 4RIXA 4CMOA 4RMZA 2FSMX 3CR0A 3ZO4A 4JG7A 3DBFA 2PUUA 4IWDA 4YJSA 5HTCA 4LOQA 4I94A 2VTAA 3DBCA 3GI3A 5DG5A 4ZTSA 4DGLC 4BCNA 4ZMFA 2UV2A 3TNIA 5DN3A 3CPCA 5C01A 4L42A 5DI1A 3LMHA 3T9TA 1YI6A 2REIA 3F5UA 2RIOA 4N70A 4GFMA 4GYIA 2J6MA 5HE1A 3PSBA 3W16A 5B2KA 3V3VA 2QKWB 3F2RA 1E1VA 4MBJA 4PMSA 4JBQA 5FXRA 5C8MA 3I0OA 3NW6A 4CGAA 4O7TA 5CXZA 3FLWA 4V0GA 2J7TA 3OCGA 4RG0A 2P33A 4L67A 3FZRA 2OK1A 3PFQA 4TYEA 5CEPA 2P2HA 2XKDA 4YZCA 2C3KA 4PTEA 2YCQA 4WUNA 5E92A 5IA0A 3MY1A 4ZTNA 5E8VA 2A4LA 2HZ0A 4UWBA 5D9HA 4EOLA 3FPMA 2C47A 4EHEA 2RFSA 1ZMWA 2J2IB 3OBJA 4KB8A 4YZDA 4D58A 3NIZA 4G3EA 4CCBA 3GC7A 2R0IA 3GEQA 3P9JA 3QZGA 1OM1A 4C3FA 4IANA 1UVRA 2OW3A 4PDPA 5DH3A 5BYYA 5I5ZA 1ZOEA 3VW8A 4O7VA 3UC3A 3CGFA 3KRWA 4FSNA 2Y4IC 3PVWA 4UXLA 4E26A 5K4IA 3CY3A 5K3YA 3UP2A 4RSSA 3RKBA 4TPTA 3U8WA 1MRUA 1OL7A 4JJRA 4MYGA 3D5XA 2IW9A 3H0ZA 1GIIA 5IA3A 3BYUA 4OBPA 4QP3A 3W1FA 4QTAA 5IQEA 3NNWA 4FSUA 4ZJIA 4K33A 1XBBA 2PHKA 5CTPA 5HOAA 5B0XA 4EQUA 4WRGA 5C4LA 2QNJA 4FIIA 4FSMA 2RF9A 3DTCA 2CN5A 3BEAA 4YMJA 3KMUA 3L8VA 5KKRB 2UZBA 1H1SA 1J7IA 4P5ZA 4DG0E 2G1TA 2OI4X 4YPDA 3UOLA 4O84A 1J1CA 1M17A 3D14A 2CCHA 4FTOA 3SC1A 2PK9A 5L2IA 3TUCA 1ZYLA 5CQWA 2G9XA 4JBVA 4BHZA 3AC2A 4JRNA 2QOKA 4FTTA 4QYEA 2ZB1A 4RZWA 2A1AB 1NVSA 2F57A 3QRJA 3MH3A 4OBQA 3NYXA 4H39A 4TWNA 4FTUA 3U54A 2OF2A 3TXOA 5HVKA 1H00A 4AW0A 2CKPA 4ZY4A 2WOTA 4LMUA 4JG6A 4HGSA 3GU4A 4OUCA 3Q3BA 3RALA 2J0JA 2R3HA 3ET7A 3VC4A 3O8PA 1KE9A 1OI9A 1Y91A 3EKKA 5DE2A 2W4OA 3PY0A 3ULIA 4DH8A 2YM4A 2XS0A 1DI9A 2HXLA 2JGZA 2OFUA 3DPKA 3G90X 5AP3A 4BI1A 4BIDA 3IS5A 4EYJA 5DLSA 2ETKA 3GCVA 5A4CA 1QPEA 4EORA 3TV7A 4UMUA 1VR2A 4QMLA 2OXXA 3G5DA 4E93A 4PRJA 2FVDA 3AMBA 2PUIA 3JVSA 5IQBA 3G9NA 4G16A 4EK4A 3BV3A 2BROA 2QOLA 4C37A 4V04A 2PE1A 5E4HA 5CF8A 4K18A 4IADA 4RQKA 4YLLA 3ORIA 4HPUE 4O7RA 4FKWA 5FG8A 4K6ZA 5GZ9A 2X8IA 4FSTA 3DBEA 2ZOQA 2UW3A 5C9CA 3S95A 3ORKA 4FTIA 3PWYA 2ZMCA 3A99A 2BILB 4FTNA 3TACA 4C2VA 4DCEA 1UV5A 4ASEA 4MXAA 5KMKA 4FT3A 4FKJA 2VV9A 4JX7A 3FL5A 5HLNA 1H27A 5D10A 4O7YA 1FBNA 2P0CA 4FICA 3E3PA 4L46A 4IAIA 5B2LA 1CKIA 2P55A 3QCQA 4D9TA 2R3MA 2VWVA 3OCBA 3U6JA 3ZU7A 2J50A 1DS5A 5K5NA 4G34A 1E9HA 2W9ZB 4QMOA 4DFXE 2ITVA 4ZS4A 3ZMMA 2PVYA 2XUUA 1HCLA 3UZRA 4DF3A 3GU6A 4DEDA 2BIYA 1W84A 1OVEA 4F0GA 1Z57A 4PNKA 3A62A 1F0QA 2OJ9A 2VWXA 3ORZA 2B7AA 3ORNA 3PPKA 3R8VA 4G31A 4E8AA 4AGWA 4XNEA 1JOWB 1T45A 4UMTA 5HZNA 2GS7A 4HCUA 4EYMA 5T68A 3BLRA 3UOJA 3CJFA 3L1SA 3PPJA 2C5NA 3ACJA 2R9SA 4LYNA 3W55A 4IE9A 4OTPA 4X6QC 2VGPA 4WNPA 2IZSA 5DWRA 5T3QA 1WMKA 3QQFA 4FVQA 5ANEA 4IWPA 4QPAA 1ZZ2A 3Q4UA 1XO2B 2GMXA 4KIKA 4EC9A 5HNIX 4PDSA 3QBNA 3VQHA 2ITWA 1BLXA 3RHXA 4CFXA 3ZBFA 2QLUA 3POOA 4BTMA 4O7ZA 1NXKA 1GNGA 2FSLX 2HY0A 2BDWA 3BIZA 3LXLA 3ZEPA 2IW8A 4DN5A 4QQTA 4ZLOA 4O2PA 3DDPA 5CS6A 1FGIA 2IVUA 3HDMA 3I0QA 1YXVA 4R5SA 2WIPA 4IB3A 2GS6A 3UPXA 4GJ2A 2X9FA 4IW0A 5H2UA 2GNFA 2HYYA 2C1AA 2OO8X 2BVAA 2YCSA 