4FVQA

Crystal structure of the jak2 pseudokinase domain (mg-atp-bound form)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
274
Chain Sequence
VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Crystal structures of the JAK2 pseudokinase domain and the pathogenic mutant V617F.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fvqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fvqA01
3PPKA 4D55A 5LWMA 3I79A 3BGQA 3NUYA 3O8UA 5D7AA 5M51A 4IFCA 5IA0A 5AFVA 2ITYA 5E4HA 3P79A 5AUZA 4GKIA 3ZRKA 4O0VA 3CEKA 5HESA 3ZUUA 4W4XA 3LCKA 4U5JA 2R2PA 1R39A 4FTTA 4M69B 3DKOA 3MH3A 3LFCA 1PKDA 2XK7A 4D9TA 3ZO4A 2Y6MA 3R9OA 2BFYA 2AC5A 4K8AA 4E6CA 4HVSA 2X8DA 1DAYA 2NPQA 3EN7A 3TNPC 5BPYA 4TZRA 5KX8A 2PSQA 3PXKA 4YZCA 2OJJA 5AR4A 4XUFA 3WARA 3ALNA 4FKWA 2Z2WA 3UQFA 1TVOA 2YM8A 3W2RA 3MB7A 4AT4A 4O7WA 3FDNA 5A4QA 3C4ZA 2PMLX 4UB7A 5IUGA 3I81A 1PXJA 3KEXA 3LM5A 3Q32A 1A06A 3BWJA 3B8QA 3LKMA 4FUXA 3E8NA 4GT5A 4RVLA 1SVGA 3P0MA 1ZZ2A 4G3GA 4NW6A 5AA9A 2ETKA 4WHZA 4PDSA 4ZP5A 5DN3A 4R7BA 4FKRA 4E5AX 1WBSA 2ONLA 4AQCA 3SHEA 3O50A 5CAUA 3HUBA 4TYHA 4B99A 1KE8A 2J90A 3BWFA 1H28A 3I0QA 5KMLA 3WYYA 3UO4A 3CPBA 3DGKA 2VO3A 3WZUA 3R21A 1KWPA 4L45A 2OJIA 2I0YA 4J96A 5E8ZA 3HP2A 4JJRA 5IPJA 5EHLA 3N4VA 5DEWA 2QOHA 3O2MA 4O84A 3AT2A 3ELJA 4MHAA 5AWMA 3SG8A 1URWA 4MH7A 3SA0A 2I6LA 4ACHA 2BCJA 3IOKA 3KU2A 5JQ5A 3SRVB 4B8MA 4L8MA 1SNXA 4JG6A 4P90A 3VJNA 2QVSE 4F9CA 5HBJA 2XRUA 4OTDA 3S95A 4CFVA 1L8TA 4EJNA 4FV9A 4HGLA 3GQLA 5AEPA 5J5TA 2QU5A 4AW5A 2VTJA 2LAVA 3NW6A 1XHAA 2QG7A 1VYZA 4EHZA 4AGCA 5L2TA 1QPEA 2V22A 4NFMA 4YU2A 1Q99A 3KMUA 4ZTHA 5A6OA 3A7JA 3R7VA 3Q96A 2WXVA 4F08A 3MW1A 3KKVA 5HVYA 4YUQA 3E62A 4MD8E 3I0OA 2VTNA 4ZSLA 3SD0A 4BYIA 1PXOA 4XX9A 5DE2A 5J1VA 2R64A 2R3HA 3OFMA 5AJQA 5HLWA 4JX7A 2CKQA 3DBQA 4CKJA 3KA0A 4PUZA 4RFZA 3R8ZA 5BVDA 3MB6A 1P14A 1IG1A 2JAVA 4KIOA 4BCNA 3F5XA 4AN3A 3DTWA 3KVWA 3CCNA 3TNHA 4BF2A 4G9CA 1OPLA 3S3IA 4WNPA 4E8AA 2W06A 2HOGA 4F9WA 4L42A 3KXXA 4S32A 3QC9A 5JZNA 3RJCA 3JPVA 4M84A 4FK3A 4FT5A 1JKTA 4KBCA 4X3FB 3S2PA 5BVWA 2PUPA 4V05A 4FG8A 2XK8A 2I0VA 2ERKA 4QYYA 3FI4A 3F5PA 5GIPE 3VN9A 4XG2A 3ZU7A 2I7QA 3LFEA 3FHIA 4CCUA 3U4WA 2BUJA 3F3WA 4EUTA 3VUKA 4NKAA 4BDIA 4U0IA 4I1ZA 4LFIA 4DGMA 4K33A 2XK6A 3QWKA 4NM7A 3LVPA 5IQCA 2VWYA 3NPCA 3OZ6A 4YURA 5J9YA 5KHWA 4YTHA 5HCZA 4H39A 3Q53A 2YWPA 2W5BA 3BKBA 4HPUE 1WBPA 3BBWA 4LI5A 5ACBC 5TT7A 2BKKA 5I3RA 1F5QA 4QMSA 4I5MA 1S9IA 4DG2E 3ZS5A 1BUHA 4MCVA 5DG5A 1P2AA 3ZC5A 3DBDA 4ANOA 4JBVA 3SX9A 3D2KA 5L2WA 5CVFA 2VGPA 1PMEA 5FTQA 2BALA 3KRRA 3ZH8A 4YNOA 3RAKA 5IQGA 3C5UA 1JSUA 3EQDA 4D1ZA 4D2VA 4F6SA 2J0JA 4NEUA 1RQQA 2GS2A 2W4JA 2XBJA 4YJQA 5EM6A 1LEZA 3L1SA 4GVAA 3BHYA 4Q9SA 2IO6A 4BWXA 2QR7A 2O5KA 3FQEA 5CY3A 4WIHA 4RG0A 3CGFA 3OP5A 4O7LA 3BQRA 3G2FA 5HQ0A 2HWOA 2VNYA 4L3PA 5EDRA 5HEZA 3Q4CA 1R0PA 5HGIA 1VJYA 4JIKA 4DH8A 5BNJA 5HTBA 3DJ6A 3PWYA 4FKSA 2W05A 2EXMA 4XOZA 4A4OA 4Q2AA 4R77A 5M09A 1W82A 3OBGA 3T9TA 4F1MA 1WCCA 2YCSA 3LQ3A 5E91A 2RKUA 5DVRA 5E8XA 1Z57A 2PVMA 2YM6A 3TUCA 3T3VA 3AC4A 2JDSA 3OOMA 5CASA 2WKMA 2ZVAA 1GZNA 4JR3A 3R6XA 2J6MA 4ID7A 4U44A 4WSQA 4RWIA 5CEKA 4N57A 4WKQA 4DFZE 4F1TA 3C50A 3E93A 3RAHA 4AT5A 3GOKA 3VS2A 4CMOA 4F0FA 1O6LA 5L8KA 3GU8A 4OAUC 3PA3A 4CG9A 2QOIA 3I5NA 4J52A 3W2PA 5L2SA 1APME 2WTDA 4YHTA 4BCMA 3O96A 3EFWA 4D0XA 3FYJX 2VTTA 3ID6C 2IZUA 2WQEA 2UZVA 4ZTRA 3SRVA 1UA2A 2AUHA 4LGHA 3C4CA 3L8SA 1NXKA 4GH2A 3MY1A 2PHKA 2RG6A 5C01A 3EFJA 3D5WA 2B9IA 2YAAA 3P4KA 4XNEA 5CENA 2ZJWA 1PYEA 2GS7A 4UXLA 1R78A 3HV4A 3UIMA 3C7QA 4BGQA 2IVTA 4FV8A 5IQIA 4QO9A 3R01A 4YO4A 4JQEA 2W1GA 2X9FA 3TEIA 4BI2A 4E3CA 4UX9A 4MXOA 4U41A 4ZMFA 2NRYA 2WHBA 2YIQA 4IB1A 4QT1A 3TT0A 3UDBA 3PE2A 4WG3A 5KKRB 1XJDA 3W2CA 4XS2A 5BYZA 2UW7A 2OFUA 4QQ5A 3V5WA 4CT2A 3GCVA 3AT3A 2EXCX 4E6DA 2VWUA 5L2IA 3JS2A 3N9XA 4U8ZA 1PMNA 1PY5A 3EQBA 1XO2B 3HA6A 1YXVA 1CKJA 3QGWA 4OT5A 3GI3A 2IVSA 2IZSA 4JDIA 5HKMA 4OTQA 1MRVA 3NCZA 5I9UA 5DHJA 3ZFXA 3E5AA 2G1TA 3C0IA 2WIPA 1PXPA 5H2UA 4R1VA 4OR5A 2KULA 3U6HA 4ZSAA 3IOPA 5IH6A 5C03A 4JBPA 4K9YA 3W2QA 4O7RA 3UZPA 4FF8A 2C5XA 5TR6A 4EQUA 3PLSA 3R8UA 4IM2A 3QCYA 5J87A 4EHGA 4E4MA 4BC6A 4UYNA 1CM8A 4EEVA 2Y4IB 2ZM4A 3PG1A 4BZNA 4DG3E 4PDOA 3R02A 2OU7A 3TV7A 4F9AA 4UWYA 5EYDA 2YISA 3QQGA 2CKPA 3AD6A 4PL3A 2RFEA 5KE0A 4O7TA 5E90A 2O8YA 3F3VA 4FKPA 4EOKA 4LRKA 4I6BA 5CI7A 2JIIA 3MPAA 3L8VA 3PJ2A 3OTVA 4C3RA 2R7IA 4QPAA 1ND4A 4BWKA 4K6ZA 4H58A 3DXNA 4KKEA 4YO6A 3TL8A 4AE9A 3ZRMA 4YR8A 5JFXA 3LXPA 3EH9A 3UOHA 1OUKA 4O6LA 2PL0A 3CY3A 5DI1A 4XP0A 1GZ8A 1IEPA 4K1BA 2WNTA 3A7IA 4FODA 4O1OA 5FRIA 3QD4A 2GNIA 2QOOA 3QYZA 4FZAB 4YJSA 5BQ0A 1OIUA 1AGWA 3A60A 4G6NA 2OLCA 4UZHA 4QQJA 4YSJA 1U54B 3DJ5A 3KL8A 4L67A 4FYNA 4ASZA 3D5UA 3EQCA 3O71A 3KF4A 5IA5A 3PXFA 3RP9A 2EB2A 2ZV7A 3KFAA 4F6UA 2JKMA 3DK7A 4FGBA 2QCSA 3R1SA 5AR3A 4RVTA 2QOLA 1GJOA 4OAVB 4UWCA 2UVYA 2WFYA 4EL9A 2O65A 1FQ1B 5CZIA 5D10A 4GCJA 3RAIA 3SDJA 3DZOA 3QALE 3F88A 4U3ZA 5EH0A 4QP9A 4R7HA 3VIDA 3WZDA 4BBEA 5J95A 3VBVA 1ZMWA 2H96A 2W4OA 5IDNA 4JG8A 3ZOSA 3FAAA 4BTKA 2GMXA 3NYXA 