2QCSA

A complex structure between the catalytic and regulatory subunit of protein kinase a that represents the inhibited state
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
338
structure length
335
Chain Sequence
b'ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title PKA-I holoenzyme structure reveals a mechanism for cAMP-dependent activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qcsA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qcsA02
4HGSA 4D0XA 5HX8A 3QX2A 1YHWA 3NUUA 3BYMA 5KMLA 4K77A 2LAVA 1T45A 3ZBXA 3C4EA 2E9PA 1K3AA 4R77A 2YN8A 3CPCA 3C13A 5FM2A 4WUNA 1NVSA 5IMXA 1XKKA 4CZUA 4NEUA 3HVCA 3O96A 3QC9A 3UO4A 3JVSA 4RX7A 3IW5A 4IZ7A 5IZFA 4RWLA 1MUOA 2JC6A 3V5LA 2I6LA 3TIZA 3GQIA 2YAKA 5KZ0A 4ZSGA 1GIIA 3R2BA 5HQ0A 2YDKA 3CR0A 4D4SA 3BHVA 4LMUA 4LOPA 4WUAA 4N70A 4QYYA 2X7OA 3EQPA 2EUFB 3RMFA 3GP0A 5HBHA 4FT7A 4EK6A 3VULA 4IX5A 3KN6A 1H28A 4XOZA 2OWBA 2BAJA 4F1MA 2YIQA 3QRTA 1KOAA 5HBEA 2EB3A 2QODA 4CVAA 2YACA 2O2UA 4CFUA 2X9FA 1JOWB 2BKZA 4WOVA 3ZH8A 3AMBA 3CEKA 2YDJA 4BI2A 2O63A 3M42A 3HLLA 1PHKA 3W2OA 4AGWA 5K5XA 3BLQA 5LMKA 4O27B 3V5PA 5EK7A 2C5XA 2P2IA 2WMUA 3G0FA 3UG2A 1YWRA 2CKOA 5FD2A 4EUTA 1Q97A 4LYNA 1MRYA 5LVPA 2ERZE 5A54A 1A9UA 3W2QA 4JRNA 4FIEA 2CGXA 2UVXA 2XF0A 5DOSA 3QA8A 4FV7A 5AWMA 3OCGA 3JY9A 3PA3A 3ZONA 4YTCA 2R3NA 3CD8A 4A7CA 5I5ZA 2H34A 4NFNA 2YCFA 4BHZA 2ZM3A 4I1ZA 3QZIA 4NZWB 1VR2A 5HI2A 4DTAA 5M44A 4QT1A 2OO8X 2NPQA 3E88A 3MVMA 4YJOA 4FV2A 4Y46A 3S2PA 1GAGA 3VBTA 1ZYDA 2WTIA 4QD6A 3VQUA 4QTBA 1GY3A 2C5VA 3BQCA 4FSUA 4YGAA 2UW8A 3I5NA 1RJBA 2RGPA 3D5WA 4E6DA 3P1AA 2GDOA 4QP8A 2XB7A 3A8XA 3BHTA 1ZMVA 3QYWA 3CXWA 4EOJA 2J7TA 5L2QA 2WO6A 4PTEA 4QTAA 2I0HA 5JFVA 1K2PA 3ORZA 3Q2JA 4XX9A 4I94A 4HPTE 4XS2A 3TZ9A 3MH2A 3SLSA 3ZUUA 5AEPA 3I6WA 4FF8A 4DT9A 2X8DA 4J7BA 5ITAA 3OROA 3QTZA 3NRMA 4U8ZA 2HXLA 5FM3A 2UW6A 4KIKB 5HNIX 3SW7A 2GS6A 3PA5A 2WEVA 3QX4A 4C3PA 4ZTLA 3QHRA 5KBQA 3QTQA 2O3PA 1G3NA 2O8YA 2BRNA 2OFUA 4PRJA 2ZV2A 2VTNA 3IECA 4CEGA 1WMKA 4JR3A 2J0MB 4ACGA 4PNKA 3G9LX 4W4YA 4PTGA 4QYFA 2HZ4A 3D15A 3F2NA 3H0YA 4RIWA 3RM7A 5D9HA 5LCKA 4IAZA 3ZFYA 4FSRA 2JDTA 4BZDA 5AA8A 4BVUA 4NT4A 5BYZA 5KBRA 1NY3A 3ZU7A 3KGAA 3M11A 4K18A 2OU7A 5FDXA 1YI3A 1IRKA 3OD6X 2X4ZA 1OL7A 5HNBA 1W82A 3RHKA 3I1AA 1Q8YA 4YBJA 3HMOA 5AR4A 2W1HA 4U80A 3U8WA 3VJOA 1QL6A 4WRGA 4AE6A 4HCUA 4MQ1A 4AW0A 5AIKA 3W8QA 3FY2A 4USEA 2OZAA 4JAIA 2H6DA 2W9FB 4G31A 1E1VA 3PSBA 4JAJA 1OZ1A 5EG3A 4FEUA 3R71A 3FJQE 1XHAA 4R5SA 5K5NA 5AV1A 2W5AA 3M1SA 3RNYA 3OC1A 2C1BA 1YOLA 1I44A 3P79A 4A9YA 5DPVA 3NZ0A 5AX9A 5CAOA 5C8NA 3D4QA 2OIQA 2XKEA 4I6FA 3QUDA 2X6EA 3DBDA 3NUPA 5A4QA 4RVTA 3E8CA 3G90X 3H0ZA 3IDPA 4GT5A 4H05A 4BKJA 5ANKA 5M08A 3CJFA 2HW7A 2BALA 3F66A 4EOLA 5CT7A 2AC5A 3THBA 2W99B 4O96A 4QP9A 4CMOA 3D14A 5B7VA 5E8SA 3GC8A 2QOHA 1LUFA 5KMKA 4M84A 4RGJA 5JH6A 4UZDA 2BZIB 3FHIA 4BDCA 4A4XA 1VEBA 5A14A 4UYNA 4R3CA 4U44A 3DCVA 4XH6A 5EW9A 4BR3A 2XBAA 5DEYA 4J71A 3HV6A 3QXPA 4YMJA 2AUHA 4AOTA 2VTTA 5CX9A 4YSJA 4K6ZA 4G3EA 4UMTA 3TKIA 2DWBA 3MH1A 3UOKA 4PY1A 2OXXA 4DH7A 4GG5A 3F82A 4QMVA 3LQ3A 4YJNA 4FEVA 3O23A 5K4IA 3FI4A 5BX0A 4IX6A 1PMNA 4I0SA 3T9TA 2PL0A 5IISA 3UIXA 4CFMA 2E9UA 2ZB1A 3CKWA 1H25A 1LEZA 4QP1A 4F08A 3VS5A 3OWPA 4ZK5A 4DH3A 4O2ZA 3UZRA 2PVLA 4P4CA 3KY2A 3ZRMA 4QTDA 2NO3A 4EBWA 2WQBA 5FP5A 4BCIA 2V5QA 2WU6A 4WNMA 3ROYA 3CGOA 4MWIA 3EQRA 2XJ0A 3QZFA 2VX1A 1APME 1VZOA 3PJCA 2YCQA 3WF5A 1WFCA 4YJTA 5CLPA 2OJFE 4EH5A 5HORA 2YLFA 3OUNB 5L8JA 4ENXA 4MKCA 4MH7A 3MV5A 5DR9A 4GVJA 3U6HA 3BI6A 5LWMA 4B8LA 4IB1A 3ZM4A 4C4HA 2YM8A 4PL4A 4U0IA 4IWQA 4W9WA 4RIXA 1DI9A 2CLQA 3QD2B 4FC0A 4LG4A 2VAGA 1Q5KA 2QO7A 3A8WA 4X2NA 4YHFA 5K4JA 1FMOE 2WQMA 5T6KA 4AP7A 4CRLA 3LXNA 3O8PA 4X7QA 2XK4A 2W9ZB 3FLQA 4YJUA 2OXYA 3F7WA 4IMYA 5GNKA 4DH1A 4F4PA 5TKDA 4FKGA 5JGAA 3UC4A 3HEGA 3SHEA 3D83A 4OUCA 3A4PA 3HRFA 1R0PA 3R01A 4QRCA 3GFWA 2HK5A 3MYGA 4J8MA 4TYEA 3DKFA 3AD6A 1U5RA 4GK4A 3NEWA 3VS1A 3ZLSA 3HGKA 4YPDA 3O8TA 3DDPA 3BYVA 3GUBA 3IDCA 3BHHA 5KX8A 4OTWA 4NTSA 3HAVA 4ZMEA 4ZJVA 4NIFB 5CQWA 2W1EA 3FLNC 4NW6A 3KRWA 2PVHA 1U54A 2O64A 5EW3A 2EWAA 3ATSA 4RVKA 1YKRA 2VWXA 3ZS5A 3KN5A 3PY3A 3BKBA 4DEDA 1WCCA 2BHHA 2P3GX 3A4OX 4ZZMA 5IEYA 4D1XA 5J8IA 3QYZA 4G1WA 4IAFA 4QMYA 1KWPA 3EMGA 4U79A 1OKVA 1KE6A 3ZOSA 2IZSA 3JPVA 4LFIA 4RX9A 2RFEA 2PULA 3MFRA 1G8AA 2JBPA 3ZMMA 4PDOA 2Y9QA 4RFMA 5IEXA 4BRXA 3AC1A 2C3JA 2CNQA 3OWLA 5KMMA 4EJ7A 4YBKA 4DLIA 2R3RA 3WOWA 2PVFA 4FIJA 2YM3A 3NUXA 2JIUA 2VTPA 2C1AA 4FKUA 4KB8A 4X21A 4C33A 4C8BA 3EKKA 5BYYA 1OKZA 1LR4A 4I92A 1OBGA 5ETFA 2YIYA 4Y72A 5J9YA 3DZQA 2YM6A 4IX3A 4KRCA 5KNJA 3PE1A 3GEQA 1FVVA 4FODA 4U42A 2UZOA 4QQTA 3F3VA 3R8ZA 4Q9ZA 4UX9A 3NNWA 4CG8A 4C4GA 3FY0A 3ZXTA 5C8MA 5JN2A 5IH4A 1XH5A 3N4TA 3EN7A 4HYHA 3MTFA 5CVHA 3S0OA 3U54A 2IJMA 3UYTA 3IO7A 2DUVA 1DM2A 3LLAA 4ZTSA 1H1RA 4ZTMA 3UPZA 3UVRA 1BX6A 5I9VA 2VO6A 4FKSA 3PPKA 1H1SA 3VRYA 3LFCA 3KXNA 3OMVA 1O6LA 3CTJA 5LVLA 3CPBA 1JKLA 4NCTA 4ZSLA 3IW4A 4MXYA 5HHWA 3ZO2A 3DXNA 4QYEA 3BU3A 4O0TA 4AZEA 2QNJA 3NYOA 5ACKA 2A4LA 4FSZA 