3GFWA 2WEVA 3E92A 3PVUA 2I0HA 3F3UA 4AXAA 4F6UA 4GVAA 4RVTA 2FB8A 1KE5A 2ZMDA 4MNEB 1JKLA 3QRIA 1UKIA 3CS9A 4PTGA 4GV1A 5M07A 5TKDA 4HNFA 4FUXA 4K2RA 2CN8A 3CQEA 5M57A 3A8WA 5IA4A 1M14A 3PXKA 3ZC6A 1GZNA 1RJBA 2QC6A 3VS0A 4BR3A 2UZDA 2XCHA 2PVHA 4F08A 4J8MA 4PWNA 3NVKI 3PE1A 1H1QA 2GNHA 4JAIA 2XNNA 5AP6A 1UU8A 4BDBA 4H1JA 4M67A 4WNMA 4UMPA 3KC3A 3DY7A 3LCDA 3CP9A 3V6RA 3DCVA 4RQVA 4C4IA 4RFMA 3EN5A 2IW6A 5ETIA 3U4WA 4CYJA 2PWLA 3EQBA 3MBLA 2GTMA 3PG1A 4FV7A 2FH9A 2A19B 3QQUA 4QP8A 5EOLA 3SOAA 2WTIA 4IMYA 3UGCA 4F7JA 2O8YA 3F7WA 4FV0A 1OUYA 3LFCA 4HYSA 5AAFA 1IAJA 4R5YA 3DZOA 4KKHA 4QD6A 4E5BA 3MWUA 2QOBA 3NLBA 3F2NA 1U46A 3TNQB 3U51A 4AFEA 1GAGA 4FNWA 2WTVA 5IQFA 5C03A 3IPHA 4LUEA 4U7ZA 5FP5A 3T8OA 3TKIA 2FUMA 5BNJA 5E8TA 3LJ1A 3RZBA 3QCSA 3T3UA 3SV0A 5M53A 3LJ0A 1SVEA 1G8SA 4I4FA 4IB0A 5CEIA 5D1JA 1Q8ZA 3EQPA 3H0YA 4WRSA 3SQQA 3HL7A 3VUTA 1Z5MA 4F99A 4U40A 4YC6A 4CT2A 4YTHA 4L7FA 2Z7LA 4BDJA 3O96A 4FEQA 1PYEA 2X39A 2XZSA 4KKEA 3HV4A 4DT8A 1CKJA 4ZZNA 5E1EA 3NSZA 4BDEA 4F0IA 1ZYSA 4KABA 5A4EA 2GFCA 2H8HA 2Y4PA 1NA7A 4W8EA 4C57A 3FMHA 3NEWA 1YXXA 5F20A 1MQBA 3PZEA 5A54A 4M97A 4RRVA 4RIOA 4NTSA 2CLQA 4P4CA 4TKSA 3VS6A 3AD6A 1QCFA 2R3JA 3COMA 4BKJA 1IA8A 4G3DA 3W33A 3LFAA 4P7EA 5L8LA 1OBGA 3AC3A 2DQ7X 2ACXA 3VBXA 5C1QB 5GHVA 3I7CA 5AX3A 1Q8TA 5HIBA 3OWPA 4DE4A 3MPMA 4QP2A 2HIWA 2XYUA 1Q97A 3UO4A 1PY5A 2W17A 3EN9A 3GU7A 4MVFA 4BGQA 1OBDA 3BZ3A 3AC4A 2GNJA 3BBTB 1ZMUA 2XM9A 5HQ0A 1KV1A 3QUDA 3R22A 3ALOA 3R9NA 4N4SA 4QPSA 4NT4A 3JY9A 1OIYA 1H1RA 4KBKA 4QYFA 2F7EE 5A9UA 3I4BA 4AGCA 1J91A 2VGOA 5AR7A 4BCHA 1JKTA 5AP4A 2A2AA 4IC8A 2YERA 5L2SA 1M52A 1B38A 3QTSA 5E1SA 3V04A 2J0IA 2PVRA 4IJPA 4WG5A 1YDTE 2CJMA 2WMWA 4AUAA 3AQVA 2YIYA 3II5A 4L68A 4QMVA 4U6RA 4AE6A 4IDTA 3LFDA 3IQ7A 4ERWA 2VTRA 3GQIA 4Z55A 4MXXA 4IVAA 1KV2A 3H9OA 5BMMA 3TT0A 4KRCA 4EH3A 4RGJA 3OF0A 4M14A 3RGFA 4F9BA 1O6KA 2PVFA 3ZYAA 3OC1A 5JFWA 3OVVA 3R1YA 3FI3A 4B7TA 2CGWA 4H3QA 2YDJA 3QALE 4IHPA 4LRKA 4Y83A 4HCTA 2XIXA 3IOPA 4DCAA 3F5GA 4UYNA 5AAGA 2ITZA 2OGVA 5HVJA 2QR8A 3QUPA 1R78A 2H96A 3R00A 3R8ZA 5GZ8A 1U5RA 4ZMEA 5KO1A 3I81A 4FSWA 5EDPA 3VW6A 2OSCA 3FYJX 5AR4A 3CEKA 3O50A 4YTCA 2ITPA 4E7WA 1YKRA 4PV0A 4NJDA 5AJQA 3C5UA 3L9LA 4KRDA 4IZAA 4J71A 5LMKC 3SRVB 2QO7A 4GL9A 4O86A 1Y8GA 3G0EA 4R77A 3AT4A 4E6QA 3LM0A 4HVIA 5BUEA 3POZA 4NIFA 3VN9A 3FI8A 5EKOA 4I22A 3AT3A 1WVYA 4FX3A 4U42A 4YO6A 4E4NA 2PE0A 3DK3A 4BZDA 1NT2A 3NW7A 2J51A 2H9VA 4RWKA 4ACDA 4YUQA 3FPQA 1J7UA 1ZRZA 2OU7A 4MXOA 2OWBA 3BE2A 4MCVA 3BPRA 5C8KA 4M8TA 3LMIA 4QTDA 3GFEA 3OUKA 3OXZA 3JPVA 4FKSA 5KMMA 4M0ZA 2BTRA 2Q0BA 3THBA 3PXFA 1PXPA 5DBXA 4ANLA 1YXSA 3C13A 4GYGA 1WBTA 2X2KA 2PMLX 4PP7A 1STCE 3FYKX 4RFZA 4XOYA 3TV6A 4CRLA 3P7CA 4I41A 4RWIA 5A4LA 2I6LA 3AMAA 3TTJA 4EHZA 5A46A 3WF5A 3O7LB 4GK3A 1E1XA 1FOTA 3KK9A 5ACBC 3R9DA 4CFWA 2ITXA 3EQCA 2ZDTA 3UC4A 4KKGA 4FKOA 4TT7A 4J53A 5EI6A 3F82A 4FIHA 4FA2A 3TDVA 5CU4A 