4FVQA

Crystal structure of the jak2 pseudokinase domain (mg-atp-bound form)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
274
Chain Sequence
VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the JAK2 pseudokinase domain and the pathogenic mutant V617F.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
total genus 85
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fvqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fvqA01
3O8TA 3GOPA 3V51A 4Z7HA 4GT5A 4E4XA 4PPBA 4R3RA 2C5YA 3MY5A 3P7AA 4EYMA 4YR8A 4E6QA 4CFMA 3HUBA 5HIDA 4U40A 3CQUA 4BIEA 5CAPA 5KKRC 3HDNA 1WBSA 3IW4A 2BVAA 3WZEA 5A4EA 5HO6A 5ICPA 1PMEA 3W2QA 3IS5A 3NW7A 3A7FA 4DT9A 1B6CB 4KA3A 3H9RA 3VQHA 3PA4A 2CNUA 3C0HA 2X81A 1OZ1A 2OIDA 1AD5A 2IN6A 4ZLYA 1FBNA 5C1QB 4RT7A 2RFSA 2ETKA 3DBEA 3CBLA 3OROA 3FUPA 2FSTX 2OH0E 5EM5A 3DS6A 4S31A 2ERZE 2BHHA 3L9LA 3UBDA 4D9UA 3PWYA 4E5AX 3G15A 4G3DA 2BKZA 3NLBA 3ODYX 4MBLA 3I4BA 3G0FA 4AG8A 2XK8A 4BDAA 3RCJA 3KKVA 2C6MA 2O5KA 3UZPA 2C6OA 5L8LA 2ZV7A 3ZU7A 3KVXA 4NCTC 4TWPA 4K18A 5TO8A 2QO9A 2X4FA 4K1BA 3NYVA 3MH0A 4MX9A 4O21A 4F7JA 4EK5A 2WTJA 1XHAA 1O9UA 2UW3A 4C62A 2A0CX 2ZMDA 3P4KA 3U54A 3OD6X 4L68A 5BX0A 4BGHA 4FEXA 5J9ZA 5HBEA 4BZOA 4DHFA 5FEDA 3ATTA 2IJMA 4U5JA 4R1YA 1QCFA 2I6LA 3CQWA 5F95A 3T8OA 1LR4A 2OWBA 5AR2A 4C34A 3DK7A 3AT3A 1ZY4A 1DAWA 3C9WA 4C2WA 5L2TA 2WQMA 4NH1A 4O6EA 4F64A 4UX9A 5H9BA 3DBFA 5M53A 1QPEA 4KNBA 4GCJA 4IB1A 3DKOA 4FL2A 3OXTA 3UZTA 3UE4A 4B8LA 3ORLA 4ASZA 2X7OA 3SV0A 3PPKA 4AZVA 1GZNA 5DH3A 3KRJA 3RPRA 3NGAA 5BNJA 3PRFA 4QD6A 5L4QA 3DLZA 3MBLA 4G3FA 5EFQA 4L44A 4XEYA 4BWPA 5BMSA 4L7SA 4U0IA 3BWFA 5A4CA 3AC3A 4PUZA 2J5FA 3K3IA 3DK6A 3RAKA 4PPCA 4AZTA 3CY2A 1Q5KA 2QOFA 2VO7A 4G34A 1VYWA 5DNRA 3BV3A 2W0JA 4DEIA 4TWCA 3GT8A 3MV5A 2XJ1A 4HYUA 3FDNA 3R22A 1JBPE 3POZA 1FQ1B 4KIPA 4AWIA 4C58A 3LFCA 5CU4A 3QD4A 4IX3A 4BDIA 2HZ4A 2CMWA 2GCDA 1BMKA 3HV4A 1CKIA 2WB8A 3FPMA 2R7IA 4NSTA 5T68A 4QTDA 2B7AA 3BBWA 3F88A 2WTCA 4IWDA 3UVRA 5L2SA 4U6RA 3ENMA 3C51A 4DITA 2PU8A 2BFXA 3QRUA 2C3JA 2BIKB 5BUEA 2YWVA 3ZFYA 3I0QA 4ZMEA 5LMBA 3JY9A 4O2PA 4BHNA 5CWZA 3RZFA 1OM1A 3L8VA 3CP9A 2C5NA 3I5NA 4Z9LA 5FXQA 4BI1A 4XG4A 3M11A 2Y0AA 4AN2A 3JYAA 5IEVA 1J3HA 3H30A 3JY0A 4CFNA 3G51A 4RFYA 3E88A 3NZ0A 1OKVA 4YPSA 4RVKA 3UOJA 1YOJA 2KULA 5L6WL 2YDJA 4MTAA 2HAKA 4MHAA 3ZO2A 4KUJA 4ZJIA 3UMXA 3DOGA 3SAYA 3PXQA 3TCPA 3OEFX 3C4XA 4BZNA 4Z3VA 1GJOA 1YI3A 2JDSA 1OKYA 4GFGA 3R02A 4BCNA 2F49A 4KSPA 2CLQA 3CKWA 4MD9E 3R28A 4QYHA 4ZTHA 4C02A 4CTBA 3KVWA 4AA0A 3DJ5A 3UPXA 4ZLZA 2XZSA 2YM3A 4FK6A 4ZOGA 4PL4A 4W4XA 4W8DA 1PY5A 3S3IA 4OAUC 3MJ2A 3O71A 2UZBA 5CENA 1T46A 3OWLA 3R04A 2FSLX 4FICA 3FE3A 2VGOA 4B7TA 3AC5A 4TYJA 1UKHA 4FSQA 5ANEA 1ZMWA 4E20A 5AAEA 3RM6A 4EOJA 4ZSAA 2W1DA 5JGAA 1UNLA 2R3KA 4A9TA 2B55A 3SA0A 3I60A 2VTJA 2R9SA 3ZSGA 2X9FA 3UQCA 3SXRA 2CKQA 3ROCA 3BRBA 4A9SA 5CAOA 3SGCA 4NYEA 4GV1A 3R8VA 2X6DA 1JPAA 4JG6A 1KE6A 3DB8A 3HZTA 4NKSA 5HIEA 2UVXA 2UZOA 2BDWA 2VWIA 4OTPA 3KQ7A 3GFWA 3PLAE 2OSCA 3EFLA 5HHWA 3ITZA 2PL0A 2UVZA 3C4ZA 3QLFA 4D2WA 3TXOA 3QXOA 3L1SA 3C50A 4YTCA 4H3QA 4YSJA 5I9UA 4E6AA 4FTIA 5BUJA 3LJ1A 3ODZX 1U59A 4R7HA 2Z7QA 5C01A 4EL9A 3A7HA 4G6NA 3DQWA 4C57A 3SLSA 2JFMA 3QU0A 4LMUA 4BDBA 2J0JA 3LFEA 4I20A 1VEBA 4AUAA 4PV0A 4RC4A 2VWVA 4FSMA 3FZ1A 4C3RA 4ERWA 2VTMA 5E8YA 5AFVA 4DFXE 4IAIA 5K5XA 4V01A 5AR4A 3Q96A 5E8WA 4F09A 3FLWA 1F0QA 1UU9A 4BC6A 3TT0A 2W1EA 4ACMA 3E3PA 5HCXA 2O65A 4FIFA 2IVVA 5I9ZA 4CKIA 3VS7A 2QO2A 3MIAA 3R2BA 4RA5A 3HP5A 4N4SA 5AV0A 4AZWA 4JBQA 4EH4A 2I0EA 3HRFA 3LQ3A 5CTPA 3D7TB 4QTAA 4JBPA 4XG8A 5H8BA 1WBPA 3PZHA 5FG8A 5BVWA 4Q5HA 2R3LA 3PP0A 1B38A 4FV5A 2NP8A 5AUWA 3JPVA 5K9IA 1LEZA 4BTMA 2YABA 2J90A 2C3LA 1BYGA 2WMXA 3QXPA 5DRBA 5JSMA 4Y95A 2OG8A 3F3ZA 3I7CA 1QPDA 4MH7A 4DC2A 1IAJA 4OR5A 4D58A 1PXOA 5ANDA 5CVHA 2QOHA 4GK3A 5J1WA 2XK9A 4DTAA 4G3EA 3SHEA 4CFVA 3EH9A 3FBVA 5B2KA 2ZV8A 5ACBC 3SW4A 3DAEA 2WMSA 4RWJA 3RAHA 3MVLA 2P4IA 3DCVA 3PVWA 4C35A 4O7NA 2UZWE 2PMIA 3EN4A 2J4ZA 4M7IA 3I1AA 3EQCA 3DBQA 3TTJA 2RFEA 3TNHA 2PZYA 3A99A 4HCTA 4AOJA 5A46A 2PUUA 2V7OA 1GIHA 3G2FA 3DZQA 5CYIA 5J5SA 3E63A 3AC1A 5CAQA 5D7AA 2CSNA 4AW2A 4BHZA 4BBMA 4RVMA 3F61A 4QYEA 2XNGA 3ZDUA 3U4UA 2QONA 1K9AA 3ID6C 1OGUA 4FTRA 1M2PA 4QOXA 3TDWA 2BCJA 4KKEA 2VNYA 2XS0A 3NUXA 4W4VA 5J9YA 3Q4ZA 3D94A 3PE1A 5JH6A 5FXRA 3VAPA 4RMZA 3D5VA 5A4TA 5K4IA 4M97A 1KE9A 4H3BA 5FEEA 3VF9A 5J7BA 1YWVA 3HV7A 2C6KA 3ZBFA 3PUPA 2FA2A 3H10A 4O0WA 4PTEA 4XHKB 2YDKA 2UW7A 2XM9A 5M51A 4FTKA 3KL8A 4KIKA 4E6CA 2P2IA 3EQFA 4DCEA 3RNYA 1H00A 2E9NA 5M4UA 2XKEA 3HA6A 4AT3A 4DE4A 3UG2A 4CQEA 5KZ0A 1IA9A 1JWHA 3KXXA 1WVXA 2UVYA 4Y85A 5E8SA 3UC3A 2PUNA 4FODA 5K4JA 4KWPA 5B2LA 3VS1A 2ITZA 3IDCA 3QCSA 3U8WA 1H07A 2OXXA 2RFNA 4ACDA 4I3ZA 4LOPA 4YJNA 4DFLA 4IJ9A 3G5DA 2C1AA 4X7QA 2C6EA 2UZLA 4R7IA 4BCQA 3WARA 2HELA 5KX8A 5CEIA 2X39A 5EDPA 5BVEA 3LJ0A 2YISA 3NYNA 4IXPA 2WGJA 5AP3A 5DVRA 5A14A 1JKLA 1YOLA 3W16A 4RA4A 3BELA 3PXRA 3R00A 2VX0A 3NAXA 4F0GA 3MVHA 2ZM4A 4WNPA 1URWA 5IMEA 2WO6A 4CFWA 3UO4A 4PWNA 4FOCA 3VBVA 5IH5A 2YM7A 