4FVQA

Crystal structure of the jak2 pseudokinase domain (mg-atp-bound form)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
274
Chain Sequence
b'VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Crystal structures of the JAK2 pseudokinase domain and the pathogenic mutant V617F.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fvqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fvqA01
3VWAA 3E7OA 4PDPA 4AZWA 4F0IA 2CKOA 1G8AA 3C4ZA 5T68A 4ANNA 5JT2A 4DTBA 1H1RA 4ID7A 3VUDA 4ZTLA 4MTAA 5D9HA 3AD5A 3UIUA 1QL6A 1U5QA 4ALWA 5EM7A 4YURA 5IEYA 2OWBA 4RJ4A 4CCBA 4AXAA 3C0IA 3NUAA 5CS6A 2XK8A 3HAVA 4P4CA 3H9FA 5BVEA 4U81A 3IKAA 1H24A 3MFSA 5JMSA 4CSVA 2DQ7X 4X7QA 2C0OA 4GW8A 4E20A 5CAOA 4GVAA 4FK6A 4NFNA 2WELA 4Q9ZA 4IVDA 5TKDA 1DI8A 5IMXA 5HIEA 4IVAA 3F3VA 4X3JA 2XNNA 4XP3A 2YJRA 5HE2A 5M06A 3AMYA 3ZLWA 5M56A 2CNUA 2R2PA 4WRGA 4FKGA 3QTZA 3PTGA 4M7IA 3ZOSA 5EKNA 5FG8A 3ZDUA 4LM5A 3F61A 3DGKA 3JY9A 3NR9A 3W2QA 4QMYA 4KABA 2A0CX 4UMUA 3R1SA 2XZSA 2HK5A 3MSSA 4GFMA 3QA0A 5HBHA 3L8PA 4R8QA 5E1SA 2JDTA 3LMHA 5KKRC 4FG7A 4M14A 2PZYA 4M13A 3ORPA 3G0EA 2VU3A 3HV6A 4TWOA 5DRDA 3LQ3A 4RWKA 4LQMA 5TT7A 4BDFA 4W9WA 3ZH8A 2PVNA 3FYJX 1YOJA 4GT4A 3CQEA 3DXNA 5FXQA 3DFAA 5H9BA 2PHKA 4YBKA 4EH4A 2Z2WA 4KKEA 4C61A 2IG7A 3OWLA 4HGLA 2GTNA 4EOQA 4KUJA 3DJ6A 4QQJA 4MXCA 1MQBA 1QMZA 2VO6A 5HHWA 4B7TA 2XNBA 4YJSA 3C1XA 1VJYA 4ZS4A 3MJ1A 3W2SA 1RJBA 4G3GA 5J87A 2PUPA 3QRUA 3MTFA 2R0IA 5BUJA 2ITTA 5FLFA 3OZ6A 5HE3A 4PMTA 2OIDA 4CKRA 4HNIA 2FA2A 4O0YA 4AX8A 5HU3A 3V5PA 3FY2A 4JAJA 4R78A 2QD9A 5IQGA 3MA6A 1W82A 3GU6A 5B2KA 2LGCA 4OBQA 3EQCA 3D2KA 1W83A 3DAEA 5AR5A 3SD0A 5HTBA 5E91A 5BMSA 3QTUA 4RGJA 1VYZA 3KCFA 4ZSLA 5EW3A 2OLCA 2WMSA 5E7RA 3Q6WA 3F3TA 4GCJA 3PVWA 2WZJA 3I6WA 4AG8A 5F4NA 4Q9SA 4MKCA 4WOVA 5GZ8A 2J90A 2EU9A 5LVNA 4FNZA 5FGKA 3A4PA 2HZNA 4WNOA 5KO1A 2H8HA 3E8EA 1Q4LA 5IUIA 5J5TA 1WZYA 4RJ3A 4FL2A 4JIKA 2R5TA 3MVLA 2QONA 4RWIA 4F65A 3VBTA 4FV8A 4I5HA 4GJ3A 2UZEA 2VTSA 4A9RA 3HA8A 1REJA 4ZLYA 4DBNA 4FNWA 2YACA 4HPUE 2R3FA 1OKWA 2PMLX 3GNIB 3PIZA 3QFVA 2YDJA 4FIHA 5M08A 1I44A 4AACA 2JITA 2YAKA 4YTCA 1T46A 4ITIA 4DEEA 2IVTA 4YZ9A 4XJ0A 4GU6A 5AUXA 4FV1A 2CNVA 3LMGA 3C0HA 4BCPA 4D5HA 3HMPA 3K3IA 4MF0A 5AP1A 3MI9A 3BYOA 2WTDA 3QU0A 3ZSGA 2ZV2A 3VS1A 4EHZA 1FBNA 4DEIA 1BL7A 1UU8A 3MDYA 4GU9A 4WT6A 3OCBA 5HOAA 4O91A 4XRJA 1CDKA 4OBOA 3ZXTA 3V01A 1ZYLA 3A99A 3VW8A 3KXZA 3WE4A 4AA5A 4CZYB 4F70A 3PXKA 2REIA 4C2WA 4UZHA 5DH3A 1JSVA 4MAOA 4DLIA 3D15A 3R9DA 3TUBA 3GFWA 4WA9A 5E9EA 4L45A 3S4QA 4FF8A 3V3VA 3H9RA 3R8MA 4QMPA 5CF4A 4QO9A 4RX5A 3KRLA 5G1XA 3UIBA 1H1PA 1MRVA 4TNBA 4LUDA 5KMJA 4DFZE 5FM2A 2GCDA 3P5KA 4J98A 1U54B 2C3JA 2PUUA 3CTQA 3P7BA 4XH6A 4C3FA 4OR5A 4IB1A 2BROA 5AIRA 2JDVA 2J0IA 3U9CA 4D28A 3SXSA 5M09A 3KXMA 3EQFA 3EFJA 4FIJA 4FKQA 4Y83A 2BKKA 3VS7A 4FV7A 4NL0A 2A1AB 1PXNA 3E7VA 4QMOA 2YCFA 5AM6A 3RI1A 2B9FA 2WKMA 1OL7A 1WMKA 2UZDA 1OUYA 1YKRA 2W99B 3NWWA 4UXLA 3SVVA 3GCSA 4AGWA 4FG8A 4EK5A 4DH5A 4TZRA 4FICA 4D2RA 2GFCA 3OCGA 3QD3A 2JBOA 2R0UA 5BVWA 4X3FA 4FV4A 4BCKA 2CLXA 2UUEA 1OUKA 4U41A 4FIGA 4QNAA 4TXCA 3A7IA 3HNGA 3MB6A 5A3XA 3RNYA 5CEQA 3H9OA 4L3LA 4MH7A 1XBCA 4NCTA 5H2UA 5LMKA 2IZSA 5ANEA 3PY3A 3ZS5A 2QOQA 2XA4A 4FVQA 3JR1A 4QT1A 3GENA 4YC8A 3H10A 3PA4A 1ZY5A 3TZ9A 2UW8A 2VTRA 1U5RA 2Z7LA 4YZNA 1WAKA 2RFNA 3LCDA 5IEVA 2XRUA 2WO6A 5CZIA 4RIXA 4ENXA 4F63A 2I0HA 3LFDA 3E64A 2PZRA 2VTLA 4BCFA 5C01A 3LXKA 5CVHA 4K33A 3G0FA 5CU2A 4ACDA 3TUCA 1BKXA 4IANA 2BFYA 4UX9A 4H3PA 3NVKI 3KEXA 3ALOA 2YA9A 5IA5A 4BGQA 1R0EA 3PP0A 2G01A 1JKTA 3AC8A 5CSWA 3RCJA 1Q61A 2UZNA 5EM8A 4F6SA 3KN6A 3I81A 4HCTA 4O6LA 3VUIA 4HVHA 5A4TA 5IZFA 4J1RA 2ONLA 3CTHA 4UMQA 4R7HA 4B8MA 4C4HA 5K3YA 4O2ZA 2HELA 1IAHA 2OJ9A 1JAMA 4GIIA 4E7WA 3QUDA 2F2CB 4MHAA 4AOJA 3Q4ZA 3VW6A 4ANMA 2BHHA 4FSTA 1B6CB 4FBXA 4IX6A 3FI3A 3LPBA 3E87A 5B0XA 3PVUA 5IH4A 2G9XA 3U8WA 4X2KA 4NM7A 4BIDA 5LMBA 2UW3A 1KOBA 3GCVA 3QQGA 4EOSA 4QMTA 4AZVA 4C8BA 3UYSA 2VWWA 3LCTA 3HVCA 4AZFA 1RDQE 3OROA 5LOHA 2FUMA 3QRIA 1LPUA 3UQCA 1UNHA 5EHLA 3FXXA 1PXJA 5LMAA 3B2WA 2PVRA 4BTKA 5DHJA 5EH0A 3LJ0A 2VZ6A 3Q9WA 4IVBA 3ULIA 3DBFA 4DF3A 2WTWA 3CD3A 1PYEA 4FTKA 3WOWA 2FB8A 4EOPA 3TKIA 4UY9A 1L8TA 3RHKA 1UKHA 2QOIA 2WTCA 3UZTA 2R3MA 2VO0A 1M7QA 2X39A 3OHTA 4Q5HA 4UV0A 4CD0A 5E8UA 4DHFA 3MESA 3A7FA 4RC2A 3CJFA 5AMNA 2PSQA 4RIWA 2VTNA 1HOWA 2W5HA 3R1QA 3M2WA 4L43A 3KFAA 5DOSA 5LVLA 1R3CA 2PVYA 2O64A 2QVSE 5AWMA 4EONA 3I1AA 3COMA 3F7ZA 3OXIA 3TN8A 3WIGA 2ZV9A 4IZAA 4HOKA 2CN8A 4TYJA 2B54A 3G6GA 4DEGA 2CNQA 4FV6A 5ETAA 3RJCA 3UVPA 2C5VA 3JY0A 4ANBA 4BIBA 4RZVA 4EHVA 2XEYA 3E92A 1XH7A 2RKUA 4X6QC 4QQTA 4C58A 2XF0A 5L4QA 3EKKA 4IM2A 1FPUA 3PSDA 5E8SA 4PP7A 2WMAA 3KRJA 3PY0A 4YJQA 2C5YA 4E4XA 4DYMA 4IM3A 4MQ2A 5L6WL 2PVFA 2XJ0A 4CTCA 2HZ4A 2X2KA 5JK3A 3G33A 3OTUA 5CASA 5T6KA 1DAYA 2O63A 4U3ZA 3RTPA 3DNEA 3VHEA 4AZTA 5M4UA 5HCXA 2UZLA 4NTSA 3FZ1A 2X8EA 3RK9A 1YHVA 4YSMA 5AP6A 3KL8A 1E9HA 4R6VA 3DT1A 4M97A 2VD5A 4OTFA 3PUPA 4ZOGA 4O7VA 5C4KA 4B9DA 4RVTA 4MF1A 4L52A 4LV5A 4OW8A 3V8WA 3G15A 4KBKA 5EM6A 