5M51A 2ERKA 4TXCA 1GOLA 3ULZA 1WBVA 3IOKA 5HE2A 3OCTA 2R3OA 4LL0A 4MWHA 5CSWA 5DMZA 3VS4A 3HEGA 3HX4A 4XBRA 3UIUA 3C4CA 2G2HA 5D7VA 2QHMA 4AG8A 4FTCA 3MA6A 4QQCA 4I0SA 3V5JA 4E6DA 3NUXA 4CKRA 3SG8A 5IA1A 2ZB0A 4JIKA 5EH0A 1MRYA 1YW2A 5KHWA 2I40A 4FZDB 1JLUE 3WE8A 4IEBA 4EH6A 3D15A 5TOZA 1WBWA 3F2AA 4MK0A 3E8DA 2F2CB 4YNEA 4O38A 3TV4A 5IDNA 5DIAA 5K5XA 5L3AA 2XB7A 4WNOA 3RPOA 4DFUA 2IVSA 3WZEA 5EQYA 1YVJA 3H30A 4RZVA 5CZIA 3ZZWA 3VBQA 1UNLA 2WELA 2GHGA 2Y6OA 4L8MA 1U54B 4DHFA 3NNVA 5HCZA 3E93A 1KE6A 4TWPA 4BYIA 4JBOA 3WOWA 2YLFA 3QZFA 3TWJA 4BIEA 4S34A 4BYJA 4PPBA 4X2JA 5IEXA 4DTBA 3ITZA 3HYHA 4UYAA 3R9HA 4C35A 5L6OA 4MH7A 5TT7A 5LVLA 3OG7A 4F9CA 4B8MA 2O63A 5G1XA 4QRCA 2J0MB 4G3CA 5I0BA 1P4FA 2GHMA 3U9CA 1PXNA 2W4JA 2J0KA 3RM6A 3QRTA 1YXTA 3O23A 5HGIA 3VS1A 1JQHA 2R3QA 3UODA 2UUEA 3FV8A 4OT5A 5EW8A 5HBEA 4L53A 3QQGA 2YWPA 4C0TA 3V8WA 2G2FA 4NFMA 4C7TA 1APME 2WTKB 1PXKA 3BLHA 3RCDA 4E3CA 3R1SA 1WBSA 3DB6A 3RAKA 1AGWA 4BIBA 5J79A 1W98A 5D11A 1KE8A 5GNKA 5CANA 5LWNA 3WYXA 2E2BA 3MH1A 3FLSA 1PW2A 1B39A 3CKWA 4RIXB 2DUVA 4GT4A 3DKOA 4CMUA 4DG3E 4E6CA 4R7HA 3O2MA 4ASZA 3D2KA 3E7OA 1XH4A 4QMWA 5FBNC 5DT4A 2V7AA 2O64A 3R1QA 2WXVA 5DR2A 2ZV7A 3Q6UA 4QMUA 5HLPA 1YOLA 2WTJA 1U59A 2BAQA 1ZLTA 5F9EA 5I9YA 1PXLA 5IQAA 2XK7A 3ATTA 4QQ5A 2QO9A 3F3ZA 2GNIA 5BPYA 2YABA 3AMYA 3COIA 4FTAA 1Q4LA 4APCA 4FTQA 5JRQA 3GU5A 4KUJA 3QUEA 5HNBA 2C0OA 1OPKA 3K3IA 1S9IA 3E8CA 3ZH8A 2V55A 4XG3A 4IB5A 4Y5QA 2I0VA 4F9YA 2YIXA 5CSPA 2YM3A 1PXIA 3MB6A 2J90A 1OIUA 2B1PA 4G2FA 4CQGA 5HCYA 5EYCA 4BCFA 4EZ3A 3RCJA 3UVRA 3AD5A 3UTOA 1SZMA 1XWSA 4BTJA 1Q8UA 4EOMA 5IUGA 2IG7A 4R7BA 3KGAA 2QONA 3MFTA 4PL3A 4W4WA 3R63A 5JGDA 1TKIA 4YJNA 4QTEA 1U54A 4ZXTA 1BL7A 2E9NA 2JBPA 2GDOA 2Z2WA 4YZ9A 1UNGA 4P90A 4DEHA 2PY3A 3KULA 2XNMA 1SNUA 3ZTXA 3ORTA 4C59A 4EQCA 5A4TA 2QKRA 3EN7A 3F3TA 2YDKA 3EL7A 4HPTE 4YGAA 3G51A 3D2IA 3EH9A 2Y9QA 2R2PA 4XJ0A 3A7HA 3F66A 3IO7A 3TNWA 2P4IA 4ZTRA 4I6QA 4DGOA 3TL8A 4CG9A 4YJPA 3Q4ZA 4RVKA 2XBJA 4E4XA 4AGDA 3KK8A 5HE3A 2J5FA 4FL3A 3AD4A 5HI2A 4N6ZA 2PVMA 3BELA 3Q60A 4EOSA 4EZ5A 1H0VA 3E88A 3V5LA 3KRJA 4ID7A 4FV4A 5EM8A 5BVNA 4DGNA 2VO6A 1XBCA 1Z9XA 1M7QA 4DGGA 2ETRA 2QCSA 2GCDA 1QL6A 1UU7A 3D5WA 3NUNA 3PSCA 4FTKA 1OL6A 4NW6A 4WOVA 2JIUA 2VTSA 3KFAA 2JKQA 5K0KA 3E8NA 2VWWA 2R7IA 4XRLA 5H3QA 4D4SA 3FI4A 4F9AA 4YSJA 4O96A 3JYAA 5IF1A 3QD4A 5JFSA 2CLXA 1W7HA 3IW6A 3VUKA 2WEIA 3KXGA 3W8QA 1F3MC 4KIQA 2YZAA 2ZDUA 2KULA 4MF1A 4YHTA 3UG2A 4I6HA 3OWKA 1P5EA 3CGOA 5I9ZA 2WTKC 4DYMA 3Q5ZA 5AWMA 4I24A 2IN6A 3PJ1A 4YLKA 2RFEA 4AE9A 4ZK5A 4DH7A 2F7XE 5LOHA 4BTFA 4ZY5A 2WHBA 3BGPA 4I1ZA 2QR7A 4TWOA 4GT3A 4AZSA 4F0FA 3C4XA 4J7BA 4ZP5A 3BHTA 3HDNA 2YIQA 2C6EA 3U9NA 4FIFA 3W8LA 1PXOA 1P4OA 4GIIA 3LLAA 3MSSA 3ZM9A 2F49A 2X4FA 3HV3A 3R71A 4DC2A 5CZHA 5IH5A 3LFQA 1YDSE 1JWHA 4RLLA 2XRWA 3NUAA 3ENHA 3HA6A 3OUNB 3MIAA 4BBEA 3C5IA 5CU6A 1Q62A 4EK5A 3TI1A 3JS2A 4USDA 3PP1A 2JFLA 3UYTA 