2QCSA

A complex structure between the catalytic and regulatory subunit of protein kinase a that represents the inhibited state
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title PKA-I holoenzyme structure reveals a mechanism for cAMP-dependent activation.
pubmed doi rcsb
source organism Mus musculus
total genus 99
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qcsA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qcsA02
4XJ0A 1HCKA 4YMJA 4MD9E 4ZY4A 3EWHA 4WBOA 3CD3A 1DI8A 4RWIA 4QRCA 4D1SA 2F57A 3I7CA 2ERZE 2IVSA 3A2CA 3O7LB 1J1CA 2YABA 3MH0A 4LGHA 4TYHA 4X2KA 1PXMA 3PA5A 2PMOX 5GNKA 4ANMA 4CFNA 4CYIA 5HZNA 4O7WA 4L8MA 4V04A 4FSZA 4L67A 5J87A 1Y57A 2PUIA 4ENXA 3QRJA 4MF1A 4HVDA 5JGAA 1QPCA 1TQIA 4EH7A 2UZVA 2C5VA 3ZMMA 3O50A 2F49A 2VNWA 4YJSA 5KMKA 4KA3A 4AUAA 4EHEA 3DNEA 2PZYA 4IW0A 3U4UA 4DH5A 3MBLA 3UPZA 3K2LA 2F9GA 1PYXA 1P4FA 3FMEA 3UTOA 3R7YA 3DGKA 3EIDA 5JZNA 4O6LA 3FMJA 1L3RE 3UJGA 4CLIA 4GKHA 3Q9ZA 3BELA 3ZRMA 4IM0A 3KN5A 3DB8A 4GVAA 3DAJA 3QQGA 4AZEA 4FTQA 4YHTA 3D94A 3Q96A 4C57A 4JDKA 4USDA 4LGDA 3ZZWA 3F5UA 4YJUA 1OKWA 3UOJA 2GCDA 4M0ZA 4RX7A 4U7ZA 3FMKA 4Q5HA 5KE0A 3LFFA 4DAWA 4DEGA 3LXNA 4DHFA 2BFXA 4MH7A 4FNZA 3ORLA 4CV9A 1MRYA 2JGZA 3KVWA 2BHHA 2WTWA 3VUHA 3WE4A 3OTUA 5JFVA 4RFYA 4DE4A 4BCOA 5FP6A 3RZFA 2RFEA 2BRBA 1QPJA 3DBQA 3TM0A 2HZ4A 2YEXA 4PDYA 4RX9A 4YTHA 3PY3A 4PL3A 4FEUA 3K5UA 3QQUA 3NAYA 4HGSA 4DFZE 3WBLA 2E9OA 3QA8A 3TNQB 1ZYDA 3KK8A 1KE7A 3IDCA 3G90X 3II5A 3FLNC 5CNOA 5GJDA 4BGGA 2XK9A 2QR7A 3OT8A 2YM8A 2PULA 2CKQA 2QKWB 3UODA 4DH7A 3A8WA 5CENA 3SHEA 4O84A 4FKSA 4IVAA 2R0UA 3R8MA 4FX3A 1JSVA 5C9CA 3HUCA 3IONA 3QALE 3TV4A 3DQWA 3PDTA 4KIPA 3EKNA 4AZFA 1CDKA 3OFMA 4HYUA 3VJNA 3G33A 3HMNA 4X3FC 5CSWA 1UU8A 2J0KA 3UOLA 4PTGA 3DZOA 4M67A 2O3PA 3NPCA 5IMEA 2XNNA 4IJPA 3HMMA 1K3AA 2Z7QA 1V1KA 2GTMA 3LCSA 4ZMEA 2XK4A 2W1GA 4J8NA 5B2MA 4G9RA 3ZTXA 2C5YA 3L9MA 4II5A 3UE4A 5BYZA 5KMLA 2YITA 4JXFA 3A7IA 2WAJA 3C4EA 3F5XA 3PRFA 1SVGA 2R7IA 4JNWA 5L3AA 2CKOA 3V5LA 3FYKX 1WBPA 1CKIA 4XRLA 3RK7A 2LGCA 4U81A 4CSVA 4L3LA 4UX9A 3F9NA 3S4QA 3QTXA 3EQPA 4JT3A 3VS6A 4S34A 3WF8A 4FSNA 2VNYA 5LARA 4C3RA 4ANOA 2H8HA 3HP2A 4F99A 4OAUC 3FY0A 3NGAA 2C1BA 3LIJA 3NNUA 4BCKA 2GQRA 4TYHB 4WNMA 4TXCA 4EQCA 5LMKA 4I3ZA 3ORTA 1P5EA 3HZTA 2EWAA 2XYUA 4JIAA 4IZ7A 4XG8A 5F4NA 1YOLA 4NCTA 1YI3A 2YFXA 5IQCA 3H4JA 4FKVA 3QCSA 4ASDA 2JFLA 3JPVA 2R3QA 5AUYA 4I5PA 2PZPA 4S32A 4C0TA 1OI9A 2F7EE 3LFNA 1GJOA 5C8KA 1VYZA 1R3CA 3QD4A 4ERKA 4YR8A 3KC3A 1JAMA 5KNJA 2Q0NA 1PRYA 4MHAA 2C69A 5B7VA 3R63A 4H1MA 3MN3A 5EW3A 4TW9A 3QXOA 4EKLA 3NSZA 4QTBA 3OOMA 4DLIA 5AR5A 3DT1A 4FTAA 4BDEA 2Z02A 4I21A 3T8OA 1GIIA 4UYNA 4N4SA 3ZOSA 2IVVA 1V0PA 2UVZA 3EFJA 4NM3A 3CR0A 4B9DA 3IG7A 5D12A 4AXAA 3QQLA 1Q4LA 3BYSA 1KV2A 3UBDA 3RPRA 3V8WA 4WIHA 1PXNA 3EN5A 3R7UA 1YHWA 4U9AA 3TG1A 4FZAB 4FSWA 4C4JA 4J97A 5E91A 1H8FA 4FT9A 1VJYA 4HCVA 2AYPA 3OD6X 5FRIA 5HBEA 3ZM4A 2BDJA 3UG2A 4ZZNA 4BZDA 2FYSA 2OFUA 1ZYSA 2OKRA 4YZNA 3VBYA 2QO7A 2UV2A 4FV1A 4O86A 3QTUA 3HRFA 1GY3A 2OICA 4CFVA 4APCA 4I0TA 1OPKA 4G2FA 3ZEWA 5CU0A 4K11A 4DG0E 4GT5A 3U6JA 1M17A 2R3PA 2W1ZA 3ACKA 4CZUA 1JPAA 2OW3A 5A54A 1GZOA 5FG8A 2X4FA 2CKPA 3POOA 1IASA 4XG6A 5HO6A 4KS7A 4ACDA 3WIGA 3CC6A 3R1QA 3DTWA 2OJJA 4ACGA 1YWNA 1XO2B 3E8CA 4RIYB 4WSYA 4DINA 2ZJWA 4L9IA 4O96A 4F0FA 1YXVA 1H1WA 4RIWA 1ZYCA 4XOZA 4FV4A 3QTQA 5CEKA 4BBEA 2HWPA 4RJ3A 4E4NA 1AQ1A 4LUDA 1W84A 4NKSA 3R8LA 3PP1A 3U4WA 4FIEA 4BKYA 4YJPA 2W1FA 2XK7A 4XMOA 2CN8A 3BI6A 3Q4CA 3FQEA 3E8NA 3KN6A 4IEBA 4RVLA 3QC9A 4TRLA 5GJGA 3E87A 4BHZA 2XK8A 5AR8A 4EI4A 1KOAA 4EQUA 2IVUA 2GFCA 2ITPA 3DY7A 4NUSA 5AA8A 4Y85A 2YACA 4FTNA 3ZUVA 4CKJA 3QKLA 4BDAA 5LVPA 1ZMVA 5EW9A 5LVMA 3QKMA 4J95A 1E1XA 2RFSA 3WZUA 2BR1A 4QP6A 3FYJX 1M2QA 4E6QA 4YURA 3G51A 2J90A 5E1EA 1OB3A 3GQLA 3W8LA 1PY5A 2I0YA 5D41A 4W9XA 2UW5A 2BZKB 4Y83A 4KSPA 3SLSA 5ETCA 1YXUA 2WTIA 3BU6A 2BROA 2X2KA 4OTQA 3G15A 3AD6A 2DUVA 2JKMA 1RQQA 5HGIA 2VTNA 4CQEA 2W9FB 5FDXA 4OBQA 1M14A 2XZSA 3G6HA 5IDPA 4KRDA 3MESA 1H26A 4C7TA 2WMXA 1YW2A 2W4KA 4IANA 2E9NA 4GJ2A 3FAAA 3PVBA 3O96A 5AWMA 4ZTNA 4JAJA 4UZHA 3PYYA 3IW8A 2B52A 2XEZA 4GUEA 5BX0A 1AGWA 2YDJA 2IZSA 3DA6A 3IECA 3BGQA 3R1SA 4IAFA 5AUTA 4KINA 2CNQA 1BKXA 1NW1A 5DT0A 3TUCA 4MNEB 4BCMA 4JJRA 4DEIA 1RW8A 5HX6A 3OC1A 3SXSA 4ASEA 3PZEA 5IG1A 4BYIA 5LXMA 2R4BA 3WOWA 4DF3A 1AD5A 4V0GA 4HJOA 2QKRA 4UMUA 1L8TA 2BTSA 2XP2A 5ANOA 2PVJA 4BCHA 5FP5A 4BI2A 3Q60A 4KIQA 4QMMA 3W16A 2PTKA 4ZAUA 1R0PA 3CKWA 3D5XA 4FEWA 1SVHA 4WKQA 4X6RA 4EK5A 5AP2A 3RKBA 5IEYA 1K9AA 1YHVA 3QFVA 3HKOA 4O22A 3C51A 2PK9A 4RX5A 5EQPA 1SYKA 1CM8A 3MB7A 3VQUA 1H01A 3EN4A 3SQQA 3GP0A 4JRVA 1JVPP 2YJRA 1IR3A 3SV0A 3ZC5A 4E3CA 4CVAA 2FSTX 4YZBA 4YTIA 2YM7A 5ANIA 4FTJA 4M3QA 1KOBA 4AW5A 2FH9A 4LM5A 3HEGA 5DT4A 4DA5A 3C5IA 5EQYA 5KKRB 3CD8A 3OBGA 4QTAA 2V22A 2VU3A 4JX3A 3HMIA 2R3NA 4XX9A 4XP3A 1H4LA 4X2JA 2XH5A 2GDOA 4TKSA 3NCZA 3HRCA 3R02A 3JY0A 3LFSA 5E8TA 5JEBA 2B1PA 2W4JA 2OJGA 4LOOA 2JFMA 3ORMA 1FGKA 2C3KA 4RIWB 4M66A 4WUAA 2CGVA 4IACA 3LCDA 3HV5A 2WKMA 