3MH1A 1MP8A 4FV4A 1DAWA 1PXKA 4BN1A 3A7FA 3CKXA 2WMSA 4FK6A 4U80A 5ANKA 1Q8ZA 5HX8A 3BYVA 5HIDA 4FTIA 3ACKA 4ZIMA 3PFQA 4TWCA 4JG7A 3C13A 3FBVA 3ROYA 4F4PA 4HOKA 4FC0A 3EQRA 3A8XA 1WVYA 3AOXA 5L6PA 3TN8A 2FSTX 5IQFA 2ESMA 1VR2A 2J51A 5AM7A 5BMSA 5IQAA 4FTMA 2XNGA 3EZVA 3ZYAA 4ZLZA 4JDJA 2GSFA 4MX9A 3QL8A 2BFXA 3JVRA 2VD5A 2WQMA 4JLCA 5EK7A 2IW6A 5CSWA 3TUDA 4O0RA 4EH3A 4BICA 1UWJA 5JN2A 3A2CA 4LOQA 5J79A 4MYGA 3R04A 3KMWA 4II5A 1WBVA 2WB8A 4ZJIA 4CG8A 2IW8A 3Q2JA 3LFAA 3EQFA 1VZOA 4MXAA 3CTJA 5JEBA 2Z7LA 1UKHA 3EQHA 1REJA 5D7VA 4R78A 3HDNA 4FZDB 4RFYA 5IEVA 4DFBA 2PE1A 4DTBA 2PWLA 4G3DA 2OZAB 3Q9YA 3EQGA 4ERKA 4FZ6A 5CYIA 3OBJA 3HLLA 4FNYA 4CTBA 1BKXA 4XH6A 4BHNA 4C36A 2R0UA 3SQQA 3PJ8A 2EVAA 4MD9E 2BRGA 3F3UA 4USEA 4APPA 2YHVA 3CXWA 4Q9ZA 3GOPA 4FVPA 2XH5A 5L2QA 3RWQA 2XUUA 1M17A 2YFXA 3U87A 3EJ1A 4NM5A 3BEAA 3S00A 4O81A 3ANQA 4C4GA 5KCVA 4NTTA 3M11A 2XYNA 5EG3A 4RA5A 4N6ZA 4XOYA 4K77A 5HX6A 1H4LA 1M2QA 1OITA 4QMYA 4UMPA 3GU7A 1PRYA 4RPVA 2CGVA 4PX6A 3MA3A 4IWQA 3PP0A 4YLKA 3F7WA 3FMDA 3GCPA 4H3BA 4ZAUA 4FKUA 4LRMA 4R1YA 3GU4A 3HL7A 3BI6A 4RWJA 3SAYA 3K3JA 2YABA 2CHLA 4KRCA 3ORPA 4DGOA 3AC8A 4DYMA 4BKZA 2B52A 1W0XC 3L8XA 4FOCA 3UYSA 5LQFA 4QMOA 3SOAA 4ZS4A 4I5HA 4GIHA 3QUEA 4QTDA 5CU2A 4E7WA 2W4KA 3TJCA 5EQYA 1O9UA 3EL8A 4I0SA 3I4BA 3QTZA 4HYIA 2IVVA 3ROCA 3P1AA 3EB0A 2VO0A 1AD5A 5AV4A 3AC3A 3PP1A 4E6QA 4NL0A 2C4GA 2QI8A 3CLYA 4U97A 4YSMA 3O23A 3CD3A 3TZ8A 3QTXA 5LMKA 2C6LA 2PY3A 4IBMA 4Q5EA 3OCTA 4TT7A 4YJRA 5TKDA 1SZMA 3ZZWA 4AGWA 5EQPA 3NYVA 5EDPA 3DDPA 1OBDA 1U54A 3BHVA 1H07A 2CN8A 4LQMA 5AUXA 5EYCA 5KO1A 4O6EA 1ZAOA 4FOBA 1QMZA 3HV5A 4S30A 4WRSA 3OMVA 3NCGA 3WF6A 1OKWA 4FSZA 1KE7A 5K9IA 3LCDA 5BMMA 5HORA 4EK3A 4GV1A 2BDJA 5BUEA 4I6FA 4CGAA 3LAUA 3EKKA 4KKGA 3OWJA 2GHMA 5CSHA 3QQFA 3O17A 3UBDA 2WQBA 1UV5A 5HZNA 3QA0A 5F9EA 4IWPA 2BTSA 2XNPA 4NM3A 2CGUA 2W5AA 4IB0A 4MWIA 4KNBA 4QTCA 4BCGA 1LPUA 4PQNA 5EYMA 3PZHA 4DN5A 5EW8A 2RSVA 1YXSA 3FKNA 5FP5A 2VWXA 4PDPA 2C68A 3GFWA 4FICA 4F70A 4RJ4A 5AA8A 1FPUA 2X8IA 3ZLWA 4CLIA 5HTCA 3U51A 2R3NA 3DXPA 2YWVA 2W9ZB 3ZDUA 1JSTA 4C8BA 5HTIA 5EM7A 5C4LA 2OIBA 3E7VA 5AV0A 4APCA 4DF3A 4IFGA 3PSCA 1IR3A 2H6DA 2QODA 3KRJA 4YGAA 5J8IA 3WF8A 4MXZA 2W0JA 3OW3A 1Z9XA 4ZK5A 5EW9A 2BAQA 5E8UA 2W1EA 4DFLA 5F94A 1PMUA 2CLXA 2E9UA 2ITOA 2WMBA 4QMTA 5AUYA 3IW4A 4MXYA 3C4EA 4BIBA 3V5LA 2WTIA 4I22A 3OWKA 1YXXA 5GZAA 4FT9A 1JNKA 4FZFB 4O22A 4U43A 5CVHA 3MH0A 2QD9A 2F49A 1YDTE 2F7EE 3W18A 1FMOE 2Y6OA 5AIRA 4RC2A 5JGBA 2PVFA 1V0BA 3FSKA 2R3QA 5K3YA 4KIKB 5J9LA 5A6NA 3TKHA 4RIYB 3QZFA 2WMTA 4ZXTA 3VBXA 1Q4LA 1BI8A 4O21A 5ETIA 1UU3A 1G5SA 5HHWA 5HVJA 3ZCLA 5ANDA 3TIZA 3CPCA 3AGMA 3UODA 5TE0A 3GGFA 4FT7A 4IXPA 4CNHA 3EKNA 4JOAA 4MNEB 3CQUA 5EM8A 2UW0A 5JKGA 4C4FA 2YDKA 4R5SA 3F2AA 4XV3A 3RCJA 3UVQA 3U6IA 5CF4A 4FTLA 3TTJA 1OL5A 4FV7A 4KA3A 4BDCA 4FA2A 1JKKA 5BX0A 5L3AA 2YIWA 4P2KA 1M52A 3ZSHA 3MFRA 2YAKA 3OWPA 3ZMMA 4AUAA 3TCPA 1GAGA 4U45A 2VWVA 4QTEA 2VGOA 4O0YA 3NZ0A 4CLJA 4IDVA 1PKGA 4PV0A 2UW6A 4ZTSA 5HE2A 4BKJA 1CDKA 4FKOA 3UIUA 3PXRA 4IZ5A 3FMKA 3FZOA 3V5PA 1GIJA 4JAJA 5IQBA 3Q5ZA 4CCBA 3Q60A 2UZDA 1CTPE 2VTRA 3ORXA 5AP4A 2R9SA 5IU2A 3QRKA 3HV7A 1FGIA 4W9XA 2PVHA 1GZKA 3FMEA 3IW5A 4DT9A 2VAGA 3OC1A 5CSVA 4TPTA 3FHRA 3RK9A 2E9PA 3HMMA 3R7UA 3PLAE 1YDSE 4YZBA 2XBAA 4I5PA 3OD6X 4IX3A 5JGDA 4PTCA 4WBBB 2VWWA 3LPBA 4L68A 3W1FA 3BHUA 5J7HA 3FMLA 2B4SB 4MBLA 4O38A 2OK1A 2XK3A 2DQ7X 1UNGA 3V51A 4C37A 4U40A 5IA1A 3NUUA 4H1JA 1ZRZA 3OOGA 3ORTA 3PTGA 4BZDA 5IISA 4EQCA 5C9CA 3FC2A 2HELA 4RWKA 4FTAA 3V01A 1P4FA 1FVRA 4L3JA 1J1CA 4G3EA 3PVUA 4X0MA 3R8LA 4WOVA 1XH8A 2PK9A 4RC4A 2PUIA 5G6VA 5AAGA 5DFPA 3KN5A 4O1PA 4IH8A 5EI2A 2H34A 3MY0A 4ANQA 2Q83A 2YLEA 5AR8A 4J95A 4FYOA 5CSXA 3UC4A 3MSSA 5DT3A 4J97A 3UE4A 4AF3A 2I40A 4UN0C 4C57A 1ZYJA 3ZLXA 4WUNA 3QTRA 2CNUA 2W1DA 3R22A 4EH2A 4L44A 1PHKA 2R3FA 3K3IA 4F0GA 4XMOA 5KUPA 5BUIA 1PYXA 4I94A 3HAVA 3AD5A 4BCJA 1SVEA 4UYAA 5JZJA 2UZNA 2CGWA 3MI9A 3DBFA 3KXGA 2QOCA 4G1WA 4PMSA 4IZAA 5ETCA 2B0QA 4XV2A 3D9VA 2P55A 2GNJA 4FL3A 5I9WA 3RPRA 3PRIA 3ATSA 3AXWA 2FVDA 1NVQA 4MAOA 3LJ2A 5CF6A 5GJFA 2C3KA 5FG8A 2IJMA 4D58A 2YA9A 2BKZA 3QTUA 3O51A 4ZZMA 4TXCA 3SG9A 1QPCA 4DBNA 3ODZX 3KULA 3TJDA 3MGYA 1H1PA 2A1AB 4EONA 4C2VA 5EKOA 4IADA 3R2YA 2P33A 3NRMA 4ITIA 5IKWA 4ZLOA 1K3AA 3QA8A 3SC1A 3NNVA 3VBWA 4GIIA 3VBYA 2XKCA 3H10A 1JQHA 2O63A 3R9HA 4E4XA 4XLIA 2PZPA 4YNEA 4IAYA 4ZTMA 3N51A 1JVPP 1XBCA 3H9OA 4RJ8A 3VS3A 2WZJA 4LMUA 4UMQA 5D11A 2PZYA 2X7GA 3PJ1A 1F3MC 4ZJVA 5K4IA 5CF8A 1MQBA 3COIA 5HOAA 2WTVA 1Q3DA 3OS3A 4MK0A 4D5HA 1H0VA 2BRBA 3R7YA 5M57A 5M4IA 5D12A 2WEIA 3E8EA 4AGUA 4FL2A 3SGCA 3W10A 3OROA 4HGSA 2XKFA 3TNQB 4HCTA 2PVRA 3KQ7A 5CAQA 1WVXA 3PVWA 4R5YA 4OBOA 4AA0A 3AD4A 2J0MB 2X0GA 3E63A 4ERWA 5JT2A 3CQWA 4MNEA 5AUTA 4DAWA 2GQRA 4FKQA 1Y6AA 3R63A 4AZTA 4AA4A 3EFKA 3EYGA 4D4VA 1ERKA 5IUIA 2ZV8A 2UW8A 3TI1A 3C9WA 4HVIA 4DFXE 1SM2A 4IIRA 1Y57A 3DLSA 2ITNA 4JDHA 2OJFE 3PXYA 4FKIA 2QOKA 4Y72A 2BZIB 5LMBA 3CD8A 5FQDC 4JBQA 4BTFA 4EH9A 2WQNA 1DS5A 2GPHA 2OSCA 4A4LA 4D4YA 5ICPA 1U4DA 