5IUHA 4R7BA 3PXKA 2C6TA 2ZAZA 3DU8A 4OTQA 5EQEA 1ZZ2A 1IR3A 1U46A 2YM4A 2WKMA 4LV8A 4EHVA 5A46A 1KE7A 2YISA 1XH6A 3R9OA 5I4NA 2Z7RA 4FZAB 4NJDA 1JKTA 4GG7A 1OPLA 2AC3A 4V05A 1PMUA 4E7WA 3FPMA 2VZ6A 5JGBA 3CC6A 2BUJA 4M8TA 4ZEGA 3PA4A 5AAGA 1XBAA 3E8NA 4BCHA 4I23A 4O7VA 5CNOA 2CN5A 3NLBA 2F7EE 4KBAA 3QCQA 3VF8A 4DGMA 3O8UA 1CKIA 4R6VA 1V0BA 4CLJA 2F2CB 1KOBA 3OHTA 2VO7A 2C68A 3ODYX 4BCKA 3R7UA 1TVOA 1OITA 4PQNA 1P4OA 2R0IA 3WZDA 4CCUA 5JQ5A 1R78A 1G8SA 5A4TA 3GC0A 4F7SA 4M12A 3NGAA 4RMZA 2GS7A 2VTIA 5AV0A 3UGCA 3NCZA 4EBVA 2PUNA 3Q9XA 3QTRA 4ZZNA 5AADA 5HX6A 3H10A 3SG8A 1ZYCA 3PY1A 1PXNA 3RAWA 3TNWA 4DAWA 4E6AA 3TTJA 4YU2A 3FEGA 4RX5A 3UMXA 3UOLA 4FTNA 1B38A 5HIDA 3ORXA 3IOPA 3NAYA 4XCUA 2VGPA 4G6NA 5D1JA 3RJCA 3W10A 4YSMA 5C1QB 3O50A 4CKJA 3VUGA 5CSHA 5I3RA 4A07A 1NXKA 2PPQA 1ZMUA 2FSLX 3UNZA 4AXAA 3G5DA 2W1IA 3GCUA 2BROA 4RVMA 2G15A 2X39A 4BDDA 5HLWA 3F3TA 4RA5A 3RAIA 1V0PA 4ZJJA 3NIEA 3OT8A 3H9OA 3HP2A 1DAYA 3QQUA 4X3FB 5DBXA 5AR3A 5GJGA 4AAAA 4I0TA 2C3KA 2R7IA 4KSQA 4XG7A 5CEKA 3BBTB 3BGPA 3R7EA 2JAMA 4CMTA 3C4XA 2RG5A 2GS2A 3QD3A 3LFNA 4TN6A 5TF9A 2VO0A 5A6NA 2XEZA 4JL9A 4RZVA 5HE1A 3NUAA 4XP2A 5AV3A 2ONLA 4ALVA 2IZTA 3HRCA 2FUMA 2B0QA 2YABA 3MGYA 4YPSA 2VWWA 4L00A 3SXFA 1ZWSA 2ITYA 3U9CA 3PRFA 1SVGA 2V55A 4O91A 4F1OA 5CAVA 3EQGA 5HZNA 4HZSA 4J53A 4MAOA 5CZIA 1S9JA 3MPTA 3NW7A 4D2SA 4DFUA 3AMAA 5DT4A 2R3QA 4RG0A 3LE6A 3FHRA 4FOCA 3LFQA 4PTCA 4D0WA 4C37A 4EL9A 3SA0A 3K2LA 4WSYA 2XRWA 2HCKA 5GINE 1M2PA 2FH9A 4W8EA 3GCPA 3ZDUA 4LQMA 4HJOA 4W4VA 4DGNA 3KXGA 5ICPA 3V01A 3E62A 5H3QA 3C4WA 1UVRA 1W0XC 2X81A 1H07A 5JGDA 3DBCA 3IG7A 1RW8A 3QC4A 4HOKA 3GU6A 2R64A 1ZAOA 4FUXA 3ZO4A 4DA5A 4YZBA 2ETKA 2QG5A 3O7LD 5M57A 5ETIA 3BHUA 3QKKA 3ANQA 2Z2WA 3MVLA 4E6CA 1YXTA 3KRJA 4O7YA 3FKLA 3A7HA 3VBQA 4YNEA 3ZC6A 5M4IA 2JEDA 2W1ZA 3EJ1A 3LCTA 4I24A 5KKRB 1OUKA 4Q2AA 5M06A 5CU4A 5C4LA 3PIZA 4XV9A 2UW4A 4QMLA 2VWZA 3VHKA 3FI2A 1H0WA 5E7RA 4C7TA 3NUYA 2REIA 4I4EA 2I0VA 4UMUA 1TQPA 4QMPA 2E9NA 5JZJA 4L44A 1QPJA 2YIXA 3F5UA 3OCBA 4WA9A 4M3QA 4Y95A 4Z7GA 2WMWA 4MD7E 1KE5A 4PF4A 4UEUA 4XJ0A 5KMNA 3KF4A 3MPAA 4NL0A 3VUDA 2QD9A 4O0SA 1SNXA 4I6HA 4FT3A 3LJ0A 5CENA 5JFSA 5E1SA 5J79A 4EOPA 3KB7A 5CSWA 3K3JA 1GZOA 2WPAA 1ZXEA 2ITNA 3UP7A 4AZWA 5I9WA 3HAMA 4YNOA 2IVVA 3FV8A 3NIZA 4LM5A 1ZZLA 5IQFA 1Q4LA 3B2TA 3C0HA 4FTJA 4IB3A 5AMNA 1NVQA 3EN5A 3OTVA 2R2PA 5HNGA 3E87A 4WD5A 3CCNA 3E64A 4C2WA 3SOAA 5EW8A 5FTOA 1KUTA 3OW3A 5TE0A 2JLDA 3R8LA 3UC3A 3MJ2A 4AS0A 2W4OA 4BCPA 3AT3A 1UV5A 4FKPA 5DA3A 5A9UA 2HY0A 4U9AA 2G1TA 4RJ6A 2UZDA 4EHZA 3VUHA 5A4EA 1UU8A 1YI6A 4AZTA 5IUGA 1MRUA 4D9TA 1UA2A 3OCTA 2QOCA 3FZRA 4K1BA 4TKSA 4M67A 4XLIA 2VTOA 3FI3A 4MNFA 4BBMA 5LVMA 4I3ZA 4ZY4A 4YLJA 1YXVA 4NKSA 2FSTX 2XM9A 3FZOA 1IG1A 3ANRA 5BNJA 3TCPA 4IAYA 4ERKA 4HGEA 4FSMA 4G3CA 4FKJA 1JWHA 5EKOA 2X6DA 5IPJA 1H4LA 4A06A 3D5XA 2WOTA 3PPZA 5H8BA 2ZDUA 3LJ1A 4DTBA 4FKOA 4YLKA 3UQFA 2VWBA 3E8EA 4FKTA 5D11A 1HCLA 1IASA 3R8UA 5K3YA 3RPVA 5H2UA 3F3WA 2AYPA 5ANJA 3DS6A 1OUYA 3D7TA 4IWOA 3SXRA 4C61A 4F1TA 4A9SA 5EDPA 4S34A 1UNLA 2YHVA 1P14A 4C0TA 2XM8A 4JDHA 3VS0A 2OZAB 5EM5A 3FC2A 1WVXA 4P5QA 2VWIA 5A4LA 1YDSE 2C6EA 3BZ3A 1ZMWA 4R8QA 5IA5A 2VX3A 4H3PA 3ERKA 3HV3A 2SRCA 4P90A 1H00A 4H1JA 1XH9A 5CYIA 3TDWA 1GNGA 4QMWA 1K9AA 3OY1A 4EOMA 4E73A 2FSOX 3PWDA 4BDHA 2QOBA 2BFXA 5H8EA 2PZ5A 1IAHA 5DN3A 1PY5A 1WZYA 2VD5A 3P7AA 3PIXA 4FZ7A 3ZLXA 4HVDA 5M55A 2VTQA 2WAJA 4O0UA 4FSWA 1HCKA 2Z7QA 3ZFXA 1AGWA 3R7IA 3BRBA 4ZLOA 4KA3A 3P08A 4U97A 2R4BA 2PYWA 4JG8A 4AT5A 2WMTA 4BIEA 5EQYA 2C0TA 1W7HA 2XK8A 3P9JA 4MBLA 5E8VA 5HCZA 4FV8A 1SYKA 4NYEA 4F9AA 3MA6A 4G3GA 4IACA 4C3FA 2X8EA 4ZY5A 4OAVB 3UODA 3GOPA 4PMSA 3R7YA 5BUIA 1TKIA 4UWBA 4WSQA 3UIBA 4ANQA 4BCFA 5JK3A 3UO5A 2QO2A 2IVUA 4U41A 3BE2A 4QMOA 2FSMX 5HE0A 4ZLZA 1ZLTA 3MFUA 3VS3A 4X3FA 5HG8A 4MNEA 4S2ZA 4GKHA 3NYVA 3FLYA 4ASZA 1GIJA 3A7IA 4LL5A 4RSSA 4YHTA 4FV5A 3UMWA 5DIAA 3QU0A 5JSMA 4BZNA 3D2KA 3D5VA 3TZ8A 5HD4A 1JKKA 3MN3A 5HESA 2WQEA 2EB2A 3Q3BA 2JITA 2YM7A 3R00A 5JFXA 3WI6A 2CCIA 4E4LA 4EOSA 1WVYA 3IGOA 4TWNA 1YDRE 3R1QA 2UW3A 2PMNX 3BLRA 4KSPA 4U43A 1SVEA 3QQHA 1H08A 4NM0A 3LAUA 4O22A 4RLKA 5ANDA 5LVOA 2OIDA 3GU4A 2BIKB 2JDSA 3QBNA 4U3ZA 1UNHA 3JYAA 4YJSA 4YTIA 4E5AX 2CLXA 4EQCA 3DQWA 4F63A 2NRYA 5LMAA 4B99A 4O0VA 4X2FA 4ZS4A 4GU9A 4RIXB 3HDNA 3KU2A 3RTPA 4NK9A 4EI4A 4MXOA 4FTOA 4QQJA 2JKOA 1RDQE 2X9EA 5L8KA 4ANNA 2CKQA 3SRVA 2C5NA 3FZSA 2R3MA 4OTPA 5AUXA 4X2JA 4E4MA 5D41A 3F5GA 1GJOA 4AFJA 1SVHA 5GZAA 5ANIA 4FK3A 2BAQA 2HW6A 4FV1A 5CANA 2JFMA 3H9RA 4N6YA 5E8YA 3W2PA 4AE9A 3ZBFA 2WTJA 4DE4A 4XNEA 3IQ7A 3VS2A 2OJGA 4CV8A 4M13A 5EM6A 3OWKA 5L6PA 4IEBA 4MVFA 1OBDA 2XJ2A 2ACXA 4XUFA 4ANSA 3VUTA 2XCKA 5CF6A 4TL0A 4EH6A 5CAUA 3A62A 5CSXA 3UVQA 4YZNA 1U54B 3TM0A 4KWPA 3FZTA 3KREA 3PYYA 2W06A 4UBAA 5CXZA 2WMVA 2HZ0A 4NKAA 4YC3A 4OTRA 4BCQA 3KMWA 4BDEA 3ALOA 5AUWA 3BELA 1LPUA 5L2TA 5IQAA 2WTVA 3C0GA 4C58A 4EH7A 5M07A 3O0GA 3IDBA 1F3MC 4R5YA 3EL8A 4UXLA 3RGFA 4FK6A 4RQKA 2FB8A 3DK6A 2PUPA 2BRMA 3D9VA 3PJ8A 5BPYA 3P78A 2OJ9A 3VC4A 2YWPA 3ORPA 