4IZAA 5JGDA 4O86A 3ORZA 4RX9A 3W2PA 1H28A 1XBAA 2C5VA 2R3OA 3TUDA 4V0GA 2BDJA 1MP8A 4KINA 4ZZOA 1RE8A 1H1QA 1K3AA 4MEDA 5HU9A 4B6LA 3PG1A 4J95A 5CF6A 3WE8A 5BVNA 4AW0A 4R5SA 5LVMA 4HYHA 3AGMA 4YZMA 2WAJA 4QQJA 3WIKA 4F6UA 2B1PA 2J0LA 4FKRA 1G8AA 2IO6A 4MVFA 3VUIA 3IOPA 2GQSA 5JMSA 3L9PA 4UZHA 3VS0A 1AQ1A 1YXXA 2F7EE 1Y57A 1FVRA 4JVGA 4RX5A 3IGGA 4UMUA 3PIXA 2H9VA 3BI6A 4QQ5A 4A06A 3ETAA 2WTDA 3WOWA 4AE6A 4EYJA 2GS6A 4QPSA 2OZAA 3E8CA 3VBQA 1JKTA 4OTQA 4AAAA 1KSWA 3UYTA 3VUMA 4KIKB 4TYHA 3CTJA 2CHLA 3FI2A 4YJUA 1KE7A 3DKCA 1FMOE 1M7NA 2XKCA 1YXTA 3OCSA 3OOGA 3QX2A 2VD5A 2PK9A 3OP5A 4EWQA 4ZTQA 2XCHA 4YJVA 3JVRA 5M44A 3N51A 3QF9A 4KKHA 3SW7A 4IDVA 5CF5A 4ORKA 5G1XA 5G6VA 2LGCA 4KB8A 4W9XA 3W2SA 5FDPA 5IEXA 4A9UA 4IX5A 4FEVA 2R0IA 1OUKA 5FLFA 4A9RA 5M07A 3EQRA 3KF7A 4EK8A 2Y4PA 4OW8A 4JDIA 4EH7A 3UNZA 4Y73A 3PSDA 5EHYA 2CDZA 3S1HA 4HYIA 5FEQA 3LCTA 3OWKA 4BYJA 4LYNA 3FQSA 1JAMA 2OJGA 4D5KA 5KMLA 4X3JA 5CSWA 3Q2MA 4E93A 4FK3A 1J91A 1MRUA 2XNMA 2Z7LA 3PJ3A 4U45A 5FTGA 4O83A 3FAAA 4ALUA 3EMGA 1IASA 3P7CA 3QTQA 5HIBA 5KMJA 4IAFA 2UW8A 3HRCA 3RVGA 2OU7A 4FG8A 3FWQA 4BCGA 4BCJA 4TL0A 4FUYA 3AOXA 4XCUA 3E8EA 4WBBB 4ZS0A 4O7LA 4WBOA 2YAKA 1PXJA 3A2CA 4L00A 2QOCA 4CYJA 3UQFA 2XCKA 2PMLX 2Z7SA 4EC8A 4I4FA 2DWBA 3LVPA 4G5JA 2J0IA 3C4EA 1Z5MA 1OB3A 4BDCA 3AMAA 2IW9A 4ZTMA 2QU5A 5FQDC 4EQMA 5ETFA 5JZJA 4S30A 4RIOA 3C4FA 2R3PA 3GQIA 5CZHA 3VC4A 3B2WA 2WMTA 3KULA 1QPJA 4FTLA 4ANBA 4EORA 2V62A 4EUTA 4NW6A 3MSSA 2CN5A 3ULZA 3R7IA 4CNHA 3M2WA 4DAWA 4U81A 3QZHA 5LWNA 4BCIA 4OTIA 1SZMA 3CCNA 5FTQA 3C4CA 4LUDA 1J1BA 1JSVA 3QUDA 2YZAA 4AF3A 5HG5A 4QNAA 4G17A 4ITJA 3RWQA 4K77A 4W8EA 1R0EA 4OLIA 3D9VA 5IZFA 2PVRA 3UQGA 4F65A 1QL6A 2EXEA 3G0EA 3NYOA 4DFZE 3DPKA 3GOKA 3W1FA 4BIBA 5IDNA 4RGJA 4C4FA 4OTRA 4RWKA 3LFFA 4RWIA 5GZ9A 4EI4A 1DI9A 4D0XA 3GU6A 3KXNA 3DJ6A 1OL2A 3WE4A 1P5EA 1RJBA 3BCEA 1IG1A 3MH2A 3QWKA 4E4MA 4E7WA 1ZZLA 2I1MA 4E4LA 5JFSA 5IUHA 1NXKA 1UWHA 3GCSA 4JXFA 4DBXA 4EH3A 5AP0A 4O6LA 3FLQA 4OBQA 5ANKA 2GDOA 3W2RA 3QYWA 3BPRA 5EKOA 5DYJA 4X3FB 5KMOA 1REKA 4RIXB 5HVYA 2ETMA 2Z7RA 3S00A 1RW8A 4FEWA 5M06A 3EL8A 3OTVA 4FKUA 3RM7A 3ORPA 3UTOA 3O2MA 3MI9A 2QR7A 4FVPA 4HYSA 4RLKA 1ZXEA 5CXZA 2ZAZA 3F82A 5KHWA 2WEVA 4I41A 2ITNA 3G90X 3KEXA 3H0ZA 4HCUA 5GJFA 4BTJA 4YJOA 5DLSA 5KHXA 2YWPA 5IQFA 1PXLA 2OJFE 3QQHA 4E26A 3PTGA 4UZDA 1DAYA 3T3VA 4OUCA 4BCMA 4WUNA 5AP7A 2UZNA 1PXKA 4X2FA 2ZV2A 3C0IA 1E1XA 2XA4A 3WF9A 4IW0A 4Y83A 1R0PA 5ITAA 5ANJA 3A61A 5AP1A 3W10A 2B9JA 4IMYA 4TTHB 4F9CA 4CCUA 4A4XA 2OIQA 3BYSA 4ACHA 2J5EA 4X3FC 1XH5A 5TOZA 3VBTA 4I5MA 3NR9A 3EQHA 3HGKA 2WNTA 3QRJA 4NUSA 3E8NA 4U79A 3ZHPC 3IK3A 3DXQA 2CNQA 3RNIA 1H24A 2HWPA 3KULB 4PMTA 2DQ7X 2X8EA 4YTFA 5L2IA 4JX3A 1P14A 2ZDUA 3EYHA 3D2KA 3ZZWA 3V3VA 2GHMA 2V0DA 2HZ0A 4LRMA 4QQCA 4ZTRA 4ANQA 2ESMA 2OBJA 2PPQA 1M14A 2WU6A 4O22A 4A4OA 1XKKA 4ACCA 3WF5A 5CXHA 4DGOA 5I9VA 3Q60A 4HGEA 4MXXA 3LQ5A 4ZSJA 4V0GB 5IUGA 2WXVA 2UZTA 3GBZA 3QUEA 4OTGA 1A06A 4CG8A 3P78A 2OZOA 5H2UA 3AT4A 4HPTE 2UW0A 4KRCA 4KS7A 4DH7A 3ELJA 5CS6A 2W1FA 3OUNB 4KAOA 4QP1A 5D7VA 4AA4A 4LRJA 1Q8ZA 2AYPA 2ZM1A 3VJOA 5AV4A 1YW2A 4F7LA 3W2CA 2GNJA 5AJQA 4JQ7A 4YHFA 3V6SA 3F3UA 5JKGA 4YSMA 4OTDA 4V05A 3RK7A 4EH8A 1L8TA 3FL5A 1JSTA 5I3RA 5FBNC 3VS6A 5HBHA 3V5JA 4TRLA 2C6DA 5HE0A 4ZZMA 1TVOA 4GUBA 4RJ7A 4MXOA 2G01A 5HNGA 2YCRA 3V5WA 5CSPA 4IVCA 4ZSEA 1ERKA 2ONLA 3D5XA 5FUTA 4D4YA 3M42A 2GS7A 1XO2B 3FSKA 3FMEA 3L8PA 4AW1A 3UIBA 2BTSA 4YJRA 2C69A 2YITA 3TM0A 3TJCA 3R7GA 2OFUA 4XYFA 3QKKA 4YO4A 4D28A 4JL9A 5LWMA 3D83A 2HOGA 5EM8A 5CALA 4BF2A 5HCZA 3FHIA 4DH3A 5IDPA 3O17A 3U6IA 2BZJA 5IQDA 2QLUA 5KZIA 3Q6WA 3HV6A 3LFSA 3O7LD 3LKMA 3NUAA 2GMXA 1BX6A 3LCKA 3UIXA 4IAYA 2XNPA 1Q3WA 5CASA 4WG3A 3B8QA 4HCVA 3NX8A 4MD8E 4F08A 3RP9A 2NNWB 1XR1A 4QP8A 2PY3A 4D1XA 2JKKA 1BL6A 2HIWA 4FSTA 4QPAA 5AWMA 4N0SA 5T3QA 4E6DA 4EOOA 4JNWA 1OMWA 2A4LA 4JR7A 2X7FA 3ZONA 2VWWA 1Q4LA 4UYNA 2F4JA 4G31A 3TKUA 5FGKA 2BAJA 4IB3A 3EWHA 3COMA 1ZOHA 2JDOA 4OTWA 2Z60A 2QI8A 4RLLA 3TKIA 4ANMA 1YHVA 5J9LA 4O0SA 4MQ2A 3GC0A 3ORMA 3EQGA 3BU6A 3LW0A 4S34A 3LHJA 3OW4A 2QVSE 4EK3A 2YERA 2Z8CA 1CKJA 4PF4A 4ENYA 3VVHA 3ZBXA 2GNGA 2W9ZB 2WMVA 4IWOA 2WQBA 3HDMA 3ANQA 5EYCA 3U4WA 5EW9A 3QA8A 1GAGA 2OXDA 4IJPA 3AQVA 3PJCA 3CKXA 4FMQA 5FBOA 3QA0A 3VJNA 4BI0A 4EH6A 4RBLA 2OLCA 4TPTA 4UALA 2V5QA 3FXWA 4FV6A 2JLDA 3D0EA 3PIYA 3PZEA 4KBCA 5JFXA 3UNJA 2G2HA 2J51A 3FLNC 4M13A 5CX9A 3B8RA 1PXMA 1MUOA 5DHJA 5ETCA 4F1OA 1M52A 4FI1A 4HPUE 4JDKA 5CT0A 3BGPA 4LI5A 3N4VA 1H1SA 2E2BA 2R64A 4F6SA 3QHWA 3GCVA 1DM2A 4H05A 4HW7A 3VNTA 3QD2B 4CMUA 4FTNA 4MCVA 4Q2AA 4NIFA 4NWMA 2WTKC 4P7EA 2XJ0A 4GMYA 2C0TA 2PZPA 1JOWB 3PA5A 1QPCA 2CGVA 4J8MA 3ZEWA 2EWAA 3BGZA 4ENXA 5CI6A 3KN5A 4ARKA 3NSZA 4C59A 4Y46A 5DMZA 5HNBA 3H3CA 2WMQA 3UOKA 4QMWA 1DS5A 3PXKA 3KK9A 1Q3DA 4AN3A 5E4HA 3PY0A 5IA1A 3R83A 3LLTA 3D4QA 4ASXA 4FYNA 2VTTA 3TACA 5HG8A 3FI8A 4P5QA 2NPQA 2W1GA 4BI2A 4JG8A 5CLPA 5BQ0A 4FKQA 4X0MA 3HEGA 4UWCA 3SQQA 3HMMA 4QP3A 3DU8A 2WIPA 3UOLA 4RIXA 4BFMA 4C38A 3EQIA 4RIWB 3PPJA 2XKFA 5FP6A 4W9WA 4FSWA 4MXZA 