4OW8A 2BZHB 2CMWA 4ZTQA 4ANNA 3HX4A 4WUAA 4EC8A 4GRBA 4L3LA 3OT8A 3R8MA 3R9DA 4IDTA 4XG9A 2XIZA 5FWKK 5AAEA 4MWHA 4JNWA 3IW8A 1ATPE 4EBVA 2B9HA 5DRDA 4HW7A 5EI6A 4O2ZA 2OKRA 1LR4A 4GL9A 3ZSIA 2ZM1A 3IG7A 4PPCA 4TKSA 4FIJA 3QD3A 3FQHA 5FGKA 5F95A 2WPAA 3UQGA 2ONLC 4PRJA 4UBAA 5L6WL 3FY2A 4AFJA 4GK3A 2XIRA 4RJ6A 4IAFA 2HENA 4I5CA 5TF9A 4XG7A 3ZDIA 4BVUA 3BELA 4ONAA 3QKLA 5BVFA 4FV0A 3MWUA 4B6LA 1M2RA 4BCHA 2VTAA 3G6HA 4G34A 3TV6A 3PXZA 1OL2A 5DT0A 4PY1A 4A9UA 4JBOA 2C6IA 4H36A 4LG4A 5HU9A 5AP0A 3U6JA 4RMZA 2QOBA 4HYSA 3R2BA 5JMSA 4HNIA 2WELA 5H9BA 4F99A 4S33A 2HK5A 4YC6A 3BBTB 3CP9A 3D7ZA 1YI3A 3DLZA 5BVNA 5GJGA 1M7QA 3VJOA 4EHEA 5IH4A 2J5EA 5DEYA 2GDOA 4M0YA 4FIEA 4YMJA 3ZM4A 5FXSA 4EK8A 4YJUA 3FE3A 4NKSA 2WTKB 4P7EA 4A9YA 1M2PA 4AACA 4E4LA 5A4TA 5AP3A 5K5NA 1ZY5A 3FLQA 3F6XA 4GT3A 4ZOGA 3VS4A 5HBHA 3RWPA 3U54A 4M13A 2OXXA 2XA4A 2B9JA 3LFQA 4JT3A 4ZTLA 1KV2A 4UEUA 4O86A 3UG2A 3KC3A 2ETMA 2Y0AA 5AP5A 4BZOA 4USFA 2ZB1A 5KBQA 3ZFMA 4KD1A 2C69A 4ALWA 4I23A 2RFSA 5EFQA 2QR8A 4QQCA 5H3QA 2P4IA 3ZXZA 2CKEA 5FEDA 2HYYA 2IZRA 3VVHA 4M69A 5CI6A 3S4QA 1NY3A 1H24A 5T68A 4UWBA 3PG3A 4X2GA 2WMAA 3I6UA 2HZ0A 2GQGA 4G9RA 5E92A 3QCXA 3H9FA 4FSYA 4AT3A 4EK4A 1VYWA 4G3FA 1DI8A 4TWOA 5DLSA 3R1YA 2QURA 2UVXA 3CS9A 3D7TB 3NYOA 4EWHA 4IAIA 4GK2A 4G2FA 4X2FA 5DR9A 3QUPA 5DOSA 5D41A 4KWPA 4NCTA 2WTCA 1L3RE 4QP2A 3EWHA 2BTRA 4LV5A 3BYMA 5KZ0A 2OF2A 3L9MA 3EN9A 1TKIA 3O7LB 4WT6A 1OIYA 2EU9A 2HCKA 1MUOA 3A7HA 4ASXA 4F0IA 3VQHA 4RX8A 5KNJA 1HCKA 2R3LA 3HV3A 5IMXA 4A07A 3U8WA 4CXAA 1OL1A 4OUCA 3IW7A 3NW5A 4GYGA 4PL5A 4DFUA 4FIHA 4MKCA 3V8WA 5C27A 4CV8A 3NX8A 3FLYA 4PPBA 3H0YA 4EWQA 3RNYA 1H25A 4QMVA 4AG8A 4F9BA 4J8NA 3OEFX 3F3TA 3KVXA 3RI1A 4B8LA 4QP7A 3LJ0A 3REPA 1IAJA 5B2LA 2A19B 4FV2A 3VHEA 2XKDA 3NAYA 3QXPA 4MF0A 3E8DA 5DBXA 2YCQA 2YIYA 4UMUA 4M12A 5M07A 2WOUA 1UU7A 4ACGA 3LMIA 4F7JA 2BHHA 3PWDA 4ZY4A 3C1XA 4FV6A 5LXMA 4GKHA 3H30A 5LCKA 4N0SA 4HJOA 5M4CA 4WNKA 4BDHA 2C3LA 2JIVA 4QNYA 1XQZA 2PZRA 2W5HA 1UNLA 3UO6A 2G15A 4FSRA 4YBJA 4ZJJA 4BDAA 2IN6A 2WQOA 1V0PA 2YITA 5E8SA 3N4UA 3CIKA 1BI7A 4L00A 2YERA 3Q2MA 4C3FA 3DK6A 3HZTA 3QFVA 2J50A 3IDCA 3Q9WA 2CJMA 3SKCA 4Y85A 2DWBA 3GCQA 4G5PA 4NK9A 4BDGA 3NUSA 2CCHA 2ZMDA 1W83A 3Q4UA 3VF8A 4IX5A 2GNHA 1B38A 4M0ZA 4FTNA 4NJ3A 2OFVA 3ZFYA 2UW5A 5I0BA 4RA4A 2JEDA 3H9RA 4I24A 5CWZA 4FUYA 4JL9A 5HE3A 4HVHA 1A48A 4NYEA 2X2KA 3ZRLA 2VZ6A 3ACJA 3FEGA 3KREA 3RALA 4YP8A 3HV6A 4QMLA 2QC6A 3R71A 3WE4A 4O91A 5L6OA 3B2TA 5CT7A 3LMHA 2C0OA 2E9VA 1U5QA 3I5ZA 1CSNA 1OVEA 3AT4A 3QAME 4X3FA 3TDWA 1W7HA 4OTIA 1VEBA 2UZWE 4D1SA 5CALA 4XG8A 3DY7A 3NS9A 3U9NA 1Z5MA 4O0WA 4X7QA 3RK5A 1QPDA 4QMQA 1WFCA 4QMWA 1OMWA 3OY3A 2C6TA 4C34A 2HW7A 2O64A 2Z7RA 3PA4A 4C38A 5AM6A 4F7LA 2GTMA 5FXQA 2PMNX 4FR4A 3C0GA 2A27A 4NFNA 3QZIA 3LLTA 3RPSA 2IPXA 3KK8A 3DU8A 2QO7A 2VV9A 4BGHA 1OZ1A 1I09A 5C1QB 2FYSA 1S9JA 3QRTA 1OL7A 3RPOA 3CJGA 3FMHA 3G51A 3GBZA 4HGEA 4MQ2A 3LFDA 4RJ5A 4X21A 1XH4A 5ANJA 3UG1A 3EYHA 3IGGA 4PTGA 2WOTA 3SXSA 2QO9A 4EUUA 5AAFA 3P78A 3UVRA 3UPZA 1ZMUA 2C1AA 4EH7A 4PMMA 4FT3A 3P9JA 3RVGA 4CVAA 4BCQA 4WRGA 5GIOE 4EOIA 2B54A 4IANA 2W1IA 5IA3A 2PUUA 4OBPA 4JQ7A 4HYHA 5IDPA 3TM0A 3JR1A 4X3FC 3C4FA 3MVHA 4M7IA 3D7TA 4RT7A 2PTKA 2XP2A 3R0TA 1XBBA 4Z7HA 5L8JA 2OGVA 4RIWB 3UNZA 1H27A 2XCKA 1ZYLA 2ZDTA 2XNEA 5K5XA 2XB7A 3NGAA 4F65A 1IRKA 3MESA 3A4OX 1WBWA 3FXXA 3FC1X 4GVJA 5E1EA 2R3MA 3WF9A 5HVKA 5JGAA 5AP1A 3PE1A 3D4QA 5AV3A 1STCE 2C47A 2R3GA 2P0CA 2C6KA 5FP6A 3CY2A 4TYEA 1OBGA 4CKIA 4CYIA 4OTRA 2JBOA 4QQTA 1BL7A 3NUXA 2V0DA 3OF0A 5E8WA 4RBLA 4I6QA 5HBEA 4DTKA 4CFXA 4C4IA 1YQJA 2HXQA 2BRHA 2YJRA 4AXAA 2ERZE 3DDQA 2F57A 3GC7A 5FD2A 3Q6WA 2XNOA 3AGLA 4IW0A 5DPVA 2J7TA 4PTEA 4D2PA 4E5BA 3WZJA 2PMIA 3LQ5A 4XLVA 3ORMA 3VQUA 3DV3A 3AG9A 3VUMA 3PY3A 4GU9A 4S2ZA 4C59A 3EL7A 1GNGA 3PSDA 4AW0A 2UUEA 2C0IA 4F64A 3SXRA 1PXMA 4DFYA 3K2LA 3UIBA 3K5UA 4LL0A 2UV2A 3SXFA 4M97A 3COMA 3OCBA 3BLHA 5CX9A 5A3XA 4FI1A 1SYKA 4FTOA 4TY1A 5K0XA 4BDKA 2ZMCA 2GNLA 1U46A 3ALOA 1MQ4A 1TQMA 2BR1A 2V5QA 3BLRA 3ZO3A 2R3IA 5FEQA 3F5GA 3LIJA 4FL1A 4PMTA 5AMNA 5CXHA 2CN5A 5HO6A 2JKOA 3EHAA 3PIZA 4AU8A 3DJ7A 3QWJA 3TV4A 4AA5A 3R8PA 5HCXA 4YTIA 2H8HA 5CNNA 2CCIA 1ZYDA 2GS6A 5M08A 1J7IA 2QONA 5AV1A 4F1OA 3Q6UA 3UQCA 3WIGA 1Q24A 3QTQA 3FLZA 4NSTA 3HMNA 4CRSA 5H8BA 4PDYA 3ORLA 3SV0A 3QBNA 4RIXB 2R3OA 2J9MA 4FV5A 4LGDA 4YTCA 2ITUA 3LMGA 5E9EA 3GP0A 1RE8A 2OXDA 4WSYA 4XG4A 3F7ZA 3BE9A 5AR5A 4AE6A 2YZAA 3ORKA 2WMWA 4XCUA 4ANLA 5CTPA 4M68A 4YPSA 4ENXA 2FSMX 3COHA 1Y6BA 3F2NA 2BDWA 3G0EA 3V04A 4CV9A 3VHKA 3VS1A 3P7BA 1G8SA 1JOWB 3BU6A 3FLWA 3CGOA 3NLBA 4OGRA 2V62A 2CSNA 4WNMA 4EZ5A 2DUVA 2GNFA 3QQKA 4GW8A 3QCSA 1ZZLA 3R7GA 4RSSA 4X2NA 3WYXA 3OY1A 5HD4A 3PDTA 2VWZA 4OTHA 2VTQA 2XF0A 4D5KA 4L53A 2PU8A 4D28A 3S1HA 3DT1A 3LCSA 4B9DA 5LOHA 4G31A 5KBRA 2C6OA 5LVOA 3DNDA 1MRUA 4QTAA 3VW8A 4W4WA 4DG0E 3MN3A 5FLFA 4BDDA 3ET7A 3ULZA 2VTIA 3DB6A 3ODYX 5E1SA 4CFFA 4IX4A 2UZLA 3UP2A 2ITPA 2YCRA 4QD6A 3ZZEA 4D0WA 2A0CX 3QKKA 3NUAA 1QPJA 5KKRC 4QP8A 3T9IA 4AN9A 4RIOA 3C51A 4HVGA 4RZWA 4CMUA 