4XV2A 4FG7A 2ONLC 3T8OA 4WBBB 4EQUA 2W96B 4PP7A 5JQ8A 1YWVA 1J7LA 1KE8A 3Q5ZA 1XH8A 2WQOA 3MS9A 3LXLA 3PP1A 4BGGA 3WF9A 4F7LA 5EHOA 3BWFA 1YHSA 4KS7A 1STCE 5EYDA 3KRXA 4EORA 2J0JA 4NM3A 3ACKA 3C7QA 3KVWA 3QFVA 4GJ3A 5HU9A 3PTGA 1EH4A 3IK3A 4XHKB 2P33A 3RINA 3BLHA 4KBKA 5IG1A 2IWIA 4ACMA 4NUSA 3MIAA 2WMAA 4GSBA 4HNIA 4L53A 3W1FA 4P7EA 3VUIA 5HTIA 2PUIA 2JDOA 5DNRA 3VN9A 3NVMB 4G16A 5EM7A 4EH4A 5IA1A 5EQPA 2Q0BA 3AT2A 3FC1X 4H3BA 4UN0C 3G51A 1WBOA 4FMQA 4I6BA 2Y4PA 4EOIA 4DFYA 4J96A 4Q5EA 1JBPE 2WOUA 5CF5A 3ZTXA 4MF1A 5DFPA 2EXMA 1H26A 3NNVA 4FEXA 3R1YA 2VUWA 5IQBA 1FBNA 3Q4TA 4FZ6A 3F3UA 4PPCA 4RVLA 3U87A 1H1WA 3BYOA 4Z7HA 3V5QA 3LM5A 5KO1A 3G33A 4FKQA 1OL2A 4LUDA 2R3KA 2J0LA 2GU8A 3U6IA 5BUEA 3Q2MA 3UIUA 4DN5A 4EK4A 3COIA 4QMZA 4RPVA 3Q32A 4X6RA 4FYNA 5DLSA 5AUZA 2KTYA 3M2WA 4XRLA 1MP8A 4UB7A 4B7TA 4D2VA 3W2RA 2KULA 4U81A 1BUHA 4TNBA 3DNDA 5FXQA 4K2RA 2QQ7A 4IH8A 5EH0A 2XK7A 3KA0A 3MPMA 3E8DA 4LRKA 3TT0A 1PRYA 3SD0A 4V0GB 5CSPA 1WBNA 2IVSA 3GFEA 3C5UA 2YERA 1CMKE 4AACA 2WIPA 3DLSA 3F5XA 3DZOA 4C59A 3BPRA 4CKRA 3TTIA 1YVJA 4D5KA 3OXIA 4FBXA 1JLUE 2ZB0A 2OJIA 2PZYA 2GNLA 3W18A 4CYJA 3RBWA 4MQ2A 3EFJA 3CE3A 3G0EA 2ESMA 2NP8A 5BVDA 3TUCA 1M52A 4FVRA 5F95A 3GI3A 5H9BA 5K0KA 4E4NA 2ZVAA 4LUEA 3R02A 5ANEA 5F9EA 2XRUA 2RSVA 4AG8A 5A6OA 2PVRA 2JIIA 4R7IA 5L2WA 5LXMA 3FLZA 3QQGA 3BBWA 4BI0A 4CSVA 3RZBA 4BYIA 1I09A 5A3XA 3TNQB 4DG2E 4EKLA 5CAQA 4JBVA 4FIIA 1F5QA 1Q99A 5FXRA 3DNEA 5CU6A 3NX8A 5AM6A 4O7WA 4CT1A 4O86A 4C3RA 3PE2A 2XK6A 4WKQA 4FR4A 2H9VA 3TV6A 1MQ4A 3R8MA 3QWJA 3A7GA 2XEYA 3IKAA 4IVBA 4FGBA 3MB6A 3ZSHA 5ANGA 2X8IA 3WE4A 5KMIA 4U6RA 4HYUA 3S1HA 5JMSA 2B52A 3PFQA 3UIMA 4X2KA 5FG8A 2XNNA 4FGRA 4M66A 2GMXA 4D2PA 3NNXA 4OT6A 5JEBA 4QMTA 1QMZA 3SAYA 4FA2A 5IQIA 2Q0NA 1REJA 3SV0A 4DGOA 2RFNA 1OPJA 3I0OA 1OKYA 5EYMA 3LVPA 2Y0AA 3E93A 4ARKA 3F2AA 5AUVA 2BHEA 4PP9A 2VO3A 3L1SA 3R30A 1ZY4A 3CKXA 2H96A 3CBLA 2GPHA 4N57A 2OW3A 3TNHA 2CKPA 4UMRA 4OLIA 5FRIA 4K33A 2OLCA 5CWZA 2CSNA 3U51A 1KV1A 3HKOA 3DAJA 4CQGA 3EYGA 3I4BA 3LFEA 2WEIA 5DEWA 3BHYA 4S32A 1ZYSA 5M53A 3VVHA 3MVJA 4U45A 4KRDA 4BCOA 4CD0A 5L8LA 1XJDA 3RAKA 4FSQA 1OIQA 4GW8A 5CY3A 1URCA 2IZRA 2PK9A 2XKCA 3TKUA 4DHFA 1P2AA 4C62A 2F57A 3LFDA 4DGLC 1UU3A 3BEAA 3ORNA 1LEWA 1U5QA 3R6XA 3R63A 3ZXZA 4E20A 3UQGA 5LQFA 4IW0A 3C5IA 4UYAA 3L9MA 1M2RA 2Y4IB 3WBLA 4D4VA 3MW1A 5ACBC 5K9IA 4FIHA 3SGCA 5E1EA 4UALA 3BX5A 5BVNA 4USFA 2QOFA 2GQSA 2QR7A 2DYLA 4FVQA 3R1NA 1WBPA 1OPKA 5AM7A 3PDTA 1JKSA 4EYJA 2PZPA 4IZYA 3OOGA 3AC5A 2HWPA 1PXJA 2PE2A 4Q5HA 4RWJA 4YJRA 1T46A 4EZ3A 4D9UA 2BDWA 4KD1A 4FUYA 4X3FC 4QNAA 2BTRA 2OF4A 2UW5A 3WARA 4RLLA 1W83A 2C0IA 3LPBA 4DH8A 2ITZA 2V7OA 4YZMA 4CMUA 3V51A 5J5SA 2EU9A 3Q96A 3ENHA 1PXOA 4L3LA 4QMSA 3PVGA 4RJ7A 4YO6A 4BIDA 4ANOA 2ZV7A 4EJNA 2IG7A 3OEFX 4XLVA 4F64A 1WVWA 4ZSEA 4F99A 2IN6A 2QONA 4ANMA 2GHLA 1CTPE 4TZRA 4XV3A 3E5AA 4GKIA 3PSCA 2YDIA 3A7FA 4ZJIA 3LZBA 4F0IA 4GRBA 1AD5A 3GXLA 2PTKA 5CTPA 5KUPA 4C35A 4AA0A 3HECA 4IADA 3FMEA 3QALE 3QRJA 3ZUVA 4FICA 5HCYA 3H9FA 3FSFA 4ZAUA 2JDVA 2FGIA 1PYXA 2C4GA 3P86A 2HZIA 3UE4A 3Q6WA 3AGLA 3ORTA 4TWPA 5KE0A 2QLUA 2YCSA 2GNGA 5ETAA 5HE3A 1XBBA 3Q9WA 4U7ZA 5GIOE 2WMRA 2VTAA 4M69B 4F9WA 2XUUA 5GJDA 3DJ7A 3WF7A 5IQCA 3ZO3A 4PWNA 4UV0A 2WU7A 3EQHA 3HDMA 1PYEA 4AFEA 4BDGA 1QPDA 1UU7A 2QC6A 3OZ6A 4L7FA 2OKRA 4AQCA 1Q8WA 2GHMA 3FL5A 3LQ8A 2C0OA 1JNKA 4QP3A 4L52A 3U4WA 4AX8A 1NT2A 1J91A 5DGZA 4G6LA 1WBTA 5CZHA 5LMKC 4GT3A 2BKKA 2BRBA 2R5TA 2F9GA 4ZY6A 1OB3A 2WZJA 4FTQA 5FBOA 4HNFA 4BTJA 2J5FA 2ZV8A 3EN6A 3KFAA 2NNWB 2VV9A 4DT8A 4LGDA 4Z9LA 3OW4A 2W05A 4FT9A 4IDTA 4L6QA 4IJ9A 5KKRC 4J8NA 3V8SA 3KXHA 4APPA 2UZTA 2BIYA 2A0CX 4ANBA 2PHKA 4GIIA 4BWKA 4I5PA 4XEYA 2IW8A 4G5PA 4NSTA 3PVBA 2PZIA 4S33A 4A9TA 4CFFA 4YLLA 2ERKA 2XNPA 4WG3A 3LXKA 4KNBA 3ZC5A 4V0GA 4G2FA 4CFXA 4QYHA 2HIWA 2X2KA 3D7TB 5FQDC 5HLNA 5EHLA 1M14A 2I40A 2V62A 1BI8A 4DBXA 3N4UA 3A7JA 1YOMA 3QF9A 4MK0A 4R7HA 1UU9A 4L43A 4USDA 3O51A 5TT7A 3E7OA 4FSTA 4DG3E 2OICA 3DKCA 3POZA 4FG9A 4AZFA 5HGIA 3DOGA 3BE9A 4AA5A 2E9OA 4QMUA 3HV4A 4DBNA 4RIOA 3PLSA 1FGIA 3P7CA 3ZDIA 4RA4A 2ITPA 3VAPA 3WZUA 1CKJA 2JKQA 2VX0A 4MWHA 4EK8A 3IW6A 3OFMA 4F09A 3FWQA 3SQQA 5IH6A 4RWKA 4AN2A 5HG9A 3HMMA 2GSFA 4IHPA 3LLTA 3MY5A 1BL6A 3OY3A 3QQKA 3DXQA 1PJKA 2YEXA 5IA2A 5LJJA 4E3CA 3VWAA 2F7XE 5CT0A 4FTCA 3GC9A 3W2SA 4N6ZA 5AFVA 2V7AA 2G2FA 4M0YA 3WIGA 5GIPE 2PMIA 3GNIB 5FEEA 5CU3A 3RPSA 3DK3A 1ERKA 4FSYA 3ZSIA 3NPCA 4JBQA 2QOOA 5AP5A 2I1MA 4CXAA 5IEVA 4O83A 4HGTA 3T3UA 3D0EA 4EOOA 2VWUA 3CLYA 3VBWA 2R0UA 4TYHA 3VBYA 3QZHA 2IPXA 3I7CA 4QQCA 4AOIA 3HZTA 3TV4A 3OUKA 3DKGA 3SC1A 5CU2A 4RJ3A 3RCDA 4S30A 4CGAA 5ANOA 4F0FA 2VTJA 3BYUA 4J97A 3IS5A 4GFMA 4MNEB 3CIKA 3ITZA 3ZLWA 4JX7A 2A2AA 3AOXA 2RKUA 4AT4A 4I6QA 5LMBA 3D5UA 4A4LA 3KULB 5TR6A 3I60A 5HTCA 3WF8A 3EFKA 3PZEA 3RPOA 4CYIA 2UW9A 5J9ZA 2VWVA 4DH5A 3FUPA 5AP0A 4PX6A 5DVRA 4JR7A 5AIRA 2IVTA 2J9MA 4YZ9A 4BFMA 4E93A 2UZUE 3EFLA 5CF4A 3LCSA 5I3OA 4IANA 4JX3A 2UW0A 4RC4A 4R1VA 4EC8A 5J87A 3WZKA 4FIFA 1PMVA 5CEPA 4CZTA 2IW6A 5JT2A 4FNYA 4QPMA 