5M53A 3AT2A 4DITA 4O0VA 3NW6A 1JLUE 4NJ3A 2IZRA 5L2WA 4DT8A 3HV6A 4Q9ZA 4O0YA 2IW8A 1OUYA 3LFDA 4EH6A 4FF8A 4UY9A 5A6OA 5M56A 5EHLA 5AAEA 5J9LA 4LRJA 3R9RA 5HKMA 5ANJA 4IM2A 1R78A 4WA9A 5E90A 3LMIA 4RJ4A 4QQCA 2C5NA 4H58A 4XLVA 3SOAA 3FKOA 4G31A 4RFMA 3T9IA 2A2AA 4AGCA 4C4FA 2XBJA 3BYUA 4LOQA 3QQJA 5D7VA 1WVXA 3F3WA 2BHEA 2IG7A 3V6RA 1UNLA 2VRXA 4YU2A 2OBJA 5HNGA 1Q8WA 2W99B 2BRMA 5CI7A 4U5JA 5K3YA 3ORPA 4H3QA 5CLPA 3O2MA 3QQKA 3P9JA 3G0FA 3BEGA 4BYJA 3BWJA 2QNJA 2P33A 4HZSA 3Q04A 5A14A 2RGPA 2UZNA 3QA0A 3R8ZA 2RF9A 3TI1A 3UP2A 4GFOA 3VS4A 3U9CA 2YM5A 4WG4A 1YXXA 4ANLA 2CHLA 3FY2A 5HLWA 1H28A 1Q97A 3KY2A 4GK4A 5CZHA 3FEGA 4D1ZA 5IQGA 2Z7SA 1H07A 4AN9A 5M4IA 4YZCA 1S9JA 2OIBA 2PUPA 4C4GA 3R73A 3PWYA 4CKIA 4FV7A 3PJ3A 3ZSHA 1KSWA 2HZIA 3MA3A 4B99A 3RCJA 3ZXZA 2ERKA 1CSNA 2NRUA 3UNKA 1QMZA 5T6KA 4R77A 1PJKA 4IC8A 4WSQA 3BRBA 3CS9A 3MA6A 4TYEA 4ANQA 4FEXA 5EDRA 2WFYA 2OH4A 4GK3A 2E9VA 2JAVA 1H08A 5TF9A 4HYHA 4MQ2A 4ZS4A 4Y5QA 4BWKA 4ONAA 1FVTA 5AFVA 3G9LX 1Q3DA 3NRMA 4FUXA 5J8IA 3BLHA 5FTOA 5CSXA 3VF9A 1MUOA 4BICA 2VO3A 2WQOA 2X81A 4R5YA 2R3MA 2ITNA 2VAGA 4FV5A 2ZB1A 1P2AA 5AR4A 1SNUA 3BPRA 4M12A 3P7AA 2ZDTA 3PLAE 4F1OA 3REPA 1SMHA 4I4FA 3PXRA 4U43A 2I6LA 3JUHA 3Q52A 3NNWA 3SA0A 2CPKE 3DS6A 5CT0A 4AQCA 4HNFA 4L43A 2PYWA 4FTLA 3OWKA 3N51A 2W05A 5LQFA 3N9XA 3R9DA 3OCTA 1APME 4O0XA 4F64A 5E9EA 4W8EA 3FMDA 3PJ1A 3EFKA 1U59A 4L7FA 4BCGA 3EQIA 3MV5A 1PMVA 4O27B 4NM5A 2XIXA 1JKTA 3RAIA 3KU2A 4KBAA 1PKDA 2QONA 3ODYX 3PXFA 4FKLA 4UXLA 1EH4A 4AACA 4BTKA 4TL0A 3PSBA 4AT4A 4QTEA 4U6RA 4MD8E 3QTRA 3SOCA 4AF3A 4BIDA 4O1PA 4O83A 1OPJA 1F5QA 5FEDA 4YLJA 2F7XE 5A4LA 1TQMA 1M7QA 2ITXA 1ZARA 1FQ1B 3R2BA 4B8MA 4KWPA 4BRXA 2UZEA 4G3CA 4EH5A 2C6MA 3PVWA 4I5CA 4GS6A 3FPMA 1XH4A 4FSYA 3DXPA 4J71A 1OPLA 2VV9A 2YDIA 3WZJA 3PFQA 4C2WA 3VF8A 3DBFA 5IEVA 5KMIA 2H6DA 4FL1A 4IDTA 3DK6A 4WD5A 2W1EA 2OJIA 4AOTA 4OTPA 2UZUE 2XYNA 4Y8DA 4H1JA 4BR3A 3JXWA 4MXZA 3QL8A 2EB3A 3A99A 3KULA 4XHKB 3EZRA 5M08A 2UZWE 4AAAA 2ACXA 2B53A 1SM2A 5I9YA 3EQCA 4KIKB 3ZZEA 3GU4A 2O0UA 3KB7A 3A62A 3FQHA 1UVRA 4QP2A 5H2UA 5HE2A 3WARA 3HDMA 2VTRA 3GOKA 2VO0A 3LCKA 4ENYA 4F4PA 5J9ZA 2QU5A 2HCKA 5AP1A 4O7SA 1H1QA 2HY0A 1ZYLA 2WU6A 4KRCA 2YZLA 3HGKA 4EOQA 4Z55A 5J5SA 5I9ZA 5JFWA 3P23A 2CLQA 3C13A 3NAXA 1BLXA 5AA9A 4PDPA 4RC2A 5AX3A 1F3MC 5AR7A 3E8DA 4PQNA 4ZS0A 3KXZA 3R0TA 2VTJA 1Y8GA 3C4WA 4WRSA 4NJDA 3HVCA 3TXOA 3H30A 4EH3A 5J1WA 4AA4A 3MY0A 3FLQA 4AOIA 3Q4ZA 4QPAA 3QCYA 3TNPC 3HAMA 3DFAA 3BHHA 5KZIA 3GCPA 1JSUA 4QPMA 3IKAA 4ZTSA 1M2RA 3KXHA 3NYNA 3T9TA 4DGOA 4FIHA 1R0EA 5CNNA 3SRVA 2WTKB 3VW8A 5BUIA 2PZ5A 3FI2A 1GNGA 5BYYA 3COKA 2VN9A 3B8RA 3OXZA 4BTMA 4ASZA 3H3CA 4QNAA 4ANSA 4QYFA 3R9OA 3NUAA 2JKOA 3OUNB 2OG8A 2J51A 2PVLA 4O82A 2ITZA 1VR2A 4NSTA 4OTGA 3WZKA 2B9HA 3LOKA 4C02A 5HVKA 2YWVA 4ZMFA 4L53A 4ZEGA 4U79A 2Y7JA 2RL5A 4D2WA 2AC5A 4JG7A 4AU8A 2HXQA 4EH9A 2C6EA 2QO2A 3RHXA 3U9NA 2FSLX 1KUTA 3ATSA 1BMKA 4O81A 3S1HA 5BVKA 3FDNA 2QOBA 4U40A 4H3PA 3ATTA 4X3FA 3MH3A 3V5JA 4EH2A 4FT5A 3DJ6A 2H9VA 5AR3A 4DLJA 2PWLA 2A0CX 2XIKA 2I7QA 4NYEA 2V62A 4HYIA 1YWRA 3IGOA 5ITAA 2HIWA 3TZ8A 5CU2A 4DEDA 4ZP5A 4GU9A 4QMOA 3ORKA 4XG4A 3NMUF 5KMOA 1OBDA 3GC0A 4M68A 4FV6A 4IJ9A 4N6YA 5J1VA 5IISA 3U6HA 2BAKA 3EN6A 3KF4A 3CBLA 5M55A 3SDJA 1WMKA 3UO6A 3LCTA 4CFMA 2NP8A 4UYAA 2IJMA 3TWJA 4LUEA 4D9TA 2WGJA 1Y6AA 3PVUA 4P5QA 3FSFA 4XG2A 4C59A 2WD1A 4TNBA 4EK6A 4IX5A 5EHYA 5CF8A 1W83A 2UVYA 3KF7A 3EOCA 3ENMA 4PV0A 4QMNA 4OT6A 2CMWA 4GG5A 4CG9A 4GT3A 4M0YA 5BVNA 4ID7A 4BY9E 3MPTA 3MW1A 3P7BA 4QMPA 3VS0A 1A48A 2F7ZE 5FTGA 5A4QA 2HAKA 1WBVA 2WTKC 2C6TA 2Z7LA 3EYHA 3KXNA 3IDPA 4MXYA 4BL1A 5EOBA 1O9UA 5L2TA 2FSMX 4YHJA 5CU4A 4G5JA 2BPMA 1DM2A 4G3EA 4ALWA 2WMRA 1WBSA 4C34A 2XS0A 4MTAA 1S9IA 3AMAA 4WG5A 4UZDA 4O6EA 1O6KA 3R6XA 4Z3VA 2OSCA 2QOOA 2ZVAA 4L52A 5D10A 5EK7A 3ITZA 2JC6A 5E92A 3I6WA 1GAGA 2IW6A 3A61A 3F82A 4F08A 4EHVA 3R9HA 3N4TA 3E5AA 4XEYA 4C58A 4UWYA 1MP8A 4DN5A 2VWBA 4BKJA 2PVHA 3BWFA 4HGEA 4IAYA 3M11A 2CCHA 2XNBA 3L9NA 2G15A 3NNVA 3RINA 4YTCA 1IAHA 5EQEA 4FV3A 3CQEA 4XG7A 5CZIA 4D2TA 3P0MA 2OGVA 3PY0A 2VWIA 1P4OA 3ACJA 4DEBA 3MVJA 5IF1A 4L7SA 4JR3A 4O0TA 4ZJIA 5EYCA 5IZFA 2RSVA 4IXPA 3ORZA 3UIBA 1ZOGA 2O65A 2Y4IC 3ORIA 3QZFA 3TNIA 5M57A 4G1WA 2UW7A 3F88A 3EZVA 3KRXA 3NUUA 3TACA 3W55A 4I24A 2C3LA 4EBVA 5KMMA 2UW9A 2XKEA 3A7FA 4CRSA 1H00A 5EKNA 4D2SA 2YCSA 3C1XA 4PF4A 5KO1A 4IH8A 3MH1A 4PNIA 3VVHA 4X3FB 4S33A 3TZMA 1FVVA 1J3HA 3LVPA 4CFUA 3VJOA 3QLFA 5CU3A 3D2KA 2YIXA 2BRHA 3UYSA 4F9AA 1OL2A 3MDYA 4EUTA 3QD3A 3QRKA 3R21A 4G5PA 3FI3A 3TEIA 4ACCA 2WOUA 3P4KA 3D9VA 3ULZA 3FKLA 1QCFA 3KGAA 4EOPA 5B2KA 3UO5A 2PPQA 4BVUA 2G2HA 3UYTA 5CS6A 5BUJA 4QMVA 4WNPA 3LQ8A 2H34A 4CRLA 4R7IA 3HP5A 1B39A 3ZBXA 5DR6A 5BNJA 4FKOA 3BU3A 4RQKA 2IVTA 3LFEA 2WHBA 4RJ8A 2F2UA 1UNHA 2WMUA 4LGGA 2C5OA 5J79A 3RK5A 2C6LA 2QOHA 4FVPA 3GU7A 4RC4A 3BEAA 4AOJA 5C26A 3C4CA 4CLJA 4OLIA 5DE2A 4PMSA 5FEQA 3PA4A 1G5SA 3D5WA 5TR6A 5M4CA 2OIDA 3V5WA 4L01A 4ZSLA 1Q99A 3BHTA 2SRCA 4D55A 4FSQA 2Y9QA 4CYJA 2UZTA 4FMQA 3EQFA 4M97A 2W5AA 