4AT5A 4YU2A 3OCGA 3R7EA 1YXSA 2UW4A 1JLUE 3FJQE 4WRSA 5DOSA 2VO6A 3EQPA 2JIUA 2ITVA 3OT3A 4NK9A 4A4LA 4ANLA 5IQHA 5HX6A 1S9IA 3AD5A 4L7FA 4YLKA 3QX4A 1OBGA 1E1VA 4MXCA 2WPAA 4DEDA 2PVFA 3FMJA 1B39A 3LCSA 1GY3A 3EN9A 3TI1A 5HU3A 4ONAA 1A48A 2A1AB 3VS4A 3R63A 3B2TA 3ZDIA 2XF0A 5EQPA 3KB7A 3RPYA 2ZM3A 2XEZA 3RAIA 3UDBA 2IPXA 1TQIA 2P2HA 3HV3A 1I09A 3TV6A 4DH5A 5J5TA 4I0TA 2WMAA 2B4SB 2YJRA 3POOA 4IANA 5CEMA 2VZ6A 3VF8A 4I6BA 5K0XA 2J9MA 4FZAB 3LFQA 4D2TA 2PZ5A 3WF6A 5IA4A 3D7TA 2CN8A 3V6RA 4J96A 5EM7A 4Y72A 3GGFA 3QGYA 4L6QA 4G6LA 1CMKE 4K33A 4DFBA 4FTUA 4JG7A 3F69A 4NTTA 4RZVA 3GB2A 3KXZA 4CFUA 3WI6A 3A8WA 4QMLA 2OZAB 3L9NA 5AP2A 1KV2A 2WEIA 5LXMA 3C0GA 4ASEA 4ITIA 5IA5A 3BWJA 4CT2A 5CEPA 2I0VA 4IHPA 1H8FA 4JLCA 3HECA 2AC3A 2XKDA 4IM3A 4Z7GA 4FL3A 3KCFA 4UBAA 4WIHA 1OIYA 3E62A 3W2OA 4HVSA 3QFVA 5B2MA 3JVSA 4YTHA 3PY3A 2Y8OA 5E8TA 4XV3A 4AGDA 1Q8TA 4FKSA 1GNGA 3VBYA 4J97A 1NVQA 1I44A 4F99A 1WBNA 2ITXA 3AMBA 4LM5A 3VIDA 4OGRA 4M69B 3G6GA 4RPVA 4UYAA 5BYYA 3TG1A 4EBWA 3TKHA 5EKNA 2CJMA 5LJJA 3U51A 4BDEA 1Q61A 1REJA 1ZYJA 3I79A 4JBVA 4QRCA 3QQUA 3EN6A 4DCAA 5BVDA 3ACJA 1PXPA 4ACGA 3KXGA 4O7RA 2OGVA 5IQGA 4K0YA 1A9UA 4R7BA 1LPUA 2YIXA 3CJGA 4ERKA 5FXSA 4FTCA 4FGRA 3E7OA 5GIOE 4XG9A 3R8PA 5IA3A 5M4CA 1ZOGA 2HZNA 3CS9A 2CCIA 2IW6A 1O6KA 4HGSA 4ZY6A 2ZDTA 3DDPA 4APPA 4M14A 3BKBA 5DWRA 4F4PA 1QMZA 2P0CA 5KUPA 1YXVA 3BHYA 3DKFA 3G9NA 2YCFA 4RC3A 2QNJA 3HAVA 4FSYA 4I92A 3R71A 4WNMA 4LMNA 3R1QA 2ITTA 1H25A 4MAOA 4AOTA 4FSNA 2O0UA 2YM6A 3DFCB 4GT4A 4RJ6A 1PMUA 3FZRA 3HV5A 4FG7A 3ERKA 4OBOA 4HVHA 1FPUA 5BVOA 4H39A 2H34A 1WZYA 1BI8A 3QD0A 3MGYA 3IW5A 2HW6A 4OTFA 5CU6A 3RINA 3DGKA 2GFCA 3OBJA 2PVJA 4R3PA 2G15A 4O1OA 3TUBA 5GJGA 3NS9A 5M4FA 1RQQA 2XK6A 2VGPA 2VV9A 2UZEA 2XRWA 3QL8A 4FKTA 4TN6A 5FWKK 3UNKA 2YJSA 5JFWA 3FYJX 3PE2A 2YACA 4YLLA 3TNIA 3AD6A 4D55A 3IQ7A 4MF0A 4EK6A 4TNBA 3HMNA 1GOLA 3O8UA 4O96A 5EHLA 2UW9A 2W1ZA 3ZRKA 4EK4A 2ACXA 2HWOA 2XBJA 5EOLA 3E8DA 1IAHA 1V0OA 1ZYLA 2VAGA 2UV2A 3T9IA 3WYYA 1GIJA 2VTRA 1XBBA 3IDBA 3OCBA 3MTLA 3W8LA 4NKAA 1IA8A 3A4PA 4WOVA 2R3HA 3SX9A 1SVGA 1M17A 3MWUA 3C7QA 3NCGA 3FZOA 4FT3A 4G6OA 3WZJA 4DGMA 4IEBA 3PSCA 3LZBA 4ZZNA 2C0IA 3ORNA 5AIKA 5AAGA 1XBCA 4ZJJA 4WO5A 3RPVA 1R78A 1E9HA 4B9DA 3EZRA 4XMOA 3MW1A 3Q5ZA 4X3FA 5AV1A 3RAWA 1UVRA 3G9LX 4BKZA 4BDJA 5CY3A 3K54A 2OK1A 3RK5A 2BZIB 4I93A 5IQIA 3IG7A 3ZLYA 4DFYA 3LCOA 2R7BA 2Z2WA 4BCPA 2X2KA 2CCHA 2IVUA 2QOKA 2B9IA 4YC8A 3D5UA 5D1JA 2JBPA 3OW3A 4O7ZA 3I7BA 5AX3A 3KRLA 3ATSA 4G2FA 2VTSA 1APME 3IO7A 3CJFA 5GIPE 5HZNA 4QMTA 3FPQA 3F2RA 4MNFA 3N4TA 4JQEA 3LXLA 4HGLA 5M56A 3ZO1A 4BDKA 4ZK5A 3ZXTA 4M68A 2W99B 5HD4A 3CTQA 3F9NA 5C8NA 5HCYA 4PX6A 1WVYA 5DE2A 3HUCA 5HLPA 3QGWA 5HE2A 2XYNA 2YIRA 3EOCA 3NIEA 4NIFB 4PDPA 1UU3A 2REIA 2V22A 1ZMUA 4EOLA 3QTSA 3NNWA 4PRJA 4Y8DA 1SVEA 3COKA 1LP4A 2QU6A 5AUTA 4NZWB 2PE0A 4HOKA 3DDQA 5JZNA 3W8QA 3A60A 4GU6A 4LQMA 5FM2A 5A4LA 5JK3A 4EHVA 4E8AA 4YLJA 4BBEA 5IF1A 3VBWA 1U5QA 5EYKA 4KIQA 2QC6A 3U6JA 3ZO4A 4D4SA 4D2RA 3QD3A 5J1VA 3OMVA 2XP2A 1M2RA 4LL0A 3SXSA 3KXHA 3WIGA 4YZ9A 4GYIA 4YJTA 5C8KA 4BCFA 2QHMA 2VWBA 4AQCA 2OICA 1YDSE 2QOQA 1BLXA 4CZTA 4DEBA 4ASDA 4KBKA 4L9IA 2PZIA 3FKNA 3UYSA 2PVHA 1TKIA 2QOOA 4XOZA 4BCOA 1W82A 4B99A 4UN0C 3UIUA 5AEPA 3K5VA 4XS2A 3QRTA 4L45A 4LOOA 3RK9A 1WMKA 4RWLA 1LUFA 4QPMA 3IKAA 3ZSHA 4HNFA 5IA0A 3EKNA 5KMNA 4EJNA 5C4LA 4QMOA 4WT6A 4XG7A 2VWZA 1W98A 2YDIA 4RIWA 5LMKA 2YM5A 4FNYA 3CTHA 5AUXA 4IM2A 4YHJA 1W8CA 2PZRA 1CKPA 3A4OX 4GFMA 1U46A 1YQJA 4DEEA 4YUQA 3QTUA 4ZS4A 4USDA 1PKGA 3QZFA 5ACKA 5DEYA 5GZ8A 2GQRA 4FEUA 2P33A 3KRWA 4GSBA 5M4IA 2EXMA 1OPLA 1U54B 4XLIA 4I21A 4BYIA 4LRKA 4TYEA 3JR1A 1GZOA 1WCCA 3RI1A 2OI4X 3KCKA 2JEDA 2DUVA 3IOKA 2XYUA 3CR0A 5IQEA 3E3BX 4O7YA 3GUBA 3SDJA 1FOTA 2VTPA 2WTIA 3LFBA 5IKWA 1O6LA 2I0YA 4AXAA 4R6VA 3ALNA 3CD3A 3O23A 2VWUA 4FBXA 3QHRA 5LVNA 3LXNA 4YBJA 4IC8A 4IIRA 2HW7A 4J53A 5AX9A 2I0HA 3LAUA 5DI1A 3ALOA 2QD9A 3A7GA 4EOMA 4NFNA 3EIDA 1OKZA 2Y4IB 4D1ZA 4IAZA 5D12A 2UZDA 2C3KA 5I5ZA 3VUDA 1U5RA 4HZRA 5AMNA 2ZJWA 4IX4A 4G5PA 2GTMA 5HICA 4FEQA 5E8ZA 4DH8A 4FV2A 5HG9A 5IPJA 3R7OA 3A62A 2EU9A 5KCVA 1FVVA 3NCZA 4F1MA 1VYZA 4FE2A 2BALA 1KE8A 2WD1A 4Q9ZA 3Q53A 1SYKA 5F9EA 2XJ2A 4EHZA 1TQMA 2W5AA 3MPTA 4J99A 3FKLA 5M57A 4EBVA 3ZMMA 1OPJA 5HLWA 4XV2A 2HCKA 4YZCA 4F7NA 4CKRA 4F7SA 2VRXA 3OHTA 1PYEA 3L9MA 5B0XA 3BLQA 4J1RA 3EQDA 4XBUA 3NUPA 5JT2A 3MY1A 4FIEA 4CCBA 1PMVA 1Q24A 2OJ9A 3VS3A 4M0ZA 1KV1A 3FQHA 3V5PA 2O8YA 3W18A 4QMQA 4K6ZA 4R77A 4DA5A 3GCUA 3VBXA 4CEGA 2J6MA 4IZ5A 3QTIA 2NRUA 2W5BA 4FTMA 3HX4A 4IBMA 4N6YA 5TKDA 4YZNA 1J7IA 4ZY5A 3ZOSA 2YN8A 3DXNA 3BHVA 3P9JA 4QMSA 5GZAA 4TZRA 4ANNA 2PYWA 4X2NA 2PHKA 2LAVA 3BU5A 5BUIA 4EZ7A 3GEQA 4XG2A 3OWPA 1PYXA 4PY1A 5L6PA 1U4DA 3L8XA 3RPSA 5KMKA 2GPHA 3D7ZA 5E91A 2JC6A 2G2FA 2PSQA 2CKPA 2QO7A 2JDTA 4X2JA 5EW3A 5E1EA 2H6DA 2JITA 3MPAA 4KABA 5DN3A 3WBLA 3ZZEA 3H0YA 1W84A 4BCKA 3GC9A 5IEYA 2XIZA 1WFCA 1U54A 3OVVA 1H1RA 4ZY4A 3PPZA 3P86A 1Y6BA 1JQHA 3CLYA 3TEIA 5HQ0A 3DA6A 2HYYA 4CFFA 2UW5A 5J8IA 3Q32A 3SOCA 4DLJA 4N70A 5KO1A 