5CS6A 5DT3A 4EOKA 3DFAA 4FEWA 1U59A 3WZEA 3R0TA 3LMGA 4FKWA 3BGZA 4J1RA 2BDFA 5T3QA 1JQHA 3ZZEA 4Y85A 4YJQA 4BI1A 2FYSA 1B6CB 3R04A 1A48A 3ORMA 2B9JA 3OG7A 4MXXA 2UZEA 3FPQA 4I93A 5L3AA 5E91A 3SRVB 2QOQA 4AW2A 5FEDA 3COHA 2ETMA 4F70A 2WIHA 4FEQA 4BY9E 5DHJA 4MBIA 3WE8A 1GIHA 3KCKA 3QD0A 2BR1A 2R7BA 3EYHA 2C6KA 3VS4A 3W55A 2ITQA 5G6VA 5GZ8A 2CNUA 3QWKA 1H27A 5L6OA 3FXZA 4DFZE 2WHBA 2QHMA 4IB5A 4BTFA 3LCOA 2I7QA 3FXXA 4OAUC 5A4CA 3KXMA 1J3HA 4FKRA 3E7VA 5DR2A 3LMIA 3QRUA 5KHWA 4WO5A 3FMHA 3OF0A 3VS7A 1XWSA 4QQ5A 1CDKA 2B53A 3DTCA 3CTHA 3PXRA 4XBUA 3ZSGA 2WTCA 4BYJA 2QG7A 4IC8A 3LFAA 3PIYA 4WNKA 5E8ZA 2VTHA 2IZUA 5C27A 3H30A 3RI1A 4PV0A 4HGLA 4DYMA 2WTWA 4JDIA 1OL6A 4GS6A 4MD8E 4UXQA 3R7VA 4TY1A 3V6RA 5HTBA 5M4CA 5HVYA 5DH3A 3EWHA 4ITIA 3QTIA 5CXHA 4BL1A 2XIZA 1MQBA 5HG5A 4PNIA 3U4UA 3JXWA 3MH3A 2ITVA 2A19B 2CKEA 2WTKB 5EFQA 2HWOA 3ZCLA 3DFCB 4F6UA 2C69A 4G3FA 4GV1A 5AR2A 4E4XA 4GT4A 4QMQA 1CM8A 4D4RA 3DTWA 4CTCA 5M09A 4FV4A 4IQ6A 4ASXA 2PVJA 2J5EA 3QQFA 5AUYA 3V04A 1OI9A 2QOLA 4LRMA 2YWVA 2R3LA 2YJSA 3Q60A 4FTLA 5BMMA 3KL8A 4M69A 4MXCA 3PPJA 5E92A 2BCJA 3PWYA 2C47A 4TT7A 4K11A 3EB0A 4FNZA 4D2RA 4ZSAA 3KXZA 5CVGA 4R1YA 4NFMA 5CEOA 4JDKA 4K9YA 3KCFA 3OEZA 4WNPA 2RF9A 4XG3A 4EZ5A 2HZNA 1FQ1B 3TXOA 2J6MA 3WZJA 5C4KA 1KV2A 5JFWA 5IQDA 2RIOA 5FXSA 2FVDA 3FLWA 3QTUA 4YJPA 1OMWA 4YTHA 1E9HA 3OXZA 4GUEA 2B9HA 1OIYA 4BGHA 4CT2A 3ZRKA 3QTXA 4YC8A 3FL4A 3P0MA 4Y73A 3DXPA 3QA0A 4PDPA 3QUPA 5ETCA 2EVAA 3SG9A 2H8HA 4IFGA 1DAWA 4APCA 4AZVA 4QOXA 3GU7A 1R0EA 4Y5QA 1W98A 4CFNA 4HPUE 4R3RA 3MB7A 1QCFA 2X2MA 4L01A 3FMMA 4ZMFA 2HELA 4A9UA 4CV9A 3NW5A 4JRVA 2XNOA 5CNNA 5EDQA 3TACA 4DC2A 4BWXA 1W8CA 5GHVA 4DF3A 3CY3A 4BDBA 3F3ZA 4GVAA 3ZO1A 4B8MA 3P23A 5IA0A 2YM5A 4GUBA 3A60A 1YOJA 5E8WA 2O5KA 2A1AB 4W8DA 3R7OA 3ULIA 3QRIA 3R2YA 3V3VA 3CQWA 3L8XA 3C4CA 3PJ3A 4MXAA 5I9UA 4FSNA 3NYNA 4BTMA 3WYXA 4HW7A 5AUUA 3QTSA 4F6WA 4QPSA 1Y8YA 2Y8OA 3EQBA 4X0MA 5AP2A 1FOTA 4O7SA 5AA9A 2ITTA 4PUZA 5GJFA 4Z55A 3RK9A 5E8XA 4YJVA 5IMEA 3PG3A 4G34A 4X6QC 3BIZA 4FTKA 1OM1A 3ZUTA 4G6OA 1PKGA 4QP6A 3QCXA 4KIOA 2BILB 3DPKA 3AMYA 4NJ3A 1OVEA 1Q3WA 2WMXA 3BQRA 1AQ1A 2JD5A 3EN4A 3MSSA 4RIYA 4E5BA 1Q8UA 4FOBA 5DE2A 3A61A 2C3LA 2LGCA 5C9CA 4FZDB 4K0YA 2QO9A 3PSDA 2CGWA 4GMYA 2W4KA 3OBJA 4LRJA 3EQCA 4YC6A 1M2QA 2RFSA 3HUCA 3K3IA 5AP7A 3UBDA 3V5JA 2ZYBA 1J1CA 4XRJA 2HY81 2QCSA 4E1ZA 2CNVA 2VTMA 2XS0A 5EKNA 4EONA 4BC6A 4NCTC 3L8VA 1JVPP 4HCVA 1ZY5A 4AW1A 4JBPA 3RK7A 4L68A 4YURA 3EKNA 1H01A 3NW6A 3MVHA 3RNIA 2XIXA 3HV7A 5IQGA 4IDVA 3UZTA 3FMLA 1PMEA 3FI8A 2R3PA 2RL5A 3KULA 4XOYA 4F6SA 2ETRA 3BU6A 4FV9A 4DCEA 3DLZA 3ET7A 4JDJA 3EH9A 4BF2A 3P5KA 5L2IA 1J7IA 3Q4UA 2VNYA 4DFLA 4W4WA 3C4ZA 3FMDA 4O21A 5E8UA 4CQEA 3G15A 3DKOA 4AT3A 3CY2A 3VW6A 4D2TA 4E5WA 1L8TA 4HVIA 5DI1A 3LFSA 1H24A 3RZFA 3UNJA 2ZDTA 1DS5A 3RKBA 5CEIA 2G01A 3VNTA 2CJMA 4U3YA 4IXPA 2OH4A 1ZYLA 4E6QA 2PU8A 1P4FA 3DQXA 4QO9A 5AJQA 3AC2A 3IONA 2Y6OA 4FNWA 2XYUA 4RJ5A 2G9XA 3EQFA 4TWCA 3R21A 3MI9A 3RHXA 4E8AA 3C51A 1YXSA 3GGFA 3ZYAA 5EYCA 4ZTRA 3MFTA 5C26A 1H1PA 4QMMA 4IAAA 3LXPA 5FTGA 2YLEA 2J2IB 2XK3A 3R28A 1L3RE 2BZKB 3ACJA 5C01A 1Q61A 3FMJA 1SZMA 5LOHA 4L7SA 3EHAA 4D55A 4O82A 4MEDA 2Z7LA 3E92A 5D7VA 3FQSA 5AUTA 2OXDA 4MF0A 4C2VA 4BDAA 4S31A 3OCSA 5CI7A 1YDTE 2GCDA 2J0KA 5AR8A 2GFCA 3RWQA 1M7NA 5B2KA 3UJGA 3RPRA 1ZYJA 4AZSA 3MJ1A 1J7UA 2OH0E 4ZSJA 2GNIA 1ZARA 4LV5A 4KAOA 4BCMA 5AP3A 3PXYA 2PVKA 2VTSA 4FL1A 2X1NA 5E8TA 3OBGA 4AGDA 2XKDA 3DJ6A 4FTMA 2FO0A 3L9LA 5AR5A 4IWPA 2BVAA 1PXMA 4OBPA 4NM5A 3ATTA 3EQIA 1ZOGA 3AC4A 5IKWA 4RJ4A 3ETAA 3TG1A 2PMOX 1BL7A 4G17A 3CGFA 4AW5A 5CEQA 4FL3A 4EUUA 4LL0A 5M4FA 4GFGA 4MD9E 3QL8A 4IAKA 3VIDA 3R9RA 1A06A 4ONAA 4BTKA 1R39A 5FBNC 4KIPA 4Q9SA 4OTGA 1YHVA 2BPMA 2WFYA 4U40A 3KKVA 4ID7A 1Y6BA 4OBQA 2A27A 3RPYA 3UG1A 4O2PA 3ID6C 1WBSA 2YIWA 4M0ZA 4XYFA 3LM0A 3ORIA 3BEGA 3QXOA 3NMUF 4TWOA 3C50A 4M7IA 4CNHA 3R7GA 4TYIA 4QP7A 4C4EA 2RG6A 5BVEA 4DEIA 2OG8A 2WGJA 1VYWA 4FKLA 2BRHA 3SKCA 3DBQA 3F88A 4FV3A 3KMUA 2BRGA 4OTIA 2C6IA 3L9NA 3AD5A 4Z16A 5IQHA 5J7BA 3VO3A 3D94A 3Q6UA 5I9ZA 2R9SA 3PG1A 2ITWA 2ZV9A 3IPHA 2XMYA 1JPAA 4FTAA 1PW2A 3PXZA 4JXFA 4NWMA 4O1PA 4EWQA 4UMPA 4TW9A 2UZNA 3MIYA 3DBFA 2C3IB 3HMNA 4F7JA 4O38A 1PXKA 3V5WA 1OKWA 4CFWA 4NW5A 2Y4IC 4I21A 5B2MA 4B0GA 2YJRA 3GBZA 4RZWA 5FWKK 2HYYA 3N4VA 2W7XA 5HO6A 3MH0A 5IQEA 4PMTA 2PZRA 3EQDA 5JZNA 1ND4A 4HYIA 2C6OA 3NR9A 3II5A 5F1ZA 4FZFB 2OSCA 4Y8DA 3OTUA 2ZMDA 4D2WA 3CS9A 4G9CA 3QZGA 1NA7A 4H39A 1IAJA 2XH5A 3HL7A 4MCVA 3LJ2A 5EOLA 5M4UA 4GYIA 4F9CA 4XG9A 4RC3A 4DGGA 3AQVA 4O0RA 3AC3A 4L42A 3VJNA 3FSKA 4MYGA 4HVSA 4BDFA 1VJYA 4QP4A 4BKYA 3DJ5A 5IA4A 3TKHA 3ALNA 4II5A 5HIBA 4FYOA 5HE2A 5BUJA 2E2BA 3ELJA 2B1PA 2PVNA 4TYJA 5TO8A 3TEIA 4M15A 1FINA 5AR7A 3TUBA 4FTUA 1J1BA 4GH2A 4XP3A 3VF9A 4N4SA 4OW8A 2P0CA 2GFSA 3C1XA 3KMMA 2PSQA 2W1GA 4IWDA 3V8TA 3LKMA 2P4IA 4H36A 4DLJA 4MBJA 5CAPA 1V0OA 2JFLA 2I0YA 2VNWA 2WD1A 4BWPA 1OL1A 3KXXA 2BAKA 1GZKA 3HV5A 5HKMA 3UVPA 3WILA 2XBJA 4KUJA 4N0SA 3OWJA 5FGKA 2YIRA 4CKIA 3CD3A 3TV7A 5DYJA 1Y57A 2F7ZE 