1ZRZA 4X6RA 3EL7A 2GNHA 3ZBFA 2FH9A 2JDSA 5CXHA 4AW1A 4K18A 1A9UA 3KMMA 2VTAA 5KZIA 4BN1A 3VF8A 3W8QA 4CV9A 5LVOA 3D7ZA 4RA4A 3FZOA 3IPHA 4L01A 4RG0A 1WBWA 3AOXA 4YJUA 2DS1A 5FWKK 1K2PA 3HDNA 2CKQA 3PE1A 4PL4A 5FQDC 2B55A 5ACKA 3FBVA 3ZYAA 4X0MA 1J91A 2W1EA 3AG9A 3AGMA 4GFGA 1XKKA 4ARKA 1W84A 3Q04A 4I0RA 2R4BA 1UV5A 3GT8A 4JJRA 4UWBA 5I9VA 4CT2A 5I3RA 1ZY4A 3RK5A 5KCVA 1PXPA 3PVBA 4FTUA 3ZM9A 3DBCA 1ZAOA 4QP7A 4GYIA 3FLSA 5ANJA 2BRMA 2B4SB 3P86A 2RL5A 3IONA 3EQBA 4ZTQA 3VUKA 1IAJA 3ORKA 4YPSA 1OIQA 3K5UA 3RM6A 3ANRA 4F7SA 2PK9A 4RLLA 2YM4A 4KIKA 3Q2JA 4F1OA 3R04A 4MD9E 1UKIA 2Z7QA 2B52A 4XYFA 5KE0A 3SAYA 1OBGA 4MBLA 3L8VA 3QAME 4MNEA 5AR8A 4AW5A 4ZS0A 3SKCA 3TG1A 2QODA 3VS4A 1UWJA 2GS2A 2WEIA 1JSTA 3UODA 5CSHA 5C8KA 2WQMA 4UWYA 3V5QA 4NJDA 4O22A 3VS6A 1IA8A 4JBVA 3CCNA 2PUIA 1H4LA 4BB4A 3QHWA 1OKYA 4O21A 5M44A 2V7AA 2PMOX 4BZDA 3CKXA 3F82A 4FKIA 4K6ZA 4C2VA 2F7ZE 2X7GA 3WARA 3EH9A 2X8IA 4I0TA 4F0GA 3QCQA 3C0GA 3NYVA 3E8CA 4KWPA 2ITOA 5JFSA 4QOXA 5GZAA 3NMUF 1JVPP 1F0QA 2F57A 4XV1A 3FLWA 3U87A 1A48A 2ZAZA 4AN2A 4O82A 5K5NA 4PNIA 4F6WA 3UOJA 3P08A 2R7IA 4EOIA 2XVDA 3FDNA 4CNHA 4XLVA 2A2AA 2XNPA 3QD4A 4D1XA 4KRDA 1BLXA 3DTCA 4EI4A 4PP9A 4M67A 2BILB 3G9NA 3JPVA 4ZP5A 4AE6A 4ZLOA 1OECA 3OS3A 4FTNA 4FUXA 5CVGA 1LR4A 2UW6A 5M53A 2WEVA 3KC3A 1OITA 3WZJA 4GK4A 4JG8A 3PFQA 4FV2A 3RPVA 3EMGA 1F3MC 2JDOA 1BL6A 2PE1A 1RQQA 2QOCA 4L3JA 4M3QA 5ANDA 5DT0A 2BHEA 3UOLA 4HW7A 3VVHA 2WPAA 4I3ZA 4RJ7A 1XJDA 5AAFA 5KX8A 2WMRA 3UMWA 2W96B 1P4FA 3IW8A 2EXEA 4JQ7A 5JH6A 2JFMA 3FZPA 2WHBA 3D7TA 4CYJA 4IBMA 2X7FA 3WF6A 4PX6A 4BDIA 4ZTHA 4YMJA 3K2LA 4JR7A 3KK9A 4F0FA 5CAQA 4R5YA 3R28A 5L6PA 3NCZA 3WIKA 2HAKA 2UZBA 3OCTA 3VS0A 4DFUA 5DIAA 5I0BA 4CV8A 2V0DA 2CDZA 1Q5KA 2G2HA 1CM8A 3C4XA 3EQHA 3FQHA 1RW8A 3QUPA 4FT0A 4GG5A 2W1FA 4KIPA 1NW1A 4GK3A 4U42A 5IISA 4QPSA 1FVRA 2OIBA 4U45A 4H1MA 3BCEA 4NH1A 3WYYA 3P4KA 1ZMUA 4A07A 4RA5A 5L8JA 4CXAA 2LAVA 2J2IB 1H28A 4EK8A 4RVLA 3THBA 2P2IA 4ZZMA 4J97A 5CVFA 5E90A 4WO5A 2JFLA 3U4UA 3QTRA 4C62A 2PVKA 5IQCA 3S0OA 2W17A 5AV2A 4C3RA 3MH1A 3SXFA 3AD6A 5IUGA 4G3DA 5HEZA 4LYNA 3HA6A 3ROCA 3EHAA 3QD0A 4W9XA 2QO7A 2QU5A 4CFWA 4ZSAA 5HNGA 2Z7RA 4TRLA 4U8ZA 4EUTA 4Z55A 3ZONA 5GNKA 2ZJWA 1H07A 4FZAB 4TWNA 2C6KA 3PPKA 2ZB1A 5IQEA 3OUNB 3QC4A 4BDBA 3VUMA 3DCVA 1GIIA 2ZM4A 5HNBA 2OU7A 4LOOA 4MWHA 4D4RA 4DH3A 4TL0A 4E4MA 2V62A 3MTLA 3JVRA 3E93A 4RIXB 4PDYA 5BNJA 4DLJA 2HXQA 2QU6A 3QALE 4FMQA 3HUCA 4LOQA 2CHLA 3CPCA 3PJ2A 4FKWA 2IO6A 2JKKA 4IEBA 4JIAA 4YJNA 5K0XA 5HKMA 3AC2A 3Q3BA 4IX3A 2J7TA 5L2QA 3DNDA 3LM5A 3FKNA 3HAMA 3HRCA 3RALA 5IA4A 4EKKA 4DN5A 5EI8A 4N6YA 4G16A 3FE3A 3BHHA 3RM7A 2HW7A 3WZDA 1JSUA 4UEUA 4CRSA 4ZK5A 5EYDA 4APPA 2BZIB 4BBFA 3S00A 3R02A 4TY1A 2XNOA 3FLYA 5HTIA 4EH2A 3VO3A 4E73A 4E6CA 4YNEA 1YXTA 2VTOA 4DH7A 4GG7A 3TT0A 5EQEA 2XIKA 4D0WA 3UVRA 5A54A 1O9UA 1J3HA 3IDPA 2ZM3A 5IDNA 3D5UA 4NKAA 3Q4UA 4S32A 5J7BA 2F7XE 5I5ZA 4YBJA 2PTKA 2YABA 4Z3VA 5IG1A 4M15A 4IFGA 2Y4IC 1ZYCA 3LFBA 4I93A 3ZO1A 4E4LA 4YC6A 1TKIA 5H8BA 4MYGA 4RVMA 4AN3A 3UVQA 4AGCA 1WBOA 1XH6A 2HW6A 4AT5A 3PA3A 2FVDA 4IVCA 4E3CA 4NIFA 3NDMA 4RC4A 5B2LA 4MQ1A 2WQOA 3A2CA 4CT1A 3CIKA 4IXPA 4IE9A 2CGXA 2F4JA 4QP4A 2WQEA 2YWPA 1KUTA 5GJFA 3QQKA 4Z9LA 3PXFA 4BCMA 4OUCA 4DC2A 4I6HA 1YXVA 3II5A 3SRVA 4D1SA 1OBDA 3I5NA 1NVQA 3LAUA 3FZRA 3IS5A 5CY3A 1OVEA 5ITAA 1M7NA 4JDHA 4ANLA 2OJFE 2YN8A 4BHZA 3ZM4A 1R1WA 2X6EA 3MIAA 3AD4A 4G1WA 3PPJA 2R3HA 4AA0A 4DEHA 3TACA 2P4IA 5IMEA 3G6HA 2R3GA 1UWHA 2BAJA 3CY3A 3V5LA 4QP3A 2BIKB 2XNEA 3F6XA 5GIPE 5AA8A 3CS9A 4KKGA 4BHNA 5C4LA 3OWPA 3BQCA 4NT4A 4OBPA 4U79A 1CKJA 4YLLA 3UO6A 3R9RA 3MVMA 3RINA 3LMIA 4IAYA 4BCIA 3TM0A 3R7GA 3KCKA 1YXXA 2GNFA 5HGIA 3ETAA 5CNNA 2G2FA 3GEQA 5LQFA 3MV5A 3KMWA 4D2TA 3PG1A 4TPTA 5HO8A 1H25A 2H34A 2YWVA 4FKOA 4TW9A 4EL9A 1CTPE 3I60A 3N4VA 5A46A 3NW7A 4ITHA 1URCA 3VAPA 1AQ1A 4UBAA 4TKSA 4EJNA 3DV3A 4QTAA 3QL8A 5KMIA 2IZTA 3NUUA 1O6KA 5JGDA 1LEZA 5HG5A 4ZTMA 4E4NA 4NJ3A 1ZYSA 2BRGA 2QI8A 3NNVA 1YOMA 4A06A 1OB3A 2J0LA 2W1HA 5J9ZA 5DR9A 3TUDA 4QMXA 4R1YA 4B8LA 4RX9A 5BX0A 5HQ0A 1YWNA 3DB8A 4W8DA 2X1NA 4AE9A 1QPEA 5J1VA 5KHXA 4FZFB 3I79A 3REPA 3FKLA 1NVRA 4U80A 4D1ZA 4QMQA 1JKKA 1PMEA 1WBVA 4JBOA 3BHTA 2ZMDA 4O2PA 1SVEA 4OAVB 1YOLA 1UNGA 4HVDA 3ZSIA 4TYHB 5BPYA 1Q8UA 3E63A 2WMVA 3RPRA 3KA0A 3R00A 1FVTA 5LJJA 4X2GA 2C5OA 4QMSA 2XIRA 5L2IA 2EVAA 3NW6A 3U6IA 2I7QA 1PKGA 5EDPA 5JFVA 2VWXA 3Q4CA 4IAFA 3CP9A 4IC8A 5EQYA 2BAQA 4WKQA 1WVXA 3R7EA 3DLSA 2FYSA 4G2FA 2B53A 5ANGA 4D2WA 2CGWA 5LVPA 4UB7A 3V5JA 3IOKA 2F2UA 1URWA 4M69A 5CQWA 4AOIA 4D2SA 2XM8A 3BE9A 4WNPA 4GT3A 4AGDA 4EWQA 5JSMA 4MNEB 4RC3A 3QLFA 1Q3DA 5CAVA 3PLAE 1IEPA 4D0XA 3RAIA 4EHEA 5HBJA 5CSVA 4G9RA 5DR6A 2OGVA 5HORA 2CCIA 2Q0NA 2VV9A 2XKFA 1GZNA 4LGGA 3T9IA 3H0ZA 4IJPA 4R7BA 3RCDA 4FZ7A 1WBPA 4FKPA 4GJ2A 4DH1A 4TT7A 2NNWB 3L9PA 4FV9A 4BI1A 4XHKB 3D94A 3FUPA 3LZBA 5AUVA 1WBTA 5C1QB 3UOHA 4M8TA 3BPRA 5CF5A 2C0TA 1KOAA 4A9TA 1FOTA 4DGLC 3CPBA 4Y5QA 2C5XA 1PW2A 5HIBA 3QD2B 4DITA 2RF9A 3O23A 4C36A 3FWQA 4FKUA 3KULB 1KE9A 2OXDA 3R7IA 5ETCA 