4X2GA 4ANOA 4FX3A 1OI9A 1UKIA 2FH9A 3Q3BA 5AIRA 5ANOA 5EK7A 4AZFA 4I5PA 2WTVA 4ZSLA 1STCE 1Q8YA 2WQOA 4USEA 5KBQA 5DEWA 2PMOX 3QKMA 2BRHA 3QQLA 4B8MA 4RJ3A 2X0GA 3SKCA 2HY0A 3ZH8A 2CGWA 2ZV9A 3LFAA 5L6OA 4DG2E 2I7QA 4XP3A 5LVLA 3VUGA 3IPHA 4F9WA 4F9BA 3OS3A 4H36A 4O0RA 4QO9A 3NNVA 4DG0E 1R3CA 4FKGA 3EB0A 3OFMA 4IACA 3QRIA 4LL5A 5AP6A 1TQPA 4CT1A 4GIIA 4DFNA 3I5ZA 5D11A 1P4FA 2W05A 3KU2A 2ZYBA 1UV5A 3G33A 4BGQA 3LMGA 3K2LA 3DTWA 4GRBA 5AM7A 5BYLA 1CM8A 3MFRA 4UMQA 4DEGA 2JDRA 2P3GX 2R3IA 1YWRA 5I4NA 1MRVA 1YXUA 2BIYA 1OL7A 5AUVA 3FHRA 4I6HA 3F3VA 5KKRB 4EOQA 4CV9A 5CSXA 2FSMX 3EFWA 3DJ7A 3BIZA 3I81A 5HORA 2QG7A 4RG0A 4FG9A 5CU2A 3KRRA 5E8UA 3D2IA 2BR1A 3E7VA 4IH8A 1ZWSA 4OBPA 3TIYA 3UMWA 2HY81 2PE1A 4KRDA 1H1WA 3GC8A 4NM7A 4UEUA 4EQCA 3FI3A 4YC3A 5HVKA 4DINA 3QBNA 4DEAA 4YMJA 4ZTSA 4NJ3A 4FIJA 5HBJA 3O96A 4CMTA 4DGNA 4S2ZA 1X8BA 3R9HA 1G8SA 5LVOA 3DFAA 4YJPA 3E5AA 1ZAOA 4I6FA 1XH9A 1OIQA 4HJOA 3S2PA 3I6UA 2EVAA 4IFCA 4KSQA 5E90A 2QR8A 3FMNA 4HVGA 5CSHA 5E92A 3ZXZA 1FVTA 2JKOA 5CVGA 2VN9A 5IQAA 4FKPA 1PRYA 3OXZA 1WBTA 2BAKA 3KGAA 2VX1A 4RQKA 4UXLA 1OPKA 5DT0A 3A7JA 2WU7A 3JS2A 3LXKA 3PLSA 4IAAA 2RF9A 4RJ4A 4U43A 4U8ZA 4M84A 5BVKA 3ZRLA 4XNEA 4GL9A 3OC1A 4FV8A 4GU9A 5H8EA 2CKEA 4X2KA 2E9UA 3OF0A 3UC4A 1IEPA 4JRVA 1ZYCA 4BDFA 2IVTA 2BKKA 2WZJA 2HK5A 1FMKA 3R7VA 5CEKA 3TL8A 3U87A 4I0RA 3C5IA 1WBWA 2VTQA 2RL5A 3R9RA 5IMXA 5EQYA 3E93A 5DR9A 4CV8A 5LVPA 3GCQA 2OKRA 4PNKA 4ALWA 1NW1A 1G3NA 5L2WA 1PXIA 4P4CA 4F0IA 2ITQA 4QMPA 5EH0A 4D9TA 4DFUA 1PMNA 4HZSA 4O0TA 5IQBA 5E1SA 3O50A 4CRLA 4CLIA 1UU7A 3T9TA 4O7SA 4XLVA 4KIOA 3NDMA 4UB7A 4I22A 3R8ZA 4XJ0A 3FXXA 3K3JA 4O82A 4O81A 3WF7A 4KKGA 4R3CA 4BCHA 4MXAA 1NVRA 4PMSA 5D9HA 3ZUVA 4HVIA 4C36A 4ZTLA 4FGBA 2B0QA 2W9FB 4E3CA 2XB7A 2OF4A 3LFDA 1VJYA 2R4BA 3QTRA 5DA3A 1YVJA 4QMNA 5EYMA 2FVDA 4FNXA 4DGGA 3EFJA 3H4JA 4K9YA 5L8KA 1KUTA 4CD0A 5E8VA 4AE9A 3QQFA 5JQ8A 1YHSA 4JAIA 4QT1A 3U55A 3MDYA 4CSVA 4J8NA 2ITYA 2A2AA 5EG3A 2C0OA 2X8IA 5JN2A 3LLAA 4CG9A 4IVDA 3Q9XA 3G6HA 4FVRA 3C5UA 2BRGA 4RFZA 3NW5A 2BTRA 5KNJA 4EKKA 4FTAA 5CANA 5EHOA 1EH4A 3HL7A 4U7ZA 3UO5A 1WVWA 4UWBA 4NJDA 5AV3A 2IZRA 2Q0BA 4UMTA 4OT6A 3PP1A 5CNOA 4G1WA 3PA3A 4DF3A 2GS2A 3ZM9A 4D2VA 3UVQA 3MH1A 3MY0A 2R3QA 3AGLA 5E9EA 4USFA 3OTUA 3COHA 3FZTA 4FNWA 3EL7A 2BFYA 5AR3A 5CZIA 5HVJA 3S95A 3GVUA 4L53A 4AP7A 5J7HA 4WSQA 5GNKA 3FV8A 3BQRA 4QMYA 3FMLA 3W55A 4DYMA 3D14A 5CF8A 4ID7A 1ZYDA 5AUYA 4MXYA 2CGUA 3C13A 3FEGA 2ONLC 2BUJA 4DLIA 3Q9WA 3F3TA 3LXPA 1FGKA 3PJ2A 4GIHA 3MYGA 4WRGA 5D10A 5BPYA 2I40A 2Q83A 3GFEA 3HAMA 3KC3A 2VX3A 5I3OA 1PHKA 2JIVA 4IQ6A 5H3QA 3F2AA 5HE3A 3ZLSA 2WIHA 4F9AA 4XH6A 5AV2A 1PJKA 4O7VA 4YC6A 3FMHA 2VTOA 2Y7JA 3VUKA 1UA2A 4E1ZA 4Y5HA 4EHEA 5BYZA 1UNHA 3P0MA 4H1JA 4L01A 1MRYA 4X6RA 3UVPA 2JAVA 3P7BA 5HEZA 2YIWA 4PDOA 3PG3A 5ETAA 4CQGA 4UMPA 1RDQE 5K0KA 3P5KA 4P5ZA 5GJDA 4M66A 3OWJA 5DG5A 3N9XA 2Z02A 4O0YA 2ZMCA 4BKJA 1DI8A 2R3JA 4M12A 1OIRA 3OT8A 3BYOA 3HKOA 3R1SA 2PULA 1Q8WA 3LM0A 4LV8A 3VN9A 4EZ5A 3KMUA 3LIJA 2PVMA 2BPMA 2F7ZE 4C61A 2R0UA 3LPBA 2AUHA 4I94A 4O91A 3OZ6A 4I5HA 4U3YA 3R8LA 1IR3A 5C4KA 4QP6A 4QTBA 3PVGA 4C2VA 3R8MA 4D1SA 3DKGA 3DT1A 2H8HA 2YIYA 3FC2A 3CSVA 2WTWA 3DTCA 5AP5A 2P55A 4EKLA 4R1VA 3SRVA 2FYSA 2IWIA 4BVUA 1NA7A 2AC5A 1YHWA 2QCSA 3R1NA 3RALA 4NTSA 1M7QA 5E8XA 2C6IA 3Q9ZA 1CSNA 3FZSA 2W1IA 2W1CA 4PQNA 4TNDA 3TNWA 4O2ZA 3BEGA 4EC9A 4F63A 3KA0A 3V5QA 2XM8A 4QMZA 3TNPC 4GT3A 3DBDA 3KK8A 4F1TA 3FLYA 2RGPA 2ZB0A 3TN8A 2XNEA 3PJ1A 4XRJA 3GXLA 4D0WA 5CAUA 4IAKA 1OITA 2X2MA 3EN7A 5TT7A 2ZB1A 3OCTA 4RZWA 2IZUA 4HGTA 1MQ4A 5IH4A 3UIMA 3BQCA 1ZLTA 2J0KA 2YHVA 3NNUA 3KRXA 4G9RA 2EUFB 4QYGA 3F7WA 1M2QA 4TYHB 4IWQA 5D41A 3VULA 1FINA 2UUEA 5L8JA 4C3FA 4E5BA 5JEBA 4KS8A 1Z57A 4AX8A 4EZ3A 3MA6A 2WOTA 4YZDA 1XQZA 3P08A 3MVJA 3KF4A 3REPA 3VUHA 4PNIA 2VTLA 5CQWA 4ZSGA 4RX8A 5FTOA 3FXZA 2WMBA 4FZFB 4O0VA 2W4JA 5EDRA 3DV3A 1ZMVA 5M55A 3CE3A 2YLEA 3KFAA 1V0PA 4D2PA 3HRBA 3IDPA 3KREA 1VZOA 4Z16A 3KY2A 5K5NA 1JKSA 4FKIA 4JQ8A 5C03A 3FMMA 4XUFA 1YDTE 2FUMA 2VTHA 3EZVA 4AGUA 1H26A 1UWJA 3TWJA 4BWKA 2VTAA 3V8SA 4L43A 3FY0A 3R2YA 4QNYA 4GKHA 3PXYA 3GU4A 2PUIA 4L46A 2GHLA 1CDKA 1YOMA 3RKBA 4FT9A 3CPCA 4AZSA 2ITWA 4FT0A 3F66A 3VWAA 3F5XA 3ANRA 4IE9A 3GU8A 1SVHA 3Q4TA 4LUEA 2GQGA 4UY9A 5LCKA 4IM0A 2HZIA 2QHNA 4GW8A 1WAKA 4ZMFA 3R73A 4TW9A 3NW6A 2NO3A 3I0OA 2Y9QA 3TJDA 5F1ZA 2RFDA 3ZRMA 3ORTA 5HNIX 4C4HA 2UZVA 2UW6A 1Q62A 3EJ1A 3GU7A 3NWWA 3R0TA 4FL1A 4IZYA 4M15A 4TWOA 4XBRA 2J7TA 4L52A 5ETIA 4CYIA 4EH5A 3L8SA 5HO8A 3BLRA 2J0MB 3TZ7A 2X8DA 5AR8A 3GP0A 4MBIA 4JT3A 3DNDA 2X7GA 4X21A 3SG8A 2YFXA 4PTGA 4KD1A 4RJ5A 3IW6A 5AM6A 3RBWA 2WHBA 5BMMA 5CEOA 3CGOA 4C4GA 4GS6A 4H58A 2G1TA 4YZBA 4BGGA 3NNXA 3GCPA 4RVTA 4DH1A 5A6OA 1J7UA 1JNKA 2H96A 4D4VA 3F5GA 4Q9SA 3ENHA 5TE0A 3QRKA 4BR3A 4YGAA 3R7UA 4EONA 4P90A 1Q99A 2VUWA 3UJGA 4BRXA 2PMNX 3QQJA 4EOSA 4O0UA 3BYMA 5CAVA 3UP2A 3UGCA 3ZCLA 3BBTB 5F4NA 4B4LA 4RQVA 5KMMA 2C4GA 4FNZA 4QP9A 3ZYAA 3MESA 2QODA 2XIYA 4M8TA 5DGZA 1URCA 5AAFA 2KTYA 3RMFA 4FKJA 4GFOA 2DYLA 1ATPE 1LEWA 3H9FA 4U80A 