4C57A 1XH7A 4KKGA 4YTFA 3VHEA 2CGUA 3QGYA 3SX9A 3F9NA 2W5BA 2X7FA 3E3BX 5HLPA 5EDRA 5AP6A 2WMQA 2XYNA 4BHNA 4EZ7A 3U6JA 4FX3A 2R3IA 2P55A 2X0GA 3PXQA 3PVUA 2HXQA 2I0EA 4AOJA 4OGRA 3FQHA 4F0GA 3U9NA 2XA4A 2X2LA 4PL3A 3C4FA 4ZTQA 4CLIA 4FT5A 5IF1A 3FMKA 1PXPA 2ITXA 4EHEA 4XMOA 5DMZA 1REKA 3GU8A 3OP5A 3B8RA 4I20A 4V04A 3S4QA 4W9XA 3HMIA 3UOJA 4J99A 4ZOGA 3W2CA 3EOCA 4L8MA 4ACHA 2YZAA 3GOKA 3V6SA 5CI6A 4ZLYA 4MX9A 2YCRA 3R22A 4TYHB 5HVJA 2CDZA 3NNUA 4R3PA 4BDJA 4UWYA 4GK2A 5HIEA 1FVRA 4JBOA 5EM8A 2GTMA 5J1WA 2UZWE 3B2WA 4F9YA 3GCSA 2B7AA 3QLFA 3EIDA 4AU8A 4GEOA 3QUEA 4M14A 2XNGA 3UTOA 2Q83A 3BV3A 4IB0A 3ENMA 4CTBA 5B2LA 3HMPA 1YW2A 3PUPA 4QNYA 2C5YA 4HVHA 1KSWA 4I4FA 4PL5A 3RK5A 3G6HA 4PMPA 3DAKA 3I81A 2XZSA 4G5JA 5AP4A 5CEMA 3TNIA 4ITHA 4ACDA 3BGQA 4WG5A 4G3DA 2V22A 2VGOA 3REPA 4O6LA 4KABA 4PMMA 4EH9A 2J4ZA 3TIYA 4BCNA 5BMSA 2WTDA 1FPUA 2UZVA 3W8LA 4YR8A 2ZM4A 3HA6A 4DG0E 4CFVA 4DTKA 3FYKX 4FKVA 1ZRZA 4RFYA 3RP9A 2QOKA 4FTIA 2PUUA 2GNJA 4JG7A 3DBEA 3KVXA 3MBLA 3Q52A 1TQIA 3FLSA 3WF6A 4EKKA 1BYGA 4O7ZA 4XBRA 5I9YA 1FVTA 1Q41A 4IM3A 4ZP5A 5EYKA 4OR5A 5HEZA 2RFDA 2R3JA 1M17A 4YUQA 4NU1A 4L45A 3SOCA 3IOKA 3BWJA 3W16A 4D1ZA 1DI8A 3CJGA 4IZ5A 4GL9A 3TZMA 3EZRA 3ZLYA 3JR1A 1PXIA 2Y6MA 2X4FA 2W1DA 2GHGA 3CSVA 4EWHA 4JQEA 4TPTA 4C38A 4AA4A 3NAXA 1GZ8A 4B4LA 3RALA 5KMJA 4BICA 4KS8A 3VQHA 2XVDA 4B9DA 4V01A 4ERWA 4NM7A 1H0VA 3FDNA 3F61A 1W84A 3C9WA 1H1QA 4DFXE 4FT0A 2CPKE 5KZIA 3Q04A 5EHYA 2QU5A 5JKGA 4Y5HA 3PVWA 5E9EA 1JAMA 1M7QA 4BB4A 5I0BA 5BYLA 4F7NA 2OBJA 4EH8A 5D12A 2VRXA 3AD4A 2W4JA 4J95A 3RM6A 4BKZA 3TUDA 3DV3A 3O7LB 3IW8A 4IAIA 4OTFA 4WBOA 5H8GA 4DEEA 3MFSA 4TNDA 4I5HA 1RQQA 4ZTNA 1BMKA 3S00A 2JKKA 2XK9A 3CQEA 3PZHA 2PVMA 4UWCA 4JJRA 3PP0A 1YI4A 3I5ZA 4LGHA 4CCBA 3QRKA 2WXVA 2B9IA 4KBCA 4R78A 5HVKA 3QCYA 4ZXTA 5LWNA 4ORKA 4QMNA 3EFWA 4FIGA 5JRSA 3O2MA 3KK8A 1G5SA 5AV2A 1URWA 3GVUA 2XP2A 4GFOA 2EXCX 2XIRA 3ROCA 3QKMA 4BIBA 5DR6A 4AF3A 1OGUA 2J51A 5FUTA 4XP0A 3ZFMA 2XKFA 3C0IA 3RCJA 3QAME 3HA8A 4C36A 2CCHA 2XNBA 4ZTHA 5HICA 4CG9A 1S9IA 2Z60A 3MTLA 4YHJA 3DDQA 2JGZA 3Q9ZA 3E63A 3GB2A 5BVWA 4JQ7A 3DT1A 4LI5A 5AX3A 3O71A 1YQJA 1NW1A 4KIQA 3DY7A 3QKLA 5KMOA 3GCVA 5IU2A 1TQMA 3POOA 4QTEA 3SVVA 2C30A 4KIKA 2QKRA 1Q62A 4DINA 4DCAA 3GQLA 5GZ9A 4LOQA 1P5EA 4JNWA 3NWWA 4MTAA 1Z57A 3JS2A 3NCGA 3R8VA 2UV2A 4O81A 2WELA 4ALWA 3ORKA 2X7GA 2QU6A 4NH1A 4I41A 3GT8A 4YZDA 4EQMA 4XG2A 5IA3A 3FMNA 3Q5IA 5EI6A 3L9PA 2GNFA 4XG6A 3TZ7A 3P4KA 3UDBA 4FI1A 4EH3A 1KE9A 3BYSA 4WRSA 2UUEA 5F94A 4IX4A 1UWJA 2QKWB 4JS8A 4GIHA 1QPEA 1Z5MA 3MDYA 1O6YA 5EOBA 4BBEA 4E26A 5G1XA 3U55A 3QQLA 2J90A 3I0QA 5LARA 2G2HA 5K0XA 4IM2A 4W4XA 5J9LA 4HZRA 3NVKI 1GOLA 3FE3A 2WTKC 1YXXA 4O0WA 5I9XA 2UVYA 5HO7A 4AWIA 1E1XA 4XG8A 5CVFA 2QR8A 2ZJWA 4XV1A 3VS6A 1X8BA 3MY0A 3K5VA 4DFBA 4RT7A 1Y8GA 4JLCA 3FZ1A 5IH5A 3DAEA 5FTQA 3R9DA 4CZYB 3H4JA 5AAEA 4IVCA 2ITUA 3OT3A 2YZLA 4X3JA 4HYSA 1GZNA 1NVRA 4BBFA 5IDPA 4RWIA 1UWHA 5J5TA 1IA9A 3FBVA 4I0RA 4IJPA 4P5ZA 3P7BA 3QCSA 4RIYB 4ZIMA 3F6XA 4EOQA 4YO4A 3ZEPA 3R83A 2OK1A 3LQ5A 5JRQA 4PDYA 5BQ0A 3ZHPC 4BN1A 4PDSA 4A9RA 4JIKA 4O7RA 3KEXA 3RVGA 4O7NA 1Q8ZA 4JVGA 2QI8A 5FLFA 4FL2A 1WAKA 3MWUA 2CN8A 2JDRA 2QOIA 3S3IA 4C4JA 4O6EA 1R1WA 1PF8A 1U4DA 4KKEA 3UQCA 3LCDA 4IE9A 4J98A 4EYMA 3OVVA 3K5UA 3A2CA 2XNEA 3BCEA 2OZOA 3O17A 4GK3A 2QHNA 5C03A 4AN9A 4I5MA 4C02A 3EL7A 3I7BA 4D1SA 2VN9A 2BZJA 1Q8TA 2CMWA 1Q24A 1YRPA 3CP9A 2HOGA 2VWYA 4GCJA 4YZCA 2IW9A 3LHJA 3DB6A 2OGVA 3RAHA 4WNOA 4MHAA 3VUKA 4DEGA 1CSNA 5AV4A 5L6WL 4QPAA 3PXFA 2HAKA 3H3CA 4O84A 5M56A 3Q9YA 4A4OA 5CQUA 5LVNA 3TNPC 2DQ7X 2R3HA 3Q4ZA 2PWLA 2C5OA 3SXSA 3ZEWA 1ZOEA 2Z02A 5B0XA 4L3JA 5HBJA 3PJ2A 4IIRA 2BZHB 3LOKA 5DG5A 3SDJA 4IVAA 4ZZOA 5AAFA 3QGWA 3WIKA 1OIUA 1Z9XA 3K54A 1RE8A 1QPCA 3FKNA 3QTWA 2BMCA 5KCVA 3OOMA 4TTHB 4QYGA 4TRLA 4QMXA 3BV2A 5DRBA 4C4FA 3HNGA 3QQJA 3RWPA 1O6KA 4I5CA 4DITA 4IM0A 3KK9A 4WG4A 2JKMA 4ANLA 2WMSA 4H3QA 2YA9A 4EC9A 2W0JA 3Q4CA 1WBWA 2UVZA 4AUAA 4D28A 1O9UA 4EK3A 3N9XA 3ORLA 2J50A 3UO6A 3PY0A 3SW4A 2XJ1A 3I79A 2PY3A 3COMA 3UP2A 3GENA 2WB8A 4ZS0A 1UNGA 3R9NA 3D2IA 3PJ1A 4X2GA 3W33A 4CRSA 4ITJA 3FYJX 5HOAA 3MA3A 3QHWA 3HRBA 4HVGA 5F4NA 3FQEA 3VBVA 5CF8A 3TN8A 4ENYA 4O0YA 5BVKA 4BGQA 3UOHA 5CASA 2JBOA 5HD7A 3FXWA 1BKXA 4FKIA 4FE2A 2V0DA 3NDMA 4IBMA 2OI4X 4B6LA 2VTRA 1B39A 5EI8A 1WBVA 2IO6A 2GQRA 3DK7A 1Y91A 2YFXA 2B4SB 3LCKA 4IFCA 5D7AA 4JOAA 4AGCA 2Y7JA 4RRVA 3TJDA 4FTRA 4OBOA 2HENA 1H8FA 2FA2A 4NIFA 3E3PA 3F7ZA 2OIBA 3F69A 3KRRA 4Y83A 4RC2A 1XBCA 2NRUA 2OJJA 5F20A 4UMQA 4PPBA 4C4IA 3V5TA 1LP4A 4D58A 3LW0A 3CQUA 5FEQA 3PLAE 2PE0A 4K8AA 4QTCA 4EK5A 4RFZA 4TYGA 4C34A 3FAAA 5IUIA 5LCJA 4RJ8A 4H1MA 4L9IA 3DB8A 4BCGA 1BI7A 4L67A 3VRZA 3V8WA 4GU6A 3UYSA 4UZHA 3T9IA 3S95A 1BLXA 4BDIA 4F65A 3R9HA 5L2SA 1YWNA 4FNXA 2BTSA 4RBLA 4O0XA 1JSTA 1Q3DA 2UW7A 3JY0A 3NUNA 2OFVA 3KF7A 3D7ZA 4IZAA 4FG8A 4M97A 2PE1A 2ITOA 2CHLA 4GYGA 3TL8A 2JIVA 4OTDA 1VYZA 4ASEA 2VTLA 4BCJA 2UZBA 4AN3A 5DT0A 1SMHA 4YP8A 1IA8A 2O65A 4EH2A 4WHZA 3R8PA 1HOWA 1V1KA 3L8PA 2R3FA 3G6GA 4LMNA 2PVYA 1ZOHA 