3ET7A 4GFOA 4JT3A 4ZSJA 4AA4A 4O7TA 1XQZA 4F9AA 2PMIA 5IA1A 2BDJA 4BY9E 5DE2A 1J7UA 4PL5A 2C4GA 4XOZA 3NUNA 3BGZA 3KF7A 1J7LA 3KXHA 2W1DA 3LCSA 2QR7A 4M0ZA 3O7LD 3KB7A 5DG5A 1O6LA 2W5AA 2XUUA 4PMPA 5C26A 3DDQA 2GHLA 4EOOA 3EJ1A 2QG7A 4QPAA 5HVJA 3QRTA 5E8TA 3D7TB 2HYYA 2R3PA 3RNIA 4HGSA 3KKVA 3QWKA 2C30A 4U0IA 3VUTA 4CFVA 5BVDA 4BWXA 4L42A 3TDVA 5BYLA 3C50A 4LRKA 3UC3A 4BCOA 2PPQA 2XK6A 4EZ3A 1J1CA 3V6RA 2ITVA 4Y5HA 2WGJA 3Q32A 4CLIA 1Q8WA 2B9JA 3MBLA 1WBSA 2W9FB 4UMTA 4B99A 4E6DA 3DA6A 3CJGA 3BHUA 3SQQA 4PPBA 5EQPA 3NUXA 3TXOA 4YHJA 4YR8A 3DK3A 2XIXA 1MRYA 3P1AA 4YJPA 1FMKA 4QMZA 2Z02A 4AQCA 4FZ6A 2YDIA 2YISA 2B7AA 1NXKA 2XM9A 1YXUA 3AC1A 3BLRA 3QWJA 4D58A 3N9XA 5CT7A 4QP1A 1PXIA 3MH2A 3EL8A 4AFEA 1BI7A 2C6DA 5C9CA 4FA2A 2YM6A 4OTWA 5ANOA 4O84A 2BZJA 3V8TA 3EN5A 4R3PA 3EN6A 3DOGA 2JKMA 4FR4A 5LCJA 1I09A 5FEDA 1ZARA 3W32A 3TZ8A 3P9JA 4DT9A 4HZSA 1OPKA 2GQRA 4F7LA 3W2OA 4QRCA 5CT0A 1R39A 3NRMA 5AM7A 5FBNC 4YZMA 4AZEA 2E9NA 5AADA 3PDTA 2EWAA 4S34A 4RQVA 3U4WA 4JDKA 5KNJA 5AUYA 2VNWA 4QMMA 2BVAA 3VUHA 4XS2A 3LHJA 2VWIA 4QYEA 1REKA 4EK3A 2VO3A 3RWQA 3ITZA 5AX9A 4MXOA 4EZ7A 2RFSA 4OTDA 4XV3A 2VUWA 2J0JA 3A4OX 3PJ1A 1GZOA 5T3QA 3RPOA 3ZZWA 3R71A 2WD1A 4XLIA 4GL9A 3GOKA 5DN3A 2GHGA 5FUTA 3C4FA 4O7ZA 4I24A 3NX8A 5IPJA 2VTPA 4GT5A 3ZEWA 3T8OA 2XIZA 3NYOA 4F1TA 3D5WA 4K9YA 2O65A 2RGPA 3TTIA 1G8SA 5JRQA 4JG6A 3CY2A 1MQ4A 4JLCA 4DCAA 2P0CA 4J53A 5C8MA 1PKDA 4BBEA 4L6QA 1TQIA 2QOLA 4CQGA 3BE2A 1K3AA 1OPJA 2W4JA 3FI2A 3MFUA 5DWRA 1V0BA 3UYTA 2VTJA 4XV2A 5D7AA 5HE0A 3O96A 4YSJA 1NA7A 1PF8A 2YM5A 2XKEA 5CTPA 3HMOA 5EW9A 5BVKA 2X0GA 1JKLA 1OMWA 3GC0A 4IADA 4KSPA 4MEDA 5DLSA 3QX2A 3SLSA 3PIYA 3PE2A 2OJJA 3ORLA 4QYHA 4FTIA 3GXLA 3ZO4A 1V0OA 4RJ5A 3TV6A 5JGBA 4MK0A 4DFNA 4FYOA 4HYUA 1Z57A 4ZEGA 3R8VA 2R3LA 2GQSA 4B6LA 2UZVA 3ERKA 2I40A 4FIFA 4I6QA 4JNWA 2YZAA 3BBWA 1R78A 3K5VA 3Q53A 4BDAA 4YP8A 4TWPA 3DKOA 3O7LB 4EYJA 3IO7A 4WSYA 3NLBA 4BTFA 5CF6A 2I1MA 3FZSA 3CSVA 4HGTA 5DNRA 5K5XA 4IMYA 5FXSA 4O7WA 1MUOA 1P4OA 4JRVA 4O81A 5CU0A 2IVUA 5HX8A 1IA9A 2IW8A 4JG7A 5FDPA 2PZIA 2QHNA 2WTVA 3F5UA 3FY0A 2UZUE 4EZ5A 3D14A 5D12A 2CGUA 5DBXA 3RBWA 3NEWA 1OL1A 2ZB0A 3OP5A 2GS6A 4Y95A 4BZOA 4ZJVA 1ZYDA 4BCJA 3SV0A 2ZDTA 3Q9ZA 3DU8A 2YZLA 2VWYA 1SM2A 4L00A 4GRBA 4JQEA 3SDJA 5E8VA 3U6JA 4I5PA 5LWNA 4U97A 1Q99A 3SG9A 3GCQA 5A4QA 3GVUA 4U43A 3ENHA 3EQRA 4V05A 1LP4A 2PMNX 3LQ8A 1G3NA 3Q52A 3HV4A 5D1JA 4H05A 4IIRA 4O0VA 3ZCLA 4RWJA 2J5FA 3KXNA 4AGUA 4BGGA 3O51A 1TQMA 1YQJA 2Y6OA 5HO6A 1Y6BA 4FTJA 1GOLA 2WMBA 3LM0A 2C6EA 5I3OA 4BYJA 4JDIA 4ACGA 4EH3A 2V22A 2R3KA 5DPVA 3CXWA 3QTQA 5EW8A 5GJDA 2JKQA 4QTBA 5TE0A 5J5SA 5D41A 2UVXA 3ZMMA 1K9AA 4HGEA 1BMKA 3GU4A 4O0SA 5KBQA 3BWJA 1T45A 3Q9YA 5K0KA 3HDMA 3AT3A 1CKPA 1KE5A 3CE3A 4AOTA 1YDSE 5IH6A 4RQKA 3UO5A 4RFYA 3BV2A 1ZZ2A 3CD8A 4O38A 1UU9A 3EFWA 4YLKA 4YTIA 2UW7A 3F3WA 4WHZA 4CFMA 5IQFA 2C47A 3DPKA 1YHSA 4OTPA 3QKKA 3I5ZA 4F9CA 4CEGA 4XUFA 3OVVA 1LEWA 4MD7E 3TIYA 4JBPA 2AYPA 2X2MA 5DT3A 1H27A 3G2FA 3OEZA 2GFSA 4CVAA 3HV3A 4CMOA 4C33A 3VQHA 4HVSA 5C27A 3RP9A 1QCFA 4YUQA 4JXFA 5F9EA 3ZUUA 4O1OA 2R7BA 4DGOA 5E8XA 4FT9A 5AP7A 3RVGA 4MVFA 4BKYA 5I9YA 5IF1A 1SMHA 2WB8A 5EFQA 5FP5A 3POZA 2EB3A 4FEXA 4QP6A 4C0TA 3GUBA 1PXMA 3BKBA 4RIYA 4W4XA 2WU7A 4FYNA 2OH4A 4TYGA 1Z9XA 2J0KA 4EK4A 3EYHA 5JZJA 4IB0A 4PUZA 1OGUA 1DS5A 3ROYA 3IK3A 4X2NA 2GNGA 4WSQA 1P2AA 3ALNA 3HGKA 3L9MA 3RPYA 2QOFA 1AD5A 4NW5A 5E1EA 3OXZA 4PNKA 2WIPA 4HPTE 4ASZA 3BQRA 4RRVA 3E88A 3OBJA 3DAJA 1ZYJA 3QKLA 4YZCA 5IDPA 2AUHA 3OD6X 4M66A 3BX5A 2OJGA 4I20A 4IM0A 4BYIA 2B9HA 3MPAA 3PSCA 4J71A 1PY5A 5CWZA 3FI8A 2J5EA 5KMMA 4RT7A 2WMQA 1CMKE 2PVJA 3WF5A 3T3UA 4PPCA 2YFXA 3QKMA 1OKVA 1X8BA 5CSPA 5JQ8A 2IN6A 3CC6A 4HYHA 4XBUA 3TKUA 2XEZA 2OXYA 2QC6A 1CSNA 2Y8OA 4E5AX 3VNTA 4L67A 2GQGA 3TL8A 2I0VA 2W1CA 4AP7A 2P33A 3MW1A 3FQEA 2G15A 3S2PA 3ATTA 5EOLA 3VS2A 4HVIA 5A6OA 3CR0A 5I9UA 5IQIA 4K11A 3R83A 4OT6A 2JAMA 4NSTA 2OBJA 4QNYA 4EQCA 4XG9A 1Y91A 4PV0A 3E5AA 5J9YA 4N57A 2R3JA 2GSFA 1S9JA 4XG2A 4DTAA 5HLPA 4ZSEA 3R8ZA 4KINA 3BLQA 5E8YA 4EUUA 5KHWA 4EJ7A 5A4CA 4FSMA 1Q8ZA 1JBPE 4NKSA 4IDVA 4O0WA 5AAGA 3UG2A 3EFLA 3O8TA 2CKEA 1ZLTA 3DKGA 4W4VA 3V5TA 3ZRMA 3FZTA 4PQNA 3B8QA 4ZJJA 4W8EA 3JUHA 3KU2A 4O7NA 4W4WA 1Q62A 4U3YA 5CZHA 3VBXA 4NYEA 4EKLA 2XRWA 4YPDA 3BGPA 1XH9A 4TYEA 4R77A 3G9LX 4G3EA 3EQPA 3FEGA 3FQSA 4YU2A 3VS3A 4YJOA 4YC3A 2Y4PA 4BICA 5JEBA 2GDOA 2YLEA 3E3BX 3ANQA 2ETKA 4Y73A 4ZXTA 2JGZA 3ZO3A 2J9MA 3UNZA 3M11A 3UOKA 1RE8A 3IW7A 3FPQA 4H36A 3IW4A 1M2PA 2Y9QA 3BEAA 4QQCA 3ATSA 3HMIA 4R3CA 5E8ZA 5JFWA 3SOCA 5L2TA 2ACXA 4FSNA 4XG7A 4ACMA 5HO7A 4FV0A 3WZEA 1XH8A 3OBGA 2P2HA 4KS7A 3GQIA 4AN9A 3KXXA 4DT8A 3A7GA 4UXQA 4AFJA 5EHYA 3M42A 3MY1A 2XBAA 2FSOX 3NNWA 3QZIA 4FKRA 1ZOGA 2RG6A 1GNGA 2JLDA 2W5BA 4FVPA 5C8NA 4QTCA 2QHMA 2QKRA 1KE6A 3NUSA 3NUYA 3W2PA 1H8FA 4EH9A 4OT5A 5J8IA 3GOPA 2UZTA 5HLWA 4C34A 1OM1A 3QF9A 4BDGA 4FT3A 5LWMA 4O7LA 2BTSA 5M55A 5DT4A 3HP2A 2CJMA 1NT2A 5BQ0A 3AC5A 3LE6A 4P5QA 4DFBA 3A7JA 1H1SA 3R7UA 2A4LA 2PYWA 3P78A 2X2LA 1LUFA 5TOZA 3SG8A 4ASEA 5IA0A 