4D2PA 5AP3A 3LFAA 3WE8A 1X8BA 1MQBA 4GRBA 5AIKA 2OXYA 4IHPA 2GNHA 1TQPA 3RWQA 4OTWA 4F7JA 5FD2A 3ENHA 4AGWA 4F6WA 5HU3A 2ITQA 1JNKA 2UW8A 4K18A 2VWWA 5KCVA 4G17A 4RIYA 3EL7A 3F7ZA 3TN8A 4CD0A 2WOTA 2B9JA 3FZRA 2JDRA 2W1DA 4L3JA 4TWCA 5AIRA 4D4YA 2CCIA 4E20A 1QL6A 5CWZA 4QP7A 2GNLA 3BHYA 4C8BA 2RFNA 4EKKA 3VHEA 2PVFA 5DIAA 4PMPA 1REJA 2PL0A 2R3OA 4M69B 5I9XA 4HGLA 3CY3A 4QMXA 5E4HA 1BUHA 2UW4A 2G1TA 1O6LA 2BUJA 2J9MA 5I9UA 2Z8CA 2FO0A 4FNXA 1QPEA 4TWOA 2HENA 5HO8A 4BF2A 2EXEA 2EXMA 4U41A 3MPMA 3NYVA 3R1NA 3P86A 3PXYA 3F6XA 4RIXA 2GPHA 4TZRA 4FVRA 1P14A 4IADA 1TKIA 5HG7A 5EM6A 3T3VA 1Q3WA 4O7VA 3QUEA 5FXSA 1VYWA 1FPUA 2BALA 3P1AA 2JDTA 5IQIA 3IW6A 5CU6A 2BDWA 2GMXA 3AT3A 3KCKA 4ZLYA 4ZTQA 4FOBA 4QMSA 5TKDA 3BV3A 3LW0A 4FVQA 3C4XA 1RE8A 1Q62A 3DKGA 3QHWA 3TIYA 3ZDIA 1FMOE 4RRVA 1GIHA 5CEIA 3UZPA 1OKVA 2C6KA 3RPSA 3OY3A 1WBOA 4KIOA 4FG8A 1I44A 3D7TB 1YDRE 3H0YA 4BTFA 1Q8TA 3SGCA 1U46A 2CN5A 3MJ2A 4IAIA 2P55A 2GS2A 1Q61A 3CJFA 3F61A 1PMNA 5M4UA 4AZSA 4GSBA 5FUTA 4R6VA 2C0OA 4IZAA 3GUBA 3MS9A 1YOJA 4MEDA 4KAOA 3CQUA 4PTEA 1UWHA 3JYAA 4IWPA 4MNEA 4XRJA 4IFCA 2ITTA 4M84A 2XIZA 3OCGA 3UDBA 5IA1A 1ZXEA 3CIKA 3IOPA 1PKGA 3EQDA 4QQJA 3W32A 4G9CA 4L00A 1YKRA 3HMOA 4LMUA 3DKOA 4UB7A 4FZ6A 5AP6A 2BVAA 5CSHA 3SAYA 4E5BA 4GL9A 1G8SA 1ZZ2A 3U6IA 4YLLA 4EJ7A 3ID6C 4I0SA 1Q8UA 2ETRA 3GC9A 4C35A 2GTNA 4XNEA 4A9RA 1HOWA 3F3VA 3R8VA 3KQ7A 3BYVA 3HL7A 2XMYA 4X6QC 3MB6A 5DI1A 3RTPA 5IA2A 4EONA 3UZTA 1V0BA 1XWSA 4AFJA 3TUDA 5A4EA 1Z5MA 3F2RA 5DYJA 1MQ4A 3ZSGA 3AXWA 3OROA 4RX8A 3RP9A 2CGXA 4E4XA 3AC4A 2J0IA 2R64A 3BBTB 4G6LA 4OT5A 5L6WL 3V5TA 5HD4A 4CFXA 2PUNA 3G2FA 1T45A 3PE1A 3F3UA 4LOPA 3P5KA 3Q2JA 1MRVA 1PXJA 3HX4A 4RIOA 5ANEA 4YSMA 3D14A 3NUXA 4NH1A 4E73A 4JDJA 3UQCA 3FSKA 3PJ2A 3TKHA 5JH6A 1UV5A 3NIEA 3GFEA 5HI2A 1DAWA 3UNZA 4DYMA 1URWA 1PXOA 3BQCA 3EKKA 3MYGA 4NM0A 1M52A 3ZH8A 4BFMA 3E93A 4FKJA 3DNDA 4EYMA 3VIDA 2XIRA 5I9VA 1NVRA 2J5EA 4FYNA 2GNJA 1B6CB 3R7VA 4DH8A 5IQBA 3UNJA 2XRUA 4YHFA 2YCRA 2YDKA 2X7FA 4IWQA 3IS5A 3MGYA 1OECA 4RVMA 5AP4A 5DWRA 4B7TA 1ZY5A 4HCTA 4PNKA 3FLSA 3P78A 3R28A 2OF2A 4IFGA 5AEPA 5C4LA 3F69A 4K2RA 4NEUA 4RIXB 4UWBA 2V7AA 2FB8A 4APPA 4KD1A 3ZRLA 2Q83A 3UVPA 2VTPA 4FA2A 4QMZA 3O8TA 4WG3A 5HEZA 5JK3A 4O7TA 3QLGA 4F9WA 1ZZLA 2J0LA 1ZRZA 4FK6A 4FL3A 4NTSA 2GU8A 2J2IB 3O23A 4B8LA 2PSQA 2NNWB 2FSOX 1KE8A 3DOGA 3SW4A 5DR9A 1ZMUA 5HHWA 1H0VA 3WF6A 4IVBA 4ZLOA 2ESMA 3SW7A 4YO4A 4GCJA 4O0UA 4RWLA 5EW8A 4U8ZA 2GSFA 3LE6A 4DGGA 3QBNA 3E7VA 3FMLA 3IW4A 3WF7A 2WTJA 3NUYA 3ZU7A 3RM6A 4D5KA 3JR1A 2Z60A 1WVWA 4RZVA 1IEPA 3OCSA 5HIDA 2WMTA 2OU7A 2IO6A 3KMUA 4FKUA 4I5MA 3RCDA 3POZA 3ZC6A 4UN0C 3V5PA 4OUCA 4C61A 4Y73A 3TL8A 4MXOA 1NVQA 3UMWA 4M7IA 2R3HA 2VWVA 3R83A 2UW6A 4UMPA 5IQFA 2WIPA 4GIHA 5AUXA 4J52A 3DXNA 3R7IA 5IH5A 5BMMA 2VTTA 4UMRA 1BL7A 4OBPA 1LR4A 5JRSA 1IRKA 4D2RA 3C0GA 4E6CA 2FGIA 5J7BA 5HICA 2QOIA 3VS7A 4D0WA 4MK0A 4JOAA 2GQGA 3PTGA 3QU0A 3G9NA 4A4XA 5AUUA 4HGTA 4BHNA 4DG2E 2JIUA 4ZOGA 5FBNC 4BI0A 2RKUA 3CTJA 4C4HA 5L8LA 2W1CA 3UVRA 5J95A 4B6LA 1PYEA 5BQ0A 5HVYA 2YZAA 3LM5A 4FKIA 4WT6A 1BX6A 5FM3A 3TV7A 1M2PA 3VNTA 3BV2A 4K9YA 4E4LA 1NVSA 3MFSA 3NYOA 1JOWB 4HZRA 2JLDA 5EDPA 5LOHA 2HK5A 3VBQA 3OW4A 4YSJA 4FKRA 2G2FA 4DGLC 3ZONA 4BZNA 3SC1A 4HPTE 3ZCLA 4D4RA 3MPAA 1UKHA 5C8NA 3RM7A 4FODA 2R3GA 4FT0A 4FOCA 4LQMA 3NEWA 4DC2A 3GCQA 4GK2A 1PMEA 3I79A 5HTBA 5I9WA 3EJ1A 4NTTA 3DKCA 5IH4A 1GIJA 3ZLSA 4QNYA 1XH6A 3NWWA 5EHOA 4JBQA 3V5QA 4BGHA 4LG4A 2GQSA 4AWIA 5EYDA 5BVWA 3TTJA 4NFMA 2R2PA 5A3XA 3CEKA 4GKIA 5HNIX 1CTPE 5BUEA 5J9YA 5F1ZA 4UMTA 4O1OA 4KABA 4QTDA 3R9NA 3VAPA 3B2TA 5GIOE 3ALOA 3PWDA 4Z7GA 4MBJA 4Q2AA 3PE2A 2QQ7A 4RA4A 4AW0A 3Q4TA 4WO5A 3DU8A 3GB2A 3SG9A 2WTVA 5FWKK 2PVYA 3BIZA 3D4QA 4F6SA 2X6EA 2IW9A 4OAVB 3GXLA 4LYNA 4WOVA 3E63A 4C38A 5IUGA 2PU8A 3FMNA 3IO7A 2W5BA 4RC3A 3FHIA 2I0VA 2AC3A 3GI3A 2AUHA 3ZHPC 4W8DA 4GIIA 1JKSA 3LKMA 1Q41A 4EC9A 4EOIA 2R3FA 4R7HA 4L46A 4AE6A 3I81A 5H3QA 3BZ3A 3OCBA 2C0TA 4RVKA 4YO6A 4KIKA 4R3RA 2QU6A 3M2WA 2VWUA 4W4VA 2YIRA 3ZFXA 2OLCA 3LMGA 4DGNA 5DT3A 4BDGA 4EOOA 1G8AA 2OJFE 2YM6A 2PVKA 3Q2MA 4Q5EA 4R5SA 4ASXA 1UU7A 1PF8A 1XBCA 3FXXA 4XV2A 2JKQA 4X21A 1J7LA 5AUVA 1I09A 4U42A 3MFUA 3GGFA 3QUPA 3R7OA 3U8WA 3S2PA 3MIAA 3R2YA 3QRIA 1OZ1A 3GU8A 3BBWA 3WIKA 1WBWA 3GENA 4H36A 4GYGA 4EHGA 4F6UA 5DA3A 5IQAA 4FTMA 2XVDA 4HPUE 4IB0A 3RBWA 1LEZA 1NA7A 2QURA 2R3KA 2WQNA 3MFRA 2ETKA 4JBPA 2XRWA 3BE9A 5M06A 4E26A 2VTQA 4ALUA 3PIZA 2WEIA 4EOLA 4XUFA 3QCXA 4QMQA 2PE1A 2ZB0A 3QWJA 4HNIA 3V04A 3OG7A 3LQ5A 4MXXA 3PJCA 4LFIA 4QP4A 5DVRA 3I5ZA 2OZAB 3QTIA 3U87A 3DZQA 2HY81 2UZLA 4OTFA 3UOHA 5LVNA 2YA9A 3QZHA 4ORKA 2Z2WA 1XJDA 2OH0E 3B8QA 5D11A 2RG6A 4XBRA 4YJTA 3PPZA 3ZYAA 3R8UA 3E3PA 2OFVA 4GG7A 1JKLA 5BVEA 2F4JA 1JKKA 2BCJA 2REIA 4UALA 1KE6A 3N4VA 4YJRA 3V8TA 4ZSJA 2A4LA 3CP9A 2XK6A 1OIUA 2XNGA 4Z7HA 3PXKA 3VBVA 1XQZA 4A9TA 2HXLA 2RFDA 1ZWSA 4KBKA 5FTQA 1K2PA 2W4OA 3NUNA 2YCFA 1YXTA 4GH2A 3C50A 3MVMA 4KS8A 4MVFA 4ZZMA 1J7IA 4JVGA 4CFFA 2FVDA 3HA6A 5EDQA 4DCAA 2A27A 3RAKA 2GNFA 3CTHA 2VZ6A 4GT4A 