4RSSA 3ZS5A 4BL1A 1BKXA 3MFUA 3U6HA 5AUZA 4EQUA 4RRVA 3HLLA 1YRPA 3C4WA 3PRIA 1GZKA 5T6KA 5JQ5A 3VHEA 5EI8A 3R9DA 2CLXA 4FV9A 4BDGA 3FY2A 2YEXA 2YAAA 4LGGA 4TWNA 3TNQB 4L3PA 3FC1X 2WTKB 3LE6A 4FKWA 4PMMA 4QMMA 4ALVA 5JFVA 1ND4A 3F5UA 5HGIA 3MVMA 4FV1A 1H0VA 4EOPA 1FGIA 1K2PA 3AC8A 2FGIA 5DIAA 1OL5A 4FV4A 2O63A 3WYXA 3DLSA 4C0TA 1VR2A 1HCKA 2XH5A 4JOAA 3OY3A 4XP2A 3WF8A 4WNOA 4LV5A 3VW8A 4C4IA 5EQEA 2QKWB 3V5TA 2E9VA 3U9CA 4CVAA 4IX6A 3Q5IA 3FL4A 4Z55A 4BDHA 2OXYA 2PVYA 2VO3A 4ANSA 4DGLC 3OY1A 1SM2A 5ANIA 4EJ7A 4O0XA 4RJ8A 2YM4A 4YJSA 4AGCA 4EUUA 2YM8A 3THBA 3SG9A 5IU2A 4X6QC 2JFLA 4RFMA 4PTCA 4QTEA 5HD7A 3AC4A 3VS2A 4FKLA 1MQBA 4F70A 3A7IA 2IZSA 4IC7A 2QG5A 1JVPP 2RG5A 1YI4A 4IVAA 2ETRA 3PWDA 5CSVA 5CVFA 4FIIA 4ZTNA 1Y6AA 5CU3A 4MBJA 4RVLA 2NRYA 3CC6A 4F0FA 2B53A 5CF4A 3C1XA 1PW2A 3Q9YA 4MKCA 3HMPA 4R78A 5DR6A 2G9XA 3BLHA 5CNNA 3K5UA 4OAVB 4FR4A 3OOMA 3OEZA 3QLGA 3QWJA 4MD7E 1SNUA 3AG9A 3UPZA 3QCQA 3SXFA 4FT7A 4IFGA 2GNFA 5AR7A 2GSFA 2JIIA 4RIYB 4XG3A 4QMVA 3BZ3A 3FMDA 4BN1A 4C7TA 2V7AA 3F3WA 4Q5EA 2B9HA 4MQ1A 4U44A 4WKQA 4U42A 5DRDA 1PKDA 4RX7A 2YLFA 3D5WA 4GVAA 5HOAA 4L8MA 2JGZA 3CPBA 4YBKA 3ZFMA 4N57A 4G3GA 4I1ZA 1GZ8A 4E73A 4AZEA 1Q41A 3ZUTA 5DT3A 4AW5A 3PIZA 4ZJVA 3VO3A 3OG7A 5FD2A 5F20A 3WZDA 1P2AA 3LCDA 5HX8A 1NT2A 3DAJA 3E64A 3QCXA 2Q0NA 4QP2A 1HOWA 4FTJA 4RC2A 2F57A 4DN5A 1YWNA 4LFIA 2JBOA 4H1MA 4YTIA 2VTIA 3FLZA 2XIRA 3QTWA 5LARA 4BICA 3RTPA 3QKLA 2W4OA 3R9OA 2WELA 4W4YA 2IVSA 4BTKA 4GYGA 4NT4A 1ZARA 5FDXA 4PDYA 4CKJA 5CQUA 2WQEA 3PJ8A 3BYVA 4C3PA 3EN5A 4EOIA 4PL3A 3ROYA 4JIKA 5JRQA 4J71A 3ORKA 4AFJA 2PVLA 4BZDA 3NIZA 3QTZA 3RGFA 3RWPA 1KE5A 3RJCA 3ET7A 5FRIA 4BTFA 2RG6A 3GI3A 3MA3A 4II5A 4NL0A 1NY3A 3IECA 3F6XA 3DY7A 4FIGA 3UODA 3LMIA 4JI9A 3BU3A 3EHAA 4GUEA 2A27A 3M1SA 2B52A 2VU3A 3QQGA 4YURA 3ZC5A 2C3IB 3O8PA 1XH4A 2FB8A 2ITUA 2Y4IC 5LMAA 2JD5A 3COIA 2YZLA 4JBOA 3MFSA 4B0GA 5DT4A 4ITHA 4U41A 4YNEA 3ZLXA 4QYFA 3BX5A 2BRNA 4QP4A 2BMCA 5IH6A 3FLSA 4AU8A 1XH7A 3GNIB 4E5WA 1H1PA 1O6YA 3AT2A 4IWPA 2C1BA 3QC9A 1OBDA 3ZTXA 1BUHA 1W7HA 5IISA 2PE2A 4OT5A 4CMOA 2O3PA 4JDHA 4WA9A 3VRYA 4D2SA 2CNVA 3MH3A 3AXWA 3NVKI 3P1AA 1SMHA 5AP4A 4DEHA 4FKVA 4AFEA 2WKMA 3HMOA 2W5HA 3MPMA 3V8TA 4IDTA 4IVBA 4I4EA 4TT7A 4WUAA 3RPOA 5LCJA 4WD5A 4UMRA 3BE2A 3RHXA 4GJ3A 5H8GA 4C4JA 3HMIA 3DK3A 2ZOQA 3PXFA 5EI6A 2SRCA 4FZDB 5J87A 4I23A 3LOKA 2VWYA 3D15A 3CY3A 5HG7A 2BILB 5HKMA 3ZLWA 2XBAA 3NAYA 4HVDA 3Q4CA 5B7VA 1PXNA 1CTPE 2C6TA 3I6WA 3E92A 4FV0A 1BI7A 3SD0A 2XNNA 1Y8YA 4W4WA 5M08A 4PP9A 4MWIA 1BL7A 2BDFA 4M67A 5I0BA 2GNHA 3BHUA 5EW8A 4ZEGA 3UO6A 3RCDA 4BDDA 4GH2A 2C6LA 3VUTA 3Q6UA 4EH2A 1YKRA 3OXIA 5AUUA 2EB3A 2C47A 4D5HA 5DFPA 5HESA 3TUCA 3Q4UA 5KBRA 3QTXA 4K2RA 4AS0A 4PPAA 3W32A 1J1CA 3BYUA 5I9WA 2GNLA 3GC7A 3V01A 2W4KA 2W7XA 4NW5A 5GHVA 2GFSA 2OH4A 5CU0A 4L3JA 3UZRA 3TZMA 3FSFA 4ZXTA 4GKIA 2J50A 4NM0A 3HVCA 3SRVB 4H3PA 5K3YA 3V5LA 4CXAA 5M09A 2R3FA 3CGFA 3PSBA 4TYGA 4ZLOA 3DXPA 1KOBA 3QYZA 5EM6A 2JDVA 4GK2A 4ZAUA 2XNBA 1F5QA 3SC1A 4YO6A 2GHGA 1Z9XA 4EEVA 4A7CA 2C5OA 1V1KA 3PY1A 4CFXA 2FSOX 2BRBA 2J2IB 2EXCX 4I6QA 4JR3A 3LJ2A 3QAME 4IZ7A 4YHTA 5LMKC 4BY9E 5C27A 3NMUF 5C26A 3AD4A 4AGWA 4JX7A 4CZYB 3LQ8A 4C33A 4FV7A 4G16A 4NU1A 4QQTA 4AACA 4TY1A 2QOBA 2BZHB 4DBNA 4J7BA 4PP7A 4GEOA 1OL6A 2V55A 5EOBA 3R9NA 3BHHA 3PVUA 3F7ZA 2OF2A 3R30A 2IG7A 5TR6A 5IQCA 3QZGA 4JS8A 3TZ9A 3RZBA 4WG5A 2R2PA 2R3RA 3VHKA 5FM3A 4FSUA 4BKYA 1GIIA 2F2CB 3TV4A 4BWXA 4LGHA 4FT5A 2JKMA 3FZPA 2XMYA 3PFQA 5KMIA 3HYHA 5J95A 2YIQA 5A4QA 2HXQA 1OKWA 2VTNA 1XJDA 4PDSA 3QALE 3EYGA 4FTQA 2CGXA 4Y5QA 3BHTA 4M0YA 3FMKA 4MF1A 4ZIMA 3WILA 4DG3E 3TZ8A 3KN6A 1ZOEA 4FUXA 3DZOA 2O64A 2WMUA 2O2UA 3NUYA 1OECA 2W06A 2C5XA 3O7LB 4FSRA 4FSZA 1YDRE 4IB0A 3WZKA 4O7TA 1JSUA 4XRLA 4S33A 4OTHA 2XK3A 4YNOA 3QUPA 2QURA 4GG7A 2G2IA 3II5A 3T3UA 2BRMA 3QQKA 1XH8A 3AMYA 2GTNA 3LMHA 4QMUA 2FO0A 3SOAA 3P23A 2PWLA 3MB6A 4LG4A 3IGOA 3OUKA 4MWHA 4AN9A 4GJ2A 2BROA 3ORIA 4IB5A 5DBXA 4TYIA 4EWHA 2YCQA 4C8BA 3EFKA 3HP2A 3HNGA 3N4UA 5IA2A 2IZTA 2Y6OA 4O7WA 2PVKA 4K8AA 5CT7A 4UV0A 3GU5A 4CZUA 4FIHA 2GU8A 5C9CA 4FC0A 4UWYA 4J52A 3RHKA 4YPDA 3CIKA 2C30A 1H08A 1HCLA 1H27A 3R7YA 5JRSA 1WBVA 2WFYA 1AGWA 1OVEA 4M69A 2BHEA 3GQLA 3BEAA 2PVNA 3NUUA 3VS5A 1R1WA 4FTOA 4MK0A 4CLJA 1ZZ2A 1WBOA 2WMRA 2WMWA 3CXWA 3PXZA 3MS9A 2OFVA 3VW6A 4G9CA 5HTIA 4FKOA 4FYOA 4U97A 4L3LA 3H9OA 5AADA 4A07A 3CQEA 2QLQA 4FVQA 3TV7A 4I5CA 4K11A 4A9YA 4MNEB 1Q97A 4APCA 2W96B 1Q8UA 4YP8A 3NYXA 2VO0A 2Y6MA 3KMWA 3FI4A 4NEUA 2PUPA 4NM5A 3KXMA 5HTBA 3V8WA 4QP7A 2OJIA 5F94A 5LOHA 4L67A 2IW8A 5HI2A 2X2LA 4F6WA 2B54A 1W0XC 3VRZA 2QKRA 3FKOA 3TDVA 4I0SA 1S9JA 4EH9A 5HO7A 4NFMA 2XNOA 5L2QA 1V0BA 4EHGA 3PYYA 4YJQA 4O1PA 5TF9A 2YA9A 3MIYA 3HA8A 4O38A 4AT4A 3PVBA 3IONA 5HTCA 3R8UA 2XIKA 3MJ1A 4FOBA 1YI6A 3Q04A 2X4ZA 2ERKA 3TTIA 2F2UA 1XWSA 5A3XA 3PDTA 2R3GA 4XG6A 2EB2A 3MTFA 1ZYSA 3R1YA 4F9YA 3F5PA 3O0GA 3MN3A 3ZUUA 3ZM4A 2DS1A 3IW8A 3NUSA 3DAKA 4L42A 5HLNA 4G3CA 1OIUA 4NM3A 3CEKA 5I9XA 4DTKA 3ACKA 3Q52A 4JAJA 5C8MA 2OIBA 2X6EA 3IW7A 5EDQA 4N6ZA 4GVJA 5A54A 