3L1SA 4EOMA 3EOCA 3PWYA 3BU3A 4Z7GA 3PVGA 1KE8A 1FQ1B 4FTTA 4EQMA 3D5VA 1H1WA 3TNWA 5A4EA 3Q4TA 4H58A 4Q2AA 3SW7A 2DWBA 4RJ6A 2ETRA 5J79A 4ZZOA 5IKWA 5LVMA 1Q97A 3LQ5A 4BDCA 2DUVA 5JQ5A 4X3FB 4KBAA 4QTEA 5EDRA 3UTOA 4RJ8A 3D5XA 1W98A 4FV3A 4C35A 1HCKA 3MVJA 4FZDB 2FSTX 3CKWA 3R7VA 3TNIA 3JS2A 2XCKA 5BYZA 4F6UA 3KN5A 3UGCA 3BELA 2ZVAA 2UW9A 3R2YA 5AV0A 3VUGA 4E5BA 2O3PA 4E5WA 5AUTA 3PIXA 4HCVA 3LJ1A 5JKGA 4FSYA 4DG2E 3F2RA 3QLGA 2QOBA 3P23A 3BBTB 5AUZA 4E6AA 5I4NA 4UYAA 3TJCA 2W7XA 4CFUA 3ZC5A 5J1WA 5BUIA 2WMWA 2ZMCA 3QTIA 2BALA 4MBIA 4ENYA 4YTFA 1IASA 1CKIA 4G17A 4O0TA 3V5WA 4MBJA 2AC5A 5KZ0A 3G51A 3PLSA 3GU7A 2OH0E 1JOWB 1JPAA 4Q5EA 4CMTA 3ZO2A 3PJCA 3FC2A 5K9IA 3EQGA 1ZOEA 3RAHA 3EN7A 3W2CA 5KMNA 4ZSGA 1QPCA 4EHGA 2IZRA 4D2VA 5DA3A 2HENA 5AAEA 4ZY6A 4Y72A 5BVOA 1IG1A 3LXLA 4AW0A 1Y8GA 4AS0A 4XP0A 4TYIA 3WF7A 5HTCA 3Q96A 3G90X 3VULA 5HCYA 4CFFA 4OAUC 3FHRA 4A9SA 4ZY4A 1ERKA 2IW6A 1Q3WA 4JI9A 3UDBA 3ZDIA 4BDEA 2YIYA 4DTKA 5ETIA 5CEMA 3GC7A 4FSWA 5F20A 3GU5A 4YNOA 4ZTRA 3OOGA 4WBOA 2I0EA 2W0JA 1YI3A 1E1XA 1ZWSA 1FINA 4L7FA 4C4IA 5KKRB 3FC1X 2A19B 3KREA 2JBPA 4ANOA 4BR3A 2BRHA 2I0YA 2ERKA 4FVRA 4YJVA 3EN4A 1YW2A 4PTEA 2ZOQA 3SA0A 1W8CA 5IQDA 3HUBA 3P7CA 3W1FA 3PZEA 2VN9A 3DBDA 5F95A 5A9UA 4F9WA 2R3RA 3BYMA 4XV9A 2O8YA 5TO8A 4ZZNA 1PMNA 3CTJA 3U54A 4CZUA 4BZNA 5EYMA 2RG5A 3LLTA 5IH5A 5AA9A 3EN9A 3LLAA 2HXLA 2GMXA 3F3UA 3W8LA 3R8PA 4DFYA 3UBDA 3SHEA 4XP2A 5FDXA 2Y0AA 4BKZA 4RIWB 4PF4A 3I0QA 5AJQA 3WI6A 3S1HA 4ACCA 5BVFA 4O0RA 2UW5A 3RZBA 3S3IA 3EZVA 4FE2A 5KMKA 1B38A 3PRFA 4WNMA 5TR6A 5AP3A 3A8WA 3C5IA 2O5KA 3HV7A 2VTMA 4R7IA 4LL0A 4CFXA 4S30A 3C4CA 2EXCX 2XK9A 5A14A 3U6HA 1E1VA 1YRPA 2ESMA 3PJ8A 3U51A 5L8KA 3VRZA 4G9CA 3LFNA 3NNXA 5AX3A 4QMWA 2OW3A 4I1ZA 3T9TA 5IQHA 5AUWA 4B0GA 4BI0A 4E1ZA 3O2MA 4DGMA 3EKNA 4EBWA 1APME 4QYYA 2VRXA 2JKOA 4J99A 4TTHB 5CQUA 4DGGA 1XHAA 4UN0C 3UE4A 1XH4A 5JFXA 4A4LA 4BL1A 1OL6A 4G6OA 2WQNA 3QTSA 4F99A 2OIQA 3EB0A 4KRCA 4JRNA 2CN5A 2PWLA 3C51A 4G34A 3R6XA 5HVKA 3ACJA 3FAAA 4YHTA 4H1JA 1ATPE 5EI6A 1WBNA 3QYWA 1V0PA 5DFPA 4GYGA 4FG9A 4B4LA 1M2QA 4W4YA 3LFAA 1S9IA 1VZOA 4MXYA 5AIKA 5HD7A 1H26A 2UV2A 3E62A 4IW0A 3DZQA 4OTHA 3RAWA 4UMRA 3GU8A 4J8MA 2WTJA 4JR3A 4BTMA 3OUKA 3R2BA 3ORTA 1F5QA 1PMUA 2CMWA 1JNKA 1VR2A 5FM3A 2JIIA 4R1VA 3FMMA 3Q2MA 1J7IA 4FGBA 2YCQA 5HLNA 3DDPA 4FX3A 2XK3A 4FTQA 1YDTE 3OWKA 4FUYA 2J0MB 4Y8DA 4BI2A 4LMNA 4O0UA 5DEWA 5AR7A 3AGLA 4I22A 4ANSA 1NVSA 2C6LA 3IG7A 4IWDA 4P90A 1PXLA 4NW6A 3DS6A 3OW3A 1UA2A 3QXOA 4DEDA 4YO4A 3ORNA 5FEQA 3NGAA 3UMXA 4P2KA 4DG3E 2BAKA 3GFEA 2ITPA 4JVGA 4NCTC 1YI4A 5CEKA 5LMKC 3WZUA 3UG1A 3VBYA 3FLZA 4PL3A 3FMEA 2UW0A 3FXZA 2C6MA 3LCKA 4TWCA 4KD1A 4C57A 5DYJA 3TTJA 2GNJA 5CSXA 5FRIA 4XBRA 5FP6A 3AT2A 2WIHA 5AV3A 2WMTA 4KIKB 4WRSA 3C7QA 4BCGA 3ODZX 4NU1A 2J50A 2X8DA 3ZRLA 3TZMA 2OICA 3VBWA 2I6LA 4AWIA 2WNTA 2QLQA 2YDKA 3P7AA 3QZFA 3QTXA 3QZHA 3PXYA 4KA3A 3R73A 3P79A 3FL5A 5GIOE 1U59A 2JIVA 5FTGA 2P3GX 4FC0A 4H3QA 1PMVA 4XOYA 3G5DA 4FK3A 4WBBB 2PU8A 2G1TA 2VO7A 4R3RA 2ZDUA 3VC4A 2ONLC 3C4EA 4ZMEA 1AGWA 2OF4A 3O17A 4LMUA 3O8PA 4AAAA 1BX6A 5A4LA 4GUEA 2UZWE 4LFIA 2B9IA 3HL7A 4O6EA 4FEVA 3ORZA 5AP0A 5I9XA 2UVYA 2NP8A 3ZSHA 5L2SA 2OI4X 4GUBA 4NM0A 4RX8A 4J96A 2Z8CA 3AQVA 1Q8TA 1BI8A 2C68A 2WFYA 4GIHA 3OY3A 4BF2A 4PRJA 3U55A 4D4VA 1Y6AA 3SOAA 4S31A 4XG8A 5HG9A 3VQUA 4WNKA 3UPXA 2YIXA 2GNIA 3U9NA 4FGRA 3GC9A 5DMZA 4RVKA 3F5GA 4IAIA 4ZIMA 3TEIA 4ITJA 4ASXA 3SX9A 2PULA 1H08A 2OG8A 2WOTA 3GBZA 5EG3A 4XMOA 4BDHA 3QCXA 1XO2B 3UZPA 4O7RA 5EK7A 4G3CA 4DEBA 5IQAA 4XX9A 3RHXA 3L8SA 3L8XA 2BZHB 4FIIA 4NEUA 2BTRA 3S95A 4OTQA 3CGOA 4FI1A 2IVVA 5L3AA 3CBLA 5CALA 1B39A 3Q60A 1JWHA 2YIRA 3HRFA 4D4YA 4FKTA 3UJGA 3O8UA 2BDFA 4FNXA 5D7VA 2QOKA 5IA2A 2W1GA 4F64A 1M52A 3OT8A 5CI7A 2W1ZA 2ITQA 5EHOA 4OLIA 4N6ZA 3PZHA 1EH4A 1HCLA 2QO2A 3HYHA 5HG8A 4QMVA 4C4GA 3IDCA 4ZTSA 2J4ZA 4XRLA 1O6YA 2ETMA 1BUHA 1OKZA 5CAUA 5DVRA 2UW4A 4USDA 3ZFYA 2UZOA 4U9AA 3MH3A 4QD6A 1OL5A 2HOGA 1JQHA 4BGHA 4F4PA 3PXRA 3UNKA 4GKHA 3F3ZA 3RAKA 3SGCA 4QMNA 1YWRA 5AR2A 3NUPA 5K4JA 3PXZA 4EC9A 3I7BA 2V7OA 3COHA 3LCOA 4RBLA 2CKPA 4D5KA 4G6NA 4PDOA 1ZMWA 3FV8A 2EB2A 1Q41A 1FMOE 5CAPA 2PVHA 4UZDA 4EH8A 3MPMA 4K8AA 4N0SA 5CNOA 2B1PA 2VTHA 3IW6A 3QQHA 2XB7A 3V04A 3DZOA 4QPMA 2F7EE 3VS5A 4FT7A 2Y6MA 2XS0A 3BYSA 3OT3A 3TV4A 3BYVA 5E8WA 5FBOA 3UP2A 3FKOA 3B8RA 1XBBA 3EYGA 3H30A 4I6BA 4N70A 3GCUA 4ERWA 4JL9A 5K4IA 5M4CA 3QC9A 4RWLA 1GY3A 1DAWA 1R0PA 2OJIA 1Q8YA 4RMZA 3KQ7A 5CEIA 1YWVA 2GPHA 4E8AA 4ZJIA 4XG4A 4OTRA 4PPAA 3GB2A 3UQGA 2W4OA 5LXMA 1TQPA 2C3KA 4I4EA 4L3PA 3TNPC 4RLKA 4UWCA 3WYXA 3ORMA 4A4OA 2ITWA 4I0SA 3FMJA 3LFFA 4S33A 1KV2A 4YO6A 2X6DA 2R64A 4FKVA 4M12A 4ZMFA 2XNMA 4I5CA 5BYYA 1GJOA 4FSQA 4JDJA 1JLUE 3LOKA 4KIQA 5DGZA 5DR2A 3QQJA 3IOPA 4C3PA 2QOHA 2W05A 4WIHA 2QR8A 2C6TA 2OXXA 2CGVA 4J8NA 2XIYA 1MRUA 1FGIA 3PA5A 5HESA 5FXRA 4USEA 1V1KA 2XK4A 3ZRKA 3AC3A 4BRXA 4DAWA 1SVGA 3GP0A 4K77A 2NPQA 3FPMA 5LCKA 4ZTNA 4CKJA 1UU7A 4KNBA 1OL2A 5IA3A 1SNXA 2R3OA 3DKCA 3HP5A 3BRBA 3QQLA 5I9ZA 2SRCA 2ITXA 2GNLA 4HYIA 