4MXZA 4DFNA 2XIKA 3GCQA 2GNHA 1JSVA 3LFFA 3I6UA 4LOOA 1UKIA 2C6MA 3UNKA 4GJ2A 2GQGA 2QURA 3LFBA 4LGGA 4D5HA 4IC7A 2ZOQA 2O0UA 3UPXA 4EEVA 4BDKA 4Z3VA 4O7LA 3OS3A 3ULZA 1FGKA 3AG9A 3JUHA 3QLGA 3ZZWA 5J1VA 1CKPA 1R3CA 2YAAA 2B54A 3HX4A 4HCTA 5D10A 5EI2A 5TOZA 3MESA 1PKDA 3AXWA 2W17A 3G2FA 2W1FA 4L46A 5DWRA 2Z8CA 3LMHA 2F49A 4DEAA 2OF2A 4RX8A 3AGMA 3NSZA 4FV6A 4J52A 2E9VA 5FDPA 5BVOA 3F2RA 2W5HA 1UKHA 3AC8A 4UY9A 5L4QA 3FZPA 4P2KA 3TDVA 1SNUA 1FMKA 5KHXA 4RIWB 1JSUA 2QLQA 4G9RA 1IEPA 3KRLA 5HO8A 2F2UA 4D4YA 4RQVA 5FP6A 3TJCA 4KINA 3N51A 2J0IA 4NTTA 1XH4A 2DS1A 5T68A 4DEHA 4OTHA 3DGKA 3HUBA 1XO2B 3R1SA 4KKHA 3HYHA 3L8SA 5M51A 3A99A 4FVPA 3TI1A 4ALUA 3VW8A 2CGVA 4QP2A 5DRDA 5HU3A 5CU0A 3EN9A 2JAVA 2F4JA 4U5JA 5E90A 1OECA 2YITA 3FKOA 3IGGA 3ODZX 2P2HA 4AGUA 1MRVA 2R3GA 3GC7A 3BU5A 4PPAA 5CSVA 3UZPA 5J95A 3JVRA 1XQZA 4IVDA 4OT5A 4JQ8A 3HP5A 2QVSE 3KQ7A 4JI9A 2WQNA 4I22A 3MY1A 3OXTA 5BVFA 2PMLX 5IDNA 3EZVA 4BZOA 3GU5A 3Q53A 5HCXA 2B55A 1OL5A 1SM2A 2BDJA 1XR1A 2C6DA 2VU3A 3F5PA 3DA6A 4O1OA 5AP1A 5J7HA 3NUSA 2GTNA 2XCHA 2Z7SA 3R73A 4ASDA 2BFYA 3LIJA 5CALA 3IW7A 4O7TA 1YXUA 3COKA 3KC3A 3VBXA 1Y6AA 2B9FA 3PRIA 3NYXA 4EHGA 4F9BA 3TWJA 2W1CA 2WNTA 3B8QA 2ZM1A 1ATPE 1OIRA 4ACCA 4L3PA 2ZMCA 3W32A 3AT4A 3ZM9A 4JG6A 2G2IA 3ZRLA 5C8KA 4M68A 3NS9A 4FV0A 5HG7A 2C6LA 1PXLA 2UZLA 2XIYA 2XNMA 3CTQA 4XG4A 3T3VA 4DEBA 2R3OA 3QD4A 2WMBA 3WYYA 5E4HA 4FTTA 4JT3A 4WIHA 2EXEA 4JIAA 1F0QA 4H58A 4WT6A 4TXCA 3VUMA 3G9NA
chains in the Genus database with same CATH superfamily
4HGSA 4D0XA 5HX8A 3QX2A 1YHWA 3NUUA 3BYMA 5KMLA 4K77A 2LAVA 1T45A 3ZBXA 3C4EA 2E9PA 1K3AA 4R77A 2YN8A 3CPCA 3C13A 5FM2A 4WUNA 1NVSA 5IMXA 1XKKA 4CZUA 4NEUA 3HVCA 3O96A 3QC9A 3UO4A 3JVSA 4RX7A 3IW5A 3UDSA 4IZ7A 5IZFA 4RWLA 1MUOA 2JC6A 3V5LA 2I6LA 3TIZA 3GQIA 2YAKA 5KZ0A 4ZSGA 1GIIA 3R2BA 5HQ0A 2YDKA 3CR0A 4D4SA 3BHVA 4LMUA 4LOPA 4WUAA 4N70A 4QYYA 2X7OA 3EQPA 4DHJA 2EUFB 3RMFA 3GP0A 5HBHA 4FT7A 4EK6A 3VULA 4IX5A 3KN6A 1H28A 4XOZA 2OWBA 2BAJA 4F1MA 2YIQA 3QRTA 1KOAA 5HBEA 2EB3A 2QODA 4CVAA 2YACA 2O2UA 4CFUA 2X9FA 1JOWB 4F78A 2BKZA 4WOVA 3ZH8A 3AMBA 3CEKA 2YDJA 4BI2A 2O63A 3M42A 3HLLA 1PHKA 3W2OA 4AGWA 5K5XA 3BLQA 5LMKA 4O27B 3V5PA 5EK7A 2C5XA 2P2IA 2WMUA 3G0FA 3UG2A 1YWRA 2CKOA 5FD2A 4EUTA 1Q97A 4LYNA 1MRYA 5LVPA 2ERZE 5A54A 1A9UA 3W2QA 4JRNA 4FIEA 2CGXA 2UVXA 2XF0A 5DOSA 4DHZA 3QA8A 4FV7A 5AWMA 3OCGA 3JY9A 3PA3A 3ZONA 4YTCA 2R3NA 3CD8A 4A7CA 5I5ZA 2H34A 4NFNA 2YCFA 3W0NA 4BHZA 2ZM3A 4I1ZA 3QZIA 4DDGA 4NZWB 1VR2A 5HI2A 4DTAA 5M44A 4QT1A 3BL9A 2OO8X 2NPQA 3E88A 3MVMA 4YJOA 4FV2A 4Y46A 3S2PA 1GAGA 3VBTA 1ZYDA 2WTIA 4QD6A 3VQUA 4QTBA 1GY3A 2C5VA 3BQCA 4FSUA 4YGAA 2UW8A 3I5NA 1RJBA 2RGPA 3D5WA 3AKKA 4E6DA 3P1AA 2GDOA 4QP8A 2XB7A 3A8XA 3BHTA 1ZMVA 3QYWA 3CXWA 4EOJA 2J7TA 5L2QA 2WO6A 4PTEA 4QTAA 2I0HA 5JFVA 1K2PA 3ORZA 3UDZA 3Q2JA 4XX9A 4I94A 4HPTE 4XS2A 3TZ9A 3MH2A 3SLSA 3ZUUA 5AEPA 3I6WA 4FF8A 4DT9A 2X8DA 4J7BA 5ITAA 3OROA 3QTZA 3NRMA 4U8ZA 2HXLA 5FM3A 2UW6A 4KIKB 5HNIX 3SW7A 2GS6A 3PA5A 2WEVA 3QX4A 4C3PA 4ZTLA 3QHRA 5KBQA 3QTQA 2O3PA 1G3NA 2O8YA 2BRNA 2OFUA 4PRJA 2ZV2A 2VTNA 3IECA 4CEGA 1WMKA 4JR3A 2J0MB 4ACGA 4PNKA 3G9LX 4W4YA 4PTGA 4QYFA 2HZ4A 3D15A 3F2NA 3H0YA 4RIWA 3RM7A 5D9HA 5LCKA 4IAZA 3ZFYA 4FSRA 2JDTA 4BZDA 5AA8A 4BVUA 4NT4A 5BYZA 5KBRA 1NY3A 3ZU7A 3KGAA 3M11A 4K18A 2OU7A 5FDXA 1YI3A 1IRKA 3OD6X 2X4ZA 1OL7A 5HNBA 1W82A 3RHKA 3I1AA 1Q8YA 4YBJA 3HMOA 5AR4A 2W1HA 4U80A 3U8WA 3VJOA 1QL6A 4WRGA 4AE6A 4HCUA 4MQ1A 4AW0A 5AIKA 3W8QA 3FY2A 4USEA 2OZAA 4JAIA 2H6DA 2W9FB 4G31A 1E1VA 3PSBA 4JAJA 1OZ1A 5EG3A 4FEUA 3R71A 3FJQE 1XHAA 4R5SA 5K5NA 5AV1A 2W5AA 3M1SA 3RNYA 3OC1A 2C1BA 1YOLA 1I44A 4O4CA 3P79A 4A9YA 5DPVA 3NZ0A 5AX9A 5CAOA 5C8NA 3D4QA 2OIQA 2XKEA 4I6FA 3QUDA 2X6EA 3DBDA 3NUPA 5A4QA 4RVTA 3E8CA 3G90X 3H0ZA 3IDPA 4GT5A 4H05A 4BKJA 5ANKA 4DHIB 5M08A 3CJFA 2HW7A 2BALA 3F66A 4EOLA 5CT7A 2AC5A 2X0QA 3THBA 2W99B 4O96A 4QP9A 4CMOA 3D14A 5B7VA 5E8SA 3GC8A 2QOHA 1LUFA 5KMKA 4M84A 4RGJA 5JH6A 4UZDA 2BZIB 3FHIA 4BDCA 4A4XA 1VEBA 5A14A 4UYNA 4R3CA 4U44A 3DCVA 4XH6A 5EW9A 4BR3A 2XBAA 5DEYA 4J71A 3HV6A 3QXPA 4YMJA 2AUHA 4AOTA 2VTTA 5CX9A 4YSJA 4K6ZA 4G3EA 4UMTA 3TKIA 2DWBA 3MH1A 3UOKA 4PY1A 2OXXA 4DH7A 4GG5A 3F82A 4QMVA 3LQ3A 4YJNA 4FEVA 3O23A 5K4IA 3FI4A 5BX0A 4IX6A 1PMNA 4I0SA 3T9TA 2PL0A 5IISA 3UIXA 4CFMA 2E9UA 2ZB1A 3CKWA 1H25A 1LEZA 4QP1A 4F08A 3VS5A 3OWPA 4ZK5A 1G8JA 2XAOA 4DH3A 4O2ZA 3UZRA 2PVLA 4P4CA 3KY2A 3ZRMA 4QTDA 2NO3A 4EBWA 2WQBA 5FP5A 4BCIA 2V5QA 2WU6A 4WNMA 3ROYA 3CGOA 4MWIA 3EQRA 2XJ0A 3QZFA 2VX1A 1APME 1VZOA 3PJCA 2YCQA 3WF5A 1WFCA 4YJTA 5CLPA 2OJFE 4EH5A 5HORA 2YLFA 3OUNB 5L8JA 4ENXA 4MKCA 4MH7A 3MV5A 5DR9A 4GVJA 3U6HA 3BI6A 5LWMA 3NFFB 4B8LA 4IB1A 3ZM4A 4C4HA 2YM8A 4PL4A 4U0IA 4IWQA 4W9WA 4RIXA 1DI9A 2CLQA 3QD2B 4FC0A 4LG4A 2VAGA 1Q5KA 2QO7A 3A8WA 4X2NA 4YHFA 5K4JA 1FMOE 2WQMA 5T6KA 4AP7A 4CRLA 3LXNA 3O8PA 4X7QA 2XK4A 2W9ZB 3FLQA 4YJUA 2OXYA 3F7WA 4IMYA 5GNKA 4DH1A 4F4PA 5TKDA 4FKGA 5JGAA 3UC4A 3HEGA 3SHEA 3D83A 4OUCA 3A4PA 3HRFA 1R0PA 3R01A 4QRCA 3GFWA 2HK5A 3MYGA 4J8MA 4TYEA 