3O51A 4J98A 3BE9A 1R39A 5HE1A 2W1HA 3UP7A 2XRUA 4R5YA 3A8XA 3NPCA 4U9AA 2BZKB 2F7XE 2JAMA 3ORXA 4BBFA 3Q2JA 2YCSA 4O84A 2UZUE 4WG4A 4HNIA 4AA5A 4IADA 4LOQA 4FA2A 5BVFA 2QQ7A 1NVSA 2PTKA 2XK4A 2CKOA 1KWPA 4JIAA 2E9OA 2B9FA 2R3MA 4DT8A 5IG1A 2GNIA 2XK7A 1W83A 4PMPA 3FYKX 5DR2A 1UNGA 2RSVA 5AA9A 2BAQA 4XOYA 1OL1A 2WQNA 3W33A 3R21A 3NEWA 3DNEA 4XP0A 3OBGA 5IUIA 1F3MC 2HENA 3JUHA 1PF8A 4KBAA 5GINE 4EOKA 3S4QA 4NCTA 1IRKA 2X1NA 4JJRA 4JDJA 2RKUA 4WHZA 5E7RA 2QOIA 3ZO3A 4QTCA 3WZUA 3CD8A 3V04A 3FQEA 5EI2A 4CTCA 3MB7A 3AC2A 5KE0A 3SVVA 3LM5A 3EQBA 4MNEA 4XV1A 2OO8X 4D4RA 3MFTA 5A9UA 3GENA 5JGBA 5LQFA 1JKKA 2VWXA 1OUYA 1ZY5A 4P2KA 2X9EA 3S0OA 4GK4A 3ZSIA 3R01A 2JKQA 2ZVAA 3BV2A 3LFNA 4QYYA 3TIZA 2WOUA 4MYGA 3QZIA 4PL5A 2QOLA 3QC4A 2A19B 4XV9A 4E4NA 4FF8A 4CGAA 4M3QA 4WSYA 4I24A 4XX9A 5ANGA 5A6NA 5AA8A 3NVMB 2OJJA 3ZEPA 4BIDA 2C68A 4R8QA 4CRSA 3UG1A 3ULIA 4BB4A 2RIOA 2F9GA 5CEQA 3EKKA 1Y91A 2VNWA 3DB6A 3R6XA 4S32A 1Y8GA 5EYDA 4FTTA 1ZRZA 4DTBA 3DBCA 4QMXA 2CPKE 3NUNA 4FV3A 2HXLA 1SNXA 2XEYA 4LGDA 5L3AA 5CI7A 4FZ7A 4TXCA 5FP5A 4ZP5A 4JRNA 1J7LA 3QCYA 1H01A 2OW3A 4TKSA 3VQUA 2ITOA 1L3RE 3KMMA 3ZFXA 4RIYA 4AOIA 4C4EA 1H4LA 3DQXA 3U9NA 4U3ZA 3NRMA 1G5SA 2XIXA 5AR5A 3ZC6A 2XVDA 4FZ6A 5DPVA 4V04A 3BGQA 1KOAA 2R3NA 5J79A 2W17A 4UXQA 5I9YA 1P4OA 3E87A 4C37A 3JXWA 4O27B 2R5TA 2ITPA 3UOHA 1H0WA 2XUUA 3F2NA 1XH6A 4GG5A 1T45A 1UU8A 3P79A 4WNKA 2E9PA
chains in the Genus database with same CATH superfamily
3O8TA 3GOPA 3V51A 4Z7HA 4GT5A 4E4XA 4PPBA 4R3RA 2C5YA 3MY5A 3P7AA 4EYMA 4YR8A 4E6QA 4CFMA 4FJVA 3HUBA 5HIDA 4U40A 3CQUA 4BIEA 5CAPA 5KKRC 3PUFC 3HDNA 1WBSA 3IW4A 2BVAA 3WZEA 5A4EA 5HO6A 5ICPA 1PMEA 3W2QA 3IS5A 3NW7A 3A7FA 4DT9A 1B6CB 4KA3A 3H9RA 3VQHA 3PA4A 2CNUA 3C0HA 2X81A 1OZ1A 2OIDA 1AD5A 2IN6A 4ZLYA 1FBNA 5C1QB 4RT7A 2RFSA 2ETKA 3DBEA 3CBLA 3OROA 3FUPA 2FSTX 1ST4A 2OH0E 5EM5A 3DS6A 4S31A 2ERZE 2BHHA 3L9LA 3UBDA 4D9UA 3PWYA 4E5AX 3G15A 4G3DA 2BKZA 3NLBA 3ODYX 4MBLA 3I4BA 3G0FA 4AG8A 2XK8A 4BDAA 3RCJA 3KKVA 2C6MA 2O5KA 3UZPA 2C6OA 5L8LA 2ZV7A 3ZU7A 3KVXA 4NCTC 4TWPA 4K18A 5TO8A 2QO9A 2X4FA 4K1BA 3NYVA 3MH0A 4MX9A 4O21A 4F7JA 4EK5A 2WTJA 1XHAA 1O9UA 2UW3A 4C62A 2A0CX 2ZMDA 3P4KA 3U54A 3OD6X 4L68A 5BX0A 4BGHA 4FEXA 5J9ZA 5HBEA 4BZOA 4DHFA 5FEDA 3ATTA 2IJMA 4U5JA 4R1YA 1QCFA 2I6LA 3CQWA 5F95A 3T8OA 1LR4A 2OWBA 5AR2A 4C34A 3DK7A 3AT3A 1ZY4A 1DAWA 3C9WA 4C2WA 5L2TA 2WQMA 4NH1A 4O6EA 4F64A 4UX9A 5H9BA 3DBFA 5M53A 1QPEA 4KNBA 4GCJA 4IB1A 3DKOA 4FL2A 3OXTA 3UZTA 3UE4A 4B8LA 3ORLA 4ASZA 2X7OA 3SV0A 3PPKA 4AZVA 1GZNA 5DH3A 3KRJA 3RPRA 3NGAA 5BNJA 3PRFA 4QD6A 5L4QA 3DLZA 3MBLA 4G3FA 5EFQA 4L44A 1G8KA 4XEYA 4BWPA 5BMSA 4L7SA 4U0IA 3BWFA 5A4CA 3AC3A 4PUZA 2J5FA 3K3IA 3DK6A 3RAKA 4PPCA 4AZTA 3CY2A 3KIOC 1Q5KA 2QOFA 2VO7A 4G34A 1VYWA 5DNRA 3BV3A 2W0JA 4DEIA 4TWCA 3GT8A 3MV5A 2XJ1A 4HYUA 3FDNA 3R22A 1JBPE 3POZA 1FQ1B 4KIPA 4AWIA 4C58A 3LFCA 5CU4A 3QD4A 4IX3A 4BDIA 2HZ4A 2CMWA 2GCDA 1BMKA 3HV4A 1CKIA 2WB8A 3FPMA 2R7IA 4NSTA 5T68A 4QTDA 2B7AA 3BBWA 3F88A 2WTCA 4IWDA 3UVRA 5L2SA 4U6RA 3ENMA 3C51A 4DITA 2PU8A 2BFXA 3QRUA 2C3JA 2BIKB 5BUEA 2YWVA 3ZFYA 3I0QA 4ZMEA 5LMBA 3JY9A 4O2PA 4BHNA 5CWZA 3RZFA 1OM1A 3L8VA 3CP9A 2C5NA 3I5NA 4Z9LA 5FXQA 4BI1A 2XARA 4XG4A 3M11A 2Y0AA 4AN2A 3JYAA 5IEVA 1J3HA 3H30A 3JY0A 4CFNA 3G51A 4RFYA 3E88A 3NZ0A 1OKVA 2A98A 4YPSA 4RVKA 3UOJA 1YOJA 2KULA 5L6WL 2YDJA 4MTAA 2HAKA 4MHAA 3ZO2A 4KUJA 4ZJIA 3UMXA 3DOGA 3SAYA 3PXQA 3TCPA 3OEFX 3C4XA 4BZNA 4Z3VA 1GJOA 1YI3A 2JDSA 1OKYA 4GFGA 3R02A 4BCNA 2F49A 4KSPA 2CLQA 3CKWA 4MD9E 3R28A 4QYHA 4ZTHA 4C02A 4CTBA 3KVWA 4AA0A 3DJ5A 3UPXA 4ZLZA 2XZSA 2YM3A 4FK6A 4O4EA 4ZOGA 4PL4A 4W4XA 4W8DA 1PY5A 3S3IA 4OAUC 3MJ2A 3O71A 2UZBA 5CENA 1T46A 3OWLA 3R04A 2FSLX 4FICA 3FE3A 2VGOA 4B7TA 3AC5A 4TYJA 1UKHA 4FSQA 5ANEA 1ZMWA 4E20A 5AAEA 3RM6A 4EOJA 3ML1A 4ZSAA 2W1DA 5JGAA 1UNLA 2R3KA 4A9TA 2B55A 3SA0A 3I60A 2VTJA 2R9SA 3ZSGA 2X9FA 3UQCA 3SXRA 2CKQA 3ROCA 3BRBA 4A9SA 5CAOA 3SGCA 4NYEA 4GV1A 3R8VA 2X6DA 1JPAA 4JG6A 1KE6A 3DB8A 3HZTA 4NKSA 5HIEA 2UVXA 2UZOA 2BDWA 2VWIA 4OTPA 3KQ7A 3GFWA 3PLAE 2OSCA 3EFLA 5HHWA 3ITZA 2PL0A 2UVZA 3C4ZA 3QLFA 3W0NA 4D2WA 3TXOA 3QXOA 3L1SA 3C50A 4YTCA 4H3QA 4YSJA 5I9UA 4E6AA 4FTIA 5BUJA 3LJ1A 3ODZX 1U59A 4R7HA 2Z7QA 5C01A 4EL9A 3A7HA 4G6NA 3DQWA 4C57A 3SLSA 1VLRA 2JFMA 3QU0A 4LMUA 4BDBA 2J0JA 3LFEA 4I20A 1VEBA 4AUAA 4PV0A 4RC4A 2VWVA 4FSMA 3FZ1A 4C3RA 4ERWA 2VTMA 5E8YA 5AFVA 4DFXE 4IAIA 5K5XA 4V01A 5AR4A 3Q96A 5E8WA 4F09A 3FLWA 1F0QA 1UU9A 4BC6A 3TT0A 2W1EA 4ACMA 3E3PA 5HCXA 2O65A 4FIFA 2IVVA 5I9ZA 4CKIA 3VS7A 2QO2A 3MIAA 3R2BA 4RA5A 3HP5A 4N4SA 5AV0A 4AZWA 4JBQA 4EH4A 2I0EA 3HRFA 3LQ3A 5CTPA 3D7TB 4QTAA 4JBPA 4XG8A 5H8BA 1WBPA 3PZHA 5FG8A 5BVWA 4Q5HA 2R3LA 3PP0A 1B38A 4FV5A 2NP8A 5AUWA 3JPVA 5K9IA 1LEZA 4BTMA 2YABA 2J90A 2C3LA 1BYGA 2WMXA 3QXPA 5DRBA 5JSMA 4Y95A 2OG8A 3F3ZA 3I7CA 1QPDA 4MH7A 4DC2A 1IAJA 4OR5A 4D58A 1PXOA 5ANDA 5CVHA 2QOHA 4GK3A 5J1WA 2XK9A 4DTAA 4G3EA 3SHEA 4CFVA 3EH9A 3FBVA 5B2KA 2ZV8A 5ACBC 3SW4A 3DAEA 2WMSA 4RWJA 3RAHA 3MVLA 2P4IA 3DCVA 3PVWA 4C35A 4O7NA 2UZWE 2PMIA 