3EQIA 3D4QA 3EWHA 3FL4A 2V5QA 3F69A 1TVOA 2W1IA 3KVXA 3MY0A 4IZ5A 4KB8A 4BFMA 3PPZA 5EOBA 1KSWA 3JXWA 2O2UA 2OZAA 4QTDA 4QMUA 3R1YA 3I0OA 5HD4A 5CENA 5CX9A 4NIFB 2RIOA 4LV8A 4EOLA 2NO3A 5CU4A 4O1PA 4AF3A 3W16A 4ANQA 3O0GA 3RK7A 5HNIX 4LI5A 4AUAA 5ETFA 3E8NA 1M17A 4FOCA 2YEXA 4BCHA 3K54A 3WILA 3R1NA 4LRJA 5BUEA 5M07A 1WFCA 3AC4A 4CG8A 3MS9A 5AP5A 5HI2A 3SRVB 3COKA 4O86A 3R30A 1U46A 5EKOA 4K0YA 4EWHA 4DH8A 3IDBA 2XNGA 4KIOA 3GC8A 2QO9A 2H96A 3FMNA 2BDWA 4I94A 5D11A 4F08A 3TV7A 3NYNA 4FEQA 4AT4A 2QKWB 2VX0A 3O71A 4UALA 3AT4A 5FTQA 4UMPA 3GQLA 5AUUA 3FMLA 4KAOA 4AU8A 3RKBA 2VAGA 2QNJA 3Q5IA 3M1SA 4QP8A 4LG4A 4K2RA 4FKLA 3HKOA 4V01A 4AZSA 1SVHA 2YCSA 3KY2A 4OTIA 5FD2A 4EH6A 3FJQE 4QP2A 4IHPA 5KMLA 3I7CA 4KS8A 2J6MA 1ZZLA 1WVWA 4U5JA 4RX7A 2C3LA 1UNLA 2E2BA 4NWMA 2QG5A 4J7BA 4E6QA 5J7HA 4CCUA 4ERKA 2OSCA 3NS9A 1PYXA 3IW5A 5IEXA 2XP2A 3ODYX 5J9LA 4V0GA 2C69A 3R63A 4GV1A 2QURA 5JZNA 1H0WA 2YCRA 3SC1A 3OXTA 3PP1A 3I6UA 4IAKA 4IX5A 3VBQA 4DG0E 2C6OA 2BIYA 1OI9A 4FL3A 4FTOA 5CXZA 5HBEA 4QYFA 4BDJA 4CZTA 4F7JA 2B0QA 2KTYA 4I5MA 1L3RE 2X4FA 3CLYA 4FEUA 3R8LA 1W0XC 4D55A 1GAGA 1Y8YA 1ZOHA 2X81A 3LFCA 3A8XA 2FGIA 4I6FA 2NRUA 2DYLA 2ZYBA 3FSKA 3DBQA 4IWOA 3LXPA 3NYXA 4NM5A 4C02A 4E26A 3FLQA 4ALUA 4ZY5A 1MP8A 3NPCA 4U6RA 4EBVA 4MX9A 3L9LA 3DKFA 3ZHPC 5ANKA 4Z16A 5M51A 3ZXZA 5EDQA 4PTGA 2JEDA 3LIJA 1WCCA 3H4JA 3R22A 4C4JA 1IRKA 3BHYA 3OOMA 2OO8X 2BPMA 4EEVA 2CPKE 5IQBA 3F2AA 1ND4A 1VYWA 4LOPA 3SW4A 4OGRA 2YM7A 1XWSA 3NSZA 2PVLA 4G6LA 3RGFA 3D2IA 4IWQA 5FTOA 4MNFA 4CMUA 3LJ2A 1OIRA 2XJ2A 1ZMVA 4L53A 4U7ZA 5I9WA 3FMHA 3JYAA 3BWFA 3DXPA 1W7HA 2ITZA 2PE2A 2WMUA 4JS8A 3W33A 4YLJA 2CSNA 3KVWA 2OZOA 4EYMA 4Y85A 4BCQA 5M4IA 4IQ6A 4LRMA 3D9VA 1A06A 3KRRA 3NCGA 4ZAUA 3Q9XA 3VIDA 1H1QA 4DFXE 4ZLZA 4C4EA 1ZXEA 5AP2A 3MA3A 2QQ7A 4LL5A 4YZBA 4G5JA 4M69B 4NUSA 2RSVA 2VWBA 3HV5A 4HNFA 4IJ9A 3DB6A 3DQWA 3NAXA 4IX4A 2EXMA 3F5PA 3RWPA 4MXXA 3F5XA 3QTWA 3F88A 3EZRA 3C4WA 2OKRA 4G31A 3QCYA 4IB3A 3TNQB 3C5UA 2XJ1A 1G5SA 3FSFA 4I92A 4BC6A 4FKSA 2G2IA 4GK2A 4J52A 3A62A 2VNYA 2Q83A 5TF9A 1UU3A 3VBVA 2E9VA 4L68A 3WE8A 4F7NA 3TI1A 4F9YA 3OF0A 3B2TA 1SZMA 1U4DA 3ENMA 5GINE 3E3PA 4GH2A 3WZKA 2XH5A 1VEBA 4FTCA 2HY81 3PYYA 3MWUA 5CI6A 3WBLA 3DK7A 3DAKA 2P55A 3R7YA 3CQUA 1PRYA 1P14A 4WUAA 2C6IA 5CLPA 4IDTA 2ITUA 1H01A 2X4ZA 2X7OA 2PY3A 3AMBA 1XR1A 3DY7A 4FIEA 4JOAA 4Y46A 4EH7A 4EOKA 4DE4A 1PXKA 2CCHA 3ORIA 3TJDA 3HRBA 2IW9A 2F9GA 3DQXA 4G3FA 4IZYA 5E4HA 4CGAA 5JRSA 4TYHA 2YM3A 3FMDA 5L2WA 4R5SA 5CYIA 1P5EA 1XH5A 1Z5MA 4OTGA 4CFNA 3TNHA 4PY1A 2V55A 2VTQA 4WG5A 4YZDA 3WF8A 4EQUA 1GIHA 2XYUA 2EUFB 2C5NA 4LGDA 2BRBA 3QYZA 4RZWA 3VJOA 2JC6A 4QYGA 4L8MA 1PHKA 4D9TA 3R0TA 3HLLA 3UPZA 5JN2A 3PXQA 4IAAA 2XYNA 4YTHA 4MCVA 4EC8A 4IAZA 4MWIA 5J95A 3GI3A 2XCHA 5F94A 4FT5A 5KBRA 5FEEA 2C1BA 3AMAA 3ZUVA 2IPXA 4PDSA 4J95A 1YXSA 4PMMA 3RPSA 4IWPA 1JKSA 3W10A 4CRLA 5CEOA 4M0YA 4O7SA 2YIWA 2PL0A 3BU6A 3EQDA 3FHIA 3HMMA 4FTAA 4A9YA 4EOJA 2WTKB 2XKDA 3KF4A 5HE1A 3OMVA 3W2RA 4JX7A 4LGHA 2Y4IB 4GSBA 3V51A 2BCJA 2IZUA 2QOOA 2WMXA 2X9EA 3GCPA 4LUEA 1PJKA 5G6VA 3PG3A 4RSSA 4A4XA 4NFMA 5GHVA 5BMMA 2XBJA 3AXWA 4FV5A 4TNDA 3R9NA 3W18A 4GEOA 4XCUA 3SXRA 3ZEPA 1DM2A 1STCE 2JIUA 3LVPA 3C9WA 3ELJA 3TIZA 3TKHA 1M2RA 3LXNA 4O0XA 2BMCA 4UYNA 4L46A 4G5PA 2OFUA 2CLQA 4X21A 4AT3A 4H3BA 4CG9A 3OTVA 3MIYA 4FOBA 5EYCA 4C37A 5CU3A 5KMOA 1YHWA 4WG3A 5AEPA 3LKMA 4FODA 3KULA 2W06A 2Z7SA 4CYIA 1PXOA 4IH8A 5HG7A 4DFLA 3F66A 2VTIA 3BGQA 2VWVA 3MYGA 4IB5A 1H0VA 4FTLA 4YGAA 5HZNA 3R01A 4MD8E 2HY0A 4DA5A 3F9NA 3IQ7A 2R3IA 3I4BA 4BBMA 4FTRA 1KWPA 4JAIA 3KXGA 3UP7A 4F1MA 4C4FA 1UVRA 1GZKA 4XEYA 2BUJA 3WF9A 4BWPA 4FEWA 3T3VA 4IACA 2WXVA 3N4TA 3HZTA 2WAJA 3Q5ZA 5HX6A 4O83A 2VGOA 4V04A 3TDWA 3ACKA 3VJNA 3E8DA 2HWOA 5GZ9A 4NM3A 2F49A 2O0UA 2PZ5A 4RFMA 3RZFA 4TN6A 3H3CA 4GS6A 1KE7A 3PRIA 3VHKA 2QLUA 2WOUA 1QPDA 2YLFA 5HIDA 5B7VA 5HCZA 3OFMA 2RFDA 3QBNA 4KBCA 3ZUTA 1SYKA 3FI4A 4BDKA 2AC3A 4QQ5A 2WU6A 3OWJA 4FSUA 3POOA 5ICPA 2JDRA 3MY5A 4HCUA 3IECA 2H6DA 3MN3A 3KRWA 3QX4A 3MH0A 3BV3A 4C7TA 3UNJA 3CQWA 5DRBA 1OIYA 3HX4A 4ONAA 2KULA 4A9UA 3A60A 4DINA 4ASDA 3TWJA 5ACBC 5CANA 5ANIA 3FLNC 3LFSA 2VWUA 3QZGA 2BFXA 1XBAA 4BIEA 1GIJA 3UC4A 4BKJA 3QRKA 2VX3A 1OZ1A 2E9UA 4HYSA 3LFEA 3OCSA 3UIXA 5CF8A 3ZZEA 2JAVA 2X9FA 3FMKA 2XMYA 3D0EA 4P5ZA 3COIA 4CKIA 3ULZA 3VN9A 3KGAA 4AW2A 4F09A 5CEPA 5JGAA 3ORXA 2HCKA 2FSMX 3CGFA 4BTJA 3F7WA 1GZ8A 3BEGA 3ZBXA 4C59A 5F1ZA 2YAAA 4O96A 4HVGA 2NRYA 3MB7A 2ZV8A 3MFTA 2OZAB 5AR3A 2IVSA 3QCSA 1YI6A 3NZ0A 2FO0A 3NNUA 4BDDA 4JBQA 4Z7HA 5H3QA 3BI6A 5BVNA 4X2JA 4DGNA 3OW4A 4WG4A 3VF9A 2A27A 4N4SA 3TCPA 3QA8A 1WVYA 1U54A 3F2NA 3QXPA 3PSBA 2BRNA 2IJMA 3DK6A 2GHMA 4XG3A 3DTWA 4ACHA 4BVUA 4F9BA 3DJ7A 2YHVA 4K1BA 4M84A 4FNYA 5EI2A 4D9UA 5IU2A 4ORKA 3OC1A 5M57A 5DEYA 4P7EA 2BR1A 4MXAA 4CQEA 2YJSA 3DLZA 2BZKB 3MPTA 4X2FA 3QGWA 2HZ0A 4NZWB 4U44A 4YJRA 1YVJA 2C3IB 3ZLSA 4C38A 4II5A 5HVYA 4U40A 4L7SA 5E92A 1J1BA 4I23A 3BIZA 5GJGA 4DCEA 3H0YA 4NTTA 5EYKA 3L9NA 4L44A 3ZLXA 5AV4A 3R9HA 1OPLA 2Z60A 3C13A 3QQUA 4IFCA 3R8UA 