3DKFA 3AD6A 1U5RA 4GK4A 3NEWA 3VS1A 3ZLSA 3HGKA 4YPDA 3O8TA 3DDPA 3BYVA 3GUBA 3IDCA 3BHHA 5KX8A 4OTWA 4NTSA 3AKLA 3HAVA 4ZMEA 4ZJVA 4NIFB 5CQWA 2W1EA 3FLNC 4NW6A 3KRWA 2PVHA 1U54A 2O64A 5EW3A 2EWAA 3ATSA 4RVKA 1YKRA 2VWXA 3ZS5A 3KN5A 3PY3A 3BKBA 4DEDA 1WCCA 2BHHA 2P3GX 3A4OX 4ZZMA 5IEYA 4D1XA 5J8IA 3QYZA 3W0PA 4G1WA 4IAFA 4QMYA 1KWPA 3EMGA 4U79A 1OKVA 1KE6A 3ZOSA 2IZSA 3JPVA 4LFIA 4RX9A 2RFEA 2PULA 3MFRA 1G8AA 2JBPA 3ZMMA 4PDOA 2Y9QA 4RFMA 5IEXA 4BRXA 3AC1A 2C3JA 2CNQA 3OWLA 5KMMA 4EJ7A 4YBKA 4DLIA 2R3RA 2X0OA 2PVFA 4FIJA 2YM3A 3NUXA 3WOWA 2JIUA 2VTPA 2C1AA 4FKUA 4KB8A 4X21A 4C33A 4C8BA 3EKKA 5BYYA 1OKZA 1LR4A 4I92A 1OBGA 5ETFA 2YIYA 4Y72A 5J9YA 3DZQA 2YM6A 4IX3A 4KRCA 5KNJA 3PE1A 3GEQA 1FVVA 4FODA 4U42A 2UZOA 4QQTA 3F3VA 3R8ZA 4Q9ZA 4UX9A 3NNWA 4CG8A 4C4GA 1XMLA 3FY0A 3ZXTA 5C8MA 5JN2A 5IH4A 1XH5A 3N4TA 3EN7A 4HYHA 3MTFA 5CVHA 3S0OA 3U54A 2IJMA 3UYTA 3IO7A 2DUVA 1DM2A 3LLAA 4ZTSA 1H1RA 4ZTMA 3UPZA 3UVRA 1BX6A 5I9VA 2VO6A 4FKSA 3PPKA 1H1SA 3VRYA 3LFCA 3KXNA 3OMVA 1O6LA 3CTJA 5LVLA 3CPBA 1JKLA 4NCTA 4ZSLA 3IW4A 4MXYA 5HHWA 3ZO2A 3DXNA 4QYEA 3BU3A 4O0TA 4AZEA 2QNJA 3NYOA 5ACKA 2A4LA 4FSZA 5IUHA 4R7BA 3PXKA 2C6TA 2ZAZA 3DU8A 4OTQA 5EQEA 1ZZ2A 1IR3A 1U46A 2YM4A 2WKMA 4LV8A 4EHVA 5A46A 1KE7A 2YISA 1XH6A 3R9OA 5I4NA 2Z7RA 4FZAB 4NJDA 1JKTA 4GG7A 1OPLA 2AC3A 4V05A 1PMUA 4E7WA 3FPMA 2VZ6A 5JGBA 3CC6A 2BUJA 4M8TA 4ZEGA 3PA4A 5AAGA 1XBAA 3E8NA 4BCHA 4I23A 4O7VA 5CNOA 2CN5A 3NLBA 2F7EE 4KBAA 3QCQA 3VF8A 4DGMA 3ML1A 3O8UA 1CKIA 4R6VA 1V0BA 4CLJA 2F2CB 1KOBA 3OHTA 5BV3A 2VO7A 2C68A 3ODYX 4BCKA 3R7UA 1TVOA 1OITA 4PQNA 1P4OA 2R0IA 3WZDA 4CCUA 5JQ5A 1R78A 1G8SA 5A4TA 3GC0A 4F7SA 4M12A 3NGAA 4RMZA 2GS7A 2VTIA 5AV0A 3UGCA 3NCZA 4EBVA 2PUNA 3Q9XA 3QTRA 4ZZNA 5AADA 5HX6A 3H10A 3SG8A 1ZYCA 3PY1A 1PXNA 3RAWA 3TNWA 4DAWA 4E6AA 3TTJA 4YU2A 3FEGA 4RX5A 3UMXA 3UOLA 4FTNA 1B38A 5HIDA 1W2FA 3ORXA 3IOPA 3NAYA 4XCUA 2VGPA 4G6NA 5D1JA 3RJCA 3W10A 4YSMA 5C1QB 3O50A 4CKJA 3VUGA 5CSHA 5I3RA 4A07A 1NXKA 2PPQA 1ZMUA 2FSLX 3UNZA 4AXAA 3G5DA 2W1IA 3GCUA 2BROA 4RVMA 2G15A 2X39A 2X0PA 4BDDA 5HLWA 3F3TA 4RA5A 3RAIA 1V0PA 4ZJJA 3NIEA 3OT8A 3H9OA 3HP2A 1DAYA 3QQUA 4X3FB 5DBXA 5AR3A 5GJGA 4AAAA 4I0TA 2C3KA 2R7IA 4KSQA 4XG7A 5CEKA 3UDTA 3BBTB 3BGPA 3R7EA 2JAMA 4CMTA 3C4XA 2RG5A 2GS2A 3QD3A 3LFNA 4TN6A 5TF9A 2VO0A 5A6NA 2XEZA 4JL9A 4RZVA 5HE1A 3NUAA 4XP2A 5AV3A 2ONLA 4ALVA 2IZTA 3HRCA 2FUMA 2B0QA 2YABA 3MGYA 4YPSA 2VWWA 4L00A 3SXFA 1ZWSA 2ITYA 3U9CA 3PRFA 1SVGA 2V55A 4O91A 4F1OA 5CAVA 3EQGA 5HZNA 4HZSA 4J53A 4MAOA 5CZIA 1S9JA 3MPTA 3NW7A 4D2SA 4DFUA 3AMAA 5DT4A 2R3QA 4RG0A 3LE6A 3FHRA 4FOCA 3LFQA 4PTCA 4D0WA 4C37A 4EL9A 3SA0A 3K2LA 4WSYA 2XRWA 2HCKA 5GINE 1M2PA 2FH9A 4O4BB 4W8EA 3GCPA 3ZDUA 4LQMA 4HJOA 4W4VA 4DGNA 3KXGA 5ICPA 3V01A 3E62A 5H3QA 3C4WA 1UVRA 1W0XC 2X81A 1H07A 5JGDA 3DBCA 3IG7A 1RW8A 3QC4A 4HOKA 3GU6A 2R64A 1ZAOA 4FUXA 3ZO4A 4DA5A 4YZBA 2ETKA 2QG5A 3O7LD 5M57A 5ETIA 3BHUA 3QKKA 3ANQA 2Z2WA 3MVLA 4E6CA 1YXTA 3KRJA 4O7YA 3FKLA 3A7HA 3VBQA 4YNEA 3ZC6A 5M4IA 2JEDA 2W1ZA 3EJ1A 3LCTA 4I24A 5KKRB 1OUKA 4Q2AA 5M06A 5CU4A 5C4LA 3PIZA 4XV9A 2UW4A 4QMLA 2VWZA 3VHKA 3FI2A 1H0WA 5E7RA 4C7TA 3NUYA 2REIA 4I4EA 2I0VA 4UMUA 1TQPA 4QMPA 2E9NA 5JZJA 4L44A 1QPJA 2YIXA 3F5UA 3OCBA 4WA9A 4M3QA 4Y95A 4Z7GA 2WMWA 4MD7E 1KE5A 4PF4A 4UEUA 4XJ0A 5KMNA 3KF4A 3MPAA 4NL0A 3VUDA 2QD9A 4O0SA 1SNXA 4I6HA 4FT3A 3LJ0A 5CENA 5JFSA 5E1SA 5J79A 4EOPA 3KB7A 5CSWA 3K3JA 1GZOA 2WPAA 1ZXEA 2ITNA 3UP7A 4AZWA 5I9WA 3HAMA 4YNOA 2IVVA 3FV8A 3NIZA 4LM5A 1ZZLA 5IQFA 1Q4LA 1TFFA 3B2TA 3C0HA 4FTJA 4IB3A 5AMNA 1NVQA 3EN5A 3OTVA 2R2PA 5HNGA 3E87A 4WD5A 3CCNA 3E64A 4C2WA 3SOAA 5EW8A 5FTOA 1KUTA 3OW3A 5TE0A 2JLDA 3R8LA 3UC3A 3MJ2A 4AS0A 2W4OA 4BCPA 3AT3A 1UV5A 4FKPA 5DA3A 5A9UA 2HY0A 4U9AA 2G1TA 4RJ6A 2UZDA 4EHZA 3VUHA 5A4EA 1UU8A 1YI6A 4AZTA 5IUGA 1MRUA 4D9TA 1UA2A 3OCTA 2QOCA 3FZRA 4K1BA 4TKSA 4M67A 4XLIA 2VTOA 3FI3A 4MNFA 4BBMA 5LVMA 4I3ZA 4ZY4A 4YLJA 1YXVA 4NKSA 2FSTX 2XM9A 3FZOA 1IG1A 3ANRA 5BNJA 3TCPA 4IAYA 4ERKA 4HGEA 4FSMA 4G3CA 4FKJA 1JWHA 5EKOA 2X6DA 5IPJA 1H4LA 4A06A 3D5XA 2WOTA 3PPZA 5H8BA 2ZDUA 3LJ1A 4DTBA 4FKOA 4YLKA 3UQFA 2VWBA 3E8EA 4FKTA 5D11A 1HCLA 1IASA 3R8UA 5K3YA 3RPVA 5H2UA 3F3WA 2AYPA 5ANJA 3DS6A 1OUYA 3D7TA 4IWOA 3SXRA 4C61A 4F1TA 4A9SA 5EDPA 4S34A 1UNLA 2YHVA 1P14A 4C0TA 2XM8A 4JDHA 3VS0A 2OZAB 5EM5A 3FC2A 1WVXA 4P5QA 2VWIA 5A4LA 1YDSE 2C6EA 3BZ3A 1ZMWA 4R8QA 5IA5A 2VX3A 4H3PA 3ERKA 3HV3A 2SRCA 4P90A 1H00A 4H1JA 1XH9A 5CYIA 3TDWA 1GNGA 4QMWA 1K9AA 3OY1A 4EOMA 4E73A 2FSOX 3PWDA 4BDHA 2QOBA 2BFXA 5H8EA 2PZ5A 1IAHA 5DN3A 1PY5A 1WZYA 2VD5A 3P7AA 3PIXA 4FZ7A 3ZLXA 4HVDA 5M55A 2VTQA 2WAJA 4O0UA 4FSWA 1HCKA 2Z7QA 3ZFXA 1AGWA 3R7IA 3BRBA 4ZLOA 4KA3A 3P08A 4U97A 2R4BA 1ST4A 2PYWA 4JG8A 4AT5A 2WMTA 4BIEA 5EQYA 2C0TA 1W7HA 2XK8A 3P9JA 4MBLA 5E8VA 5HCZA 4FV8A 1SYKA 4NYEA 4F9AA 3MA6A 4G3GA 4IACA 4C3FA 2X8EA 4ZY5A 4OAVB 3UODA 3GOPA 4PMSA 3R7YA 5BUIA 1TKIA 4UWBA 4WSQA 3UIBA 4ANQA 4BCFA 5JK3A 3UO5A 2QO2A 2IVUA 4U41A 3BE2A 4QMOA 2FSMX 5HE0A 4ZLZA 1ZLTA 3MFUA 3VS3A 4X3FA 5HG8A 4MNEA 4S2ZA 4GKHA 