3EN4A 2NYAA 2J4ZA 4M7IA 3I1AA 3EQCA 3DBQA 3TTJA 2RFEA 3TNHA 2PZYA 3A99A 4HCTA 4AOJA 2XAMA 5A46A 2PUUA 2V7OA 1GIHA 3G2FA 3DZQA 5CYIA 5J5SA 3E63A 3AC1A 5CAQA 4QEBA 5D7AA 2CSNA 4AW2A 4BHZA 4BBMA 4RVMA 3F61A 4QYEA 2XNGA 3ZDUA 3U4UA 2QONA 1K9AA 3ID6C 1OGUA 4FTRA 1M2PA 4QOXA 4LDTA 2BCJA 4KKEA 2VNYA 2XS0A 3NUXA 4W4VA 5J9YA 3Q4ZA 3D94A 3PE1A 5JH6A 5FXRA 3VAPA 4RMZA 3D5VA 5A4TA 5K4IA 4M97A 1KE9A 4H3BA 5FEEA 3VF9A 5J7BA 1YWVA 3HV7A 2C6KA 3ZBFA 4LV7A 3PUPA 2FA2A 3H10A 4O0WA 4PTEA 4XHKB 2YDKA 2UW7A 2XM9A 5M51A 4FTKA 3KL8A 4KIKA 4E6CA 3P5JC 2P2IA 3EQFA 4DCEA 3RNYA 1H00A 2E9NA 5M4UA 2XKEA 3HA6A 4AT3A 4DE4A 3UG2A 4CQEA 5KZ0A 1IA9A 1JWHA 3KXXA 1WVXA 2UVYA 4Y85A 5E8SA 3UC3A 2PUNA 4FODA 5K4JA 4KWPA 5B2LA 3VS1A 2ITZA 3IDCA 3QCSA 3U8WA 1H07A 2OXXA 2RFNA 4ACDA 4I3ZA 4LOPA 4YJNA 4DFLA 4IJ9A 3G5DA 2C1AA 4X7QA 2C6EA 2UZLA 4R7IA 4BCQA 3WARA 2HELA 5KX8A 5CEIA 2X39A 5EDPA 5BVEA 3LJ0A 2YISA 3NYNA 4IXPA 2WGJA 5AP3A 5DVRA 5A14A 1JKLA 1YOLA 3W16A 4RA4A 3BELA 3PXRA 3R00A 2VX0A 3NAXA 4F0GA 3MVHA 2ZM4A 4WNPA 1URWA 5IMEA 2WO6A 4CFWA 3UO4A 4PWNA 4FOCA 3VBVA 5IH5A 2YM7A 4IZAA 5JGDA 4O86A 3ORZA 4RX9A 3W2PA 1H28A 1XBAA 2C5VA 2R3OA 3TUDA 4V0GA 2BDJA 1MP8A 4KINA 4ZZOA 1RE8A 1H1QA 1K3AA 4MEDA 5HU9A 4B6LA 3PG1A 4J95A 5CF6A 3WE8A 5BVNA 4AW0A 4R5SA 5LVMA 4HYHA 3AGMA 4YZMA 2WAJA 4QQJA 3WIKA 4F6UA 2B1PA 2J0LA 4FKRA 1G8AA 2IO6A 4MVFA 3VUIA 3IOPA 2GQSA 5JMSA 3L9PA 4UZHA 3VS0A 1AQ1A 1YXXA 2F7EE 1Y57A 1FVRA 4JVGA 4RX5A 3IGGA 4UMUA 3PIXA 2H9VA 3BI6A 4QQ5A 4A06A 3ETAA 2WTDA 3WOWA 4AE6A 4EYJA 2GS6A 4QPSA 2OZAA 3E8CA 3VBQA 1JKTA 4OTQA 4AAAA 1KSWA 3UYTA 3VUMA 4KIKB 4TYHA 3CTJA 2CHLA 3FI2A 4YJUA 1KE7A 3DKCA 1FMOE 1M7NA 2XKCA 1YXTA 3OCSA 3OOGA 3QX2A 2VD5A 2PK9A 4O4BB 3OP5A 4EWQA 4ZTQA 2XCHA 4YJVA 3JVRA 5M44A 3N51A 3QF9A 4KKHA 3SW7A 4IDVA 5CF5A 4ORKA 5G1XA 5G6VA 2LGCA 4KB8A 4W9XA 3W2SA 5FDPA 5IEXA 4A9UA 4IX5A 4FEVA 2R0IA 1OUKA 5FLFA 4A9RA 5M07A 3EQRA 3KF7A 4EK8A 2Y4PA 4OW8A 4JDIA 4EH7A 3UNZA 4Y73A 3PSDA 5EHYA 2CDZA 3S1HA 4HYIA 5FEQA 3LCTA 3OWKA 4BYJA 4LYNA 3FQSA 1JAMA 2OJGA 4D5KA 5KMLA 4X3JA 5CSWA 3Q2MA 4E93A 4FK3A 1J91A 1MRUA 2XNMA 2Z7LA 3PJ3A 4U45A 5FTGA 4O83A 3FAAA 4ALUA 3EMGA 1IASA 3P7CA 3QTQA 5HIBA 5KMJA 4IAFA 2UW8A 3HRCA 3RVGA 2OU7A 4FG8A 3FWQA 4BCGA 4BCJA 4TL0A 4FUYA 3AOXA 4XCUA 3E8EA 4WBBB 4ZS0A 4O7LA 4WBOA 2YAKA 1PXJA 3A2CA 4L00A 2QOCA 4CYJA 3UQFA 2XCKA 2PMLX 2Z7SA 4EC8A 4I4FA 2DWBA 3LVPA 4G5JA 2J0IA 3C4EA 1Z5MA 1OB3A 4BDCA 3AMAA 2IW9A 4ZTMA 2QU5A 5FQDC 4EQMA 5ETFA 5JZJA 4S30A 4RIOA 3C4FA 2R3PA 3GQIA 5CZHA 3VC4A 3B2WA 2WMTA 3KULA 1QPJA 4FTLA 4ANBA 4EORA 2V62A 4EUTA 4NW6A 3MSSA 2CN5A 3ULZA 3R7IA 4CNHA 3M2WA 4DAWA 4U81A 3QZHA 5LWNA 4BCIA 4OTIA 1SZMA 3CCNA 5FTQA 3C4CA 4LUDA 1J1BA 1JSVA 3QUDA 2YZAA 4AF3A 5HG5A 4QNAA 4G17A 4ITJA 3RWQA 4K77A 4W8EA 1R0EA 4OLIA 3D9VA 5IZFA 2PVRA 3UQGA 4F65A 1QL6A 2EXEA 3G0EA 3NYOA 4DFZE 3DPKA 3GOKA 3W1FA 4BIBA 5IDNA 4RGJA 4C4FA 4OTRA 4RWKA 3LFFA 4RWIA 3NFGB 5GZ9A 4EI4A 1DI9A 4D0XA 3GU6A 3KXNA 3DJ6A 1OL2A 3WE4A 1P5EA 1RJBA 3BCEA 1IG1A 3MH2A 3QWKA 4E4MA 4E7WA 1ZZLA 2I1MA 4E4LA 5JFSA 5IUHA 1NXKA 1UWHA 3GCSA 4JXFA 4DBXA 4EH3A 5AP0A 4O6LA 3FLQA 4OBQA 5ANKA 2GDOA 3W2RA 3QYWA 3BPRA 5EKOA 5DYJA 4X3FB 5KMOA 1REKA 4RIXB 5HVYA 2ETMA 2Z7RA 3S00A 1RW8A 4FEWA 5M06A 3EL8A 3OTVA 4FKUA 3RM7A 3ORPA 3UTOA 3O2MA 3MI9A 2QR7A 4FVPA 4HYSA 4RLKA 1ZXEA 5CXZA 2ZAZA 3F82A 5KHWA 2WEVA 4I41A 2ITNA 3G90X 3KEXA 3H0ZA 4HCUA 5GJFA 4BTJA 4YJOA 5DLSA 5KHXA 2YWPA 5IQFA 1PXLA 2OJFE 3QQHA 4E26A 3PTGA 4UZDA 1DAYA 3T3VA 4OUCA 4BCMA 4WUNA 5AP7A 2UZNA 1PXKA 4X2FA 2ZV2A 3C0IA 1E1XA 2XA4A 3WF9A 4IW0A 4Y83A 1R0PA 5ITAA 5ANJA 3A61A 5AP1A 3W10A 2B9JA 4IMYA 4TTHB 4F9CA 4CCUA 4A4XA 2OIQA 3BYSA 4ACHA 2J5EA 4X3FC 1XH5A 5TOZA 3VBTA 4I5MA 3NR9A 3EQHA 3HGKA 2WNTA 3QRJA 4NUSA 3E8NA 4U79A 3ZHPC 3IK3A 3DXQA 2CNQA 3RNIA 1H24A 2HWPA 3KULB 4PMTA 2DQ7X 2X8EA 4YTFA 5L2IA 4JX3A 1P14A 2ZDUA 3EYHA 3D2KA 3ZZWA 3V3VA 2GHMA 2V0DA 2HZ0A 4LRMA 4QQCA 4ZTRA 4ANQA 2ESMA 2OBJA 2PPQA 4AXDA 1M14A 2WU6A 4O22A 4A4OA 1XKKA 4ACCA 3WF5A 5CXHA 4DGOA 5I9VA 3Q60A 4HGEA 4MXXA 3LQ5A 4ZSJA 4V0GB 5IUGA 2WXVA 2UZTA 3GBZA 3QUEA 4OTGA 1A06A 4CG8A 3P78A 2OZOA 5H2UA 2XANA 3AT4A 4HPTE 2UW0A 4KRCA 4KS7A 4DH7A 3ELJA 5CS6A 2W1FA 3OUNB 4KAOA 4QP1A 5D7VA 4AA4A 4LRJA 1Q8ZA 2AYPA 2ZM1A 3VJOA 5AV4A 1YW2A 4F7LA 3W2CA 2GNJA 5AJQA 4JQ7A 4YHFA 3V6SA 3F3UA 5JKGA 4O4FA 4OTDA 4V05A 4YSMA 3RK7A 4EH8A 1L8TA 3FL5A 1JSTA 5I3RA 5FBNC 3VS6A 5HBHA 3V5JA 4TRLA 2C6DA 5HE0A 4ZZMA 1TVOA 4GUBA 4RJ7A 4MXOA 2G01A 5HNGA 2YCRA 3V5WA 5CSPA 4IVCA 4ZSEA 1ERKA 2ONLA 3D5XA 5FUTA 4D4YA 3M42A 2GS7A 1XO2B 3FSKA 3FMEA 3L8PA 4AW1A 3UIBA 3W0OA 2BTSA 4YJRA 2C69A 2YITA 3TM0A 3TJCA 3R7GA 2OFUA 4XYFA 3QKKA 4YO4A 4D28A 4JL9A 5LWMA 3D83A 2HOGA 5EM8A 5CALA 4BF2A 5HCZA 3FHIA 4DH3A 5IDPA 3O17A 3U6IA 2BZJA 5IQDA 2QLUA 5KZIA 3Q6WA 3HV6A 3LFSA 3O7LD 3LKMA 3NUAA 2GMXA 1BX6A 3LCKA 3UIXA 4IAYA 2XNPA 1Q3WA 5CASA 4WG3A 3B8QA 4HCVA 3NX8A 4MD8E 4F08A 3RP9A 2NNWB 1XR1A 4QP8A 2PY3A 4D1XA 2JKKA 1BL6A 2HIWA 4FSTA 4QPAA 5AWMA 4N0SA 5T3QA 4E6DA 4EOOA 4JNWA 1OMWA 2A4LA 4JR7A 2X7FA 3ZONA 2VWWA 1Q4LA 4UYNA 2F4JA 