2BFYA 4IWDA 4K33A 2A19B 2DS1A 2UW0A 2WMSA 2OZOA 1WBTA 4G6OA 4JI9A 4BZOA 3RAWA 1T46A 3RNIA 4I4EA 3UPXA 2O8YA 4E8AA 2XUUA 3ZM9A 3PP0A 2GHMA 3HRBA 4I22A 4QD6A 3A60A 4IM3A 3CKXA 1O6YA 3OVVA 5FM2A 4L44A 4ALVA 3D5UA 5C03A 4JDHA 4FG7A 1U5QA 4FTOA 4U3ZA 4BBFA 4JS8A 4NU1A 4I92A 4XV3A 2C0IA 1OITA 3OOGA 3RALA 3I7BA 2WELA 1RDQE 4PPBA 4YLKA 2QLQA 3NLBA 4IDVA 4FG9A 3HDNA 3FZPA 2W06A 2ITUA 4I6BA 4YGAA 4PTCA 4BDKA 4YJQA 4EC8A 5HVJA 5K4IA 2PVNA 3EHAA 1XBBA 3DB6A 3ERKA 3ZLYA 3IK3A 4E6AA 5AP0A 3NX8A 2GHGA 4L3PA 3ANRA 2KULA 4FTIA 3F2AA 3D2IA 5F94A 1G3NA 2F2CB 1XBAA 3EFLA 3GCUA 5ACBC 4BKZA 4PMMA 5AM6A 4RPVA 1CKPA 4JBOA 5DOSA 3KMWA 4I23A 2WPAA 5ANGA 4EZ5A 5HTCA 1XH7A 2X9FA 1ZMWA 1WAKA 3CPBA 4RJ6A 5BVOA 4IVDA 4F0IA 1A9UA 2X4ZA 1H25A 5L2QA 2W0JA 4H05A 2R7BA 3PG1A 4CG8A 2VGOA 3PLSA 3QYZA 3V51A 2VX0A 4F0GA 4W4WA 5AMNA 4D4VA 2VWYA 3KRWA 2V5QA 2GS6A 3HNGA 4N57A 3SKCA 5HESA 4FTUA 4BDHA 2C30A 4BCPA 4C62A 4BBMA 3QHRA 2X6DA 3BGZA 4FICA 3NW7A 1NY3A 2GNIA 2CSNA 3KA0A 3KFAA 4BIEA 5M4FA 3P08A 4F9YA 3GU6A 2ZOQA 1H1PA 3UGCA 2B55A 1WBNA 2YM4A 3SX9A 2J6MA 4I6FA 4ZZOA 5T68A 3QGWA 1GZ8A 4AZTA 2BZIB 5KBQA 2ITWA 3IOKA 4FV0A 4MBLA 4QQTA 3PPJA 4EJNA 5HE3A 4RWJA 4TNDA 4XV1A 2XKCA 2NPQA 2XKDA 3BX5A 5GINE 3L1SA 2QI8A 3RK9A 2WZJA 3NW5A 3FZ1A 4BGQA 4CCUA 5BVDA 1U54B 4MF0A 4DFUA 3FBVA 3DLSA 4FEQA 5EM7A 1OIQA 2HZNA 4I41A 4PDSA 5JQ5A 3F3TA 3R8PA 5KX8A 2OXDA 3E64A 4BCNA 3G5DA 3RAHA 4L45A 1J91A 2VX1A 2V55A 3VUDA 4NFNA 1REKA 1GZKA 3BLRA 2YAAA 3GVUA 4IZYA 3MIYA 3PG3A 4USFA 3ORXA 4FKWA 4AA0A 4Z16A 5J7HA 3W2OA 2Y4IB 3ZO3A 2W1HA 3R30A 3VUGA 4EEVA 5GZAA 3ZDUA 1UU9A 5BPYA 1E1VA 4XG9A 3FQSA 3PXZA 1ZYJA 4GU6A 3QWKA 1ZAOA 3E7OA 4MYGA 4YJVA 4UBAA 4AS0A 3MI9A 4C37A 3I1AA 2XM9A 4TY1A 4UWCA 5C01A 1FMKA 4E6DA 1BI7A 2YERA 3QZGA 4G3GA 4OR5A 3TNWA 4BWXA 3EQGA 4QMUA 2DWBA 5KHXA 4RWKA 4W4YA 4FE2A 3KVXA 3L9PA 3MY1A 1WFCA 3FMMA 1OVEA 2WQEA 4Y72A 4TWPA 3HECA 2HELA 5HLNA 2C3IB 3FLZA 4JQ7A 2JEDA 3ZO2A 2BRGA 5IA0A 2W7XA 2YIWA 2YM3A 3NYXA 5IA3A 4EOJA 2WEVA 4YNOA 2CLXA 2XB7A 4IIRA 1QPDA 3VUIA 4F65A 3UIUA 4J1RA 2ZYBA 1SVEA 2BRNA 5DGZA 4MWHA 4DEHA 3FXWA 2YIQA 4BWPA 3ZRKA 5GZ9A 3ZUUA 4D2VA 4XP0A 2VTSA 3DDQA 4YJOA 2QG7A 4NL0A 5CAUA 1JSTA 5JSMA 4JBVA 3HA8A 1A06A 2WMBA 5I3OA 1FBNA 3VHKA 2B9FA 4WNKA 4L68A 2XKFA 4NT4A 4I93A 4E5WA 3DBDA 4GFMA 4U97A 4FSUA 4O7YA 3EQBA 4K0YA 2PY3A 4G3FA 4OTIA 3AQVA 4YBKA 1XH5A 1UNGA 3TNHA 3VUMA 2I0EA 2BIKB 3QGYA 4HVHA 2QOFA 4QMWA 2IZTA 2ITVA 4M69A 1OKYA 2ONLC 5EM8A 4BDBA 1PMUA 4PP9A 4IX4A 5CI6A 4GJ3A 3VN9A 4YUQA 4WHZA 2CNUA 3VS2A 2W1IA 4BI1A 1BYGA 3OF0A 3QTZA 4GFGA 5E1SA 3UOKA 5M51A 2C1AA 2EXCX 3C5UA 3VS3A 5FGKA 4DFXE 1NT2A 5ETFA 4E93A 1OL7A 3AC2A 2QODA 2PVMA 4LV8A 5CY3A 3ZUTA 1VZOA 2J0JA 2JDSA 3DK7A 2QG5A 3BHUA 3GBZA 3OZ6A 4P2KA 4FV8A 5D9HA 1R39A 4CGAA 4PMTA 1W82A 4AGDA 4J98A 3LJ2A 4HYSA 2RIOA 4AT3A 2X7GA 4DH1A 3ETAA 4QO9A 2HW6A 2XNMA 2H96A 2R3LA 3HUBA 4F9CA 5IH6A 1OBGA 4J53A 4QQ5A 2ZV9A 4JRNA 1Y6BA 4B4LA 4F9BA 3VRZA 3BYOA 4LRKA 3NUPA 5A46A 3G0EA 4JL9A 4CT1A 5LVLA 3KXMA 4J7BA 4CV8A 3ZFMA 2JIVA 3D7TA 3I4BA 4FIGA 4IVCA 4MKCA 3UMXA 4ACHA 4DEAA 4F1TA 4IAKA 5TO8A 1J1BA 1Q5KA 3A4OX 3PY1A 5CTPA 1OL6A 2EB2A 4O2PA 2C4GA 3AD5A 4XP2A 2ITOA 5DG5A 5DEYA 4CFWA 3PJ8A 4Y95A 4OBOA 3VC4A 4FKPA 1OL1A 4N70A 3FJQE 4G6NA 4D28A 4C36A 1FVRA 2B7AA 3ORNA 4RVTA 4DCEA 5LWMA 4QYHA 1M7NA 2BTRA 2E9UA 3OMVA 3RGFA 4J99A 3S00A 3DTCA 4KBCA 1YRPA 5DN3A 3FLWA 3RPOA 4FV2A 4AZWA 1OUKA 2VD5A 3WF9A 4LL0A 3COMA 3L9LA 4JX7A 3QAME 4IWOA 1YXSA 4RG0A 1TVOA 5KUPA 2R9SA 2JITA 2ZM3A 2NO3A 3D83A 3DAKA 2BILB 3DBCA 4C4EA 5AV4A 5JT2A 3DV3A 2VTOA 3KRRA 1YHSA 4CNHA 4QYEA 3GCVA 2Y4PA 5J5TA 3F5PA 3B2WA 3PIXA 3ZLWA 1W7HA 3D0EA 3QRTA 4E5AX 4O0SA 4NWMA 4FTKA 1Z57A 3DJ7A 1W0XC 2FUMA 4AN3A 5A4TA 1H0WA 1UA2A 3QD0A 4BCJA 3NZ0A 3BQRA 1OM1A 4IE9A 3FI8A 1YOMA 4FT3A 1BL6A 3AG9A 3H9FA 5FXQA 3ZSIA 2WIHA 5CVGA 1SNXA 1GOLA 3UG1A 5AADA 3OXTA 4QPSA 3RZBA 2UZDA 4FI1A 3FL5A 5ETAA 4KNBA 4F7NA 5JFSA 3H0ZA 5L8JA 4BDFA 1PXLA 3Q6WA 3QTWA 3LAUA 2YLEA 4FR4A 4I6HA 2RG5A 3TIZA 5M07A 5CAVA 2YCQA 2OK1A 4TWNA 4NIFB 3SVVA 3MVHA 5M09A 5EM5A 4X0MA 3F2NA 4QP9A 4HVSA 4KUJA 3L8SA 4QOXA 5D7AA 4X7QA 5C4KA 3H9RA 3Q5ZA 2YIYA 5IMXA 3IQ7A 3A4PA 2XNOA 4AZVA 4EZ7A 2BIYA 2C5XA 4P7EA 2YAKA 4FL2A 5LWNA 1STCE 3Q9WA 2PE0A 4RSSA 3FWQA 4FZDB 4YC3A 2O63A 3EB0A 3GCSA 4OTRA 3A7GA 5K0KA 3V01A 3W2PA 3TCPA 1ZY4A 3KMMA 5H9BA 4ZY6A 4OW8A 4TYIA 3OS3A 4AN2A 4TYJA 3FE3A 2OF4A 4IZ5A 1Y8YA 5GZ8A 4ARKA 3BHVA 3FV8A 3Q9YA 4PDOA 4RA5A 4O21A 3EL8A 3F66A 5AUZA 5AV0A 3TKUA 2G01A 3L8XA 4A9YA 2O64A 5E8UA 5AV1A 3Q32A 4DT9A 5HU9A 3MTFA 1Q8ZA 4EHZA 1LUFA 3K3JA 5IQHA 3ZO4A 4PL4A 3C9WA 2P0CA 4O7ZA 3MVLA 2R0IA 5CASA 1U4DA 2I40A 5AM7A 2JD5A 2J0MB 2ZDUA 3CE3A 4A9SA 4EL9A 3R1YA 2LAVA 1OL5A 2QVSE 2YWPA 4I6QA 4XH6A 3MH2A 5BYLA 3JVSA 3PXQA 4A9UA 5CF4A 5JGDA 4MXAA 5EH0A 2VTIA 5K4JA 4ACMA 2X2LA 4TT7A 3VUKA 2VTLA 3UC3A 3C4ZA 4FTTA 4AT5A 4EK4A 2ZM1A 3CY2A 3KL8A 1ZOEA 5CSPA 2ETMA 3UQGA 5HG8A 4TPTA 4JQEA 3VW6A 3COHA 4JQ8A 3R22A 5AP5A 4IC7A 2XF0A 3BGPA 2QLUA 2QOCA 2WMVA 2XNPA 1KV1A 3BKBA 2QD9A 2QHMA 4FBXA 4LI5A 2Y6OA 3DLZA 