3R6XA 1R1WA 4CSVA 1WBNA 5BYLA 3OOMA 1V0OA 3BX5A 4FKLA 5FP6A 3GB2A 4BCKA 2YIWA 5BVFA 3KL8A 4JI9A 4XBUA 2PUNA 3NAYA 3EZRA 5EOBA 4Y73A 3HRCA 3QC9A 3F3WA 4O0UA 3PPZA 2QU5A 5F94A 3TZMA 4AT4A 4BVUA 3GENA 3GCQA 4XV9A 2WD1A 4GK2A 2BTSA 4MF0A 2PE2A 2VO7A 2Q0NA 2KTYA 3LFEA 1QPDA 3PYYA 2PZIA 4OAUC 1URWA 3ORMA 3OZ6A 4X3FB 3FXZA 3COHA 2UZLA 5KMOA 5EHLA 1XH7A 3U4UA 4KNBA 4JS8A 1EH4A 3QCYA 3VAPA 3UNKA 2BDFA 4DFYA 3FI2A 3BU5A 4IWOA 3LMGA 4NU1A 4O0VA 3ZBXA 4O27B 3TIYA 4EBWA 2R64A 5H8BA 5D7AA 4B9DA 5CU0A 4TY1A 4FNZA 4BGGA 3UOHA 4BICA 4A4LA 3VHKA 4JLCA 2EXEA 2YHVA 4W8DA 4O1PA 1MRVA 2W5AA 3LOKA 2XIZA 4U81A 4C4GA 5LWMA 3VVHA 4B6LA 4UZDA 4AOJA 3E5AA 4BY9E 4FTLA 2X8DA 3MS9A 4FNXA 4A06A 3PJ3A 4KIKB 4O0XA 5I9WA 4ONAA 4TYHA 4Y8DA 2UW0A 4YZMA 4BC6A 5J7HA 5JEBA 3BEGA 1WBOA 4FMQA 3W2SA 2A0CX 4A4XA 4A9SA 2Y6MA 2YM6A 3GC0A 4ENXA 4WKQA 3UIBA 2BRMA 2UZVA
chains in the Genus database with same CATH superfamily
1H1WA 4HNIA 4BCIA 5AA9A 4RIWB 3EJ1A 3OT3A 3UOKA 5CLPA 2W1DA 4BDIA 2OJIA 3UP7A 4YJRA 1BL6A 3DQWA 5J87A 4AXDA 2X0QA 1PYXA 1YXUA 2UZWE 2WTDA 4C38A 4XMOA 1Y6AA 2PZYA 2XBAA 2ZYBA 5CNNA 3TCPA 3Q2MA 4CT1A 5IISA 2QOCA 3OWLA 3MJ1A 2CSNA 4NSTA 2UW9A 3W2PA 2VZ6A 4GJ3A 1VJYA 3NPCA 4BHNA 2PSQA 3IECA 1OITA 4RC3A 2R3LA 5AR8A 1GJOA 4FEXA 5DR9A 3SD0A 3AOXA 1RQQA 3JXWA 4TTHB 4YHFA 2UW7A 5AUZA 4TYIA 3PDTA 3ANRA 4TYGA 3U6IA 4B99A 3GQLA 2CDZA 4FT0A 3ZLXA 2JDOA 2VTJA 5IEVA 2W1FA 3BBWA 1GZOA 3LPBA 2BALA 3IGOA 2WMXA 4J96A 4K9YA 2W9FB 4EOOA 3C4ZA 4JQ7A 3DK6A 1LUFA 4LRJA 4BKZA 1ZMVA 4IXPA 3MA3A 2QG7A 5HKMA 2BHHA 5IH6A 1CTPE 5EI8A 4NUSA 1A48A 5A14A 2UZTA 5AP0A 4EOPA 4ZZOA 5A6NA 2HCKA 4P2KA 4YC3A 2WQOA 5DPVA 2YN8A 5ETAA 2XVDA 3MTFA 4QMNA 5TO8A 4R78A 1KSWA 3LFNA 4W4XA 4YURA 4EL9A 1ZZLA 4C8BA 3HKOA 3ROCA 1FVRA 4DHZA 5KX8A 3FZSA 5EW9A 3OOGA 1UWJA 1PRYA 3AC1A 3VF9A 3DFCB 4AX8A 3BE9A 5CF4A 4O6EA 5L8JA 3LW0A 2JFMA 1A06A 4FSQA 1SVHA 3HP5A 4C3PA 4PP9A 2VN9A 4CZYB 5CSXA 3QXPA 5G6VA 4E73A 4WD5A 3OMVA 4M68A 3HMOA 2XF0A 4L7SA 2B0QA 1W83A 3KB7A 1M2QA 2X9EA 3F7ZA 5EHYA 4XG8A 4D2TA 3QLFA 2H6DA 3UDTA 4ANBA 3MPTA 4EZ7A 4WT6A 4BTKA 3RP9A 2WU7A 5H9BA 1TVOA 2A27A 5F1ZA 3VUDA 4H3BA 4HJOA 4KBAA 4DEBA 4AXFA 3CTQA 4AS0A 3M2WA 1O6LA 1JKKA 4FZFB 2YITA 2YAKA 3CQWA 3HGKA 5HO8A 3VS3A 3ZCLA 4D9UA 4DA5A 2GTNA 5IQCA 5EM6A 4IWQA 1SMHA 2IJMA 4MXCA 3EKNA 3W2OA 2XNPA 3NCGA 4EEVA 3BRBA 2WAJA 4CLIA 3RAIA 4K77A 4FTJA 4FYNA 4GH2A 4I20A 5CAQA 3Q52A 3QX4A 3ACKA 3VF8A 3TZ8A 2PZRA 3ZZEA 1H1PA 1W2CA 2RL5A 4YHJA 4DBNA 5IQHA 3QTIA 1BI8A 4L6QA 3WIKA 4FEVA 3HAVA 3FSFA 4TYJA 2JC6A 3P5KA 1Q3DA 3CTJA 3QRKA 1TQIA 5K4JA 3I5NA 1B6CB 2XH5A 4RIYA 2HZNA 2WTWA 4OLIA 3SRVA 4EKKA 4ITJA 4IB1A 2DYLA 2CHLA 3H9RA 4OTDA 4DITA 3IW8A 4E20A 4YJUA 4F70A 4O4DA 1XHAA 5EDQA 4AT3A 2OXYA 1WFCA 4FNYA 2VWIA 3RI1A 4QMQA 4ANQA 1ERKA 1RE8A 2HW7A 5AIRA 2QQ7A 4NK9A 1W2DA 2O65A 3PUPA 3Q4TA 1Y57A 1KWPA 5KMIA 4I23A 3EFWA 4I92A 4Z16A 3H9FA 2BDJA 3D0EA 3DXNA 4YLJA 3R8LA 4R7IA 