2XS0A 4FSQA 4ZSEA 4KKHA 2G9XA 3UZTA 3MIAA 4KIPA 2Z8CA 5K4JA 4FSNA 3LLAA 2C5YA 2HWPA 1RJBA 2XEYA 2X2LA 3F3ZA 3FL5A 4IVDA 4I6HA 5ANEA 4DEBA 2VX1A 4FG7A 3ZM9A 1UVRA 4KSQA 2P2HA 3NSZA 4AGDA 4Z9LA 3AMYA 4N4SA 5CEIA 3VAPA 1SMHA 5CU4A 3D5XA 2C1BA 3ERKA 4NWMA 3GC8A 1UKIA 1XWSA 4FBXA 4MTAA 4R3CA 5CQUA 1YXUA 4RIWA 4V0GB 2IG7A 4ANBA 4F9YA 2B9FA 5F1ZA 5IQEA 2FSOX 4CFNA 2Y4IC 3ATTA 3BRBA 3LCTA 1H0WA 2X7OA 4BDBA 4BL1A 3LW0A 3FI3A 4Y73A 5E8VA 2HW6A 4Y83A 2W17A 4Z55A 2IW9A 1H01A 4LYNA 2ETRA 2XJ2A 4O2PA 1OPKA 4RJ3A 5H8EA 3CJFA 4M3QA 1M7NA 3QHWA 2QHMA 3TACA 2JLDA 4CD0A 3VW6A 4CQGA 4XV1A 4HVDA 2JDOA 2OH0E 2X4FA 3GT8A 5KMMA 4NZWB 4MD7E 3ZC6A 3E3BX 2EUFB 1SVHA 3I7BA 3W55A 2JDRA 1FVTA 1Q62A 1YHSA 1OI9A 5KMKA 2ZYBA 5LMKC 3ITZA 1ZOEA 2ZV2A 3KB7A 4FNXA 5AIKA 4JVGA 3SLSA 3ZTXA 4FTUA 4Y95A 3RINA 4Y5HA 5JFVA 1H1QA 1ZXEA 2UZEA 2LGCA 2Y9QA 3QGYA 4C35A 3V8TA 1AQ1A 4D2WA 2VNWA 3UYTA 2C6MA 2PE2A 2XNMA 2BIKB 4FX3A 4HPTE 4DEEA 3LCOA 4KINA 2NNWB 2FGIA 2XEZA 5FXRA 3MTLA 1Q97A 3RAWA 4ACDA 2Y8OA 1H8FA 3BGPA 3IDPA 3OWLA 3B2WA 2UW4A 1H00A 2YIRA 4QRCA 4YBKA 4DBXA 3MVLA 4YTFA 4Z16A 3HUCA 3VUIA 3ANRA 2OZAA 3WZKA 1TQPA 4EK5A 2G2IA 1DM2A 2W96B 3BU5A 5J5SA 1XH5A 5EOBA 3I6WA 2QO2A 5DYJA 1JSVA 4O7NA 4UZDA 4V01A 4MXXA 4QMMA 4CKRA 5JFSA 4PMPA 5K0KA 3GUBA 4KUJA 1R0EA 5HLPA 3Q52A 4EKLA 4H1MA 5CU0A 4IVCA 3HMIA 5AX3A 2HAKA 3E64A 4DH3A 2XM8A 4RIXA 3IKAA 5AP6A 2WMUA 3DTCA 4H3QA 4TYIA 3BX5A 4TW9A 4EH4A 4EK6A 4K11A 2BMCA 1J7UA 3DFAA 4QTBA 3NMUF 4CFWA 5KHXA 3EQIA 5DT4A 4IAKA 1FBNA 4MQ1A 2PUNA 2PVLA 3NIZA 4L9IA 3DA6A 4O0XA 4MXCA 4OTGA 4ZLYA 3BHHA 2G2FA 2GQSA 2F7XE 2BRNA 3JUHA 3NWWA 4F7NA 3NDMA 4X2KA 4X6QC 2PVJA 3G6GA 5ANOA 3T3UA 5IEXA 3C5IA 5C8NA 4ITHA 1FINA 4LGGA 2BRMA 3BV2A 1NW1A 3VWAA 2PVKA 3UP7A 4AS0A 3PJCA 4DEHA 3C4WA 1Q3WA 3PZEA 5CT0A 4WBOA 3BEGA 1V0OA 2E9OA 3DAKA 4C61A 3FI8A 4IVBA 3A4PA 3O8PA 2Z02A 3EN4A 2FH9A 2OI4X 3OEZA 4PNKA 5HNIX 4R6VA 4FTCA 5HNBA 2W1CA 3G33A 3ZEWA 2GHLA 5G1XA 4E20A 2ZDUA 1W98A 5A14A 3D14A 3ORZA 1WZYA 3UOKA 4FSTA 3UMXA 3R1NA 4EQMA 2WMQA 3GB2A 4DGNA 3G90X 5EW3A 5HICA 4BRXA 4NW5A 4I92A 2YM4A 3RM6A 4DCAA 3CTQA 4FEVA 1BL6A 4OTWA 2JGZA 3M1SA 4A4XA 1UU8A 3EQPA 1WMKA 3NYNA 4AX8A 2UZBA 3QZGA 1YWRA 5EM5A 3R9NA 4A9SA 4U3YA 4E73A 3NVMB 5IG1A 2W7XA 4JDKA 4YZNA 3AC1A 2J5FA 4B0GA 4S31A 5EHOA 4FGRA 4CYJA 2H9VA 3HRCA 3MPMA 4GUBA 4ZTNA 1MRYA 2XZSA 3IW6A 3JXWA 4V0GA 2Q0BA 5ANIA 4G5JA 3RPVA 1OGUA 4AOIA 4M15A 2QQ7A 4ITJA 1YVJA 4DCEA 4DEAA 3F9NA 4AZWA 2ZV9A 4TWNA 3G9NA 5B0XA 4YPDA 3PRFA 1IAHA 1YRPA 3UO5A 3D94A 3KK9A 3FI2A 1XBAA 3SW4A 4I41A 2R3PA 4E6AA 4IX6A 4EOMA 3VO3A 4AFEA 3BPRA 4ZSJA 3DBEA 3FSFA 3QX4A 4YHJA 3ZO1A 2IWIA 2VU3A 5LARA 4HCVA 2BIYA 2WMRA 3PJ3A 2JKQA 4KS7A 4Z3VA 3IONA 3KXMA 2I0HA 4BY9E 4DEIA 2JFLA 4AW2A 5M4UA 3W8LA 3FWQA 4BI0A 4ZY5A 4J53A 4LOOA 5CAOA 1ZARA 3P7AA 2JITA 2R0IA 2HZNA 3QTIA 2YJSA 5HE1A 3DPKA 3E88A 3FQSA 3WBLA 2GFSA 3LFFA 4QYHA 3A8WA 3CC6A 4RWLA 4EZ3A 5CAPA 3DXQA 4U6RA 5FTOA 3TZMA 4J71A 4WO5A 1YOJA 5CQWA 2QG5A 5HG7A 4RVKA 3BU3A 3FLNC 2OW3A 2JFMA 3THBA 4EOPA 2CNVA 4I21A 5M06A 4UMRA 3OCSA 2VO6A 2C3IB 1Q8TA 3QUDA 2RIOA 4I20A 3V5TA 2R4BA 4JS8A 2WMVA 4KIKA 4NM0A 2J0LA 3D5VA 5JRSA 4RIYA 4BB4A 4PL4A 3CE3A 4PPAA 3VBQA 3VS5A 4EHVA 1YWVA 3DKFA 5LVMA 1REKA 4GJ2A 3ZSGA 2EXEA 2XYUA 3RBWA 4FSWA 5EKNA 3ZLYA 4XBRA 3DBCA 3QHRA 3FLSA 2DS1A 1LEWA 3R7OA 3TKUA 4BKYA 4E1ZA 4C4HA 3L9NA 1B6CB 3VS6A 3KCKA 4QYGA 2CPKE 4XEYA 3MJ2A 3G9LX 3I1AA 3QRJA 4KRDA 4EH5A 3TKIA 4YZMA 2BHEA 3HA8A 2VTPA 4XG6A 1JAMA 4TTHB 3E7OA 4FTJA 4MF1A 4UALA 4C3PA 4O83A 3IS5A 3QC4A 5C26A 3ENHA 2YN8A 5D9HA 5CEPA 4F09A 5HCYA 4FZ7A 5DH3A 3ZUTA 3JY9A 1M14A 2WD1A 1E9HA 3DKGA 4JI9A 1P4OA 3NIEA 4U81A 1QL6A 3LQ8A 4WD5A 3DOGA 2PZ5A 3MIYA 2J0KA 3ZBFA 2XIXA 3QD2B 1LP4A 3OUNB 4LV8A 2HZIA 4GMYA 1XH9A 1YDRE 4YLLA 3RGFA 1I44A 4RQVA 1OL6A 2X81A 3IECA 4EH6A 4A9TA 2HIWA 4KS8A 4AN2A 1UNHA 2BZKB 2F7ZE 2IVUA 2A4LA 2X1NA 4M67A 2C30A 2UZUE 3R83A 3KXNA 3HECA 4YC8A 3SOCA 4NJDA 5FUTA 2HXLA 2GHGA 3MH2A 4GUEA 4IM0A 4KSPA 5TOZA 4GT4A 4BBFA 4G3CA 3D15A 1HOWA 3PVBA 4X2JA 5FBNC 2UW3A 5LJJA 1X8BA 4RVMA 3W33A 4FVQA 4A7CA 4ZSGA 4DHFA 5T6KA 2GCDA 3E3PA 5LCJA 4O96A 4S34A 5B2KA 3MFUA 2PVNA 5BYLA 1Q8YA 2R7BA 3CR0A 4LOPA 2ITVA 2OBJA 3DAJA 4QP6A 2VWIA 4GYIA 1JPAA 4GK4A 4X6RA 5B7VA 5BYYA 3NNXA 3FMJA 1XR1A 4HCUA 2ZAZA 3R28A 4QMZA 3LFNA 5GHVA 5LVLA 5KZIA 4DLIA 3FZSA 2NO3A 5HG5A 4MVFA 1JBPE 3KXHA 3RKBA 1NA7A 4ALVA 3AMAA 4U42A 4W9WA 3W32A 4ASDA 4OT6A 3EIDA 3R00A 3DQWA 3AC5A 5ACKA 4EJ7A 4JR7A 2CLQA 3HEGA 4BIEA 1GZOA 5TO8A 3WI6A 4D2SA 5JQ8A 4K18A 2UVZA 2WO6A 2J0IA 4CFUA 4CMTA 4D1XA 3OUKA 2A2AA 2QHNA 3T8OA 3SVVA 4BYJA 5A9UA 5DMZA 2OIQA 4C02A 2JKKA 4EYJA 2CGXA 2X9EA 4IB5A 3FZPA 4LRJA 3EMGA 3KRXA 3OW4A 5CF5A 4FNZA 2AC3A 5CSPA 4XHKB 2C5VA 3UZRA 2BAKA 3GENA 3NW7A 5FM2A 3HAMA 1B39A 3MVMA 5M55A 2WMXA 2X6EA 1ZYSA 4XRLA 3A61A 5CLPA 3TNWA 2C0TA 4ANMA 1J91A 5F4NA 2QU6A 4ZMEA 3F5UA 5AP2A 3P5KA 3GVUA 3OXIA 4W4YA 3QRUA 3MTFA 4DC2A 3QXOA 3RZBA 3OVVA 4I3ZA 4C0TA 2QKRA 3OG7A 1K9AA 3JYAA 5HO8A 4IMYA 1IA8A 4TYJA 2YM7A 3L9LA 4L01A 3HKOA 4UY9A 3W2OA 2O3PA 2JC6A 3PY0A 