4AXEA 3NYVA 3FLYA 4ASZA 1GIJA 3A7IA 4LL5A 4RSSA 4YHTA 4FV5A 3UMWA 5DIAA 3QU0A 5JSMA 4BZNA 3D2KA 3D5VA 3TZ8A 5HD4A 1JKKA 3MN3A 5HESA 2WQEA 2EB2A 3Q3BA 2JITA 2YM7A 3R00A 5JFXA 3WI6A 2CCIA 4E4LA 4EOSA 1WVYA 3IGOA 4TWNA 1YDRE 3R1QA 2UW3A 2PMNX 3BLRA 4KSPA 4U43A 1SVEA 3QQHA 1H08A 4NM0A 3LAUA 4O22A 4RLKA 5ANDA 5LVOA 2OIDA 3GU4A 2BIKB 2JDSA 3QBNA 4U3ZA 1UNHA 3JYAA 4YJSA 4YTIA 4E5AX 2CLXA 4EQCA 3DQWA 4F63A 2NRYA 5LMAA 4B99A 4O0VA 4X2FA 4ZS4A 4GU9A 4RIXB 3HDNA 3KU2A 3RTPA 4NK9A 4EI4A 4MXOA 4FTOA 4QQJA 2JKOA 1RDQE 2X9EA 5L8KA 4ANNA 2CKQA 3SRVA 2C5NA 3FZSA 2R3MA 4OTPA 5AUXA 4X2JA 4E4MA 5D41A 3F5GA 3PFYA 1GJOA 4AFJA 1SVHA 5GZAA 5ANIA 4FK3A 2BAQA 2HW6A 4FV1A 5CANA 2JFMA 3H9RA 4N6YA 5E8YA 3W2PA 4AE9A 3ZBFA 2WTJA 4DE4A 4XNEA 3IQ7A 3VS2A 2OJGA 4CV8A 4M13A 5EM6A 3OWKA 5L6PA 4IEBA 4MVFA 1OBDA 2XJ2A 2ACXA 4XUFA 4ANSA 3VUTA 2XCKA 5CF6A 4TL0A 4EH6A 5CAUA 3A62A 5CSXA 3UVQA 4YZNA 1U54B 3TM0A 4KWPA 3FZTA 3KREA 3PYYA 2W06A 4UBAA 5CXZA 2WMVA 2HZ0A 4NKAA 4YC3A 4MUQA 4OTRA 4BCQA 3KMWA 4BDEA 3ALOA 5AUWA 3BELA 1LPUA 5L2TA 5IQAA 2WTVA 3C0GA 4C58A 4EH7A 5M07A 3O0GA 3IDBA 1F3MC 4R5YA 3EL8A 4UXLA 3RGFA 4FK6A 4O4FA 4RQKA 2FB8A 3DK6A 2PUPA 2BRMA 3D9VA 3PJ8A 5BPYA 3P78A 2OJ9A 3VC4A 2YWPA 3ORPA 4XV2A 4FG7A 2ONLC 3T8OA 4WBBB 4EQUA 3AKJA 2W96B 4PP7A 5JQ8A 1YWVA 1J7LA 1KE8A 3Q5ZA 1XH8A 2WQOA 3MS9A 3LXLA 3PP1A 4BGGA 3WF9A 4F7LA 5EHOA 3BWFA 1YHSA 4KS7A 1STCE 5EYDA 3KRXA 4EORA 2J0JA 4NM3A 3ACKA 3C7QA 3KVWA 3QFVA 4GJ3A 5HU9A 3PTGA 1EH4A 3IK3A 4XHKB 2P33A 3RINA 3BLHA 4KBKA 5IG1A 2IWIA 4ACMA 4NUSA 3MIAA 2WMAA 4GSBA 4HNIA 4L53A 3W1FA 4P7EA 3VUIA 5HTIA 2PUIA 2JDOA 5DNRA 3VN9A 3NVMB 4G16A 5EM7A 4EH4A 5IA1A 5EQPA 2Q0BA 3AT2A 3FC1X 4H3BA 4UN0C 3G51A 1WBOA 4FMQA 4I6BA 2Y4PA 4EOIA 4DFYA 4J96A 4Q5EA 1JBPE 2WOUA 5CF5A 3ZTXA 4MF1A 5DFPA 2EXMA 1H26A 3NNVA 4FEXA 3R1YA 2VUWA 5IQBA 1FBNA 4I6LA 3Q4TA 4FZ6A 3F3UA 4PPCA 4RVLA 3U87A 1H1WA 3BYOA 4Z7HA 3V5QA 3LM5A 5KO1A 3G33A 4FKQA 1OL2A 4LUDA 2R3KA 2J0LA 2GU8A 3U6IA 5BUEA 3Q2MA 3UIUA 4DN5A 4EK4A 3COIA 4QMZA 4RPVA 3Q32A 4X6RA 4FYNA 5DLSA 5AUZA 2KTYA 3M2WA 4XRLA 1MP8A 4UB7A 4B7TA 4D2VA 3W2RA 4QDVA 2KULA 4U81A 1BUHA 4TNBA 3DNDA 5FXQA 4K2RA 2QQ7A 4IH8A 5EH0A 2XK7A 3KA0A 3MPMA 3E8DA 4LRKA 3TT0A 1PRYA 3SD0A 4V0GB 5CSPA 1WBNA 2IVSA 3GFEA 3C5UA 2YERA 1CMKE 4AACA 2A98A 2WIPA 3DLSA 3F5XA 3DZOA 4C59A 3BPRA 4CKRA 3TTIA 1YVJA 4D5KA 3OXIA 4FBXA 1JLUE 2ZB0A 2OJIA 2PZYA 2GNLA 3W18A 4CYJA 3RBWA 4MQ2A 3EFJA 3CE3A 3G0EA 2ESMA 2NP8A 5BVDA 3TUCA 1M52A 4FVRA 5F95A 3GI3A 5H9BA 5K0KA 4E4NA 2ZVAA 4LUEA 3R02A 5ANEA 5F9EA 2XRUA 2RSVA 4AG8A 5A6OA 2PVRA 2JIIA 1VLRA 4R7IA 5L2WA 5LXMA 3FLZA 3QQGA 3BBWA 4BI0A 4CSVA 3RZBA 4BYIA 1I09A 5A3XA 3TNQB 4DG2E 4EKLA 5CAQA 4JBVA 4FIIA 1F5QA 1Q99A 5FXRA 3DNEA 5CU6A 3NX8A 5AM6A 4O7WA 4CT1A 4O86A 4C3RA 3PE2A 2XK6A 4WKQA 4FR4A 2H9VA 3TV6A 1MQ4A 3R8MA 3QWJA 3A7GA 2XEYA 3IKAA 4IVBA 4FGBA 3MB6A 3ZSHA 5ANGA 2X8IA 3WE4A 5KMIA 4U6RA 4HYUA 3S1HA 5JMSA 2B52A 3PFQA 3UIMA 4X2KA 5FG8A 2XNNA 4FGRA 4M66A 2GMXA 4D2PA 3NNXA 4OT6A 5JEBA 4QMTA 1QMZA 3SAYA 4FA2A 5IQIA 2Q0NA 1REJA 3SV0A 4DGOA 2RFNA 1OPJA 3I0OA 1OKYA 5EYMA 3LVPA 2Y0AA 3E93A 4ARKA 3F2AA 5AUVA 2BHEA 4PP9A 2VO3A 3L1SA 3R30A 1ZY4A 3CKXA 2H96A 3CBLA 2GPHA 4N57A 2OW3A 3TNHA 2CKPA 4AQKA 4UMRA 4OLIA 5FRIA 4K33A 2OLCA 5CWZA 2CSNA 3U51A 1KV1A 3HKOA 3DAJA 4CQGA 3EYGA 3I4BA 3LFEA 2WEIA 5DEWA 3BHYA 4S32A 1ZYSA 5M53A 3VVHA 3MVJA 4U45A 4KRDA 4BCOA 4CD0A 5L8LA 1XJDA 3RAKA 4FSQA 1OIQA 4GW8A 5CY3A 1URCA 2IZRA 2PK9A 2XKCA 3TKUA 4DHFA 1P2AA 4C62A 2F57A 3LFDA 4DGLC 1UU3A 3BEAA 3ORNA 1LEWA 1U5QA 3R6XA 3R63A 3ZXZA 4E20A 3UQGA 5LQFA 4IW0A 3C5IA 4UYAA 3L9MA 1M2RA 2Y4IB 3WBLA 4D4VA 3MW1A 5ACBC 5K9IA 4FIHA 3SGCA 5E1EA 4UALA 3BX5A 5BVNA 4USFA 2QOFA 2GQSA 2QR7A 2DYLA 4FVQA 3R1NA 1WBPA 1OPKA 5AM7A 3PDTA 1JKSA 4EYJA 2PZPA 4IZYA 3OOGA 3AC5A 2HWPA 4O4EA 1PXJA 2PE2A 4Q5HA 4RWJA 4YJRA 1T46A 4EZ3A 4D9UA 2BDWA 4KD1A 4FUYA 4X3FC 4QNAA 2BTRA 2OF4A 2UW5A 3WARA 4RLLA 1W83A 2C0IA 3LPBA 4DH8A 2ITZA 2V7OA 4YZMA 4CMUA 3V51A 5J5SA 2EU9A 3Q96A 3ENHA 1PXOA 4L3LA 1W2DA 3PVGA 4QMSA 4RJ7A 4YO6A 4ANOA 2ZV7A 4BIDA 4EJNA 3OEFX 2IG7A 4XLVA 4F64A 1WVWA 4ZSEA 4F99A 2IN6A 2QONA 4ANMA 2GHLA 1CTPE 4TZRA 4XV3A 3E5AA 4GKIA 3PSCA 2YDIA 3A7FA 4ZJIA 3LZBA 4F0IA 4GRBA 1AD5A 3GXLA 2PTKA 5CTPA 5KUPA 4C35A 4AA0A 3HECA 4IADA 3FMEA 3QALE 3QRJA 3ZUVA 4FICA 5HCYA 3O5AA 3H9FA 3FSFA 4ZAUA 2JDVA 2FGIA 1PYXA 2C4GA 3P86A 2HZIA 3UE4A 3Q6WA 3AGLA 3ORTA 4TWPA 5KE0A 2QLUA 2YCSA 2GNGA 5ETAA 5HE3A 1XBBA 3Q9WA 4U7ZA 5GIOE 2WMRA 2VTAA 4M69B 4F9WA 2XUUA 5GJDA 3DJ7A 3WF7A 2XALA 5IQCA 3ZO3A 4PWNA 4UV0A 2WU7A 3EQHA 3HDMA 1PYEA 4AFEA 4BDGA 1QPDA 1UU7A 2QC6A 3OZ6A 4L7FA 2OKRA 4AQCA 1Q8WA 2GHMA 3FL5A 3LQ8A 2C0OA 1JNKA 4QP3A 4L52A 3U4WA 4AX8A 1NT2A 1J91A 5DGZA 4G6LA 1WBTA 5CZHA 5LMKC 4GT3A 2BKKA 2BRBA 2R5TA 2F9GA 4ZY6A 1OB3A 2WZJA 4FTQA 5FBOA 4HNFA 4BTJA 2J5FA 2ZV8A 3EN6A 3KFAA 2NNWB 2VV9A 4DT8A 4LGDA 4Z9LA 3OW4A 2W05A 4FT9A 4IDTA 4L6QA 4IJ9A 5KKRC 4J8NA 3V8SA 3KXHA 4APPA 2UZTA 2BIYA 2A0CX 4ANBA 2PHKA 4GIIA 4BWKA 4I5PA 4XEYA 2IW8A 4G5PA 4NSTA 3PVBA 2PZIA 4S33A 4A9TA 4CFFA