4S30A 3S3IA 2QOLA 3V3VA 4A4OA 3W33A 4XCUA 4DTAA 4CZTA 4MAOA 4DG3E 3COIA 5BMSA 1SZMA 2W5HA 3M1SA 5ANKA 3VBWA 3ZLXA 5AR2A 3D7ZA 4C3PA 4F70A 5FDPA 3TDWA 2WMAA 4CXAA 4PWNA 3TZ9A 5HBHA 4QYYA 2VO7A 4O7LA 1VEBA 4K6ZA 1XKKA 5DBXA 4KKHA 3LLTA 3MFTA 4DFYA 2B9IA 3UO4A 4M13A 5EG3A 5CEQA 3SXRA 2Y6MA 4DTKA 4EQMA 5AUWA 3KXGA 3W18A 5CEMA 3P7CA 5FQDC 2J50A 5LJJA 4MCVA 3O7LD 5AX9A 4FGBA 2X39A 2Y8OA 5HD7A 3UP7A 3KCFA 3VQHA 4AFEA 4ITJA 2JDOA 4AG8A 4EWHA 5K5NA 3VWAA 2PHKA 3I60A 4UV0A 2X8IA 4PX6A 5EOLA 5KMNA 3AC8A 5DR2A 3O51A 5FLFA 1H1RA 2VO6A 3RWPA 3CLYA 4DTBA 3OHTA 5CF6A 2HWOA 5EKOA 1OKZA 2GS7A 2UVXA 2JDVA 1CMKE 3TZ7A 5GHVA 2UW3A 2VTHA 5CEOA 4YC8A 4FKGA 2R3IA 3HV7A 4PPCA 4EK3A 1FOTA 4FT7A 4KKEA 3FC1X 4FEVA 3TT0A 5DNRA 3IDBA 1U5RA 2VUWA 3GC8A 3QYWA 3WYXA 1Q24A 2PMLX 4CEGA 5CAOA 2EUFB 2WTCA 5JGBA 3QQHA 5HE1A 3P79A 4M8TA 1YI4A 1IG1A 2I1MA 1FGIA 4R1YA 3FHRA 4CMOA 3R71A 5GJFA 3HYHA 3RI1A 5K0XA 3NCGA 1E9HA 3H10A 4RLKA 3HLLA 3O8UA 5HCYA 3EN7A 1DI9A 5E8WA 4KSQA 5F95A 5HG9A 4HW7A 4IB5A 4HOKA 1PXKA 2VTMA 4GUBA 4JAIA 5EI6A 4A06A 5DMZA 2IWIA 3AOXA 2O2UA 3AMYA 3NUSA 3W1FA 3TDVA 4U44A 4WRGA 2HOGA 4S2ZA 4R8QA 3K5VA 4O38A 3QC4A 3OT3A 4OTDA 4X2NA 3F3ZA 3NNXA 5KHWA 5I5ZA 5A4CA 1HCLA 2NRYA 2GHLA 5CVHA 4FIIA 4O91A 4ZIMA 4CT2A 4C2VA 2JBPA 5JRQA 2VWZA 2P2IA 5DPVA 3QKKA 4I5HA 3Q3BA 4GEOA 3OBJA 4D1XA 3D5VA 2HZ0A 1NXKA 4QTCA 5TOZA 3OTVA 4FSRA 4DFLA 5JFXA 2QR8A 4EK8A 3KREA 4DH3A 3ROCA 2CNVA 5LMAA 4DFNA 4P5ZA 4ANNA 5AV2A 3ALNA 3DXQA 2IN6A 4IMYA 1UU3A 3M42A 3OW3A 1IA8A 1RJBA 4K8AA 3GFWA 4RT7A 3UVQA 5K9IA 2OZAA 3DCVA 4FZFB 5AV3A 4K1BA 3WZDA 5IQEA 2ZMCA 3HAVA 3CGFA 5HORA 3MSSA 4MX9A 4BDDA 4JLCA 4B0GA 3I0OA 3EH9A 5IA4A 2I0HA 5H8BA 3BLQA 4YP8A 3NR9A 3ULIA 3UIXA 2HW7A 3C0HA 4ZK5A 1ND4A 5HCXA 2W9ZB 4BDIA 4FGRA 3I6UA 3R01A 4MWIA 3W2SA 4NK9A 4WNOA 4EORA 3OWLA 1DS5A 3A7HA 3EYGA 2BAJA 4U80A 4ZY5A 3WI6A 5HE0A 5HIEA 3IPHA 3KRLA 5HCZA 5L6PA 3EQRA 3FZTA 2OI4X 3TKIA 3QQFA 5C8MA 1W8CA 3MJ1A 3GQIA 4AA5A 4EUUA 4FTRA 1YQJA 2QHNA 3E3BX 5L4QA 1WZYA 2OXXA 3ZEPA 4ERWA 2DYLA 3ZXTA 3E88A 3TUBA 3EFWA 3QRUA 5L2IA 4QP8A 4CQGA 4RGJA 3SD0A 2YLFA 2VWXA 5JZJA 5LMKC 2WXVA 4OTHA 2W96B 4NW6A 2JBOA 3C7QA 3LXKA 3Q5IA 4BDJA 1Y91A 4BTJA 3L8PA 5E8ZA 5H8GA 5IEXA 5DHJA 5DRDA 3GT8A 3I0QA 4NCTC 3JY9A 2X9EA 5EYKA 4F1MA 5JN2A 3CSVA 3LXPA 2O5KA 2Q0BA 5DLSA 4IX3A 3W10A 2WO6A 3O71A 5IDNA 3S0OA 3RNYA 4DFBA 4FIFA 4R3CA 5D1JA 3QX2A 3AC5A 4KKGA 3UC4A 2CJMA 2R3JA 3DPKA 2C3JA 1W98A 5AAGA 4FIJA 3W2CA 5HQ0A 1ZLTA 4OGRA 4QP3A 5AAFA 3U51A 4A4LA 4BCIA 3HV4A 3NIZA 1LEWA 4FZ7A 5HG5A 4ZXTA 1XHAA 3QZIA 2QOQA 2Y0AA 3L8VA 4BCQA 3QF9A 5CQWA 4HVIA 2X8DA 3BU5A 3K3IA 2GNGA 4GYIA 5DEWA 5KZ0A 3KKVA 5CAQA 3OEZA 3GU5A 4DBNA 4W9WA 4CCBA 2XJ2A 4RFZA 4R78A 3QXPA 3UQFA 4PL5A 1J7UA 2B0QA 1H1SA 2OIQA 3CTQA 3LM0A 4ZTRA 3PA3A 3Q6UA 4X3JA 2J4ZA 4FK3A 5CYIA 5B0XA 4D58A 5CVFA 4AW2A 1ZOHA 4ZLZA 4CMUA 2YHVA 2BZHB 4PY1A 3E8EA 2YISA 1PW2A 4FNWA 4JG6A 2C68A 3AT4A 4CTBA 4LV5A 2X8EA 1ATPE 2XEYA 3EN9A 3LFCA 4GMYA 5TT7A 3ZO1A 2YN8A 2UZOA 1YDTE 4L6QA 5KKRC 4JIKA 3RHKA 4AX8A 1JBPE 3KRJA 4XS2A 4O7NA 4F63A 3E92A 3DFCB 4EWQA 5LVOA 4LMNA 3FKNA 3KEXA 4FC0A 5CXZA 5E8VA 3QUDA 3FUPA 4FTCA 4ZSEA 4X2GA 1ERKA 3V8SA 4RLLA 4V0GB 2XM8A 4NZWB 4GW8A 3GOPA 2QCSA 2WMQA 3LFQA 4IBMA 4X2FA 5I0BA 5EI2A 2E2BA 3C4FA 3LXLA 5ICPA 4YBJA 3RVGA 4O0WA 4ZSAA 2ZM4A 3PRIA 4P90A 4EOMA 3ZFYA 2XIYA 2YJSA 2G2IA 2BAQA 3A8XA 5ACKA 2ZV7A 3F7WA 4I1ZA 4O2ZA 1JQHA 4J96A 3IW5A 2PMNX 1Q8YA 5IQDA 1U54A 4S31A 4YJNA 1H24A 3SG8A 4Z9LA 3TV6A 3HV3A 1LP4A 4IB1A 4E1ZA 3W8QA 5K5XA 2QC6A 4BCFA 1OIRA 3ET7A 4JG8A 2ONLA 3OXIA 2A1AB 1FINA 3T3UA 2OWBA 3LZBA 3DQXA 3PZHA 3WYYA 3DBEA 3FC2A 5CAPA 2IPXA 3QTSA 2R5TA 3H9OA 4HCUA 3JS2A 1PXPA 4ZTMA 3E62A 4BDCA 3CGOA 3LJ0A 4FSTA 3OUKA 5TE0A 5LCJA 4UXQA 2IZUA 4CZYB 4D5HA 3OEFX 4MD7E 4EH8A 5AP7A 4WUNA 4DBXA 4JDIA 2CGUA 3IW7A 4IAAA 4CMTA 3KK9A 4F09A 4R3PA 5IUHA 3WZEA 3AC3A 3JVRA 3R00A 4N6ZA 4EOSA 2EU9A 3GEQA 3QCQA 3FXZA 2XNEA 3K54A 5HLPA 3PUPA 3UIMA 3I5NA 4GVJA 4RMZA 4F7LA 4U0IA 3ZBFA 2BDFA 3WF5A 4QT1A 4EBWA 4M15A 4I0RA 3RPVA 5FXRA 4A07A 2WMWA 1UKIA 4QMTA 1DAYA 4AGUA 3DDPA 3MWUA 3ANQA 2WU7A 3MY5A 3UZRA 4ITIA 2UUEA 5A6NA 3CJGA 4PPAA 1XH9A 1URCA 1Z9XA 1YWVA 2XJ0A 2JIIA 5IU2A 4YPDA 1BI8A 5E8XA 2PUUA 4PUZA 3IGGA 3O0GA 1KE5A 4E4MA 3U54A 5E8SA 4F7SA 5CANA 3C0IA 4Y5HA 5KBRA 2PVRA 4PP7A 3FL4A 4BIBA 5CF5A 2P4IA 2VTAA 4ZTHA 2X0GA 2GFSA 2VGPA 4IX6A 4CKRA 2BZJA 3VBTA 2PE2A 4C33A 5L6OA 1OIYA 4FSMA 2XJ1A 3Q9XA 4I20A 4G34A 4O0RA 5T3QA 4CTCA 3DAEA 5CSVA 5LCKA 4JR7A 4D9UA 4DEEA 5JKGA 3QD2B 4EZ3A 2ZMDA 4D4SA 4TYGA 4KB8A 2X2MA 4FV9A 3LPBA 2G9XA 3DKFA 3EMGA 4IB3A 2HYYA 4NKAA 4Q9SA 5HNBA 3S95A 3PSDA 3ZS5A 4C3FA 2C6DA 3QX4A 4AW1A 4FKQA 5I4NA 3FZSA 2EVAA 3OY1A 4MBIA 4YZMA 3RPYA 3ROYA 4YZDA 1V0OA 3LQ3A 4R1VA 4HVGA 4LRMA 3TJCA 2XK3A 1KWPA 4FKTA 3VUTA 1F0QA 1YVJA 3O17A 4G3DA 2OJ9A 2QOKA 3AGLA 5CT7A 5DFPA 5F20A 2WQBA 1OGUA 4W4XA 3TTIA 4H3BA 4EH4A 2PZIA 4XOYA 2Z7RA 1UWJA 3FI4A 5B2LA 2QO9A 4FNYA 3AMBA 4YPSA 4E7WA 4AE9A 1YDSE 3NVKI 4FYOA 4UEUA 3FZOA 4V01A 5IA5A 3R7GA 1KE9A 4U3YA 2BKZA 3TJDA 5C1QB 5LMBA 