3BYUA 2R9SA 1BYGA 3UO4A 3PWDA 3QGYA 4GMYA 2R3QA 2FSLX 2XKCA 3QHRA 3R7OA 3VRYA 2C0IA 4V0GB 1NY3A 2R3NA 3KRXA 3N4UA 3LFQA 2IWIA 3EFKA 3V8SA 4EH5A 3ZU7A 3QUEA 4JQ8A 2WTKC 4RFZA 1FGKA 3DJ5A 4I41A 2HWPA 2PVMA 2XK7A 3FYKX 3EIDA 2J51A 3NIEA 4USFA 2ITYA 3NAYA 3R9OA 4GKIA 3OG7A 4DEAA 2OF2A 3DXQA 2GU8A 5DI1A 3KK8A 1SNUA 2YERA 1H00A 3NIZA 2ZV7A 3O50A 3MJ2A 4HJOA 1Y57A 4QP9A 1DI9A 4WUNA 3MFRA 4JX3A 5EM5A 4MXZA 4L9IA 2BKZA 4E93A 2PE0A 4RPVA 4QMLA 5B2MA 5AFVA 3UQFA 2YITA 4YHFA 3Q6UA 3RMFA 3N51A 4FL1A 2ERZE 4FSRA 4KSQA 2ITNA 2PZPA 5L6OA 4YJTA 1YDRE 5M4FA 4DBXA 5D10A 1OIUA 2HZIA 4M68A 2QCSA 3UIMA 3HEGA 4IC7A 4IZ7A 2VGPA 5AR4A 5H8GA 3HECA 5C03A 3W55A 2Q0BA 3BU5A 1FVVA 2UVZA 2W9ZB 2HIWA 3OY1A 5AP4A 3NVMB 3OEFX 2VWZA 3FXWA 1M14A 4H39A 4EK6A 3IGGA 4FKJA 4HZRA 4GVJA 4PMSA 4RIOA 2YM8A 2C1AA 2YIQA 3CEKA 1QPJA 4FTMA 5KUPA 3R21A 1Q24A 4O7YA 4CLJA 3IGOA 3JVSA 3PJ3A 3QQFA 2RFEA 3ZFMA 3BZ3A 2GTMA 2VTTA 2E9PA 3GGFA 3PY1A 4KKHA 3DFCB 4RIYB 3BLHA 2PUNA 3QRJA 4S2ZA 1KV1A 3ZC6A 2Y7JA 3LW0A 3MGYA 4FSZA 3ZLYA 1IR3A 5LARA 5IUHA 5L8LA 4BCNA 4BWKA 2GS7A 3DBEA 3K3JA 3A61A 4A7CA 4CTBA 3A7HA 4PTCA 3ID6C 4ALVA 4XG6A 2H9VA 4PWNA 2OK1A 4NK9A 2WQBA 5AV1A 3D83A 3ZFXA 4D4SA 5HU9A 5HICA 3BHVA 3P0MA 3MVHA 4WD5A 2E9OA 2WTIA 3KMUA 3V6SA 4APCA 3NW5A 4X3FC 2JD5A 4I21A 3UZRA 5CU6A 2ZM1A 3HMNA 4I4FA 4EORA 2VX1A 4D2PA 4O27B 4XNEA 2W4KA 5A6NA 5H8EA 3ZTXA 2OFVA 3TZ7A
chains in the Genus database with same CATH superfamily
3VWAA 3E7OA 4PDPA 4AZWA 4F0IA 2CKOA 1G8AA 3C4ZA 5T68A 4ANNA 5JT2A 4DTBA 1H1RA 4ID7A 3VUDA 4ZTLA 4MTAA 5D9HA 3AD5A 3UIUA 1QL6A 1U5QA 4ALWA 5EM7A 4YURA 5IEYA 2OWBA 4RJ4A 4CCBA 4AXAA 3C0IA 3NUAA 5CS6A 2XK8A 3HAVA 4P4CA 3H9FA 5BVEA 4U81A 3IKAA 1H24A 3MFSA 5JMSA 4CSVA 2DQ7X 4X7QA 2C0OA 4GW8A 4E20A 5CAOA 4GVAA 4FK6A 4NFNA 2WELA 4Q9ZA 4IVDA 5TKDA 1DI8A 5IMXA 5HIEA 4IVAA 3F3VA 4X3JA 2XNNA 4XP3A 2YJRA 5HE2A 5M06A 3AMYA 3ZLWA 5M56A 2CNUA 2R2PA 4WRGA 4FKGA 3QTZA 3PTGA 4M7IA 3ZOSA 5EKNA 5FG8A 3ZDUA 4LM5A 3F61A 3DGKA 3JY9A 3NR9A 3W2QA 4QMYA 4KABA 2A0CX 4UMUA 3R1SA 2XZSA 2HK5A 3MSSA 4GFMA 3QA0A 5HBHA 3L8PA 4R8QA 5E1SA 2JDTA 3LMHA 5KKRC 4FG7A 4M14A 2PZYA 4M13A 3ORPA 3G0EA 2VU3A 3HV6A 4TWOA 5DRDA 3LQ3A 4RWKA 4LQMA 5TT7A 4BDFA 4W9WA 3ZH8A 2PVNA 3FYJX 1YOJA 4GT4A 3CQEA 3DXNA 5FXQA 3DFAA 5H9BA 2PHKA 4YBKA 4EH4A 2Z2WA 4KKEA 4C61A 2IG7A 3OWLA 4HGLA 2GTNA 4EOQA 4KUJA 3DJ6A 4QQJA 4MXCA 1MQBA 1QMZA 2VO6A 5HHWA 4B7TA 2XNBA 4YJSA 3C1XA 1VJYA 4ZS4A 3MJ1A 3W2SA 1RJBA 4G3GA 5J87A 2PUPA 3QRUA 3MTFA 2R0IA 5BUJA 2ITTA 5FLFA 3OZ6A 5HE3A 4PMTA 2OIDA 4CKRA 4HNIA 2FA2A 4O0YA 4AX8A 5HU3A 3V5PA 3FY2A 4JAJA 4R78A 2QD9A 1TFFA 3MA6A 5IQGA 1W82A 3GU6A 5B2KA 2LGCA 4OBQA 3EQCA 3D2KA 1W83A 3DAEA 5AR5A 3SD0A 5HTBA 5E91A 5BMSA 3QTUA 4RGJA 1VYZA 3KCFA 4ZSLA 5EW3A 2OLCA 2WMSA 5E7RA 3Q6WA 3F3TA 4GCJA 3PVWA 2WZJA 3I6WA 4AG8A 5F4NA 4Q9SA 4MKCA 4WOVA 5GZ8A 2J90A 2EU9A 5LVNA 4FNZA 5FGKA 3A4PA 2HZNA 4WNOA 5KO1A 2H8HA 3E8EA 1Q4LA 5IUIA 5J5TA 1WZYA 4RJ3A 4FL2A 4JIKA 2R5TA 3MVLA 2QONA 4RWIA 4F65A 3VBTA 4FV8A 4I5HA 4GJ3A 2UZEA 2VTSA 4A9RA 3HA8A 1REJA 4ZLYA 4DBNA 4FNWA 2YACA 4HPUE 2R3FA 1OKWA 2PMLX 3GNIB 3PIZA 3QFVA 2YDJA 4FIHA 5M08A 1I44A 4AACA 2JITA 2YAKA 4YTCA 1T46A 4ITIA 4DEEA 2IVTA 4YZ9A 4XJ0A 4GU6A 5AUXA 4FV1A 2CNVA 3LMGA 3C0HA 4BCPA 4D5HA 3HMPA 3K3IA 4MF0A 5AP1A 3MI9A 3BYOA 2WTDA 3QU0A 3ZSGA 2ZV2A 3VS1A 4EHZA 1FBNA 4DEIA 1BL7A 1UU8A 3MDYA 4GU9A 4WT6A 3OCBA 5HOAA 4O91A 4XRJA 1CDKA 4OBOA 3ZXTA 3V01A 1ZYLA 3A99A 3VW8A 3KXZA 3WE4A 4AA5A 4CZYB 4F70A 3PXKA 2REIA 4C2WA 4UZHA 5DH3A 1JSVA 4MAOA 4DLIA 3D15A 3R9DA 3TUBA 3GFWA 4WA9A 5E9EA 4L45A 3S4QA 4FF8A 3V3VA 3H9RA 3R8MA 4QMPA 5CF4A 2X0QA 4QO9A 4RX5A 3KRLA 5G1XA 3UIBA 1H1PA 1MRVA 4TNBA 4LUDA 5KMJA 4DFZE 5FM2A 2GCDA 3P5KA 4J98A 3TYKA 1U54B 2C3JA 2PUUA 3CTQA 3P7BA 4XH6A 4C3FA 4OR5A 4IB1A 2BROA 5AIRA 2JDVA 2J0IA 3U9CA 4D28A 3SXSA 5M09A 3KXMA 3EQFA 3EFJA 4FIJA 4FKQA 4Y83A 2BKKA 4O4FA 3VS7A 4FV7A 4NL0A 2A1AB 1PXNA 3E7VA 4QMOA 2YCFA 5AM6A 3RI1A 2B9FA 2WKMA 1OL7A 1WMKA 2UZDA 1OUYA 1YKRA 2W99B 3NWWA 4UXLA 3SVVA 3GCSA 4AGWA 4FG8A 4EK5A 4DH5A 4TZRA 4FICA 4D2RA 2GFCA 3OCGA 3QD3A 2JBOA 2R0UA 5BVWA 4X3FA 4FV4A 4BCKA 2CLXA 2UUEA 2X0OA 1OUKA 4U41A 4FIGA 4QNAA 4AXCA 4TXCA 3A7IA 3HNGA 3MB6A 5A3XA 3RNYA 5CEQA 3H9OA 4L3LA 4MH7A 1XBCA 4NCTA 5H2UA 5LMKA 2IZSA 5ANEA 3PY3A 3ZS5A 4QDEA 2QOQA 2XA4A 4FVQA 3JR1A 4QT1A 3GENA 4YC8A 3H10A 3PA4A 1ZY5A 3TZ9A 2UW8A 2VTRA 1U5RA 2Z7LA 4YZNA 1WAKA 2RFNA 3LCDA 5IEVA 2XRUA 2WO6A 5CZIA 4RIXA 4ENXA 4F63A 2I0HA 3LFDA 3E64A 2PZRA 2VTLA 4BCFA 5C01A 3LXKA 5CVHA 4K33A 3G0FA 5CU2A 4ACDA 3TUCA 1BKXA 4IANA 2BFYA 4UX9A 4H3PA 3NVKI 3KEXA 3ALOA 2YA9A 5IA5A 4BGQA 1R0EA 3PP0A 2G01A 1JKTA 3AC8A 5CSWA 3RCJA 1Q61A 2UZNA 5EM8A 4F6SA 3KN6A 3I81A 4HCTA 4O6LA 3VUIA 4HVHA 5A4TA 5IZFA 4J1RA 3AKJA 2ONLA 3CTHA 4UMQA 4R7HA 4B8MA 4C4HA 5K3YA 4O2ZA 2HELA 1IAHA 2OJ9A 1JAMA 4GIIA 4E7WA 3QUDA 2F2CB 4MHAA 4AOJA 3Q4ZA 3VW6A 4ANMA 4I6LA 2BHHA 4FSTA 1B6CB 4FBXA 4IX6A 3FI3A 3LPBA 3E87A 5B0XA 3PVUA 5IH4A 1W2CA 2G9XA 3U8WA 4X2KA 4NM7A 4BIDA 5LMBA 2UW3A 1KOBA 3GCVA 3QQGA 4EOSA 4QMTA 4AZVA 4C8BA 