4ASEA 1JKLA 2NRUA 5CEQA 3E92A 4RC3A 3OXZA 2RFDA 4FNWA 2HY0A 4HNFA 3UOJA 5FEEA 1YXTA 3RNIA 4JQ8A 3UNJA 3WF5A 2R3KA 4RX9A 3POZA 2XCHA 4FKGA 5CVGA 3ZXTA 4FKTA 3OXTA 1KUTA 1FVVA 1OIRA 2OH4A 4ARKA 4M8TA 3FZ1A 3EN6A 4I93A 3TUBA 3CTHA 4X3JA 4C58A 5ITAA 4MBJA 4C2WA 2I1MA 5IEYA 2YZLA 3DZQA 5E8YA 3WZEA 4G16A 1O6KA 1NVSA 1E1XA 4R7IA 4ACMA 2UZOA 3D0EA 4EI4A 4F7SA 4NUSA 4ORKA 3PXQA 4PF4A 4C4JA 3QLFA 5DR2A 4CT1A 3FMMA 5DNRA 4WG5A 4U7ZA 5I9VA 5FBOA 2ZOQA 2VUWA 2W9FB 4JRNA 2PMOX 3IQ7A 3FXZA 4EBWA 3UMWA 4NT4A 4TRLA 3JY0A 4W8EA 3FMNA 4QPMA 3O0GA 4DGGA 1OKZA 4GSBA 4RZVA 1XH7A 2YM5A 3D83A 4F63A 2V55A 5T3QA 3QTWA 5I9XA 2G2HA 4P5QA 4EC9A 3TG1A 5GZ8A 2F2CB 4AWIA 3RK7A 5IUHA 4HZSA 4NIFB 4Q5HA 4TNDA 5BVOA 3NNWA 4USDA 3O7LD 3BIZA 5I4NA 4NCTC 4ANSA 3II5A 3S0OA 1OECA 3IPHA 4D2TA 2QKWB 3RCDA 2ITZA 5CS6A 4RX5A 5DA3A 5A46A 3VRZA 4E26A 2HY81 2J4ZA 4HYUA 4G17A 2XIYA 4IEBA 3PYYA 4OTFA 4RFMA 3TXOA 2X4ZA 3GU6A 3KN6A 1FMKA 3VS0A 4JRVA 2QLUA 4FSUA 1SNUA 2VTMA 4C4EA 2OJGA 3Q4ZA 1T45A 5E7RA 4BCKA 4IZ7A 4Y46A 4HZRA 3V6SA 4M66A 4DA5A 2WIHA 4I4FA 3GEQA 3MS9A 2XNNA 3JVSA 3UIXA 1WVWA 2PZIA 3GFEA 4CQEA 2GFCA 1OIQA 4FEXA 3OTUA 2JD5A 4AOTA 4DE4A 3H0ZA 4LL5A 1KE9A 1Q61A 4NU1A 4FIIA 5BVEA 4DITA 2WTWA 3Q5IA 3N4TA 3LOKA 3UNKA 4D9UA 2YEXA 1URCA 3G15A 1W84A 2BDFA 3QKMA 4A9RA 1ZOGA 4GJ3A 4ZY6A 3FPMA 3CSVA 2Z7SA 4KAOA 3NEWA 2QOQA 4EYMA 2IZTA 2CNQA 3P7CA 4MEDA 2F9GA 3OHTA 4PP9A 2REIA 2Z7QA 3FZRA 3QQHA 1A9UA 4CSVA 5KMOA 5CXZA 2B55A 4L52A 4E4NA 4XP3A 2OZOA 4AOJA 1NT2A 2YDJA 5DR6A 3QTSA 2VRXA 5DGZA 1OB3A 3QCQA 2YACA 1U59A 3P86A 5AV2A 1H1RA 3F82A 3OT3A 5AUVA 4W4VA 1J7LA 3MPTA 4YJOA 2W1ZA 3DAEA 3VS7A 4PP7A 4U9AA 1YW2A 2OICA 5KMNA 4Y5QA 1JLUE 1F0QA 1ZY4A 3W16A 1CKPA 3IK3A 3L8PA 4QNAA 3QQJA 4BDEA 5EDQA 5EI8A 3VUGA 2X6DA 5HIEA 4J1RA 4KBAA 4BI1A 2ZB0A 4UXQA 2OJ9A 4AZSA 5JK3A 2F2UA 4WA9A 2VTLA 3HP5A 4JIAA 1UWHA 1V1KA 3MVJA 5ANGA 2XNBA 4AZFA 3VUDA 3E87A 4UMTA 5AUWA 1Y8GA 3GCUA 4BIDA 3FKLA 4BDFA 4TL0A 4LUEA 5I9YA 5AR2A 4D4RA 1PF8A 4RX7A 3SW7A 4IAZA 4EZ7A 5ETAA 2X7FA 5M4FA 5FDXA 2PVYA 2OIDA 2R3JA 2Y7JA 3NUNA 4O27B 4W8DA 5I3OA 4TNBA 3Q9XA 3MJ1A 4DINA 3WIKA 2BVAA 5GZ9A 3UC3A 2VO7A 3V3VA 4LMNA 3DCVA 2C5OA 3LE6A 4GG5A 4WG4A 2WTKC 2EB3A 2OG8A 1YKRA 3QQUA 3WOWA 4CRLA 3HMOA 3L9PA 4TN6A 4U79A 3NNUA 1FOTA 3BGZA 3VNTA 3BLQA 3LJ1A 3Q4TA 4IHPA 2XM9A 3PIXA 3V5JA 2XK9A 5CAVA 4QP1A 4M14A 3HGKA 5C4KA 1YOMA 2ZM3A 2EWAA 4KB8A 3MV5A 3V5QA 4RGJA 5D1JA 4D2RA 4GFGA 4DGLC 3PVGA 4L46A 3A62A 4K2RA 4GG7A 3ZUVA 1EH4A 2Y4PA 5A4LA 2GTNA 2AYPA 4EOOA 3IGOA 3R73A 2RF9A 3HYHA 3FKOA 5IF1A 5IZFA 3W8QA 5CEOA 3GCSA 4FTRA 3B8RA 4QYEA 5AR7A 1HCLA 2WEVA 4FVRA 4MBIA 4PWNA 5FDPA 4YZDA 3R8VA 1WBNA 3ETAA 4AZVA 3PA5A 2BAJA 2WAJA 4N70A 4NIFA 1TQIA 4CZTA 4BFMA 3AMBA 4EKKA 1DI9A 1Y8YA 2ITQA 3P08A 4QMXA 3U9CA 4DH1A 5J9ZA 1P5EA 4XRJA 4QMNA 3P23A 4IM3A 3HVCA 3ORIA 1O6YA 3NVKI 4FKJA 4QMPA 2Z60A 3QZHA 5EQEA 3FUPA 4NTSA 2YM3A 4EOJA 3WE8A 3FL4A 2JBPA 4YJTA 4OBQA 5C8MA 4BWPA 5CEMA 4O0UA 2G01A 2ITTA 2BROA 4RLKA 1J1BA 3KY2A 3WILA 4O0TA 4WNOA 5L4QA 3FY0A 4FEQA 5DRBA 4BBMA 1BX6A 4TYGA 3MFSA 3FV8A 2YDIA 4J99A 1ZYCA 4XP2A 1W8CA 5HIBA 4LM5A 1RDQE 3NAXA 3Q04A 1XH6A 2WGJA 4P4CA 2RGPA 3RHXA 2XMYA 3UVPA 5LVPA 4DH5A 5A54A 4JX3A 2GNGA 3MFTA 3ZONA 1BMKA 4C33A 4C62A 4DEGA 3ZHPC 5J1WA 1GY3A 3GQIA 4FKVA 4QMUA 5HNGA 1H1SA 4FEWA 5GJDA 4H05A 5IQHA 5IA4A 4O7VA 4TWPA 2B7AA 3EZRA 2CDZA 2PPQA 1R3CA 1WAKA 4QP4A 2XIKA 2O2UA 2XVDA 4P5ZA 3UPXA 1PMVA 4KABA 1OKVA 2C5NA 5GNKA 3A99A 3MDYA 4L43A 4NH1A 4Z7GA 1IA9A 4N6YA 2ITXA 4AZEA 1K2PA 4IJPA 4J7BA 3PSBA 3VULA 3DK3A 4IVAA 5EOLA 5L8LA 4YZ9A 4IE9A 3R9RA 3KMMA 1RW8A 3HMPA 3ZBXA 3CKWA 3VBTA 4BGGA 5KMIA 2V7OA 1GIIA 2P3GX 2R3RA 4IC8A 4IJ9A 4XV9A 4AAAA 3LXLA 5I9ZA 3DNEA 4JAIA 2ITWA 5M56A 1OPJA 2JDTA 1BLXA 1BYGA 4LUDA 5CNOA 4O7ZA 4HGTA 3BYOA 4R3PA 4GU6A 1KV1A 5B2MA 2C6EA 2W99B 1YHVA 4FIFA 4I0RA 3VC4A 5HLNA 3U55A 4IQ6A 2XK4A 4ZZNA 5JH6A 1KE5A 4EORA 4BCFA 5HO7A 4IWOA 1UU9A 3WF7A 1IASA 5LMAA 1FGKA 5KMJA 3KRLA 4ZEGA 4XBUA 2RL5A 4RJ7A 3R30A 1CKIA 2VTHA 4XG3A 1KOAA 4FG9A 3W2SA 2BPMA 3R7EA 1E1VA 2XRWA 5JFWA 5JRQA 1OUYA 4RLLA 2VTSA 3H4JA 3ORNA 1GIHA 3DS6A 3GC9A 3QU0A 5H8GA 4BHZA 3I7CA 4AW1A 4ZZOA 4E93A 2WTJA 2BZJA 3G0FA 3TZ9A 1PW2A 1GOLA 3QD0A 3F2RA 5IQDA 2FUMA 2GU8A 1PXLA 3A7GA 2JDVA 2X2MA 2RFNA 3C0HA 4RRVA 2DYLA 4CTCA 1KE6A 4GS6A 4XJ0A 3BYUA 4DEDA 3TDVA 4IZYA 1Y91A 3EOCA 2QNJA 4FKLA 4GFMA 3FPQA 3F61A 3PUPA 2OO8X 1PJKA 4ZS0A 5CZHA 3RHKA 5ETFA 3GC0A 3R7IA 4BTMA 4IACA 5IA2A 4K0YA 2V7AA 2VN9A 1PXIA 2WU7A 3BYSA 1OKYA 1T46A 3HDMA 4A06A 2E9NA 2O0UA 4J8MA 5DWRA 3BQCA 3QQLA 4BCOA 1OM1A 2QOFA 2YIXA 3TNIA 3AQVA 3NR9A 5E8TA 1JWHA 4XYFA 4GEOA 2X39A 2XJ1A 5M44A 3IDBA 3ENMA 3I60A 2XKEA 3KULB 4I0TA 4V04A 2C6DA 5HG8A 3M42A 4E5WA 4ACCA 2BILB 3DB8A 1G8AA 4DT8A 1CMKE 3F66A 1Q8UA 3BZ3A 1YHWA 2OF4A 4H3PA 3C4XA 3BE2A 3EFLA 4FMQA 4FV3A 5GINE 4OTPA 2OXYA 4B4LA 4C7TA 4I4EA 4DTAA 3Q3BA 4EH8A 4O0SA 3QX2A 1WBTA 4AP7A 3UOLA 2FA2A 2E2BA 4FIGA 1ZOHA 4KIQA 4L7SA 2B1PA 3KF7A 4FTQA 4PNIA 5AADA 2CKOA 1Q41A 2SRCA 4L6QA 3RM7A 2PE0A 5J7BA 1YI4A 4DH7A 4GFOA 3ZO2A 3HRFA 3KGAA 4OLIA 