1YI6A 2V0DA 3V6SA 3VBXA 5HO7A 5CX9A 2XCKA 3Q53A 2PMIA 1CKJA 3AC1A 3GC7A 3G6GA 4MXCA 5L2SA 4R7BA 2C47A 4J8MA 3CXWA 2XBAA 3HMPA 5G1XA 4WBBB 3Q4UA 2CKEA 3RMFA 4XG3A 4Y46A 5IKWA 3LCOA 1R1WA 3OWPA 4QYGA 4V05A 3BCEA 3LJ1A 2P3GX 3CPCA 3FMHA 5DRBA 3SXFA 3PIYA 4YZ9A 5ANDA 2ZAZA 4ITHA 4ZJVA 5IPJA 3PPKA 3VS5A 4ZTLA 3N4UA 5DH3A 4UMQA 1OMWA 2E9PA 2WNTA 3AD4A 2CDZA 5EI8A 4U45A 3PSCA 3LLAA 4ANBA 4MQ1A 4NW5A 5CEPA 5CQUA 2V7OA 3BE2A 2C6IA 2WTDA 3F5GA 2XA4A 4XV9A 1IAJA 2P2HA 3PVGA 4GV1A 4NM7A 5HOAA 4USEA 4O7RA 3DK3A 4ZSGA 2R3RA 2B4SB 4XYFA 4XBUA 4D0XA 2W17A 2WQMA 1IA9A 3VS1A 4RJ7A 2X7OA 3O8PA 5A9UA 2KTYA 2BMCA 3ELJA 3DJ5A 2X1NA 4QMLA 4EOKA 3FPQA 3NS9A 5AJQA 3KULB 4QP1A 5G6VA 1XR1A 4YC6A 3OP5A 5HX8A 5HBJA 4RQVA 4TTHB 4IAZA 5FBOA 5M44A 4ZJJA 4DGMA 2C6OA 5CALA 5JMSA 2UZBA 1PXIA 1GZNA 3BYMA 1PHKA 5E8YA 1JWHA 3GNIB 2XCHA 4XLIA 4M14A 4PRJA 4I94A 4A7CA 3EQHA 3W2RA 3VRYA 2J7TA 5EYMA 2WB8A 2B54A 2ZV8A 4YTFA 5I3RA 2PZRA 3KXXA 3W2QA 4EYJA 2CGWA 2ITYA 5L8KA 4L42A 5EFQA 5JQ8A 1WVYA 2FA2A 2J5FA 2OO8X 3THBA 4MNFA 3R04A 2DQ7X 4H39A 5HTIA 2BKKA 4LL5A 3VO3A 1H27A 4NIFA 5HIBA 3LFBA 3NVMB 3U55A 5GIPE 2ZV2A 3R7EA 1B38A 2JKKA 4K77A 5H8EA 4C4IA 1XH8A 4IQ6A 3CQWA 4RBLA 4RJ5A 4G16A 3D15A 4YNEA 3WILA 1MRUA 3RJCA 3SRVB 4FUYA 1LPUA 3LHJA 3NDMA 4QMYA 5BVFA 4BB4A 4AP7A 2JAMA 4RZWA 5ETIA 3FLYA 4BN1A 3ODZX 5IUIA 3A7JA 1WCCA 3LMHA 4TN6A 3OWJA 4N0SA 3MTLA 5KMJA 5CXHA 2VX3A 5E7RA 4BC6A 5FEEA 5C27A 3CCNA 5F9EA 3AGMA 4P4CA 3VULA
chains in the Genus database with same CATH superfamily
4XJ0A 1HCKA 4YMJA 4MD9E 4ZY4A 3EWHA 4WBOA 3CD3A 1DI8A 4RWIA 4QRCA 4D1SA 2F57A 3I7CA 2ERZE 2IVSA 3A2CA 3O7LB 1J1CA 2YABA 3MH0A 4LGHA 4TYHA 4X2KA 1PXMA 3PA5A 2PMOX 5GNKA 4ANMA 4CFNA 4CYIA 5HZNA 4O7WA 4L8MA 4V04A 4FSZA 4L67A 5J87A 1Y57A 2PUIA 4ENXA 3QRJA 4MF1A 4HVDA 5JGAA 1QPCA 1TQIA 3BL9A 4EH7A 2UZVA 2C5VA 3ZMMA 3O50A 2F49A 2VNWA 4YJSA 5KMKA 4KA3A 4AUAA 4EHEA 3DNEA 2PZYA 4IW0A 3U4UA 4DH5A 3MBLA 3UPZA 3K2LA 2F9GA 1PYXA 1P4FA 3FMEA 3UTOA 3R7YA 3DGKA 3EIDA 5JZNA 4O6LA 3FMJA 1L3RE 3UJGA 4CLIA 4AXCA 4GKHA 3Q9ZA 3BELA 1G8KA 3ZRMA 4IM0A 3KN5A 3DB8A 4GVAA 3DAJA 3QQGA 4AZEA 4FTQA 4YHTA 3D94A 3Q96A 4C57A 4JDKA 4USDA 4LGDA 3ZZWA 3F5UA 4YJUA 1OKWA 3UOJA 2GCDA 4M0ZA 4RX7A 4U7ZA 3FMKA 4Q5HA 5KE0A 3LFFA 4DAWA 4DEGA 3LXNA 4DHFA 2BFXA 4MH7A 4FNZA 3ORLA 4CV9A 1MRYA 2JGZA 3KVWA 2BHHA 2WTWA 3VUHA 3WE4A 3OTUA 5JFVA 4RFYA 4DE4A 4BCOA 5FP6A 3RZFA 2RFEA 2BRBA 1QPJA 3DBQA 3TM0A 2HZ4A 2YEXA 4PDYA 4RX9A 4YTHA 3PY3A 4PL3A 4FEUA 3K5UA 3QQUA 3NAYA 4HGSA 4DFZE 3WBLA 2E9OA 3QA8A 3TNQB 1ZYDA 3KK8A 1KE7A 3IDCA 3G90X 3II5A 3FLNC 5CNOA 5GJDA 4BGGA 2XK9A 2QR7A 3OT8A 2YM8A 2PULA 2CKQA 2QKWB 3UODA 4DH7A 3A8WA 5CENA 3SHEA 4O84A 4FKSA 4IVAA 2R0UA 3R8MA 4FX3A 1JSVA 5C9CA 3HUCA 3IONA 3QALE 3TV4A 3DQWA 1ST0A 5BV3A 3PDTA 4KIPA 3EKNA 4AZFA 1CDKA 3OFMA 4HYUA 3VJNA 3G33A 3HMNA 4X3FC 5CSWA 1UU8A 2J0KA 3UOLA 4PTGA 3DZOA 4M67A 2O3PA 3NPCA 5IMEA 2XNNA 4IJPA 3HMMA 1K3AA 2Z7QA 1V1KA 2GTMA 3LCSA 4ZMEA 2XK4A 2W1GA 4J8NA 5B2MA 4G9RA 3ZTXA 2C5YA 3L9MA 4II5A 3UE4A 5BYZA 5KMLA 2YITA 4JXFA 3A7IA 2WAJA 3C4EA 3F5XA 3PRFA 1SVGA 2R7IA 4JNWA 5L3AA 2CKOA 3V5LA 3FYKX 1WBPA 1CKIA 4XRLA 3RK7A 2LGCA 4U81A 4CSVA 4L3LA 4UX9A 3F9NA 3S4QA 3QTXA 2XALA 3EQPA 4JT3A 3VS6A 4S34A 3WF8A 4FSNA 2VNYA 5LARA 4C3RA 4ANOA 2H8HA 3HP2A 4F99A 4OAUC 3FY0A 3NGAA 2C1BA 3LIJA 3NNUA 4BCKA 2GQRA 4TYHB 4WNMA 4TXCA 4EQCA 5LMKA 4I3ZA 3ORTA 1P5EA 3HZTA 2EWAA 2XYUA 4JIAA 4IZ7A 4XG8A 5F4NA 1YOLA 4NCTA 1YI3A 2YFXA 5IQCA 3H4JA 4FKVA 3QCSA 4ASDA 3W0QA 2JFLA 3JPVA 2R3QA 5AUYA 4I5PA 2PZPA 4S32A 4C0TA 1OI9A 2F7EE 3LFNA 1GJOA 5C8KA 1VYZA 1R3CA 3QD4A 4ERKA 4YR8A 3KC3A 1JAMA 5KNJA 2Q0NA 3W0SA 1PRYA 4MHAA 2C69A 5B7VA 3R63A 3W0NA 4H1MA 3MN3A 5EW3A 4TW9A 3QXOA 4EKLA 3NSZA 4QTBA 3OOMA 4O4CA 5AR5A 4DLIA 3DT1A 4FTAA 4BDEA 2Z02A 4I21A 3T8OA 1GIIA 4UYNA 4N4SA 3ZOSA 2IVVA 1V0PA 2UVZA 3EFJA 4NM3A 3CR0A 4B9DA 3IG7A 5D12A 4AXAA 3QQLA 1Q4LA 3BYSA 1KV2A 3UBDA 3RPRA 3V8WA 4AXEA 4WIHA 1PXNA 3EN5A 3R7UA 1YHWA 4U9AA 3TG1A 4FZAB 4FSWA 4C4JA 4J97A 5E91A 1H8FA 4FT9A 1VJYA 4HCVA 2AYPA 3OD6X 5FRIA 5HBEA 3ZM4A 2BDJA 3UG2A 4ZZNA 4BZDA 2FYSA 2OFUA 1ZYSA 2OKRA 4YZNA 3VBYA 2QO7A 2UV2A 4FV1A 4O86A 3QTUA 4AXFA 3HRFA 1GY3A 2OICA 4CFVA 4APCA 4I0TA 1OPKA 4G2FA 3ZEWA 5CU0A 4K11A 4DG0E 4GT5A 3U6JA 1M17A 2R3PA 2W1ZA 3ACKA 4CZUA 1JPAA 2OW3A 5A54A 1GZOA 5FG8A 2X4FA 2CKPA 3POOA 1IASA 4XG6A 5HO6A 4KS7A 4ACDA 3WIGA 3CC6A 3R1QA 3DTWA 2OJJA 4ACGA 1YWNA 1XO2B 3E8CA 4RIYB 4WSYA 4DINA 2ZJWA 4L9IA 4O96A 4F0FA 1YXVA 1H1WA 4RIWA 1ZYCA 4XOZA 4FV4A 3QTQA 5CEKA 4BBEA 2HWPA 4RJ3A 4E4NA 1AQ1A 4LUDA 1W84A 4NKSA 3R8LA 3PP1A 3U4WA 4FIEA 4BKYA 4YJPA 2W1FA 2XK7A 4XMOA 2CN8A 3BI6A 3Q4CA 3FQEA 3E8NA 3KN6A 4IEBA 4RVLA 3QC9A 4TRLA 5GJGA 3E87A 4BHZA 2XK8A 5AR8A 4EI4A 1KOAA 4EQUA 2IVUA 2GFCA 2ITPA 3DY7A 4NUSA 5AA8A 4Y85A 2YACA 4FTNA 3ZUVA 4CKJA 3QKLA 4BDAA 5LVPA 1ZMVA 5EW9A 5LVMA 3QKMA 4J95A 1E1XA 2RFSA 3WZUA 2BR1A 4QP6A 3FYJX 1M2QA 4E6QA 4YURA 3G51A 2J90A 5E1EA 1OB3A 3GQLA 3W8LA 1PY5A 2I0YA 5D41A 4W9XA 2UW5A 2BZKB 4Y83A 4KSPA 3SLSA 5ETCA 1YXUA 2WTIA 3BU6A 2BROA 