4G31A 3TKUA 5FGKA 2BAJA 4IB3A 3EWHA 3COMA 1ZOHA 2JDOA 4OTWA 2Z60A 2QI8A 4RLLA 3TKIA 4ANMA 1YHVA 5J9LA 4O0SA 4MQ2A 3GC0A 3ORMA 3EQGA 3BU6A 3LW0A 4S34A 3LHJA 3OW4A 2QVSE 4EK3A 2YERA 2Z8CA 1CKJA 4PF4A 4ENYA 3VVHA 3ZBXA 2GNGA 2W9ZB 2WMVA 4IWOA 2WQBA 3HDMA 3ANQA 5EYCA 3U4WA 5EW9A 3QA8A 1GAGA 2OXDA 4IJPA 3AQVA 3PJCA 3CKXA 4FMQA 5FBOA 3QA0A 3VJNA 4BI0A 4EH6A 4RBLA 2OLCA 4TPTA 4UALA 2V5QA 3FXWA 4FV6A 2JLDA 3D0EA 3PIYA 3PZEA 4KBCA 5JFXA 3UNJA 2G2HA 2J51A 3FLNC 4M13A 4QDEA 5CX9A 3B8RA 1PXMA 1MUOA 5DHJA 5ETCA 4F1OA 1M52A 4FI1A 4HPUE 4JDKA 5CT0A 3BGPA 4LI5A 3TDWA 3N4VA 2XAOA 1H1SA 2E2BA 2R64A 4F6SA 3QHWA 3GCVA 1DM2A 4H05A 4HW7A 3VNTA 3QD2B 4CMUA 4FTNA 4MCVA 4Q2AA 4NIFA 4NWMA 2WTKC 4P7EA 2XJ0A 4GMYA 2C0TA 2PZPA 1JOWB 3PA5A 1QPCA 2CGVA 4J8MA 3ZEWA 2EWAA 3BGZA 4ENXA 5CI6A 3KN5A 4ARKA 3NSZA 4C59A 4Y46A 5DMZA 5HNBA 3H3CA 2WMQA 3UOKA 4QMWA 1DS5A 3PXKA 3KK9A 1Q3DA 4AN3A 5E4HA 3PY0A 5IA1A 3R83A 3LLTA 3D4QA 4ASXA 4FYNA 2VTTA 3TACA 5HG8A 3FI8A 4P5QA 2NPQA 2W1GA 4BI2A 4JG8A 5CLPA 5BQ0A 4FKQA 4X0MA 3HEGA 4UWCA 3SQQA 3HMMA 4QP3A 3DU8A 2WIPA 3UOLA 4RIXA 4BFMA 4C38A 3EQIA 4RIWB 3PPJA 2XKFA 5FP6A 4W9WA 4FSWA 4MXZA 4AT5A 4YU2A 3OCGA 3R7EA 1YXSA 2UW4A 1JLUE 3FJQE 4WRSA 5DOSA 2VO6A 3EQPA 2JIUA 2ITVA 3OT3A 4NK9A 4A4LA 4ANLA 5IQHA 1W2FA 5HX6A 1S9IA 3AD5A 4L7FA 4YLKA 3O5AA 3QX4A 1OBGA 1E1VA 4MXCA 2WPAA 4DEDA 2PVFA 3FMJA 1B39A 3LCSA 1GY3A 3EN9A 3TI1A 5HU3A 4ONAA 1A48A 2A1AB 3VS4A 3R63A 3B2TA 3ZDIA 2XF0A 5EQPA 3KB7A 3RPYA 2ZM3A 2XEZA 3RAIA 3UDBA 2IPXA 1TQIA 2P2HA 3HV3A 1I09A 3TV6A 4DH5A 5J5TA 4I0TA 2WMAA 2B4SB 2YJRA 3POOA 4IANA 5CEMA 2VZ6A 3VF8A 4I6BA 5K0XA 2J9MA 4FZAB 3LFQA 4D2TA 2PZ5A 3WF6A 5IA4A 3D7TA 2CN8A 3V6RA 4J96A 5EM7A 4Y72A 3GGFA 3QGYA 4L6QA 4G6LA 1CMKE 3VONA 2IEWA 4K33A 4DFBA 4FTUA 4JG7A 3F69A 4NTTA 4RZVA 3GB2A 2AEGA 3KXZA 4CFUA 3WI6A 3A8WA 4QMLA 2OZAB 3L9NA 5AP2A 1KV2A 2WEIA 5LXMA 3C0GA 4ASEA 4ITIA 5IA5A 3BWJA 4CT2A 5CEPA 2I0VA 4IHPA 1H8FA 4JLCA 3HECA 2AC3A 2XKDA 4IM3A 4Z7GA 4FL3A 3KCFA 4UBAA 4WIHA 1OIYA 3E62A 3W2OA 4HVSA 3QFVA 5B2MA 3JVSA 4YTHA 3PY3A 2Y8OA 5E8TA 4XV3A 4AGDA 1Q8TA 4FKSA 1GNGA 3VBYA 2IF8A 4J97A 1NVQA 1I44A 4F99A 1WBNA 2ITXA 3AMBA 4LM5A 3VIDA 4OGRA 4M69B 3G6GA 4RPVA 4UYAA 5BYYA 3TG1A 4EBWA 3TKHA 5EKNA 2CJMA 5LJJA 3U51A 4BDEA 1Q61A 1REJA 1ZYJA 3I79A 4JBVA 4QRCA 3QQUA 3EN6A 4DCAA 5BVDA 1ST0A 3ACJA 1PXPA 4ACGA 3KXGA 4O7RA 2OGVA 5IQGA 1OGYA 4K0YA 1A9UA 4R7BA 1LPUA 2YIXA 3CJGA 4ERKA 5FXSA 4FTCA 4FGRA 3E7OA 5GIOE 4XG9A 3R8PA 5IA3A 5M4CA 1ZOGA 2HZNA 3CS9A 2CCIA 2IW6A 1O6KA 4HGSA 4ZY6A 2ZDTA 3DDPA 4FRFA 4M14A 3BKBA 5DWRA 4APPA 4F4PA 1QMZA 2P0CA 5KUPA 1YXVA 3BHYA 3DKFA 3G9NA 2YCFA 4RC3A 2QNJA 3HAVA 4FSYA 4I92A 3R71A 4WNMA 4LMNA 3R1QA 2ITTA 1H25A 4MAOA 4AOTA 4FSNA 2O0UA 2YM6A 3DFCB 4GT4A 4RJ6A 1PMUA 3FZRA 3HV5A 4FG7A 3ERKA 4OBOA 4HVHA 1FPUA 5BVOA 4H39A 2H34A 1WZYA 1BI8A 3QD0A 3MGYA 3IW5A 2HW6A 4OTFA 5CU6A 3PFYA 3RINA 3DGKA 2GFCA 3OBJA 2PVJA 4R3PA 2G15A 4O1OA 3TUBA 5GJGA 3NS9A 5M4FA 1RQQA 2XK6A 2VGPA 2VV9A 2UZEA 2XRWA 3QL8A 4FKTA 4TN6A 5FWKK 3UNKA 2YJSA 5JFWA 3FYJX 3PE2A 2YACA 4YLLA 3TNIA 3AD6A 4D55A 3IQ7A 4MF0A 4EK6A 4TNBA 3HMNA 1GOLA 3O8UA 4O96A 5EHLA 2UW9A 2W1ZA 3ZRKA 4EK4A 2ACXA 2HWOA 2XBJA 5EOLA 3E8DA 1IAHA 1V0OA 1ZYLA 2VAGA 2UV2A 3T9IA 3WYYA 1GIJA 2VTRA 1XBBA 3IDBA 3OCBA 2X0PA 3MTLA 3W8LA 4NKAA 1IA8A 3A4PA 4WOVA 2R3HA 3SX9A 1SVGA 1M17A 3MWUA 3C7QA 3NCGA 3FZOA 4FT3A 4G6OA 3WZJA 4DGMA 4IEBA 3PSCA 3LZBA 4ZZNA 2C0IA 3ORNA 5AIKA 5AAGA 1XBCA 4ZJJA 4WO5A 3RPVA 1R78A 1E9HA 4B9DA 3EZRA 4XMOA 3MW1A 3Q5ZA 4X3FA 5AV1A 3RAWA 1UVRA 3G9LX 4BKZA 4BDJA 5CY3A 3K54A 2OK1A 3RK5A 2BZIB 4I93A 5IQIA 3IG7A 3ZLYA 3UDSA 4DFYA 3LCOA 2R7BA 2Z2WA 4BCPA 2X2KA 2CCHA 2IVUA 2QOKA 2B9IA 4YC8A 3D5UA 5D1JA 2JBPA 3OW3A 4O7ZA 3I7BA 5AX3A 3KRLA 3ATSA 4G2FA 2VTSA 1APME 3IO7A 3CJFA 5GIPE 5HZNA 4QMTA 3FPQA 3F2RA 4MNFA 3N4TA 4JQEA 3LXLA 4HGLA 5M56A 3ZO1A 4BDKA 4ZK5A 3ZXTA 4M68A 2W99B 5HD4A 3CTQA 3F9NA 5C8NA 5HCYA 4PX6A 1WVYA 5DE2A 3HUCA 5HLPA 3QGWA 5HE2A 2XYNA 2YIRA 3EOCA 3NIEA 4NIFB 4PDPA 1UU3A 2REIA 2V22A 1ZMUA 4EOLA 3QTSA 3NNWA 4PRJA 4Y8DA 1SVEA 3COKA 1LP4A 2QU6A 5AUTA 4NZWB 2PE0A 4HOKA 3DDQA 5JZNA 3W8QA 3A60A 4GU6A 4LQMA 5FM2A 5A4LA 5JK3A 4EHVA 4E8AA 4YLJA 4BBEA 5IF1A 3VBWA 1W2CA 1U5QA 5EYKA 4KIQA 2QC6A 3U6JA 3ZO4A 4D4SA 4D2RA 3QD3A 5J1VA 3OMVA 2XP2A 1M2RA 4LL0A 3SXSA 3KXHA 3WIGA 4YZ9A 4GYIA 4YJTA 5C8KA 4BCFA 2QHMA 2VWBA 4AQCA 2OICA 1TFFA 1YDSE 2QOQA 1BLXA 4CZTA 4DEBA 4ASDA 4KBKA 4L9IA 2PZIA 3FKNA 3UYSA 2PVHA 1TKIA 2QOOA 4XOZA 4BCOA 1W82A 4B99A 4UN0C 3UIUA 5AEPA 3K5VA 4XS2A 3QRTA 4L45A 4LOOA 3RK9A 1WMKA 4RWLA 3W0QA 1LUFA 4QPMA 3IKAA 3ZSHA 4HNFA 5IA0A 3EKNA 5KMNA 4EJNA 5C4LA 4QMOA 4WT6A 4XG7A 2VWZA 1W98A 2YDIA 4RIWA 5LMKA 2YM5A 4FNYA 3CTHA 5AUXA 4IM2A 4YHJA 1W8CA 2PZRA 1CKPA 3A4OX 4GFMA 1U46A 1YQJA 4DEEA 4YUQA 3QTUA 4ZS4A 4USDA 1PKGA 3QZFA 5ACKA 5DEYA 5GZ8A 2GQRA 4FEUA 2P33A 3KRWA 4GSBA 5M4IA 2EXMA 1OPLA 1U54B 4XLIA 4I21A 4BYIA 4LRKA 4TYEA 3JR1A 1GZOA 1WCCA 3RI1A 2OI4X 3KCKA 2JEDA 2DUVA 3IOKA 2XYUA 3CR0A 5IQEA 3E3BX 4O7YA 3GUBA 3SDJA 1FOTA 2VTPA 2WTIA 3LFBA 5IKWA 1O6LA 3AKLA