3LXNA 3VWAA 5HD4A 4UMRA 3LQ3A 3R01A 3NGAA 5AV4A 3UQFA 5T6KA 3PVGA 3NNUA 3G6GA 5HHWA 2PVLA 4CFVA 3TNHA 4OT6A 2QD9A 4FKPA 4F6WA 2UW8A 3HECA 3HV6A 4MNFA 5AEPA 1SVGA 3ZDIA 3DAKA 4FI1A 3ZUTA 4UMQA 5JQ8A 3PXQA 3QKKA 5FEDA 4FT9A 5GJGA 3R9OA 2ITTA 4QMMA 4XCUA 3QTXA 2VWUA 2Z7QA 3O5AA 2GQSA 1V0BA 3O0GA 3ZSIA 5HEZA 4CTBA 4Z9LA 2GU8A 1NVQA 3PP0A 2JDRA 3TN8A 4CNHA 4EI4A 3LCSA 4BDAA 3OXTA 4F1MA 4M69B 2B52A 4GG7A 2C6LA 3ZXZA 5BVDA 4Q5EA 3EWHA 4K11A 3BU3A 4F7NA 1MQ4A 4ANOA 1REJA 2R3GA 3NWWA 4IAZA 2IO6A 4M15A 5AM6A 1OPJA 5HIDA 3WF9A 4BDGA 5A4QA 4G5JA 4R1YA 4ZTMA 2VX3A 2HOGA 2YWVA 2OJFE 4DBXA 5L2TA 3FDNA 3NFFB 5L2QA 3AGLA 4E6AA 3IDPA 3GXLA 3NMUF 3NUSA 1YWVA 4O7WA 4G3FA 4KD1A 3W32A 3OD6X 4X7QA 4F9WA 2WMSA 3H3CA 2YFXA 3RINA 4S2ZA 1R39A 4FZ7A 5AUWA 3UPZA 4I21A 4W9XA 4AGUA 3VUIA 4U0IA 4K1BA 5JK3A 4ZSEA 5HU3A 3M11A 5AUVA 3U6HA 4D5KA 2C0IA 3VO3A 2E9PA 2F9GA 3VRZA 4ITHA 3EQDA 4L44A 4OTGA 5GZAA 3G15A 2UVYA 1UU9A 1P2AA 3V5TA 3HA8A 2VTPA 5AR2A 4LL5A 4GUBA 3FZ1A 5JKGA 2HELA 5M4CA 1YDRE 3C0HA 2W1HA 3TYKA 4I0TA 4EK6A 4H36A 4HCVA 3WARA 4IAAA 1TFFA 4I6LA 4LV7A 3CKXA 3OEFX 2Z7RA 4RJ3A 4C36A 3UQGA 3FLQA 5J5TA 3IKAA 2C3LA 1OB3A 5E8YA 1G3NA 2W5HA 1GIJA 3B2TA 4NM3A 3ZUUA 3FBVA 1JKSA 1XKKA 3AC8A 2OIDA 2W5BA 4JDJA 4M12A 4QYHA 4RA4A 3QRUA 3Q96A 4DH5A 2JEDA 4BWXA 3OHTA 2XYNA 4F63A 3LIJA 4D4YA 3RPRA 1PMVA 3DJ5A 2GQRA 4BDKA 4X2KA 4JDIA 2XJ0A 4JAJA 4G9RA 4DINA 3QHWA 4I6BA 4YZNA 4FGRA 2NRYA 4NL0A 3MFUA 3BV2A 1FVVA 3ERKA 4O4CA 4CV8A 3QGWA 4UALA 2JDSA 1VEBA 4FV5A 3OY3A 1CKPA 1OKVA 3MY0A 4FG7A 5KHXA 3W0RA 3C7QA 3A61A 2BPMA 4DLJA 3K5VA 2PUPA 1OIRA 1R0EA 3PLAE 2QHNA 3DQXA 3TTIA 4FOBA 4AU8A 2VWYA 1V0PA 2QI8A 2GFSA 3ZM4A 4AZVA 3UYSA 4I5HA 3QTZA 3FWQA 4FV6A 4YP8A 4YPSA 5HO7A 2NRUA 2BCJA 4DFBA 2HW6A 2F7ZE 2IF8A 1Q99A 1ZAOA 3FZTA 4AW5A 3BWJA 4PNIA 4QTBA 4F9AA 4WA9A 2GS2A 3B2WA 4PPAA 3SHEA 3TZ7A 2CPKE 3MFSA 3UDBA 3CTHA 4CZUA 2QOIA 3I7BA 5E8WA 2X7GA 5BYZA 3VUHA 4U79A 2PMIA 3M1SA 1JAMA 1PMEA 3KU2A 3FY2A 3BHYA 4LV8A 3HNGA 3NUYA 3EOCA 3E3BX 3NCZA 4U44A 5CU2A 3TKHA 3W0MA 2DS1A 4N0SA 3E63A 5A3XA 3DV3A 5CAVA 2C5YA 3DK7A 2V0DA 3V51A 3UZPA 4RLKA 4FZ6A 4ZTLA 4M0YA 3QTRA 3RBWA 4MX9A 5B7VA 3P7BA 1FMOE 3N9XA 5HG7A 2HXQA 4PTCA 4IZ5A 4CZTA 2HK5A 4K8AA 1L3RE 3MVLA 4OR5A 3EQHA 2C6OA 3A7IA 4BDCA 4LOOA 4DEEA 3MH0A 3TG1A 5FD2A 2XKFA 3R83A 4CXAA 4LI5A 4WHZA 3HRBA 5FLFA 3PWDA 3IDBA 1GZKA 2HENA 4AT5A 4ASXA 2RSVA 5CEMA 4ZTHA 2VAGA 4CFFA 4BWKA 4TZRA 3C0GA 3FSKA 5AP1A 4FZAB 2GPHA 4MKCA 2CGVA 2UZNA 4C33A 3R02A 1AD5A 5M09A 2Y4IB 5KZIA 5CALA 5HTIA 1PMUA 3DA6A 2WQBA 4ACGA 2JLDA 3L9NA 1NY3A 3MN3A 4O4FA 4BZNA 4PDOA 3R7IA 3SGCA 3COKA 4CQEA 4CFUA 1WBPA 4YZBA 4MXZA 5DEWA 4RJ4A 4Y95A 4V05A 4DT9A 1UKHA 5GIOE 3PXRA 1G8AA 2XKEA 3EFKA 3DNDA 4LGGA 3TIZA 4IVDA 4MXYA 5M55A 3KULB 3PA3A 3LLTA 5AIKA 3AKLA 3WI6A 5E7RA 3BYSA 5IH4A 3JR1A 3C9WA 3QYZA 4ZZMA 4X2FA 3DOGA 2XNBA 2EXMA 3FL4A 2DWBA 1LEWA 4MD9E 4KSQA 3ZSHA 4ACHA 4BWPA 3WIGA 4F65A 