3DQXA 3CQEA 4YLJA 4O7YA 3PPJA 3LXKA 3PIYA 3POOA 5EYKA 4FE2A 5HG9A 4CFMA 3FJQE 4TYHB 5C8KA 3RMFA 5DIAA 3TWJA 4QPSA 4G6OA 3KRWA 3LXNA 4FT0A 4EOQA 1H1WA 4ENYA 4EOSA 3D2IA 5CU6A 1ZLTA 4G6LA 2Q0NA 5M53A 1QCFA 3QRIA 3V8SA 1ZWSA 2FSLX 4IAAA 4R8QA 3VUTA 3GU5A 5BUJA 5A4EA 5HI2A 1H26A 3KCFA 3LZBA 2PULA 1Q5KA 2C3JA 1U5RA 1YI6A 3DFCB 5IH5A 2KTYA 3ZLSA 1LUFA 4J98A 5IMEA 4UV0A 3OCGA 3GNIB 5AX9A 4FEUA 2J2IB 3LM0A 1H08A 3BCEA 2UZTA 4L7FA 1ZMVA 1NVRA 4R3RA 3ULIA 2I0EA 1JKSA 3FXWA 4YHFA 3F69A 1WBOA 4ALUA 3V6RA 2ACXA 2FO0A 3BV3A 3HNGA 4MNFA 1G3NA 5FM3A 2VWBA 4O7SA 2PYWA 2VTOA 2VX3A 5HE0A 3O8TA 3UJGA 2X8EA 3U4UA 4CEGA 3MYGA 4QYFA 3TZ7A 2XJ0A 4BDJA 3PY1A 5LWNA 3H3CA 3E8CA 4IWDA 5F20A 3RPYA 4YC3A 3COKA 3RZFA 4B7TA 1KSWA 2JAMA 2QLQA 4CZYB 4QP3A 2YLFA 4BCIA 3NUPA 3VF9A 1KOBA 3QF9A 5HD7A 3RTPA 4BCPA 4BR3A 4BTJA 3PPZA 3QLGA 3Q9ZA 1YWNA 3M2WA 3DKCA 1Q8WA 3LFSA 1YOLA 4FTKA 3HRBA 2W1HA 3K5VA 3MA6A 4Y8DA 5JSMA 2YCFA 3CBLA 4DFNA 3ZEPA 2VX0A 3VUHA 4DLJA 4IB3A 1R1WA 3VRYA 3R1QA 3MBLA 3EN5A 3IO7A 5FTGA 3UGCA 2OWBA 2P2IA 3BHTA 3AC2A 2NP8A 2B53A 4EOLA 3GXLA 4YJNA 4RQKA 5EHYA 1J3HA 4O82A 4QOXA 5LVNA 3TIYA 4D4SA 4YJVA 3K54A 4YJPA 2HZ4A 5CU3A 5AUUA 1PXNA 2RG5A 2W1FA 3LFBA 3KXZA 5BVKA 4KBKA 4CZUA 3FZTA 3LHJA 3TTIA 5I5ZA 3FYKX 3MY5A 4IC7A 5A4CA 2WU6A 4JXFA 4FV1A 1XKKA 5AP7A 2F4JA 2R5TA 2UW9A 3QYWA 4FSMA 3UTOA 4F6WA 5HU3A 2JIUA 2FB8A 5CANA 3G5DA
chains in the Genus database with same CATH superfamily
3PPKA 4D55A 5LWMA 3I79A 3BGQA 3NUYA 3O8UA 5D7AA 5M51A 4IFCA 5IA0A 5AFVA 2ITYA 5E4HA 3P79A 5AUZA 4GKIA 3ZRKA 4O0VA 3CEKA 5HESA 3ZUUA 2XALA 4W4XA 3LCKA 4U5JA 2R2PA 1R39A 4FTTA 4M69B 3DKOA 3MH3A 2XAOA 3LFCA 1PKDA 1W2CA 2XK7A 3ZO4A 2Y6MA 3R9OA 2BFYA 2AC5A 4K8AA 4D9TA 4E6CA 4HVSA 2X8DA 1DAYA 2NPQA 3EN7A 3TNPC 5BPYA 4TZRA 5KX8A 2PSQA 3PXKA 4YZCA 2OJJA 5AR4A 4XUFA 3WARA 3ALNA 4FKWA 2Z2WA 3UQFA 1TVOA 2YM8A 3W2RA 3MB7A 4AT4A 4O7WA 3FDNA 5A4QA 3C4ZA 2PMLX 4UB7A 5IUGA 3I81A 1PXJA 3KEXA 3LM5A 3Q32A 1A06A 3BWJA 3B8QA 3LKMA 4FUXA 3E8NA 4GT5A 4RVLA 1SVGA 3P0MA 1ZZ2A 4G3GA 4NW6A 5AA9A 2ETKA 4WHZA 4PDSA 4ZP5A 5DN3A 4R7BA 4FKRA 4E5AX 1WBSA 2ONLA 4AQCA 3SHEA 3O50A 5CAUA 3HUBA 4TYHA 4B99A 3VONA 1KE8A 2J90A 3BWFA 1H28A 3I0QA 5KMLA 3WYYA 3UO4A 3CPBA 3DGKA 2VO3A 3WZUA 3R21A 1KWPA 4L45A 2OJIA 2I0YA 4J96A 5E8ZA 3HP2A 4JJRA 5IPJA 5EHLA 3N4VA 5DEWA 2QOHA 3O2MA 4O84A 3AT2A 3ELJA 4MHAA 5AWMA 3SG8A 1URWA 4MH7A 3SA0A 2I6LA 4ACHA 2BCJA 3IOKA 3KU2A 5JQ5A 3SRVB 4B8MA 4L8MA 1SNXA 4JG6A 4P90A 3VJNA 2QVSE 4F9CA 5HBJA 2XRUA 4OTDA 3S95A 4CFVA 1L8TA 4EJNA 4FV9A 4HGLA 3GQLA 5AEPA 5J5TA 2QU5A 4AW5A 2VTJA 2LAVA 3NW6A 1XHAA 2QG7A 1VYZA 4EHZA 4AGCA 5L2TA 1QPEA 2V22A 4NFMA 4YU2A 1Q99A 3KMUA 4ZTHA 5A6OA 3A7JA 3R7VA 3Q96A 2WXVA 4F08A 3MW1A 3KKVA 5HVYA 4YUQA 3E62A 4MD8E 3I0OA 2VTNA 4ZSLA 3SD0A 4BYIA 1PXOA 4XX9A 5DE2A 5J1VA 2R64A 2R3HA 3OFMA 5AJQA 5HLWA 4JX7A 2CKQA 3DBQA 4CKJA 3KA0A 4PUZA 4RFZA 3R8ZA 5BVDA 3MB6A 1P14A 1IG1A 2JAVA 4KIOA 4BCNA 3F5XA 4AN3A 3DTWA 3KVWA 3CCNA 3TNHA 4BF2A 4G9CA 1OPLA 3S3IA 4WNPA 4E8AA 2W06A 2HOGA 4F9WA 4DDGA 4L42A 1ST0A 3KXXA 4S32A 3QC9A 5JZNA 3RJCA 3JPVA 4M84A 4FK3A 4FT5A 1JKTA 4KBCA 4X3FB 3S2PA 5BVWA 2PUPA 4V05A 4FG8A 2XK8A 2I0VA 2ERKA 4QYYA 4I6LA 3FI4A 3F5PA 2AQXA 5GIPE 3VN9A 4XG2A 3ZU7A 2I7QA 3LFEA 3FHIA 4CCUA 3U4WA 2BUJA 3F3WA 4EUTA 3VUKA 4NKAA 4BDIA 4U0IA 4I1ZA 4LFIA 4DGMA 4K33A 2XK6A 3QWKA 4NM7A 3LVPA 5IQCA 2VWYA 3NPCA 3OZ6A 4YURA 5J9YA 5KHWA 4YTHA 5HCZA 4H39A 3Q53A 2YWPA 2W5BA 3BKBA 4HPUE 1WBPA 3BBWA 4LI5A 5ACBC 5TT7A 2BKKA 5I3RA 1F5QA 4QMSA 4I5MA 1S9IA 4DG2E 3ZS5A 1BUHA 4MCVA 5DG5A 1P2AA 4AXCA 3ZC5A 3DBDA 4ANOA 4JBVA 3SX9A 3D2KA 5L2WA 5CVFA 2VGPA 1PMEA 5FTQA 2BALA 3KRRA 3ZH8A 4YNOA 3RAKA 5IQGA 3C5UA 1JSUA 3EQDA 4D1ZA 4D2VA 4F6SA 2J0JA 4NEUA 1RQQA 2GS2A 2W4JA 4O4EA 2XBJA 4YJQA 5EM6A 1LEZA 3L1SA 4GVAA 3BHYA 4Q9SA 2IO6A 4BWXA 2QR7A 2O5KA 3FQEA 5CY3A 4WIHA 4RG0A 3CGFA 3OP5A 4O7LA 3BQRA 3G2FA 5HQ0A 2HWOA 2VNYA 4L3PA 5EDRA 5HEZA 3Q4CA 1R0PA 5HGIA 1VJYA 4JIKA 4DH8A 5BNJA 5HTBA 3DJ6A 3PWYA 4FKSA 2W05A 2EXMA 4XOZA 4A4OA 4Q2AA 4R77A 5M09A 1W82A 3OBGA 3T9TA 4F1MA 1WCCA 2YCSA 3LQ3A 5E91A 2RKUA 5DVRA 5E8XA 1Z57A 2PVMA 2YM6A 3TUCA 3T3VA 3AC4A 2JDSA 3OOMA 5CASA 2WKMA 2ZVAA 1GZNA 4JR3A 3R6XA 2J6MA 4ID7A 4U44A 4WSQA 4RWIA 5CEKA 4N57A 4WKQA 4O4BB 4DFZE 4F1TA 3C50A 3E93A 3RAHA 4AT5A 3GOKA 3VS2A 4CMOA 4F0FA 1O6LA 5L8KA 3GU8A 4OAUC 3PA3A 4CG9A 2QOIA 3I5NA 4J52A 3W2PA 5L2SA 1APME 2WTDA 4YHTA 4BCMA 3O96A 3EFWA 4D0XA 3FYJX 2VTTA 3ID6C 2IZUA 2WQEA 2UZVA 4ZTRA 3SRVA 4LDTA 1UA2A 2AUHA 4LGHA 3C4CA 3L8SA 1NXKA 4GH2A 3MY1A 2PHKA 2RG6A 5C01A 3EFJA 3D5WA 2B9IA 2YAAA 3P4KA 4XNEA 5CENA 2ZJWA 1PYEA 2GS7A 4UXLA 1R78A 3HV4A 3UIMA 3C7QA 4BGQA 2IVTA 4FV8A 5IQIA 4QO9A 3R01A 4YO4A 4JQEA 2W1GA 2X9FA 3TEIA 4BI2A 4E3CA 4UX9A 4MXOA 4U41A 4ZMFA 2NRYA 2WHBA 2YIQA 4IB1A 4QT1A 3TT0A 3UDBA 3UDTA 3PE2A 4AXDA 4WG3A 5KKRB 1XJDA 3W2CA 4XS2A 5BYZA 2UW7A 2OFUA 4QQ5A 3V5WA 4CT2A 3GCVA 3AT3A 2EXCX 4E6DA 4DHJA 2XARA 2VWUA 5L2IA 3JS2A 3N9XA 4U8ZA 1PMNA 1PY5A 3EQBA 1XO2B 3HA6A 1YXVA 1CKJA 3QGWA 4OT5A 3GI3A 2IVSA 2IZSA 4JDIA 5HKMA 4OTQA 