2X2KA 4OTQA 3G15A 3AD6A 2DUVA 2JKMA 1RQQA 5HGIA 2VTNA 4CQEA 2W9FB 5FDXA 4OBQA 1M14A 2XZSA 3G6HA 5IDPA 4KRDA 3MESA 1H26A 4C7TA 2WMXA 1YW2A 2W4KA 4IANA 2E9NA 4GJ2A 3FAAA 3PVBA 3O96A 5AWMA 4ZTNA 4JAJA 4UZHA 3PYYA 3IW8A 2B52A 2XEZA 4GUEA 5BX0A 1AGWA 2YDJA 2IZSA 3DA6A 3IECA 3BGQA 3R1SA 4IAFA 5AUTA 4KINA 2CNQA 1BKXA 1NW1A 5DT0A 3TUCA 4MNEB 4O4DA 4BCMA 4JJRA 4DEIA 1RW8A 5HX6A 3OC1A 3SXSA 4ASEA 3PZEA 5IG1A 4BYIA 5LXMA 2R4BA 3WOWA 4DF3A 1AD5A 4V0GA 4HJOA 2QKRA 4UMUA 1L8TA 2BTSA 2XP2A 5ANOA 1TZDA 2PVJA 4BCHA 5FP5A 4BI2A 3Q60A 4KIQA 4QMMA 3W16A 2PTKA 4ZAUA 1R0PA 3CKWA 3D5XA 4FEWA 1SVHA 4WKQA 4X6RA 4EK5A 5AP2A 3RKBA 5IEYA 1K9AA 1YHVA 3QFVA 3HKOA 4O22A 3C51A 2PK9A 4RX5A 3ML1A 5EQPA 1SYKA 1CM8A 3MB7A 3VQUA 1H01A 3EN4A 3SQQA 3GP0A 4JRVA 1JVPP 2YJRA 1IR3A 3SV0A 3ZC5A 4E3CA 4CVAA 2FSTX 4YZBA 4YTIA 2YM7A 5ANIA 4FTJA 4M3QA 1KOBA 4AW5A 2FH9A 4LM5A 3HEGA 5DT4A 4DA5A 3C5IA 5EQYA 5KKRB 3W0OA 3CD8A 3OBGA 4QTAA 2V22A 2VU3A 4JX3A 3HMIA 2R3NA 1XMMA 4XX9A 4XP3A 1H4LA 4X2JA 2XH5A 3UDZA 2GDOA 4TKSA 3NCZA 3HRCA 3R02A 3JY0A 3LFSA 5E8TA 5JEBA 2B1PA 2W4JA 2OJGA 4LOOA 2JFMA 3ORMA 1FGKA 2C3KA 4RIWB 4M66A 4WUAA 2CGVA 4IACA 3LCDA 3HV5A 2WKMA 5M53A 3AT2A 4DITA 4O0VA 3NW6A 1JLUE 4NJ3A 2IZRA 5L2WA 4DT8A 3HV6A 4Q9ZA 4O0YA 2IW8A 1XMLA 1OUYA 3LFDA 4EH6A 4FF8A 4UY9A 5A6OA 5M56A 5EHLA 5AAEA 5J9LA 4LRJA 3R9RA 5HKMA 5ANJA 4IM2A 1R78A 4WA9A 5E90A 3LMIA 4RJ4A 4QQCA 2C5NA 4H58A 4XLVA 4JMQA 3SOAA 3FKOA 4G31A 4RFMA 3T9IA 2A2AA 4AGCA 4C4FA 2XBJA 3BYUA 1ST4A 4LOQA 3QQJA 5D7VA 1WVXA 3F3WA 2BHEA 2IG7A 3V6RA 1UNLA 2VRXA 4YU2A 2OBJA 5HNGA 1Q8WA 2W99B 2BRMA 5CI7A 4U5JA 5K3YA 3ORPA 4H3QA 5CLPA 3O2MA 3QQKA 3P9JA 3G0FA 3BEGA 4BYJA 3BWJA 2QNJA 2P33A 4HZSA 3Q04A 5A14A 2RGPA 2UZNA 3QA0A 3R8ZA 2RF9A 3TI1A 3UP2A 4GFOA 3VS4A 3U9CA 2YM5A 4WG4A 1YXXA 4ANLA 2CHLA 3FY2A 5HLWA 1H28A 1Q97A 3KY2A 4GK4A 5CZHA 3FEGA 4D1ZA 5IQGA 2Z7SA 1H07A 4AN9A 5M4IA 4YZCA 1S9JA 2OIBA 2PUPA 4C4GA 3R73A 3PWYA 4CKIA 4FV7A 3PJ3A 3ZSHA 1KSWA 2HZIA 3MA3A 4B99A 3RCJA 3ZXZA 2ERKA 1CSNA 2NRUA 3UNKA 1QMZA 5T6KA 4R77A 1PJKA 4IC8A 4WSQA 3BRBA 3CS9A 3MA6A 4TYEA 4ANQA 4FEXA 5EDRA 2WFYA 2OH4A 4GK3A 2E9VA 2JAVA 1H08A 5TF9A 4HYHA 4MQ2A 4ZS4A 4Y5QA 4BWKA 4ONAA 1FVTA 1G8JA 5AFVA 3G9LX 1Q3DA 3NRMA 4FUXA 5J8IA 3BLHA 5FTOA 5CSXA 3VF9A 1MUOA 4DHIB 4BICA 2VO3A 2WQOA 2X81A 4R5YA 2R3MA 2ITNA 2VAGA 4FV5A 2ZB1A 1P2AA 5AR4A 4F78A 1SNUA 3BPRA 4M12A 3P7AA 2ZDTA 3PLAE 4F1OA 3REPA 1SMHA 4I4FA 3PXRA 4U43A 2I6LA 3JUHA 3Q52A 3NNWA 3SA0A 2CPKE 3DS6A 5CT0A 4AQCA 4HNFA 4L43A 2PYWA 4FTLA 3OWKA 3N51A 2W05A 4DHZA 5LQFA 3N9XA 3R9DA 3OCTA 1APME 4O0XA 4F64A 5E9EA 4W8EA 3FMDA 3PJ1A 3EFKA 1U59A 4L7FA 4BCGA 3EQIA 3MV5A 1PMVA 4O27B 4AAYA 4NM5A 2XIXA 1JKTA 3RAIA 3KU2A 4KBAA 1PKDA 2QONA 3ODYX 3PXFA 4FKLA 4UXLA 1EH4A 4AACA 4BTKA 4TL0A 3PSBA 4AT4A 4QTEA 4U6RA 4MD8E 3QTRA 3SOCA 4AF3A 4BIDA 4O1PA 4O83A 1OPJA 1F5QA 5FEDA 4YLJA 2F7XE 5A4LA 3TMOA 1TQMA 1M7QA 2ITXA 1ZARA 1FQ1B 3R2BA 4B8MA 4KWPA 4BRXA 2UZEA 4G3CA 4EH5A 2C6MA 3PVWA 4I5CA 4GS6A 3FPMA 1XH4A 4FSYA 3AKLA 3DXPA 4J71A 1OPLA 2VV9A 2YDIA 3WZJA 3PFQA 4C2WA 3VF8A 3DBFA 5IEVA 5KMIA 2H6DA 4FL1A 4IDTA 3DK6A 4WD5A 2W1EA 2OJIA 4AOTA 4OTPA 2UZUE 2XYNA 4Y8DA 4H1JA 4BR3A 3JXWA 4MXZA 3QL8A 2EB3A 3A99A 3KULA 4XHKB 3EZRA 5M08A 2UZWE 4AAAA 2ACXA 2B53A 1SM2A 5I9YA 3EQCA 4KIKB 3ZZEA 3GU4A 2O0UA 3KB7A 3A62A 3FQHA 1UVRA 4QP2A 5H2UA 5HE2A 3WARA 3HDMA 2VTRA 3GOKA 2VO0A 3LCKA 4ENYA 4F4PA 5J9ZA 2QU5A 2HCKA 5AP1A 4O7SA 1H1QA 2HY0A 1ZYLA 2WU6A 4KRCA 2YZLA 3HGKA 4EOQA 4Z55A 5J5SA 5I9ZA 5JFWA 3P23A 2CLQA 3C13A 3NAXA 1BLXA 5AA9A 4PDPA 4RC2A 5AX3A 1F3MC 5AR7A 3E8DA 4PQNA 4ZS0A 3KXZA 3R0TA 2VTJA 1Y8GA 3C4WA 4WRSA 4NJDA 3HVCA 3TXOA 3H30A 4MUQA 4EH3A 5J1WA 4AA4A 3MY0A 3FLQA 4AOIA 3Q4ZA 4QPAA 3QCYA 3TNPC 3HAMA 3DFAA 3BHHA 5KZIA 3GCPA 1JSUA 4QPMA 2AQXA 3IKAA 4ZTSA 1M2RA 3KXHA 3NYNA 3T9TA 4DGOA 4FIHA 1R0EA 5CNNA 3SRVA 2WTKB 3VW8A 5BUIA 2PZ5A 4QEBA 3FI2A 1GNGA 5BYYA 3COKA 2VN9A 3B8RA 3OXZA 4BTMA 4ASZA 3H3CA 4QNAA 4ANSA 4QYFA 3R9OA 3NUAA 2JKOA 3OUNB 2OG8A 2J51A 2PVLA 4O82A 2ITZA 1VR2A 4NSTA 4OTGA 3WZKA 2B9HA 3LOKA 4C02A 5HVKA 2YWVA 4ZMFA 4L53A 4ZEGA 4U79A 2Y7JA 2RL5A 4D2WA 2AC5A 4JG7A 4AU8A 2HXQA 4EH9A 2C6EA 2QO2A 3RHXA 3U9NA 2FSLX 1KUTA 3ATSA 1BMKA 4O81A 3S1HA 5BVKA 3FDNA 2QOBA 4U40A 4H3PA 3ATTA 4X3FA 3MH3A 3V5JA 4EH2A 4FT5A 3DJ6A 2H9VA 5AR3A 4DLJA 2PWLA 2A0CX 2XIKA 2I7QA 4NYEA 2V62A 4HYIA 1YWRA 3IGOA 5ITAA 2HIWA 3TZ8A 5CU2A 4DEDA 4ZP5A 4GU9A 4QMOA 3ORKA 4XG4A 3NMUF 5KMOA 1OBDA 3GC0A 4M68A 4FV6A 4IJ9A 4N6YA 5J1VA 5IISA 3U6HA 2BAKA 1W2CA 3EN6A 3KF4A 3CBLA 5M55A 3SDJA 1WMKA 3UO6A 3LCTA 4CFMA 2NP8A 4UYAA 2IJMA 3TWJA 4LUEA 4D9TA 2WGJA 1Y6AA 3PVUA 4P5QA 3FSFA 4DHJA 4XG2A 4C59A 2WD1A 4TNBA 4EK6A 4IX5A 5EHYA 5CF8A 1W83A 2UVYA 3KF7A 3EOCA 3ENMA 4PV0A 4QMNA 4OT6A 2CMWA 4GG5A 4CG9A 4GT3A 4M0YA 5BVNA 4ID7A 4BY9E 3MPTA 3MW1A 3P7BA 4QMPA 3VS0A 1A48A 2F7ZE 5FTGA 5A4QA 2HAKA 1WBVA 2WTKC 2C6TA 2Z7LA 3EYHA 3KXNA 3IDPA 4MXYA 4BL1A 5EOBA 1O9UA 5L2TA 2FSMX 4YHJA 5CU4A 4G5JA 2BPMA 1DM2A 4G3EA 4ALWA 2WMRA 1WBSA 4C34A 2XS0A 4MTAA 1S9IA 3AMAA 4WG5A 4UZDA 4O6EA 