5I3RA 4NTTA 2PMNX 4UN0C 3P79A 4WBOA 1SNXA 3DT1A 3A7GA 3FE3A 2YAAA 3LCOA 3R2YA 4IVBA 3LFFA 4IX6A 4OTFA 5BVOA 2CKOA 4FTRA 1ZYDA 4I4EA 3GCUA 2YIRA 4MQ2A 4LUDA 3F5XA 4Y5HA 3UVPA 4EWHA 5AUYA 4J8NA 5IEYA 3DKGA 4GKHA 3ZO1A 3GGFA 4ORKA 4AA4A 3ZFYA 1ZXEA 5JQ5A 2ITOA 4JBPA 4LMNA 5DR6A 1G5SA 4ITIA 2OZAA 2BRBA 3PA5A 3QU0A 4D2SA 5CF6A 2R3RA 3A2CA 3ELJA 5AR3A 4YC8A 3DLSA 3ZDUA 4CYIA 4O7NA 3W0OA 5HX6A 4MNEA 4EOKA 1IG1A 3QQLA 3R2BA 3FHRA 2QURA 2QLQA 2WB8A 5CAPA 2BRGA 3Q9XA 4X3FC 2UW4A 5DVRA 5FQDC 2XNOA 3LE6A 2VRXA 5HO6A 5L6PA 1OKZA 3CQUA 4IAKA 4CLJA 5J95A 4QP6A 3CSVA 2WPAA 3FQEA 5EYKA 3DBDA 3VJNA 5CT0A 4R3CA 3I6UA 3R8MA 2FA2A 3C51A 3LCKA 2W7XA 3DBQA 4ACMA 2H34A 4XG4A 3RMFA 3PY1A 4G9CA 4D0XA 5JFVA 3LXKA 1ZWSA 1WVWA 3R7YA 3FZPA 3ATSA 5EFQA 3DKFA 2IPXA 2YISA 3OT8A 4AW2A 1Q8YA 2WMTA 3IONA 1IRKA 4GU6A 5EDRA 5AV3A 5M4IA 3SX9A 1OL2A 4QPMA 4EC8A 4ANSA 3D9VA 1ZY4A 3SA0A 3VONA 4ZSAA 4R1VA 1M7NA 3TJDA 4GT5A 5IMEA 5FDXA 3PIYA 2Z7SA 5CI7A 1GY3A 4U5JA 3PXYA 5EYDA 3VBTA 5KMNA 3PFYA 3UJGA 5FTQA 1XH9A 5I9XA 5DEYA 1OECA 5CEQA 2BHEA 4C2WA 1H25A 2Y0AA 4LGDA 4UY9A 4BBMA 4RX7A 4FODA 5M44A 4J95A 2OH0E 2B55A 2X1NA 3I79A 4HZRA 4O22A 2ITQA 4QT1A 4D1ZA 4EK8A 4ERKA 4FVRA 5DT0A 4ZLZA 5ITAA 5AADA 4O4BB 1DI8A 4ACCA 2W1EA 2ONLA 4ZS0A 3OCSA 1Q8WA 3BLQA 5DRDA 5LVOA 1W82A 3MFRA 3KMWA 5EQPA 2QODA 3RHKA 3R7EA 4QYGA 2WQNA 4WSQA 3EN4A 4BBFA 1H01A 1Q61A 5ANKA 4WUAA 5EK7A 4IVCA 4XV1A 4X3FA 4FEUA 3KRLA 3UZTA 3TM0A 3FHIA 1O6YA 4F09A 1RW8A 2J9MA 3MTLA 5H8EA 4GEOA 4GW8A 2O2UA 3RTPA 1YI4A 4RIWA 4IX4A 3EL8A 5J8IA 3PIZA 1S9JA 1LP4A 4M84A 3PJCA 4IIRA 4XX9A 4CV9A 3C4WA 4KS7A 1GIHA 4KIOA 1FINA 2OZAB 5KUPA 1YWNA 1PF8A 3A4PA 5K9IA 3QD0A 2OJJA 1G8KA 3UDZA 4FKRA 3DAEA 3F6XA 3W0SA 3DU8A 5EW3A 2C4GA 4MTAA 2JBOA 2VTIA 5FUTA 3MB7A 4QOXA 5JZNA 3FMKA 2CCIA 4H05A 2WMVA 2VTHA 3WZKA 5LVNA 5GIPE 4TYHB 2YZLA 4O0SA 4U3YA 2YLEA 1PHKA 3NAXA 4O0RA 4OTWA 4V01A 3BL7A 1XH6A 3BU6A 2VTQA 4AOTA 2PTKA 3WZJA 2F4JA 3CY2A 2NPQA 5E8UA 2RKUA 4KS8A 3L8PA 1W8CA 3KXNA 3OP5A 4F1TA 1XR1A 3FQHA 1R0PA 3BGQA 3KEXA 1KE7A 3SLSA 5IQIA 5AV2A 4BB4A 2SRCA 3VUMA 3SXRA 2XARA 3PRIA 3HAMA 2EWAA 3KF4A 3QF9A 5DFPA 2OBJA 3QAME 4FKUA 5M56A 3LFSA 3D83A 4C3RA 1PKDA 4DH1A 4BCJA 4BCPA 3KRXA 3CE3A 5BVKA 3R9RA 4RX9A 5EG3A 2VX1A 3RAHA 3UG1A 3FUPA 3QTUA 1NW1A 4F64A 4RJ8A 3V6SA 5J1WA 4BI2A 3DDQA 5GINE 4PMPA 3VNTA 4QP9A 5A6OA 5ANDA 5BUIA 5E8ZA 2XA4A 3WYYA 3E7VA 3P78A 3LM5A 1WVXA 4MWIA 3KN6A 4J99A 4QP1A 3MV5A 3GCSA 4MHAA 4KWPA 3HLLA 2B9IA 5CXHA 4JDHA 3F88A 4ZSGA 2X7FA 4AA0A 5CENA 1OUKA 5LCKA 4AAAA 3R8UA 3ETAA 3W10A 3EYHA 1A9UA 4UBAA 5KBRA 5ANIA 4JR7A 2HAKA 4L3JA 4X2NA 1YQJA 1V1KA 3MH2A 2ZM3A 4IDVA 4G6LA 2QVSE 2WKMA 5KMLA 4AN2A 5FXSA 2W4KA 2GNGA 2IZRA 2R3NA 1BUHA 4F7SA 4NZWB 5EQEA 1JSUA 3RAWA 2XALA 2VD5A 3R73A 4NFNA 3KMMA 3WF6A 4PPCA 4U41A 4YR8A 4FKTA 3KY2A 1FQ1B 2XNEA 4FT5A 4AW1A 3WBLA 2IWIA 2V5QA 3GVUA 3ROYA 3PE2A 1LEZA 2BRHA 1OPLA 1Q41A 3JY0A 4FL1A 4IC7A 3QFVA 