1MRVA 3NCZA 5I9UA 5DHJA 3ZFXA 1ST4A 3E5AA 2G1TA 3C0IA 2WIPA 1PXPA 5H2UA 4R1VA 4OR5A 2KULA 3U6HA 4ZSAA 3IOPA 5IH6A 5C03A 4JBPA 4K9YA 3W2QA 4O7RA 3UZPA 4FF8A 2C5XA 5TR6A 4EQUA 3PLSA 3R8UA 4IM2A 3QCYA 5J87A 4EHGA 4E4MA 4BC6A 4UYNA 1CM8A 4EEVA 2Y4IB 2ZM4A 3PG1A 4BZNA 4DG3E 4PDOA 3R02A 2OU7A 3TV7A 4F9AA 4UWYA 5EYDA 2YISA 3QQGA 2CKPA 3AD6A 4PL3A 2RFEA 5KE0A 4O7TA 5E90A 2O8YA 3F3VA 4FKPA 4EOKA 4LRKA 4I6BA 5CI7A 2JIIA 3MPAA 3L8VA 3PJ2A 3OTVA 4C3RA 2R7IA 4QPAA 1ND4A 4BWKA 4K6ZA 4H58A 3DXNA 4KKEA 4YO6A 3TL8A 4AE9A 3ZRMA 4YR8A 5JFXA 3LXPA 3EH9A 3UOHA 1OUKA 4O6LA 2PL0A 3CY3A 5DI1A 4XP0A 1GZ8A 1IEPA 4K1BA 2WNTA 3A7IA 4FODA 4O1OA 5FRIA 3QD4A 2GNIA 2QOOA 3QYZA 4FZAB 4YJSA 5BQ0A 1OIUA 1AGWA 3A60A 4G6NA 2OLCA 4UZHA 4QQJA 4YSJA 1U54B 3DJ5A 3KL8A 4L67A 4FYNA 4ASZA 3D5UA 3EQCA 3O71A 3KF4A 5IA5A 3PXFA 3RP9A 2EB2A 2ZV7A 3KFAA 4F6UA 2JKMA 3DK7A 4FGBA 2QCSA 3R1SA 5AR3A 4RVTA 2QOLA 1GJOA 4OAVB 4UWCA 2UVYA 2WFYA 4EL9A 2O65A 1FQ1B 5CZIA 5D10A 4GCJA 3RAIA 3SDJA 3DZOA 3QALE 3F88A 4U3ZA 5EH0A 4QP9A 4R7HA 3VIDA 3WZDA 4BBEA 5J95A 3VBVA 1ZMWA 2H96A 2W4OA 5IDNA 4JG8A 3ZOSA 3FAAA 4BTKA 2GMXA 3NYXA 3BLAA 3MH1A 1MP8A 4FV4A 1DAWA 1PXKA 4BN1A 3A7FA 3CKXA 2WMSA 4FK6A 4U80A 5ANKA 1Q8ZA 5HX8A 3BYVA 5HIDA 4FTIA 3ACKA 4ZIMA 3PFQA 4TWCA 4JG7A 3C13A 3FBVA 3ROYA 4F4PA 4HOKA 4FC0A 3EQRA 3A8XA 1WVYA 3AOXA 5L6PA 3TN8A 2FSTX 5IQFA 2ESMA 1VR2A 2J51A 5AM7A 5BMSA 5IQAA 4FTMA 2XNGA 3EZVA 3ZYAA 4ZLZA 4JDJA 2GSFA 4MX9A 3QL8A 2BFXA 3JVRA 2VD5A 2WQMA 4JLCA 5EK7A 2IW6A 5CSWA 3TUDA 4O0RA 4EH3A 4BICA 1UWJA 5JN2A 3A2CA 4LOQA 5J79A 4MYGA 3R04A 3KMWA 4II5A 1WBVA 2WB8A 4ZJIA 4FRFA 4CG8A 2IW8A 3Q2JA 3LFAA 3TMOA 3EQFA 1VZOA 4MXAA 3CTJA 5JEBA 2Z7LA 1UKHA 3EQHA 1REJA 5D7VA 4R78A 3HDNA 4FZDB 4RFYA 5IEVA 4DFBA 2PE1A 4DTBA 2PWLA 4G3DA 2OZAB 3Q9YA 3EQGA 4ERKA 4AAYA 4FZ6A 5CYIA 3OBJA 3HLLA 4FNYA 4CTBA 1BKXA 4XH6A 4BHNA 4C36A 2R0UA 3SQQA 3PJ8A 2EVAA 4MD9E 3BL9A 2BRGA 3F3UA 4USEA 4APPA 2YHVA 3CXWA 4Q9ZA 3GOPA 4FVPA 2XH5A 5L2QA 3RWQA 2XUUA 1M17A 2YFXA 3U87A 3EJ1A 4NM5A 3BEAA 3S00A 4O81A 3ANQA 4C4GA 5KCVA 4NTTA 3M11A 2XYNA 5EG3A 4RA5A 4N6ZA 4XOYA 4K77A 5HX6A 1H4LA 1M2QA 1OITA 4QMYA 4UMPA 3GU7A 1PRYA 4RPVA 2CGVA 4PX6A 3MA3A 4IWQA 3PP0A 4YLKA 2IEWA 3F7WA 3FMDA 3GCPA 4H3BA 4ZAUA 4FKUA 4LRMA 4R1YA 3GU4A 3HL7A 3BI6A 4RWJA 3SAYA 3K3JA 2YABA 2CHLA 4KRCA 3ORPA 4DGOA 1TFFA 3AC8A 4DYMA 4BKZA 2B52A 1W0XC 3L8XA 4FOCA 3UYSA 5LQFA 4QMOA 3SOAA 4ZS4A 4I5HA 4GIHA 3QUEA 4QTDA 5CU2A 4E7WA 4LV7A 2W4KA 3TJCA 5EQYA 1O9UA 3EL8A 4I0SA 3I4BA 3QTZA 4HYIA 2IVVA 3ROCA 3P1AA 3EB0A 2VO0A 1AD5A 5AV4A 3AC3A 3PP1A 4E6QA 4NL0A 2C4GA 2QI8A 3CLYA 4U97A 4YSMA 3O23A 3CD3A 3TZ8A 3QTXA 5LMKA 2C6LA 2PY3A 4IBMA 4Q5EA 3OCTA 4TT7A 4YJRA 5TKDA 1SZMA 3ZZWA 4AGWA 5EQPA 3NYVA 5EDPA 3DDPA 1OBDA 1U54A 4AQKA 3BHVA 1H07A 2CN8A 4LQMA 5AUXA 5EYCA 5KO1A 4O6EA 1ZAOA 4FOBA 1QMZA 3HV5A 4S30A 4WRSA 3OMVA 3NCGA 3WF6A 1OKWA 4FSZA 1KE7A 5K9IA 3LCDA 5BMMA 5HORA 4EK3A 4GV1A 2BDJA 5BUEA 4I6FA 4CGAA 3LAUA 3EKKA 4KKGA 3OWJA 2GHMA 5CSHA 3QQFA 3O17A 3UBDA 2WQBA 1UV5A 2AEGA 5HZNA 3QA0A 5F9EA 4IWPA 2BTSA 2XNPA 4NM3A 2CGUA 2W5AA 2A98A 4IB0A 4MWIA 4KNBA 4QTCA 4BCGA 1LPUA 4PQNA 5EYMA 3PZHA 4DN5A 5EW8A 2RSVA 1YXSA 3FKNA 5FP5A 2VWXA 4PDPA 2C68A 3GFWA 4FICA 4F70A 3BL7A 4RJ4A 5AA8A 1FPUA 2X8IA 3ZLWA 4CLIA 5HTCA 3U51A 2R3NA 3DXPA 2YWVA 2W9ZB 3ZDUA 1JSTA 4C8BA 5HTIA 5EM7A 5C4LA 2OIBA 3E7VA 5AV0A 4APCA 4DF3A 4IFGA 3PSCA 1IR3A 2H6DA 2QODA 3KRJA 4YGAA 5J8IA 3WF8A 4MXZA 2W0JA 3OW3A 1Z9XA 4ZK5A 4F78A 5EW9A 2BAQA 5E8UA 2W1EA 4DFLA 5F94A 1PMUA 2CLXA 2E9UA 2ITOA 2WMBA 4QMTA 5AUYA 3IW4A 4MXYA 3C4EA 4BIBA 3V5LA 2WTIA 4I22A 3OWKA 1YXXA 5GZAA 4FT9A 4AXFA 1JNKA 4FZFB 4O22A 4U43A 5CVHA 3MH0A 2QD9A 2F49A 1YDTE 2F7EE 3W18A 1FMOE 2Y6OA 5AIRA 4RC2A 5JGBA 2PVFA 1V0BA 3FSKA 2R3QA 5K3YA 4KIKB 5J9LA 5A6NA 3TKHA 4RIYB 3QZFA 2WMTA 4ZXTA 3VBXA 1Q4LA 1BI8A 4O21A 5ETIA 1UU3A 1G5SA 5HHWA 5HVJA 3ZCLA 5ANDA 3TIZA 3CPCA 3AGMA 3UODA 5TE0A 3GGFA 4FT7A 4IXPA 4CNHA 3EKNA 4JOAA 4MNEB 3CQUA 5EM8A 2UW0A 5JKGA 4C4FA 2YDKA 4R5SA 3F2AA 4XV3A 3RCJA 3UVQA 3U6IA 5CF4A 4FTLA 3TTJA 1OL5A 4FV7A 4KA3A 4BDCA 4FA2A 1JKKA 5BX0A 5L3AA 2YIWA 4P2KA 1M52A 3ZSHA 3MFRA 2YAKA 3OWPA 3ZMMA 4AUAA 3TCPA 1GAGA 4U45A 2VWVA 4QTEA 2VGOA 4O0YA 1XMLA 3NZ0A 4CLJA 4IDVA 1PKGA 4PV0A 2UW6A 4ZTSA 5HE2A 4BKJA 1CDKA 4FKOA 3UIUA 3PXRA 4IZ5A 3FMKA 3FZOA 3V5PA 1GIJA 4JAJA 5IQBA 3Q5ZA 4CCBA 3Q60A 2UZDA 1CTPE 2VTRA 3ORXA 5AP4A 2R9SA 5IU2A 3QRKA 3HV7A 1FGIA 4W9XA 2PVHA 1GZKA 3FMEA 3IW5A 4DT9A 2VAGA 3OC1A 5CSVA 4TPTA 3FHRA 3RK9A 2E9PA 3HMMA 3R7UA 3PLAE 1YDSE 4YZBA 2XBAA 4I5PA 3OD6X 4IX3A 5JGDA 4PTCA 4WBBB 2VWWA 3LPBA 4L68A 3W1FA 3BHUA 5J7HA 3FMLA 2B4SB 4MBLA 4O38A 2OK1A 2XK3A 2DQ7X 1UNGA 3V51A 4C37A 4U40A 5IA1A 3NUUA 4H1JA 1ZRZA 3OOGA 3ORTA 3PTGA 4BZDA 5IISA 4EQCA 5C9CA 3FC2A 2HELA 4RWKA 4FTAA 3V01A 1P4FA 1FVRA 4L3JA 1J1CA 4G3EA 3PVUA 4X0MA 3R8LA 4WOVA 1XH8A 2PK9A 4RC4A 2PUIA 5G6VA 5AAGA 5DFPA 3KN5A 4O1PA 4IH8A 5EI2A 2H34A 3MY0A 4ANQA 2Q83A 2YLEA 4MUQA 5AR8A 4J95A 4FYOA 5CSXA 3UC4A 3MSSA 5DT3A 4J97A 3UE4A 4AF3A 2I40A 4UN0C 4C57A 1ZYJA 3ZLXA 4WUNA 3QTRA 