3UYSA 2VWWA 3LCTA 3HVCA 4AZFA 1RDQE 3OROA 5LOHA 2FUMA 3QRIA 1LPUA 3UQCA 1UNHA 5EHLA 3FXXA 1PXJA 5LMAA 3B2WA 2PVRA 4BTKA 5DHJA 5EH0A 3LJ0A 2VZ6A 3Q9WA 4IVBA 3ULIA 3DBFA 4DF3A 2WTWA 3CD3A 1PYEA 4FTKA 3WOWA 2FB8A 4EOPA 3TKIA 4UY9A 1L8TA 3RHKA 1UKHA 2QOIA 2WTCA 3UZTA 2R3MA 2VO0A 1M7QA 2X39A 3OHTA 4Q5HA 4UV0A 4CD0A 5E8UA 4DHFA 3MESA 3A7FA 4RC2A 3CJFA 5AMNA 2PSQA 4RIWA 2VTNA 1HOWA 2W5HA 3R1QA 3M2WA 4L43A 4DHZA 3KFAA 5DOSA 5LVLA 1R3CA 2PVYA 2O64A 2QVSE 5AWMA 4EONA 3I1AA 3COMA 3F7ZA 3OXIA 3TN8A 3WIGA 2ZV9A 4IZAA 4HOKA 2CN8A 4TYJA 2B54A 3G6GA 4DEGA 2CNQA 3W0PA 4FV6A 5ETAA 3RJCA 3UVPA 2C5VA 3JY0A 4AXFA 4ANBA 3BL9A 4BIBA 2NYAA 4RZVA 4EHVA 2XEYA 3E92A 1XH7A 2RKUA 4X6QC 4QQTA 4C58A 2XF0A 5L4QA 3EKKA 4IM2A 1FPUA 3PSDA 5E8SA 4PP7A 2WMAA 3KRJA 3PY0A 4YJQA 2C5YA 4E4XA 4DYMA 4IM3A 4MQ2A 5L6WL 2PVFA 2XJ0A 4CTCA 2HZ4A 2X2KA 5JK3A 3G33A 3OTUA 5CASA 5T6KA 1DAYA 2O63A 4U3ZA 3RTPA 3DNEA 3VHEA 4AZTA 5M4UA 5HCXA 2UZLA 4NTSA 4O4EA 3FZ1A 2X8EA 3RK9A 1YHVA 4YSMA 5AP6A 3KL8A 1E9HA 4R6VA 3DT1A 4M97A 2VD5A 4OTFA 3PUPA 4ZOGA 4O7VA 5C4KA 4B9DA 4RVTA 4MF1A 4L52A 4LV5A 4OW8A 3V8WA 3G15A 4KBKA 5EM6A 1ZRZA 4X6RA 3EL7A 2GNHA 3ZBFA 2FH9A 2JDSA 5CXHA 4AW1A 4K18A 1A9UA 3KMMA 2VTAA 5KZIA 4BN1A 3VF8A 3W8QA 4CV9A 2ZFYA 5LVOA 3D7ZA 4RA4A 3FZOA 3IPHA 4L01A 4RG0A 1WBWA 3AOXA 4YJUA 2DS1A 5FWKK 1K2PA 3HDNA 2CKQA 3PE1A 4PL4A 5FQDC 2B55A 5ACKA 3FBVA 3ZYAA 4X0MA 1J91A 2W1EA 3AG9A 3AGMA 4GFGA 1XKKA 4ARKA 1W84A 3Q04A 4I0RA 2R4BA 1UV5A 3GT8A 4JJRA 4UWBA 5I9VA 4CT2A 5I3RA 1ZY4A 3RK5A 5KCVA 1PXPA 3PVBA 4FTUA 3ZM9A 3DBCA 1ZAOA 4QP7A 4GYIA 3FLSA 5ANJA 2BRMA 2B4SB 3P86A 2RL5A 3IONA 3EQBA 4ZTQA 3VUKA 1IAJA 3ORKA 4YPSA 1OIQA 3K5UA 3RM6A 3ANRA 4F7SA 2PK9A 4RLLA 2YM4A 4KIKA 3Q2JA 4F1OA 3R04A 4MD9E 1UKIA 2Z7QA 2B52A 4XYFA 5KE0A 3SAYA 1OBGA 4MBLA 3L8VA 3QAME 4MNEA 5AR8A 4AW5A 4ZS0A 3SKCA 3TG1A 2QODA 3VS4A 1UWJA 2GS2A 2WEIA 1JSTA 3UODA 5CSHA 5C8KA 2WQMA 4UWYA 3V5QA 4NJDA 4O22A 3VS6A 1IA8A 4JBVA 3CCNA 2PUIA 1H4LA 4BB4A 3QHWA 1OKYA 4O21A 5M44A 2V7AA 2PMOX 4BZDA 3CKXA 3F82A 4FKIA 4K6ZA 4C2VA 2F7ZE 2X7GA 3WARA 3EH9A 2X8IA 4I0TA 4F0GA 3QCQA 3C0GA 3NYVA 3E8CA 4KWPA 2ITOA 5JFSA 4QOXA 5GZAA 3NMUF 1JVPP 1F0QA 2F57A 4XV1A 3FLWA 3U87A 1A48A 2ZAZA 4AN2A 4O82A 5K5NA 4PNIA 4F6WA 3UOJA 3P08A 2R7IA 4EOIA 2XVDA 3FDNA 4CNHA 4XLVA 2A2AA 2XNPA 3QD4A 4D1XA 4KRDA 1BLXA 3DTCA 4EI4A 4PP9A 4M67A 2BILB 3G9NA 3JPVA 4ZP5A 4AE6A 4ZLOA 1OECA 3OS3A 4FTNA 4FUXA 5CVGA 1LR4A 2UW6A 5M53A 2WEVA 3KC3A 1OITA 3WZJA 4GK4A 4JG8A 3PFQA 4FV2A 3RPVA 3EMGA 1F3MC 2JDOA 1BL6A 2PE1A 1RQQA 2QOCA 4L3JA 4M3QA 5ANDA 5DT0A 2BHEA 3UOLA 4HW7A 3VVHA 2WPAA 4I3ZA 4RJ7A 1XJDA 5AAFA 5KX8A 2WMRA 3UMWA 2W96B 1P4FA 3IW8A 2EXEA 4JQ7A 5JH6A 2JFMA 3FZPA 2WHBA 3D7TA 4CYJA 4IBMA 2X7FA 3WF6A 4PX6A 4BDIA 4ZTHA 4YMJA 3K2LA 4JR7A 3KK9A 4F0FA 5CAQA 4R5YA 3R28A 5L6PA 3NCZA 3WIKA 2HAKA 2UZBA 3OCTA 3VS0A 4DFUA 5DIAA 5I0BA 4CV8A 2V0DA 2CDZA 1Q5KA 2G2HA 1CM8A 3C4XA 3EQHA 3FQHA 1RW8A 3QUPA 4FT0A 4GG5A 2W1FA 4KIPA 1NW1A 4GK3A 4U42A 5IISA 4QPSA 1FVRA 2OIBA 4U45A 4H1MA 3BCEA 4NH1A 3WYYA 5BV3A 3P4KA 2XANA 1ZMUA 4A07A 4RA5A 5L8JA 4CXAA 2LAVA 2J2IB 1H28A 4EK8A 4RVLA 3THBA 2P2IA 4ZZMA 4J97A 5CVFA 5E90A 4WO5A 2JFLA 3U4UA 3QTRA 4C62A 2PVKA 5IQCA 3S0OA 2W17A 5AV2A 4C3RA 3MH1A 3SXFA 3AD6A 5IUGA 4G3DA 5HEZA 4LYNA 3HA6A 3ROCA 3EHAA 3QD0A 4W9XA 2QO7A 2QU5A 4CFWA 4ZSAA 5HNGA 2Z7RA 4TRLA 4U8ZA 4EUTA 4Z55A 3ZONA 5GNKA 2ZJWA 1H07A 4FZAB 4TWNA 2C6KA 3PPKA 2ZB1A 5IQEA 3OUNB 3QC4A 4BDBA 3VUMA 3DCVA 1GIIA 2ZM4A 5HNBA 2OU7A 4LOOA 4MWHA 4D4RA 4DH3A 4TL0A 4E4MA 2V62A 3MTLA 3JVRA 3E93A 4RIXB 1ST0A 5BNJA 4PDYA 4DLJA 2HXQA 2QU6A 3QALE 4FMQA 3HUCA 4LOQA 2CHLA 3CPCA 3PJ2A 4FKWA 2IO6A 2JKKA 4IEBA 4JIAA 4YJNA 5K0XA 5HKMA 3AC2A 3Q3BA 4IX3A 2J7TA 5L2QA 3DNDA 3LM5A 3FKNA 3HAMA 3HRCA 3RALA 5IA4A 4EKKA 4DN5A 5EI8A 4N6YA 4G16A 3FE3A 3BHHA 3RM7A 2HW7A 3WZDA 1JSUA 4UEUA 4CRSA 4ZK5A 5EYDA 4APPA 2BZIB 4BBFA 3S00A 3R02A 4TY1A 2XNOA 3FLYA 5HTIA 4EH2A 3VO3A 4E73A 4E6CA 4YNEA 1YXTA 2VTOA 4DH7A 4GG7A 3TT0A 5EQEA 2XIKA 4D0WA 3UVRA 5A54A 1O9UA 1J3HA 3IDPA 2ZM3A 5IDNA 3D5UA 4NKAA 3Q4UA 4S32A 5J7BA 2F7XE 5I5ZA 4YBJA 2PTKA 2YABA 4Z3VA 5IG1A 4M15A 4IFGA 2Y4IC 1ZYCA 3LFBA 4I93A 3ZO1A 4E4LA 4YC6A 1TKIA 5H8BA 4MYGA 4RVMA 4AN3A 3UVQA 4AGCA 1WBOA 1XH6A 2HW6A 4AT5A 3PA3A 2FVDA 4IVCA 4E3CA 4NIFA 3NDMA 4RC4A 5B2LA 4MQ1A 2WQOA 3A2CA 4CT1A 3CIKA 4IXPA 4IE9A 2CGXA 2F4JA 4QP4A 2WQEA 2YWPA 1KUTA 5GJFA 3QQKA 4Z9LA 3PXFA 4BCMA 4OUCA 4DC2A 4I6HA 1YXVA 3II5A 3SRVA 4D1SA 1OBDA 3I5NA 1NVQA 3LAUA 3FZRA 3IS5A 5CY3A 1OVEA 5ITAA 1M7NA 4JDHA 4ANLA 2OJFE 2YN8A 4BHZA 3ZM4A 1R1WA 2X6EA 3MIAA 3AD4A 4G1WA 3PPJA 2R3HA 4AA0A 4DEHA 3TACA 2P4IA 5IMEA 3G6HA 2R3GA 1UWHA 2BAJA 3CY3A 3V5LA 4QP3A 2BIKB 2XNEA 3F6XA 5GIPE 5AA8A 3CS9A 4KKGA 4BHNA 5C4LA 3OWPA 3BQCA 4NT4A 4OBPA 4U79A 1CKJA 4YLLA 3UO6A 3R9RA 3MVMA 3RINA 3LMIA 4IAYA 4BCIA 3TM0A 3R7GA 3KCKA 1YXXA 2GNFA 5HGIA 3ETAA 5CNNA 2G2FA 3GEQA 5LQFA 3MV5A 3KMWA 4D2TA 3PG1A 4TPTA 4AQKA 5HO8A 1H25A 2H34A 2YWVA 4F78A 4FKOA 4TW9A 4EL9A 1CTPE 3I60A 3N4VA 5A46A 3NW7A 4ITHA 1URCA 3VAPA 1AQ1A 4UBAA 4TKSA 4EJNA 3DV3A 