4YBKA 1DAWA 2GHLA 5HNGA 3SG9A 1BX6A 1FPUA 4X21A 4PUZA 3L9PA 4JG8A 3QC4A 2WMQA 4G17A 4OTIA 5IDPA 5LQFA 2X0OA 3DS6A 3BYMA 3BLAA 3BYVA 5B2MA 4XG6A 2WOUA 3QTWA 2VNWA 5ANJA 3EZVA 4UXQA 2ZV9A 4D1SA 5LARA 5JMSA 3ZFMA 3RVGA 3DTWA 2PL0A 4FYOA 2BZJA 5AP7A 3TUDA 5J9YA 5HESA 2QOFA 3Q2JA 1WAKA 5C8NA 4G1WA 3PA4A 3QQKA 4QEBA 5J1VA 2BR1A 1BKXA 3RPSA 3UNJA 4AWIA 5JT2A 4GG5A 1IEPA 1MUOA 1OZ1A 1URCA 4Q2AA 4TNDA 4YTFA 5AAEA 3MESA 3OFMA 4YJOA 4KSPA 3O51A 4A9UA 1YHVA 4OAVB 2W05A 3FKNA 5TE0A 3AG9A 5AM7A 4GKIA 2JKKA 2JD5A 2VO3A 3LJ2A 4L00A 3PRFA 4UZHA 4BCMA 1FGKA 3EQGA 2JITA 5FDPA 4PX6A 3EQRA 4YJVA 3EHAA 5HORA 3GP0A 2HY81 3ZC5A 4UWCA 3UO5A 3KCKA 1ZARA 4LRMA 1H24A 1OGUA 1JSVA 4W4YA 5AX9A 2WMUA 3GBZA 2ZJWA 3PZHA 2WZJA 3R7UA 5HICA 4ZEGA 3VQUA 3W18A 4USEA 4DHIB 2XAMA 3QCXA 2CGXA 2BZKB 3NRMA 1OL5A 3DFAA 4RIYB 4D2PA 3EQFA 5HBJA 2ZVAA 3R1NA 2Y8OA 5DGZA 4FK6A 3MVMA 4O81A 3CXWA 3P23A 1H4LA 3CD8A 5AP2A 4TWCA 3UMXA 4LM5A 4BDHA 3MVHA 3OW3A 3B8RA 4TL0A 4QMYA 3JUHA 3WE4A 4HVHA 3K3JA 4IZ7A 4R8QA 3QD3A 2BAJA 3OW4A 4ZLYA 5JGAA 5JSMA 1ND4A 3W2RA 1PJKA 4XLIA 4YSJA 3PXZA 4MQ1A 3KXMA 3ZXTA 4IJ9A 3SAYA 2I0YA 3PIXA 4BFMA 2RG6A 5FM2A 2VTTA 3SKCA 1K2PA 4FSRA 5AA8A 2XP2A 3S3IA 4QMSA 4ZSJA 3LFBA 2WMAA 2XM8A 3RPVA 3E8EA 4OGRA 3UIXA 3MW1A 3NVMB 3QWKA 4FG8A 5KMJA 2R4BA 1ZOHA 2R3IA 3V5WA 1KUTA 2BRNA 2XEYA 3EN6A 3HMPA 4FKVA 3D7TA 5IZFA 2Z02A 2QOHA 3EMGA 4FSYA 4XV3A 3O7LD 3UE4A 4U43A 4Z7HA 4LGHA 3AGMA 1CDKA 1M2PA 4QP7A 2IZTA 4QQJA 2FO0A 5HVYA 3Q5IA 3ORXA 3Q04A 4TW9A 5L2WA 4NWMA 3LAUA 4FF8A 5M08A 2WQMA 2C0TA 4FVPA 5IQDA 1QPJA 4BI0A 4GCJA 2CNUA 3OWJA 4NM7A 1FMKA 2E9OA 1RDQE 3ANQA 4NW5A 2EU9A 3BQCA 3FY0A 4XOZA 3KA0A 4BZOA 5E8SA 5CVFA 4Q9SA 2ITNA 2OIQA 1X8BA 3L9MA 3PJ2A 4L9IA 3GUBA 4E4MA 1BYGA 1M2RA 3V5PA 4J1RA 5ANOA 1PXJA 1PMNA 3BGZA 2XCKA 2UW6A 3MJ2A 5CEOA 4GFGA 5L6WL 4WBBB 5ETFA 3Q9ZA 4PL5A 3LCTA 4J52A 4WG4A 4AAYA 3D94A 4FT7A 2EXCX 3GT8A 2BKZA 4O1OA 4ZOGA 3BHVA 2IVTA 5C26A 4RX5A 4RWLA 3CIKA 2ZAZA 4O0YA 3Q32A 1YHSA 3S4QA 4CEGA 4IFGA 3RNYA 1LPUA 3ZEWA 2X4ZA 3GC9A 2PU8A 3KRRA 2B4SB 2BUJA 3WF7A 4DFNA 3RWPA 5L8KA 3MY5A 3DXPA 5DT3A 3WZDA 2VUWA 3FAAA 2F2UA 2Z60A 3HMIA 4XYFA 4OTHA 4WSYA 1IASA 4I5CA 2YEXA 2O3PA 4RT7A 4QTCA 4QP4A 3KQ7A 3W2CA 4OTRA 4MD8E 4FIJA 3QQHA 3S0OA 4FE2A 3ZO3A 4B8LA 2LAVA 4RWJA 4X2GA 3FMEA 4YSMA 3ZSGA 2VTOA 3KN5A 2XRUA 3LKMA 3WZUA 4J98A 3BI6A 1CM8A 4XEYA 2R7BA 1BI7A 1XMLA 2O5KA 3F3VA 2G2IA 4EUUA 1KOBA 3AT2A 3E64A 4V0GB 5HE0A 4UB7A 4GIHA 5HX8A 1JSTA 1Q24A 3BQRA 4IQ6A 3D7TB 5EYMA 3UNZA 3ZS5A 4DGMA 5CEKA 3PTGA 3VHEA 4DFLA 3DJ7A 1VZOA 3OTVA 4AOIA 4FK3A 2I0EA 4GFOA 5D41A 4CRSA 3KXXA 4M66A 4H58A 2NNWB 4P5QA 4CVAA 5CY3A 4IACA 4NEUA 5C4KA 3ORPA 2XK8A 3L8XA 4FOCA 1JNKA 4JL9A 4HZSA 3A7JA 4HW7A 3ORLA 4EKLA 3SVVA 4GS6A 1UU3A 2OJGA 3UBDA 3UIMA 3LVPA 5ICPA 2XJ2A 2JIVA 3QKMA 2XJ1A 4EJNA 4CKIA 4FV9A 2P3GX 3CJGA 4PMTA 1OKYA 4G6OA 2XIKA 4S31A 2C6KA 2V22A 2B54A 2J4ZA 3PG3A 3VULA 3I6WA 4PMMA 5CX9A 1MP8A 