2CNUA 2W1DA 3R22A 4EH2A 4L44A 1PHKA 2R3FA 3K3IA 4F0GA 4XMOA 5KUPA 5BUIA 1PYXA 4I94A 3HAVA 3AD5A 4BCJA 1SVEA 4UYAA 5JZJA 2UZNA 2CGWA 3MI9A 3DBFA 3KXGA 2QOCA 4G1WA 4PMSA 4IZAA 5ETCA 2B0QA 4XV2A 3D9VA 2P55A 2GNJA 4FL3A 5I9WA 3RPRA 3PRIA 3ATSA 3AXWA 2FVDA 1NVQA 4MAOA 3LJ2A 5CF6A 5GJFA 2C3KA 5FG8A 2IJMA 4D58A 2YA9A 2BKZA 3QTUA 3O51A 4ZZMA 4TXCA 3SG9A 1QPCA 4DBNA 3ODZX 3KULA 3TJDA 3MGYA 1H1PA 2A1AB 4EONA 4C2VA 5EKOA 4IADA 3R2YA 2P33A 3NRMA 4ITIA 5IKWA 4ZLOA 1K3AA 3QA8A 3SC1A 3NNVA 3VBWA 4GIIA 3VBYA 2XKCA 3H10A 1JQHA 2O63A 3R9HA 4E4XA 4XLIA 2PZPA 4YNEA 4IAYA 4ZTMA 3N51A 1JVPP 1XBCA 3H9OA 4RJ8A 3VS3A 2WZJA 4LMUA 4UMQA 5D11A 2PZYA 2X7GA 3PJ1A 1F3MC 4ZJVA 5K4IA 5CF8A 1MQBA 3COIA 5HOAA 4QDVA 2WTVA 1Q3DA 3OS3A 4MK0A 4D5HA 1H0VA 2BRBA 3R7YA 5M57A 5M4IA 5D12A 2WEIA 3E8EA 4AGUA 4FL2A 3SGCA 3W10A 3OROA 4HGSA 2XKFA 3TNQB 4HCTA 2PVRA 3KQ7A 5CAQA 1WVXA 3PVWA 4R5YA 4OBOA 4AA0A 3AD4A 2J0MB 2X0GA 3E63A 4ERWA 5JT2A 3CQWA 4MNEA 5AUTA 4DAWA 2GQRA 4FKQA 1Y6AA 3R63A 4O4FA 4AZTA 4AA4A 3EFKA 3EYGA 4D4VA 1ERKA 5IUIA 2ZV8A 2UW8A 3TI1A 3C9WA 4HVIA 4DFXE 1SM2A 4IIRA 1Y57A 3DLSA 2ITNA 4JDHA 2OJFE 3PXYA 4FKIA 2QOKA 4Y72A 2BZIB 5LMBA 3CD8A 5FQDC 4JBQA 4BTFA 4EH9A 2WQNA 1DS5A 2GPHA 2OSCA 4A4LA 4D4YA 5ICPA 1U4DA 4OW8A 2BZHB 2CMWA 4ZTQA 4ANNA 3HX4A 4WUAA 4EC8A 3KIOC 4GRBA 4L3LA 3OT8A 3R8MA 3R9DA 4IDTA 2XAMA 4XG9A 2XIZA 5FWKK 5AAEA 4MWHA 4JNWA 3IW8A 1ATPE 4EBVA 2B9HA 5DRDA 4HW7A 5EI6A 4O2ZA 2OKRA 4DHIB 1LR4A 4GL9A 3ZSIA 2ZM1A 3IG7A 4PPCA 4TKSA 4FIJA 3QD3A 3FQHA 5FGKA 4BJJB 5F95A 2WPAA 3UQGA 2ONLC 4PRJA 4UBAA 5L6WL 3FY2A 3W0RA 4AFJA 4GK3A 2XIRA 4RJ6A 4IAFA 2HENA 4I5CA 5TF9A 4XG7A 3ZDIA 4BVUA 3BELA 4ONAA 3QKLA 5BVFA 4FV0A 3MWUA 4B6LA 1M2RA 4BCHA 2VTAA 3G6HA 4G34A 3TV6A 3PXZA 1OL2A 5DT0A 4PY1A 4A9UA 4JBOA 2C6IA 4H36A 4LG4A 5HU9A 5AP0A 3U6JA 4RMZA 2QOBA 4HYSA 3R2BA 5JMSA 4HNIA 2WELA 5H9BA 4F99A 4S33A 2HK5A 4YC6A 3BBTB 3CP9A 3D7ZA 1YI3A 3DLZA 5BVNA 5GJGA 1M7QA 3VJOA 4EHEA 5IH4A 2J5EA 5DEYA 2GDOA 4M0YA 4FIEA 4YMJA 3ZM4A 5FXSA 4EK8A 4YJUA 3FE3A 4NKSA 2WTKB 4P7EA 4A9YA 1M2PA 4AACA 4E4LA 5A4TA 5AP3A 5K5NA 1ZY5A 3FLQA 3F6XA 4GT3A 4ZOGA 3VS4A 5HBHA 3RWPA 3U54A 4M13A 2OXXA 2XA4A 2B9JA 3LFQA 4JT3A 4ZTLA 1KV2A 4UEUA 4O86A 3UG2A 3KC3A 2ETMA 2Y0AA 5AP5A 4BZOA 4USFA 2ZB1A 5KBQA 3ZFMA 4KD1A 2C69A 4ALWA 4I23A 2RFSA 5EFQA 2QR8A 4QQCA 5H3QA 2P4IA 3ZXZA 2CKEA 5FEDA 2HYYA 2IZRA 3VVHA 3P5JC 3W0PA 4M69A 5CI6A 3S4QA 1NY3A 1H24A 5T68A 4UWBA 3PG3A 4X2GA 2WMAA 3I6UA 2HZ0A 2GQGA 4G9RA 5E92A 3QCXA 3H9FA 4FSYA 4AT3A 4EK4A 1VYWA 4G3FA 1DI8A 4TWOA 5DLSA 3R1YA 2QURA 2UVXA 3CS9A 3D7TB 3NYOA 4EWHA 4IAIA 4GK2A 4G2FA 4X2FA 5DR9A 3QUPA 5DOSA 5D41A 4KWPA 4NCTA 2WTCA 1L3RE 4QP2A 3EWHA 2BTRA 4LV5A 3BYMA 3W0QA 5KZ0A 2OF2A 3L9MA 3EN9A 1TKIA 3O7LB 4WT6A 1OIYA 2X0PA 2EU9A 2HCKA 1MUOA 3A7HA 4ASXA 4F0IA 3VQHA 4RX8A 5KNJA 1HCKA 2R3LA 3HV3A 5IMXA 4A07A 3U8WA 4CXAA 4QDEA 1OL1A 4OUCA 3IW7A 3NW5A 4GYGA 4PL5A 4DFUA 4FIHA 4MKCA 3V8WA 5C27A 4CV8A 3NX8A 3FLYA 4PPBA 3H0YA 4EWQA 3RNYA 1H25A 4QMVA 4AG8A 4F9BA 3AKLA 4J8NA 3OEFX 3F3TA 3KVXA 3RI1A 4B8LA 4QP7A 3LJ0A 3REPA 1IAJA 5B2LA 2A19B 4FV2A 3VHEA 2XKDA 3NAYA 3QXPA 4MF0A 3E8DA 5DBXA 2YCQA 2YIYA 4UMUA 4M12A 4O4DA 2WOUA 5M07A 1UU7A 4ACGA 3LMIA 4F7JA 2BHHA 3PWDA 4ZY4A 3C1XA 4FV6A 5LXMA 4GKHA 3H30A 5LCKA 4N0SA 4HJOA 5M4CA 4WNKA 4BDHA 2C3LA 2JIVA 4QNYA 1XQZA 2PZRA 1OGYA 2W5HA 1UNLA 3UO6A 2G15A 4FSRA 4YBJA 4ZJJA 4BDAA 2IN6A 2WQOA 1V0PA 2YITA 5E8SA 3N4UA 3CIKA 1BI7A 4L00A 2YERA 3Q2MA 4C3FA 3DK6A 3HZTA 3QFVA 2J50A 3IDCA 3Q9WA 2CJMA 3SKCA 4Y85A 2DWBA 3GCQA 4G5PA 4NK9A 4BDGA 3NUSA 2CCHA 2ZMDA 4BJJA 1W83A 3Q4UA 3VF8A 4IX5A 2GNHA 1B38A 4M0ZA 4FTNA 4NJ3A 2OFVA 3ZFYA 2UW5A 5I0BA 4RA4A 2JEDA 3H9RA 4I24A 5CWZA 4FUYA 4JL9A 5HE3A 4HVHA 1A48A 4NYEA 2X2KA 3ZRLA 2VZ6A 3ACJA 3FEGA 3KREA 4JMQA 3RALA 4YP8A 3HV6A 4QMLA 2QC6A 3R71A 3WE4A 4O91A 5L6OA 3B2TA 5CT7A 3LMHA 2C0OA 2E9VA 1U5QA 3I5ZA 1CSNA 1OVEA 3AT4A 3QAME 4X3FA 3TDWA 1W7HA 4OTIA 1VEBA 2UZWE 4D1SA 5CALA 4XG8A 3DY7A 3NS9A 3U9NA 1Z5MA 4O0WA 4X7QA 3RK5A 4O4CA 1QPDA 4QMQA 1WFCA 4QMWA 1OMWA 3OY3A 2C6TA 4C34A 2HW7A 2O64A 2Z7RA 3PA4A 4C38A 5AM6A 4F7LA 2GTMA 5FXQA 2PMNX 4FR4A 3C0GA 2A27A 4NFNA 3QZIA 3LLTA 3RPSA 2IPXA 3KK8A 3DU8A 2QO7A 2VV9A 4BGHA 1OZ1A 1I09A 5C1QB 2FYSA 1S9JA 3QRTA 1OL7A 3RPOA 3CJGA 3FMHA 3G51A 3GBZA 4HGEA 4MQ2A 3LFDA 4RJ5A 4X21A 1XH4A 5ANJA 3UG1A 3EYHA 3IGGA 4PTGA 2WOTA 3SXSA 2QO9A 4EUUA 5AAFA 3P78A 3UVRA 3UPZA 1ZMUA 2C1AA 4EH7A 4PMMA 4FT3A 3P9JA 3RVGA 4CVAA 4BCQA 4WRGA 5GIOE 4EOIA 2B54A 4IANA 2W1IA 1G8KA 5IA3A 2PUUA 4OBPA 4JQ7A 4HYHA 5IDPA 3TM0A 3JR1A 4X3FC 3C4FA 3MVHA 4M7IA 3D7TA 4RT7A 2PTKA 2XP2A 3R0TA 1XBBA 4Z7HA 5L8JA 2OGVA 4RIWB 3UNZA 1H27A 2XCKA 1ZYLA 2ZDTA 2XNEA 5K5XA 2XB7A 3NGAA 4F65A 1IRKA 3MESA 3A4OX 1WBWA 3FXXA 3FC1X 4GVJA 5E1EA 2R3MA 3WF9A 5HVKA 5JGAA 5AP1A 3PE1A 3D4QA 5AV3A 1STCE 2C47A 4AXEA 2R3GA 2P0CA 2C6KA 5FP6A 3CY2A 4TYEA 1OBGA 4CKIA 4CYIA 4OTRA 2JBOA 4QQTA 1BL7A 3NUXA 2V0DA 3OF0A 5E8WA 4RBLA 4I6QA 5HBEA 4DTKA 4CFXA 4C4IA 1YQJA 2HXQA 2BRHA 2YJRA 4AXAA 2ERZE 3DDQA 2F57A 3GC7A 5FD2A 3Q6WA 2XNOA 3AGLA 4IW0A <