1O6KA 3R6XA 4Z3VA 2OSCA 2QOOA 2ZVAA 4L52A 5D10A 5EK7A 3ITZA 2JC6A 5E92A 3I6WA 3BL7A 1GAGA 2IW6A 3A61A 3F82A 4F08A 4EHVA 3R9HA 3N4TA 3E5AA 4XEYA 4C58A 4UWYA 1W2DA 1MP8A 4DN5A 2VWBA 4BKJA 2PVHA 3BWFA 4HGEA 4IAYA 3M11A 2CCHA 2XNBA 3L9NA 2G15A 3NNVA 3RINA 4YTCA 1IAHA 5EQEA 3W0RA 4O4EA 4FV3A 3CQEA 4XG7A 5CZIA 4D2TA 3P0MA 2OGVA 3PY0A 2VWIA 1P4OA 3ACJA 4DEBA 3MVJA 5IF1A 4L7SA 4JR3A 4O0TA 4ZJIA 5EYCA 5IZFA 2RSVA 4IXPA 3ORZA 3UIBA 1ZOGA 2O65A 2Y4IC 3ORIA 3QZFA 3TNIA 5M57A 4G1WA 2UW7A 3F88A 3EZVA 3KRXA 3NUUA 3TACA 3W55A 4I24A 2C3LA 4EBVA 5KMMA 2UW9A 2XKEA 3A7FA 4CRSA 1H00A 5EKNA 4D2SA 2YCSA 3C1XA 4PF4A 5KO1A 4IH8A 3MH1A 4PNIA 3VVHA 4X3FB 4S33A 3TZMA 1FVVA 1J3HA 3LVPA 4CFUA 3VJOA 3QLFA 5CU3A 3D2KA 2YIXA 2BRHA 3UYSA 4F9AA 1OL2A 3MDYA 4EUTA 3QD3A 3QRKA 3R21A 4G5PA 3FI3A 3TEIA 4ACCA 2WOUA 3P4KA 3D9VA 3ULZA 3FKLA 1QCFA 3KGAA 4EOPA 5B2KA 3UO5A 2PPQA 4BVUA 2XANA 2G2HA 3UYTA 5CS6A 5BUJA 4QMVA 4WNPA 3LQ8A 2H34A 4CRLA 4R7IA 3HP5A 1B39A 3ZBXA 5DR6A 5BNJA 4FKOA 3BU3A 4AXDA 4RQKA 2IVTA 3LFEA 2WHBA 4RJ8A 2F2UA 1UNHA 2WMUA 4LGGA 2C5OA 5J79A 3RK5A 2C6LA 2QOHA 4FVPA 3GU7A 4RC4A 3BEAA 4AOJA 5C26A 3C4CA 4CLJA 3AKJA 4OLIA 5DE2A 4PMSA 5FEQA 3PA4A 3UDTA 1G5SA 3D5WA 5TR6A 5M4CA 2OIDA 3V5WA 4L01A 4ZSLA 1Q99A 3BHTA 2SRCA 4D55A 4FSQA 2Y9QA 4CYJA 2UZTA 4FMQA 3EQFA 4M97A 2W5AA 4D2PA 5AP3A 3LFAA 3WE8A 1X8BA 1MQBA 4GRBA 5AIKA 2OXYA 4IHPA 2GNHA 1TQPA 3RWQA 4OTWA 4F7JA 5FD2A 3ENHA 4AGWA 4F6WA 5HU3A 2ITQA 1JNKA 2UW8A 4K18A 2VWWA 5KCVA 4G17A 4RIYA 3EL7A 3F7ZA 3TN8A 4CD0A 2WOTA 2B9JA 3FZRA 2JDRA 2W1DA 4L3JA 4TWCA 2XAOA 5AIRA 4D4YA 2CCIA 4E20A 1QL6A 5CWZA 4QP7A 2GNLA 3BHYA 4C8BA 2RFNA 4EKKA 3VHEA 2PVFA 5DIAA 4PMPA 1REJA 2PL0A 2R3OA 4M69B 5I9XA 4HGLA 3CY3A 4QMXA 5E4HA 1BUHA 2UW4A 2G1TA 1O6LA 2BUJA 2J9MA 5I9UA 2Z8CA 2FO0A 4FNXA 1QPEA 4TWOA 2HENA 5HO8A 4BF2A 2EXEA 2EXMA 4U41A 3MPMA 3NYVA 3R1NA 3P86A 2IF8A 3PXYA 3F6XA 4RIXA 2GPHA 4TZRA 4FVRA 1P14A 4IADA 1TKIA 5HG7A 5EM6A 3T3VA 1Q3WA 4O7VA 3QUEA 5FXSA 1VYWA 1FPUA 2BALA 3P1AA 2JDTA 5IQIA 3IW6A 5CU6A 2BDWA 2GMXA 3AT3A 3KCKA 4ZLYA 4ZTQA 4FOBA 4QMSA 5TKDA 3BV3A 3LW0A 4FVQA 3C4XA 1RE8A 1Q62A 3DKGA 3QHWA 3TIYA 3ZDIA 1FMOE 4RRVA 1GIHA 5CEIA 3UZPA 1OKVA 2C6KA 3RPSA 3OY3A 1WBOA 4KIOA 4FG8A 1I44A 3D7TB 1YDRE 3H0YA 4BTFA 1Q8TA 3SGCA 1U46A 2CN5A 3MJ2A 4IAIA 2P55A 2GS2A 1Q61A 3CJFA 3F61A 1PMNA 5M4UA 4AZSA 4GSBA 5FUTA 4R6VA 2C0OA 3AKKA 4IZAA 3GUBA 3MS9A 1YOJA 4MEDA 4KAOA 3CQUA 4PTEA 1UWHA 3JYAA 4IWPA 4MNEA 4XRJA 2X0QA 4IFCA 2ITTA 4M84A 2XIZA 3OCGA 3UDBA 5IA1A 1ZXEA 3CIKA 3IOPA 1PKGA 3EQDA 1OGYA 4QQJA 3W32A 4G9CA 4L00A 1YKRA 3HMOA 4LMUA 3DKOA 4UB7A 4FZ6A 5AP6A 2BVAA 5CSHA 3SAYA 4E5BA 4GL9A 1G8SA 1ZZ2A 3U6IA 4YLLA 4EJ7A 3ID6C 4I0SA 1Q8UA 2ETRA 3GC9A 4C35A 2GTNA 4XNEA 4A9RA 1HOWA 3F3VA 3R8VA 3KQ7A 3BYVA 3HL7A 2XMYA 4X6QC 3MB6A 5DI1A 3RTPA 5IA2A 4EONA 3UZTA 1V0BA 1XWSA 4AFJA 3TUDA 5A4EA 1Z5MA 3F2RA 5DYJA 1MQ4A 3ZSGA 3AXWA 3OROA 4RX8A 3RP9A 2CGXA 4E4XA 3AC4A 2J0IA 2R64A 3BBTB 4G6LA 4OT5A 5L6WL 3V5TA 5HD4A 4CFXA 2PUNA 3G2FA 1T45A 3PE1A 3F3UA 4LOPA 3P5KA 3Q2JA 1MRVA 1PXJA 3HX4A 4RIOA 5ANEA 4YSMA 3D14A 3NUXA 4NH1A 4E73A 4JDJA 3UQCA 3FSKA 3PJ2A 3TKHA 5JH6A 1UV5A 3NIEA 3GFEA 5HI2A 1DAWA 3UNZA 4DYMA 1URWA 1PXOA 3BQCA 3EKKA 3MYGA 4NM0A 1M52A 3ZH8A 4BFMA 3E93A 4FKJA 3DNDA 4EYMA 3VIDA 2XIRA 5I9VA 1NVRA 2J5EA 4FYNA 2GNJA 1B6CB 3R7VA 4DH8A 5IQBA 3UNJA 2XRUA 4YHFA 2YCRA 2YDKA 2X7FA 4IWQA 3IS5A 3MGYA 1OECA 4RVMA 5AP4A 5DWRA 4B7TA 1ZY5A 4HCTA 4PNKA 3FLSA 3P78A 3R28A 2OF2A 4IFGA 5AEPA 5C4LA 3F69A 4K2RA 4NEUA 4RIXB 4UWBA 2V7AA 2FB8A 4APPA 4KD1A 3ZRLA 2Q83A 3UVPA 2VTPA 4FA2A 4QMZA 3O8TA 4WG3A 5HEZA 5JK3A 4O7TA 3QLGA 4F9WA 1ZZLA 2J0LA 1ZRZA 4FK6A 4FL3A 4NTSA 2GU8A 2J2IB 3O23A 4B8LA 2PSQA 2NNWB 2FSOX 1KE8A 3DOGA 3SW4A 5DR9A 1ZMUA 5HHWA 1H0VA 3WF6A 4IVBA 4ZLOA 2ESMA 3SW7A 4YO4A 4GCJA 4O0UA 4RWLA 5EW8A 4U8ZA 2GSFA 3LE6A 4DGGA 3QBNA 3E7VA 3FMLA 3IW4A 3WF7A 2WTJA 3NUYA 3ZU7A 3RM6A 4D5KA 3JR1A 2Z60A 1WVWA 4RZVA 1IEPA 3OCSA 5HIDA 2WMTA 1VLRA 2OU7A 2IO6A 3KMUA 4FKUA 4I5MA 3RCDA 3POZA 3ZC6A 4UN0C 3V5PA 4OUCA 4C61A 4Y73A 3TL8A 4MXOA 1NVQA 2X0PA 4M7IA 3UMWA 2R3HA 2VWVA 3R83A 2UW6A 4UMPA 5IQFA 2WIPA 4GIHA 5AUXA 4J52A 3DXNA 3R7IA 5IH5A 5BMMA 2VTTA 4UMRA 3NFFB 1BL7A 4OBPA 1LR4A 5JRSA 1IRKA 4D2RA 3C0GA 4E6CA 2FGIA 5J7BA 5HICA 2QOIA 3VS7A 4D0WA 4MK0A 4JOAA 2GQGA 3PTGA 3QU0A 3G9NA 4A4XA 5AUUA 4HGTA 4BHNA 4DG2E 2JIUA 4ZOGA 5FBNC 4BI0A 2RKUA 3CTJA 4C4HA 5L8LA 2W1CA 3UVRA 5J95A 4B6LA 1PYEA 5BQ0A 5HVYA 2YZAA 3LM5A 4FKIA 4WT6A 1BX6A 5FM3A 3TV7A 1M2PA 3VNTA 3BV2A 4K9YA 4E4LA 1NVSA 3MFSA 3NYOA 1JOWB 4HZRA 2JLDA 5EDPA 5LOHA 2HK5A 3VBQA 3OW4A 4YSJA 4FKRA 2G2FA 4DGLC 3ZONA 4BZNA 3SC1A 4HPTE 3ZCLA 4D4RA 3MPAA 1UKHA 5C8NA 3RM7A 4FODA 2R3GA 4FT0A 4FOCA 4LQMA 3NEWA 4DC2A 3GCQA 4GK2A 1PMEA 3I79A 5HTBA 5I9WA 3EJ1A 4NTTA 3DKCA 5IH4A 1GIJA 3ZLSA 4QNYA 1XH6A 3NWWA 5EHOA 4JBQA 3V5QA 4BGHA 4LG4A 2GQSA 4AWIA 5EYDA 5BVWA 3TTJA 4NFMA 2R2PA 5A3XA 3CEKA 4GKIA 5HNIX 1CTPE 5BUEA 5J9YA 5F1ZA 4UMTA 4O1OA 4KABA 4QTDA 3R9NA 3VAPA 3B2TA 5GIOE 3ALOA 3PWDA 4Z7GA 4MBJA 4Q2AA 3PE2A 2QQ7A 4RA4A 4AW0A 3Q4TA