2ZM1A 1ZY5A 4UV0A 1DAYA 3Q9YA 4N6YA 3P86A 5DHJA 3EFJA 4AFJA 1REKA 4QMPA 4S32A 2FSTX 3NX8A 4JNWA 4OBOA 5F4NA 4HVSA 5JRSA 1O9UA 2YM5A 3BL9A 4XG9A 3EB0A 4E5AX 4D2RA 5K0XA 4BKYA 3HP2A 4HGEA 4I5MA 2C30A 4X3JA 5KNJA 4CCUA 2OFVA 3RK7A 2X2LA 4AZWA 1U5QA 4O91A 4O0WA 5BUJA 2LGCA 4WG3A 1YRPA 2ITUA 3R30A 1HOWA 4EH9A 3NFGB 4PDYA 3G9LX 2BMCA 3NDMA 4LOPA 1ATPE 4HVGA 3QQJA 3ZLYA 1H08A 4L01A 3REPA 4RBLA 5LMBA 1U4DA 4E1ZA 4R3RA 3QTQA 1OIQA 2PMOX 4XG7A 4AQCA 3LQ8A 4FR4A 4L43A 4XLVA 1F5QA 2PZ5A 1W0XC 1T46A 4FUYA 5ACKA 1R3CA 3HZTA 4JVGA 1IA9A 3KIOC 3P0MA 2V7OA 4X6RA 3KREA 2JAVA 4R6VA 4FL2A 5FTOA 3RJCA 3ZONA 5J7BA 1IAHA 4PL4A 5AV0A 2OIBA 5E91A 3U87A 2OF4A 4E4LA 1H8FA 3SW7A 4A9RA 3TDWA 4D2WA 2XK4A 2JKOA 3LXPA 1ST4A 4EHGA 1AQ1A 2UZEA 5JZJA 2I7QA 4DAWA 3ZLWA 2CKQA 4EOIA 4PQNA 2E9VA 3FZOA 3SXSA 3AXWA 4BGHA 2YM8A 2OLCA 2C68A 3LZBA 1XJDA 4RC4A 3VBVA 3DKCA 3P08A 2C6DA 4OTQA 2UZUE 3HVCA 4GRBA 4MBIA 3V01A 5HU9A 2UZOA 2GNLA 4FKQA 3NZ0A 1FVTA 4II5A 3N4TA 3CBLA 4AP7A 1I09A 4AACA 1ST0A 3KXHA 4KIPA 3AC5A 2C6IA 4WNKA 4XHKB 2AEGA 3ZRMA 4FIEA 4XP3A 4I3ZA 4UEUA 4MD7E 4ZTQA 2BFXA 2W06A 3VRYA 4XP0A 5ANGA 4F1OA 4IH8A 3OBGA 4FGBA 4L3LA 3TJCA 2HZIA 2HWOA 2Y7JA 3A7FA 3TUBA 3IW7A 4IZYA 4AXEA 3M42A 1GZ8A 3NUPA 4ARKA 1QMZA 1KOAA 4U45A 4F6SA 2VTNA 1XH8A 4ANNA 4EONA 1J3HA 4FKGA 1ZYJA 4C4EA 4WO5A 2ESMA 3ODYX 3D5UA 5IG1A 3B8QA 4FSZA 2IZUA 3ENMA 4JQEA 5CSHA 3RM7A 2W1GA 3EFLA 4EOQA 4AN9A 3FMLA 3R8PA 4U97A 3P7AA 4D4RA 5D12A 4FV3A 5HG5A 3W2QA 4E5WA 2VTLA 2XIYA 5CVHA 3R7OA 4YBJA 2AYPA 2AC3A 4FC0A 3RNIA 5CF5A 2BAKA 4AQKA 4BN1A 2YCFA 4D28A 2IVVA 3KXZA 4KAOA 4QO9A 5CI6A 2PZPA 5AV1A 3QD2B 1YOJA 5DYJA 5I4NA 2JDTA 2ERZE 2X6DA 5CT7A 3K54A 1Y6BA 4YU2A 2EB3A 1Q3WA 4FBXA 4NYEA 4U80A 5BVWA 3JVRA 5FTGA 3U55A 3ODZX 4EOJA 3FMMA 4C02A 3I5ZA 4IX3A 2YCRA 3D7ZA 1XBAA 3VIDA 4AZEA 1H28A 1UNHA 4BRXA 5J9ZA 4ANMA 3F9NA 3RWQA 4AF3A 5CQUA 5CVGA 4FG9A 2WO6A 5KE0A 5LVPA 5FBOA 5IUHA 3R21A 3FMDA 4I0RA 4IM2A 3UDSA 3QX2A 3CCNA 4RVLA 4A07A 3OY1A 3FC1X 3A60A 2PVJA 4DH3A 1VYWA 2OG8A 2VWZA 3R7VA 3NUUA 3QXOA 5LXMA 4RA5A 2C5VA 2ONLC 4FEWA 1ZYCA 2ETMA 4EH5A 2EUFB 4ZJJA 4RJ7A 3LHJA 4O21A 5EHOA 3N4VA 2HWPA 5E9EA 2VWBA 2R5TA 2W0JA 4S33A 5FGKA 2QOQA 1L8TA 4DTAA 3BHHA 2G01A 3SW4A 3ZO2A 4FTMA 2XANA 3NR9A 1OL1A 5FWKK 5TF9A 3EYGA 2J5EA 4DG2E 2X2MA 3O8TA 2PYWA 4FV8A 5IKWA 2R3KA 4EUTA 2OH4A 3VS2A 2NO3A 4XV2A 4ASDA 2VO0A 1YHWA 4TRLA 2G15A 2CNVA 4HVDA 2OKRA 2WIHA 4IM0A 4PY1A 1I44A 2EB2A 4NKAA 5GJDA 5KKRC 5E90A 4FJVA 2ZM4A 4ZY6A 2GQGA 2WMRA 4HGLA 3MDYA 4XUFA 1Y8YA 3PJ8A 4EH4A 2E9UA 3O71A 4Y72A 3Q53A 5CWZA 4EH8A 3FEGA 2CKEA 3DAJA 4M7IA 3E87A 2PPQA 3P1AA 4ENYA 2WU6A 1WCCA 3BCEA 3WF8A 4W9WA 2C1BA 2JDVA 4JDKA 5HCXA 4S30A 2WTCA 5KCVA 3OTUA 5HG8A 4AN3A 1XH5A 4G6NA 2YA9A 1QPCA 4L3PA 2X0GA 5I9VA 2BZHB 1J7LA 2UW5A 2RFDA 1HCKA 2RFNA 4Z3VA 3ZLSA 4HYIA 3QGYA 5EKNA 2RG5A 2C6TA 4B0GA 1SM2A 1ZOGA 3VS7A 4DEGA 3DGKA 3C4FA 4CD0A 4EWQA 5HLWA 2C3JA 2C5OA 1YWRA