4QTAA 3QL8A 5KMIA 2IZTA 3NUUA 1O6KA 5JGDA 1LEZA 5HG5A 4ZTMA 4E4NA 4NJ3A 1ZYSA 2BRGA 2QI8A 3NNVA 1YOMA 4A06A 1OB3A 2J0LA 2W1HA 5J9ZA 5DR9A 3TUDA 4QMXA 4R1YA 4B8LA 4RX9A 5BX0A 5HQ0A 3W0OA 1YWNA 3DB8A 4W8DA 2X1NA 4AE9A 1QPEA 5J1VA 5KHXA 4FZFB 3I79A 3REPA 3FKLA 1NVRA 4U80A 4D1ZA 4QMQA 1JKKA 1PMEA 1WBVA 4JBOA 3BHTA 2ZMDA 4O2PA 1SVEA 4OAVB 1YOLA 1UNGA 4HVDA 3ZSIA 4TYHB 5BPYA 1Q8UA 3E63A 2WMVA 3RPRA 3KA0A 3R00A 1FVTA 5LJJA 4X2GA 2C5OA 4QMSA 2XIRA 5L2IA 2EVAA 3NW6A 3U6IA 2I7QA 1PKGA 5EDPA 5JFVA 2VWXA 3Q4CA 4IAFA 3CP9A 4IC8A 5EQYA 2BAQA 4WKQA 1WVXA 3R7EA 3DLSA 2FYSA 4G2FA 2B53A 5ANGA 4D2WA 2CGWA 5LVPA 4UB7A 3V5JA 3IOKA 2F2UA 1URWA 4M69A 5CQWA 4AOIA 4D2SA 2XM8A 3BE9A 4WNPA 4GT3A 4AGDA 4EWQA 5JSMA 4MNEB 4RC3A 3QLFA 1Q3DA 5CAVA 3PLAE 1IEPA 4D0XA 3RAIA 4EHEA 5HBJA 5CSVA 4G9RA 5DR6A 2OGVA 5HORA 2CCIA 2Q0NA 2VV9A 2XKFA 1GZNA 4LGGA 3T9IA 3H0ZA 4IJPA 4R7BA 3RCDA 4FZ7A 1WBPA 4FKPA 4GJ2A 4DH1A 4TT7A 2NNWB 3L9PA 4FV9A 4BI1A 4XHKB 3D94A 3FUPA 3LZBA 5AUVA 1WBTA 5C1QB 3UOHA 4M8TA 3BPRA 5CF5A 2C0TA 1KOAA 4A9TA 1FOTA 4DGLC 3CPBA 4Y5QA 2C5XA 1PW2A 5HIBA 3QD2B 4DITA 2RF9A 3O23A 4C36A 3FWQA 4FKUA 3KULB 1KE9A 2OXDA 3R7IA 5ETCA 3ET7A 4GFOA 4JT3A 4ZSJA 4AA4A 4O7TA 1XQZA 4F9AA 2PMIA 5IA1A 2BDJA 4BY9E 5DE2A 1J7UA 4PL5A 2C4GA 4XOZA 3NUNA 3BGZA 3KF7A 1J7LA 3KXHA 2W1DA 3LCSA 2QR7A 4M0ZA 3O7LD 3KB7A 5DG5A 1O6LA 2W5AA 2XUUA 4PMPA 5C26A 3DDQA 2GHLA 4EOOA 3EJ1A 2QG7A 4QPAA 5HVJA 3QRTA 5E8TA 3D7TB 2HYYA 2R3PA 3RNIA 4HGSA 3KKVA 3QWKA 2C30A 4U0IA 3VUTA 4CFVA 5BVDA 4BWXA 4L42A 3TDVA 5BYLA 3C50A 4LRKA 3UC3A 4BCOA 2PPQA 2XK6A 4EZ3A 1J1CA 3V6RA 2ITVA 4Y5HA 2WGJA 2IF8A 3Q32A 4CLIA 1Q8WA 2B9JA 3MBLA 1WBSA 2IEWA 2W9FB 4UMTA 4B99A 4E6DA 3DA6A 3CJGA 3BHUA 3SQQA 4PPBA 5EQPA 3NUXA 3TXOA 4YHJA 4YR8A 3DK3A 2XIXA 1MRYA 3P1AA 4YJPA 1FMKA 4QMZA 2Z02A 4AQCA 4FZ6A 2YDIA 2YISA 2B7AA 1NXKA 2XM9A 1YXUA 3AC1A 3BLRA 3QWJA 4D58A 3N9XA 5CT7A 4QP1A 1PXIA 3MH2A 3EL8A 4AFEA 1BI7A 2C6DA 5C9CA 4FA2A 2YM6A 4OTWA 5ANOA 4O84A 2BZJA 3V8TA 3EN5A 4R3PA 3EN6A 3DOGA 2JKMA 4FR4A 5LCJA 1I09A 5FEDA 1ZARA 3W32A 3TZ8A 3P9JA 4DT9A 4HZSA 1OPKA 2GQRA 4F7LA 3W2OA 4QRCA 5CT0A 1R39A 3NRMA 5AM7A 5FBNC 4YZMA 4AZEA 2E9NA 5AADA 3PDTA 2EWAA 4S34A 4RQVA 3U4WA 4JDKA 5KNJA 5AUYA 2VNWA 4QMMA 2BVAA 3VUHA 4XS2A 3LHJA 3ML1A 2VWIA 4QYEA 1REKA 4EK3A 2VO3A 3RWQA 3ITZA 5AX9A 4MXOA 4EZ7A 2RFSA 2X0PA 4OTDA 4XV3A 2VUWA 2J0JA 3A4OX 3PJ1A 1GZOA 5T3QA 3RPOA 3ZZWA 3R71A 2WD1A 4XLIA 4GL9A 3GOKA 5DN3A 2GHGA 5FUTA 3C4FA 4O7ZA 4I24A 3NX8A 5IPJA 2VTPA 4GT5A 3ZEWA 3T8OA 2XIZA 3NYOA 4F1TA 3D5WA 4K9YA 2O65A 2RGPA 3TTIA 1G8SA 5JRQA 4JG6A 3CY2A 1MQ4A 4JLCA 4DCAA 2P0CA 4J53A 5C8MA 1PKDA 4BBEA 4L6QA 1TQIA 2QOLA 4CQGA 3BE2A 1K3AA 1OPJA 2W4JA 3FI2A 3MFUA 5DWRA 1V0BA 3UYTA 2VTJA 4XV2A 5D7AA 5HE0A 3O96A 4YSJA 1NA7A 1PF8A 2YM5A 2XKEA 5CTPA 3HMOA 5EW9A 5BVKA 2X0GA 1JKLA 1OMWA 3GC0A 4IADA 4KSPA 4MEDA 5DLSA 3QX2A 3SLSA 3PIYA 3PE2A 2OJJA 3ORLA 4QYHA 4FTIA 3GXLA 3ZO4A 1V0OA 4RJ5A 3TV6A 5JGBA 4MK0A 4DFNA 4FYOA 4HYUA 1Z57A 4ZEGA 3R8VA 2R3LA 2GQSA 4B6LA 2UZVA 3ERKA 2I40A 4FIFA 4I6QA 4JNWA 2YZAA 3BBWA 1R78A 3K5VA 3Q53A 4BDAA 4YP8A 4TWPA 3DKOA 3O7LB 4EYJA 3IO7A 4WSYA 3NLBA 4BTFA 5CF6A 2I1MA 3FZSA 1G8KA 4HGTA 3CSVA 5DNRA 5K5XA 4IMYA 5FXSA 4O7WA 1MUOA 1P4OA 4JRVA 4O81A 5CU0A 2IVUA 5HX8A 1IA9A 3W0QA 2IW8A 4JG7A 5FDPA 2PZIA 2QHNA 2WTVA 3F5UA 3FY0A 2UZUE 4EZ5A 3D14A 5D12A 2CGUA 5DBXA 3RBWA 3NEWA 1OL1A 2ZB0A 3OP5A 2GS6A 4Y95A 4BZOA 4ZJVA 1ZYDA 4BCJA 3SV0A 2ZDTA 3Q9ZA 3DU8A 2YZLA 2VWYA 1SM2A 4L00A 4GRBA 4JQEA 3SDJA 5E8VA 3U6JA 4I5PA 5LWNA 4U97A 1Q99A 3SG9A 3GCQA 5A4QA 3GVUA 4U43A 3ENHA 3EQRA 4V05A 1LP4A 2PMNX 3LQ8A 1G3NA 3Q52A 3HV4A 5D1JA 4H05A 4IIRA 4O0VA 3ZCLA 4RWJA 2J5FA 3KXNA 4AGUA 4BGGA 3O51A 1TQMA 1YQJA 2Y6OA 5HO6A 1Y6BA 4FTJA 1GOLA 2WMBA 3LM0A 2C6EA 5I3OA 4BYJA 4JDIA 4ACGA 4EH3A 2V22A 2R3KA 5DPVA 3CXWA 3QTQA 5EW8A 5GJDA 3P5JC 2JKQA 4QTBA 5TE0A 5J5SA 5D41A 2UVXA 3ZMMA 1K9AA 4HGEA 1BMKA 3GU4A 4O0SA 5KBQA 3BWJA 1T45A 3Q9YA 5K0KA 3HDMA 3AT3A 1CKPA 1KE5A 3CE3A 4AOTA 1YDSE 5IH6A 4RQKA 3UO5A 4RFYA 3BV2A 1ZZ2A 3CD8A 4O38A 1UU9A 3EFWA 4YLKA 4YTIA 2UW7A 3F3WA 1ST4A 4WHZA 4CFMA 4MUQA 5IQFA 2C47A 3DPKA 1YHSA 4OTPA 3QKKA 3I5ZA 4F9CA 4CEGA 4XUFA 3OVVA 1LEWA 4MD7E 3TIYA 4JBPA 2AYPA 2X2MA 5DT3A 1H27A 3G2FA 3OEZA 2GFSA 4CVAA 3HV3A 4CMOA 4C33A 3VQHA 4HVSA 5C27A 3RP9A 1QCFA 4YUQA 4JXFA 5F9EA 3ZUUA 4O1OA 2R7BA 4DGOA 5E8XA 4FT9A 5AP7A 3RVGA 4MVFA 4BKYA 5I9YA 5IF1A 1SMHA 2WB8A 5EFQA 5FP5A 3POZA 2EB3A 4FEXA 4QP6A 4C0TA 3GUBA 1PXMA 3BKBA 4RIYA 4W4XA 2WU7A 4FYNA 4DHIB 2OH4A 4TYGA 1Z9XA 2J0KA 4EK4A 3EYHA 5JZJA 3KIOC 4IB0A 4PUZA 1OGUA 1DS5A 3ROYA 3IK3A 4X2NA 2GNGA 4WSQA 1P2AA 3ALNA 3HGKA 3L9MA 3RPYA 2QOFA 1AD5A 4NW5A 5E1EA 3OXZA 4PNKA 2WIPA 4HPTE 4ASZA 3BQRA 4RRVA 3E88A 3OBJA 3DAJA 1ZYJA 3QKLA 4YZCA 5IDPA 2AUHA 3OD6X 4M66A 3BX5A 2OJGA 4I20A 4IM0A 4BYIA 2B9HA 3MPAA 3PSCA 4J71A 1PY5A 5CWZA 3FI8A 2J5EA 5KMMA 4RT7A 2WMQA 1CMKE 2PVJA 3WF5A 3T3UA 4PPCA 2YFXA 3QKMA 1OKVA 1X8BA 5CSPA 5JQ8A 2IN6A 3CC6A 4HYHA 4XBUA 3TKUA 2XEZA 2OXYA 2QC6A 1CSNA 2Y8OA 4E5AX 3VNTA 4L67A 2GQGA 3TL8A 2I0VA 2W1CA